2JRIA

Solution structure of the josephin domain of ataxin-3 in complex with ubiquitin molecule.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the plasticity of the ubiquitin-protein recognition code: the josephin domain of ataxin-3 is a diubiquitin binding motif
rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
molecule keywords Ataxin-3
total genus 44
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2jriA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2jriA01
3OTOO 4X64O 5FLXN 3T1HO 4K0KO 4LF5O 1FJGO 5IT9N 2DOSA 4JI5O 3J80N 4B3SO 4DV4O 2UXDO 1N32O 4JI6O 4DR5O 4OPHA 4DUZO 2ZM6O 4JI3O 1R6TA 1HR0O 2DJVA 4DR6O 2Z0AA 3JAMN 4DR3O 4YY3O 5H5NA 2UXBO 4X62O 2HHHO 4LF6O 4JI7O 4LFCO 4OX9O 1G1XB 2UU9O 5IWAO 1A32A 1I94O 1N34O 1XNQO 4JYAO 4GKJO 1D2DA 3J81N 4DR2O 5LMNO 5BR8O 5LL6Y 1HNWO 4JI2O 4LFAO 1AILA 1YZBA 4OPAA 4X65O 4DR1O 4DV0O 4KHPO 3J7AU 4B3TO 2AGAA 4DV5O 4A5UB 1FKAO 2UUAO 3SDLA 3RT3C 5BY1A 2UUCO 2UUBO 4LF7O 1N33O 4JI8O 4B3RO 1X59A 4JI1O 2ZKOA 2LW7A 4JI0O 4DUYO 2UXCO 1N36O 1XMQO 5A2QN 4NXNO 4DV3O 4DV6O 3T1YO 3F5TA 2JRIA 4LF8O 2F4VO 4B3MO 2FKXA 1HNXO 4YHHO 4GKKO 3R66A 5BXZA 1KUQA 1R1BA 4DR7O 4LFBO 4AQYO 4DV1O 4JV5O 1IBMO 1AB3A 4X66O 3O65A 1IBKO 1XMOO 4DV2O 2E5LO 2VQFO 4DR4O 1F7YA 1HNZO 1NS1A 1IBLO 4DV7O 1XNRO 4NXMO 3M8AA 1J5EO 4JI4O 4LF9O 2VQEO 1XEQA 2N74A 5LMUO 1DK1A 1FYJA 4LF4O
chains in the Genus database with same CATH superfamily
1VQPV 1Q81W 4X20A 3ZMZA 2Q7HA 2PYLA 3I5DA 4B08A 3AEIA 3EFFK 4JAAA 4WFAV 1PPPA 1U9WA 3CHXA 4JI6O 4YYSA 2G8EA 3W30A 4D8BA 4DR6O 2WA3A 2QTSA 4X89A 3JARA 3OMAB 3ZHUA 4P16A 2WLLA 4X6HA 3UCSC 3QSDA 3ZMSA 2R70A 2P4KA 2ZXWC 3F7YC 2D2CB 2FQ9A 5JCOA 4BOQA 4LFBB 5CBFA 3JSNA 4OX9B 2NQAA 1K33A 1BT8A 5LMNO 4TWKA 5LL6Y 2F4VB 4U7OA 3G67A 2YSUB 2OWOA 4MI7A 2CTPA 5IY5C 1JOYA 2IU0A 1DF0A 1CV8A 2CGNA 3DGEA 4LNUB 1IBKB 2BTWB 4JI8O 1JR9A 3CBJA 2CK3G 1XMQO 1F2CA 4UUJC 3K06A 1SA0A 5DECA 3G80A 5ITZB 3CCRV 3KCYA 2EINC 4NB5A 4DR7B 2OCHA 3BVOA 1NQCA 3OVZA 2YEVB 1KFXL 1K9MW 3N3GA 3M7MX 4CH5A 1WLEA 2Q7EA 4UCOA 4YHHO 1HNXO 1S77D 2CB5A 5H9CA 4UXNA 1MEGA 1K92A 1VQ6V 3CRRA 1MDWA 4JTDB 2QSAA 1XMOO 5EZYA 4FLVA 1J95A 1Y08A 3VQXA 4W4KA 4WFEA 2AZ0A 4MSWC 1IBLO 3CC7V 5B1AC 1BS3A 4JI3B 2OIGA 2Q67A 1K3BB 3ZBHA 1YDXA 4X6JA 1YALA 2JS5A 2B9ZA 4BOPA 2F66C 4QPKA 2Q9LA 3GB7C 5IWAB 1GAXA 2UUBB 2UU9B 4O2AB 2NN4A 2DC6A 4NTWA 4LH7A 2DOSA 4JI5O 3J80N 3X2QC 4ZHQB 2QDOA 4MW3A 1IXBA 1TL9A 3PRMA 3O0UA 1F2BA 4ZUXU 3ASOB 4KHPB 3L72H 4N23A 2ZD9A 4H37A 2ETNA 2BSKA 3FAVB 4UV9A 2UXBO 4YYWA 2Q4PA 4NR1A 1GN3A 1ZIVA 1I5XA 2RCVA 4TQFA 1G1XB 4EFBA 3ABKC 2R72A 2DC7A 1W59A 4JYAO 4MVUA 1ICFA 2FE8A 1M5IA 2V1DA 4CH4A 1RSOB 3H1LH 1KBHA 4R50A 4NVPA 1ENVA 3RFRA 2L6LA 5LP6B 1BL8A 5EYPA 3RYCB 4IIJB 3K5OA 4KHPO 2CH7A 5LP6C 1K8AW 3JASA 2X0LA 1M57B 3MHSA 1L1FA 1FKAO 1VF5B 2CUGA 5LOVA 4PA4A 4LF5B 1VQ5V 4OELA 3P5WA 4DUYO 1QLNA 2IBIA 1V9PA 4PT5A 4TV8A 3D3IA 1J5EB 4RWUA 5EC1C 3D36C 3V6EA 1Y4MA 4YYQA 3CRMA 4BIZA 3UQ8A 4GKKO 1KUQA 4I9QA 1COWG 1VARA 2PNSA 1MOFA 3E86A 3BEHA 4P6EA 2LQTA 2ZE8A 1FXKB 3KWBX 1L0NH 5IY5B 2YIBA 4DV1O 2HLDG 3T4ZA 3QVNA 4YJ3B 3CCUV 4PD4F 1BY8A 4IYIA 1NB3A 2B1GA 1FD9A 4KLBA 1VQ7V 3KFQA 1L8DA 3HB3B 4G54A 1L0LH 2P4VA 2Z5UA 5JQGB 3FB6C 1U9QX 3LSQA 4X64O 4TV9A 4I55A 4LF5O 4NXNB 1UKFA 3ZRVA 1Q6IA 5FNVA 3BB7A 2DYRB 1CXZB 3M99B 1SQPH 2A06H 1Y4HA 4X62B 3BPFA 2DYRC 2WA4A 3ABTA 2XOKG 3ZRWB 1SF9A 1XL4A 3N4CA 3K08A 1ZLZA 2Q73A 2F43G 1GECE 3P3NA 1AI6A 1F4MA 4E2LA 1N33B 3LDDA 3TMPA 2UXXA 1THZA 2GUZB 3CX5F 1X9YA 3HHIA 3HHAA 2BOCC 2ZE6A 3OEHG 4EB6A 3JD3A 5JWPA 3SYOA 2UUAB 1S5LZ 1DTOA 3W7UA 3PSEA 1XREA 3BABA 3QO8A 2DJGB 1AVMA 4OPAA 5A9GA 2XASA 2C2AA 2BCCH 2OCCB 1VQLV 3ZHRA 4GX5A 3RT3C 3OISA 2XU3A 3QJ3A 1S5JA 2A9HA 4NXNO 3A0HZ 4CDEB 1G8MA 1AJPA 1JFFA 5LGUA 1WPBA 3C3TA 1BQIA 3OTOB 2BE3A 2ACTA 2HKOA 1BHAA 1PE6A 1DGSA 3OAAG 1SQXH 1NZ6A 3BHPA 5JA7A 4J9ZB 3RYFA 1PCIA 3P32A 4FLTA 4LF7B 3OEEG 4LF9B 2LGQA 3VBBA 4DR4O 3QT4A 4LP8A 2UXNA 1UPGA 3CP1A 1U97A 1XQ8A 5IJ9B 2N74A 3K9MA 3KZIZ 3OD4A 1ZL8A 2IJKA 4LF4O 4JI8B 1TAEA 4YYVA 2KG7B 5IT9N 1MSDA 1TVKA 1PPNA 1GM8A 3KCXA 1MNGA 2EZPA 4YJ2A 1B04A 5JH7A 1VQOV 5KX5A 4LF8B 4B7KA 2X6AA 1W0KG 4MTOA 2UXDO 1QBZA 3AI8A 2LFRA 5LHIA 2AUZA 4YXWG 5JVDB 3SPHA 1R3JC 5HFMA 1ME4A 3K57A 4ZBMA 2D3OW 2QM4A 4LFCO 1Q82W 1NPZA 5EGWA 2AYNA 1H2GA 3TCUA 5IWAO 4UCTA 1I94O 3CC2V 4C7UA 4GKJO 4OVZA 3PHUA 2P67A 2AW9A 5CB4B 4G28B 2YS8A 1YTFD 4BSQA 3PHXA 1AILA 4P2ZA 1S0VA 1YZBA 3OGCC 5IJ0B 4X65O 1DKIA 1KP2A 2ARYA 4LWSA 3RVVA 2P06A 4PDRA 1Z5WA 3AG4C 2F93B 3WXEA 2LFSA 4QRXA 1SA0B 1XUQA 1AU3A 1PNLA 5CVOB 1GLOA 3OGIB 1CEZA 1Q6UA 2DZYA 1MABG 3Q4HB 2DC9A 4I0XA 4YVAA 1Q90D 4DUYB 1E1RG 2JGDB 1NB5A 2E02A 1F2AA 2UXCB 4JTCB 1AP6A 1R6NA 1DF4A 1FAFA 4IHJA 3C9EA 1WB8A 3H1KH 2F1MA 2PY5A 2ZDIA 1LUWA 1SQQH 4U3FH 1N0JA 4RF0A 4GT1A 4K35A 2FYEA 4DR3B 1U9XA 1V55B 2EULA 1WA8B 4UVAA 4O2AA 3E8BA 3E89A 5C8YA 3OTOO 2ZINA 4TUYB 5B3SC 2WPDG 9PAPA 2YC0A 1HW7A 3ZMTA 2GTSA 3U0ZA 3T1CA 5B5EZ 4PI0A 3ZEDA 5KLVH 4EEQA 4K0KB 4WA6A 1AI4A 2Q69A 3NR7A 1HR0O 3HKDB 1PPJH 1NL6A 4B3SB 3HKEA 1FS0G 1CPJA 4N21A 3ABLC 2DCBA 3C3SA 1Y74A 5LMNB 5BMVB 1VIBA 4IL6Z 4I05A 2AXTZ 1Z5VA 1LR1A 2EIMC 1XNQO 3UO2A 1R73A 3N2KA 4JYBA 4JI7B 1WN7A 4YYUA 2HWKA 5L3FA 4FIPC 1KKCA 3ZMUA 1KKDA 3CCJV 4DR6B 2AGAA 4DV5O 5BY1A 1P49A 3JCZA 1WAZA 3SR2C 1YJWV 4RAIA 2ZKOA 3U10A 1XI1A 4AI8A 2VWKA 4P9OA 1DF5A 2DN9A 2PREA 3OMIB 1YT7A 4TSFG 5KHKA 3SYCA 2P7TC 2ZM6B 3WU2Z 3JARB 1A6RA 1EZJA 2ZIMA 2WLIB 5LHGA 4ZOLB 3FFQA 3JD0A 4DW1A 4YJ3A 4LFBO 3D3QA 4MVOA 1S72V 1JX9A 4X9QA 3LXSA 5EIBC 3RYHB 3SYQA 4DK0A 3IUTA 2HXZA 3TXSA 1YVWA 4RQEA 1OZ0A 4MW8A 1R3IC 3MJ5A 4FVMA 3B21A 4JI4O 3IC7A 3E9SA 4XR7A 1P7GA 1YI2V 4DV7B 4IP3A 2QR4A 2BTWA 3ABMB 2HVKC 1DK1A 1ITOA 3MDSA 3QG5A 4DV4B 3I55V 5KHGA 1BCCH 1SQFA 3T2MA 5KMGB 1CPYA 1NVPB 1GRJA 2Y0PA 3BPMA 1IBLB 1NTZH 3A2FA 3K9SA 1PADA 2VHSA 3QO7A 4YIPA 1D5NA 4UCUA 4B3MB 4YY3O 4O2BB 2GUZA 1YJ9V 1RFYA 4F6RB 1RM1C 1NT2B 1PV0A 4K8XA 2DCDA 3WB2A 2R9IA 2E74B 3CJHB 4KXRA 3PDFA 2JDIG 3UKMA 1Z2GA 3VOUA 5EBWC 4N8WA 1FFXB 4ICGA 3OR6C 4PDMA 4FM2A 1HNWO 3IFUA 4J41A 4JI2O 5IYZA 1W2BU 3LDEA 4DK1A 4BOUA 4FZ0A 4B7EA 4QBBA 3J7AU 2Y4UA 5CBGA 2IJHA 2UXDB 3LFYA 2OCCC 4BPVA 2O6XA 3D8CA 3ABLB 1CJLA 1QVFU 4L8JA 4ZI7A 4UCSA 4ZKIA 1NKDA 4LR3A 3H9VA 3HPLC 2PI4A 1R3KC 4FJCA 5LXTA 1GMYA 4DV3O 3BWKA 3RN4A 3EVKA 3DXRB 5J2TB 1I0HA 5B1BC 2X7RB 4WURA 2NQDB 1HNZB 2ITCC 3L75H 4JF3A 3H6SA 2PGGA 1Q8IA 2X6CA 1BE3H 3ZRSA 4W5BA 1AB3A 4ZIBA 4FFBB 1CVZA 1K73W 5CA0A 2ZNJA 3LSUA 4OXSA 2PI5A 1NLJA 4LFAB 2PBHA 2RDCA 3K3WA 2XHBA 1BQ0A 3B77A 2Q5ZA 2YJ8A 2E5LB 1GM7A 3JASB 5KA6A 1SNKA 4PELA 1SRYA 5LOVB 3AG2C 4HWYA 4DR1B 4HAMA 1CQDA 1H2KA 1EBOA 4QPJA 1E79G 1XKGA 1U96A 4U3JA 1Y76A 1SS3A 3ZRXA 3CXHF 2EILB 2E76B 3ICXA 4GKJB 2X6BA 1D5AA 3S3XA 3EHBB 3CH2X 2IM9A 3K03A 4P9PA 3AK2A 4D6TH 1N8RW 4B3SO 3FYIB 2VRZA 5DN6G 3RVXA 1OCZB 3CC4V 3HD3A 1H2NA 4PI2A 3SGIA 2DCCA 5CHTA 4RNAA 2W6JG 1SQBH 3CCSV 4BR6A 1KHQA 4PP2E 1JJ2U 4QJFB 3G71V 3KX1A 3BPZA 5FPRA 3BRCA 2IJIA 2XTAA 1PXVA 2P86A 2HEPA 3HR0A 4LCUC 1B3QA 1A32A 4O4IA 1BQZA 3LNNA 2Y48A 5GONA 4NYKA 1D2DA 4BOZA 4I04A 3ZJZA 4LWSB 2Y0IA 5PADA 2C0YA 5KA5A 2R9NA 1JA8A 4DV0O 5J94A 2Y5BA 1M57C 4ASUG 1POPA 5KUKA 2BTQB 3OT7A 2NLJC 4B3TO 4I55B 2W0XA 4WFBV 4GLXA 1IBMB 3I3TA 5DEDA 1PL4A 5FNVB 1EN6A 2WLHA 4JI1O 2JQGR 4PP1A 3SPCA 4GUAA 1P7BA 3ABUA 3OM3B 1YK8A 4YV8A 3RYIB 2JGDA 1M56B 3E2EA 3W7XA 2LW1A 4DO2A 4Q20A 4MTFA 1YF2A 5KAIZ 4QIWF 5BXZA 2AYOA 3ABMC 3F5VA 1H38A 4O4JA 1URFA 2EIKB 4J9YB 2BDZA 5KHHA 2AHZA 1VQNV 5LYJB 4X1YA 1EZVH 2XU1A 3CS5A 3JATA 4JZGA 4DV7O 2WBFX 1XNRO 1OHHG 3NXSA 1OCOB 3OQCA 4JASA 4F4LA 4QGPA 2LO1A 3F75A 2YXLA 1TA8A 3E22B 3JD4A 1H2MA 2G7YA 3E8FA 1PP9H 3KWZA 5J9PC 4MZOA 1QXPA 3WB0A 1WB7A 1I08A 1QMYA 4RQFA 1ZTEA 1Q6HA 4BIOA 1RM1B 4RUFA 2E00A 2WLLB 4DUZO 4WCEV 2N04A 4PDLA 4YHHB 3N2GA 2BU3A 1H8EG 3HKEB 3MHSC 5JJJB 4PA6A 4WBNA 4I50A 4DW0A 1Q86W 1N0NA 1NU1H 3P5UA 4LF6O 1OCCB 3K0GA 5K1XA 3FB8C 3MTNA 4O4LA 1N34O 3CYOA 4W4LA 1GN2A 1E1QG 4DV5B 1MMMA 4LH6A 3ERVA 5JH3A 3IMAA 1FXHA 2DQ0A 5A24A 4B3TB 4KP4A 1K97A 1O9HA 3BY4A 2QJ1A 1XNRB 1GN6A 5IJ9A 5LBQA 4Q8GA 3UT5A 2YJ9A 4LNUA 2AS8A 2KB1A 2KG7A 1GH6A 1TUBB 2XAHA 4LBEC 5E6JA 5CHVA 1VEWA 1TVKB 4DXWA 2FTDA 2XUMA 1KU9A 1FJGB 3PHWA 1TUEB 1X59A 4CBCA 1S76D 4JI0O 2ADQB 1PPDA 4D7SA 3WG7B 5J2UB 1QU7A 2DWEC 4J7ZA 3CMAV 1YJNV 5B1AB 1Y66A 1VQ9V 2JRIA 3ZHQA 3FB5C 5IDJA 2JQFR 3U11A 1AECA 3KW9A 1GK9A 1JQPA 4XUIA 3OE7G 2ARHA 4BS5A 4MVZA 1IBMO 1EWMA 2QM7A 2WLMA 2MK3A 5BZBA 3W31A 3FB7C 4H44B 3L73H 3L71H 1AYVA 2EILC 1SETA 4JZ2A 1FXKC 1JPXA 4DV2B 3M8AA 3OMNB 4BW5A 1J5EO 1SP4B 3OF9A 3V6CA 4DYLA 4R3DA 3E8GA 5LGTA 3DTUB 2EIJB 4KFMA 4X8AA 2Y69C 2A0LA 2YICA 3I06A 3T1HO 2QWRB 4JYAB 2YJCA 7PCKA 1IVSA 1HNWB 3ZN0A 2JEXA 1ZWIC 5CVMA 5C93A 2ZM6O 1KC8W 2HHNA 3SJBC 2Z0AA 3JAMN 3BOWA 1H2LA 3RVWA 1FPOA 3CJHA 2E75B 3PT2A 3TK1A 1IXMA 1QLEC 4OX9O 1K34A 2K1EA 4JPRA 3IOQA 2NNUA 4YY3B 3H8BA 2K9PA 1MIRA 4Q8HA 4MS2A 2HG5C 3UM7A 4NXMB 3E83A 3P5VA 1GCBA 1MZEA 2YI8A 4K8ZA 4OGQB 4MVSA 3T4DA 4N4ZA 3ETGA 3LNMB 2AUXA 1QNMA 1P4RA 3C0RA 4X20B 1ZX3A 3AG1B 3H7DA 2JTCA 3LUTB 1N36O 1KMIZ 3WXFA 4CS3A 4DV6O 2XU5A 3HKDA 5CVNB 3F5TA 3IFXA 4HBNA 4QRGA 3IEJA 1GO3F 4B3MO 2RMKB 4BS6A 1WJZA 2J7QA 3ZX6A 3IAYA 3JALA 5E79Z 2N05A 4CC5A 5BMVA 4HXDB 4W4UA 4TQDA 2UZJA 2GBOA 1AR4A 1ROPA 3JD2A 2BSKB 3FAVA 4JV5O 4X6IA 2H7JA 3P5XA 3APOA 1AYWA 3B2EE 3JAKA 4DV2O 3WG7C 2E3CA 1VF6A 4UB6Z 4HNAB 4JI2B 1S4VA 4FLZA 1RSOA 4PA3A 3H89A 1PNMA 4R8CA 1SZXA 4AILC 2DJFB 3S3RA 2VQEO 5EYPB 4FM0A 1VQKV 4IIJA 5B3SB 3ETDA 2ZR2A 5JZEA 2ZNIA 2RNBA 2IBZH 4KL1A 5FLXN 1US6A 3VQVA 4G27B 4UB8Z 1YVBA 2QWPB 4Z1MG 1KQSU 3TNXA 5ITZA 2XAGA 3CBKA 1YTFB 3N27A 3SYAA 1XILA 1WP7A 3IV2A 1NR1A 3K5MA 5TISZ 2PZSA 4REZA 3MAQA 1Q43A 3RNVA 3I56V 2F95B 2GTAA 4QNHB 2P90A 3D6SA 2F23A 3RYHA 3MP2A 3PW3A 1HR0B 3SJCC 3CCQV 2AIMA 1AP5A 4MM3B 1CSBB 5CA1A 4CH3A 2EJ7A 1EN4A 5D5QA 4DR1O 1EN5A 2L35A 2FO5A 2ZCEA 4UCVA 1EWLA 2JK5C 3MTVA 3DC6A 4J80A 2ZT9B 2EZOA 2BTOA 1SQVH 1QDQA 5JQGA 4LFCB 5KMGA 4MSXA 3ETEA 1SQGA 1M1KW 4TV9B 3CD6V 1QR9A 4CDDB 2PTMA 1NI8A 1NTMH 2ZDIC 1XL6A 2PADA 1KP3A 2ODMA 4X1IB 4H0LB 2VQFB 3M99A 1IWDA 1RPRA 4R6ZA 4O4JB 3JAWB 4BWAA 3B8MA 4O4HB 3WB1A 3HWNA 5CBHA 3VQWA 5B1NA 2JEUA 1IBKO 2AZ2A 1PKXA 5IYCO 1NH2B 2Z3YA 1TU6A 4JAUA 3USVA 1JCHA 5IYZB 1F7YA 2HFEC 4RUEA 4FJCC 4I4TB 3GWKC 3HKCA 3L74H 3CCMV 1YITV 3K5LA 3H1JH 1BGYH 4WFFA 2VWJA 1ZL8B 4NTYA 4YYRA 1AJNA 3K24A 3N3KA 4QH6A 2KSDA 2DE0X 3K9AA 2B1NA 3CCLV 3GWOA 3MORA 4P6GA 1EM1A 5LA6A 1SC5B 1JMKC 3SPIA 3STZC 4JYCA 4TV8B 4CZWA 3DXRA 2PUSA 1GMGA 4GX0A 1OCRB 2KKWA 3IC9A 2R9AA 3MHHA 3TGUH 1OCRC 4WBNB 2ZE5A 4DRXA 4JI3O 3KKUA 1GTOA 1ZCMA 1JFFB 1V54C 4CH6A 2M7WA 3FD9A 2ZIOA 2HH5A 3OFNG 3KSEA 1PIPA 4TT3G 2AU1A 2QE7G 4EFEA 3ZN1A 4GX2A 1AIMA 4J42A 3AK3A 3BFRA 1KD1W 1HNXB 5EZQA 1PM9A 1EFRG 2IJJA 1TGOA 4I07A 3UT5B 5EC2C 3BBAA 3ZHVA 4U3JB 3K79A 1XMQB 2ATKC 1MA1A 2UUCO 2Q8VA 5FPWA 3CRQA 1N33O 1F4NA 5H2FZ 1WPXA 4H33A 4PADA 2UXCO 1PBHA 3H1HH 1MZFA 4LF6B 4I0XB 3SYPA 2CTQA 1QOLA 3OTFA 3T1YO 1M6DA 4J7JA 1YK7A 3WFVA 3H8CA 2F4VO 5B66Z 2Q68A 1HP8A 4QRVA 1NJIW 1HDJA 3K0DA 1S3JA 1EF7A 2YIBD 4CS4A 4I5SA 4GZRB 3CRCA 4UVCA 4FIPA 1XDCA 1M9NA 3T1HB 4WFHA 2P0RA 2JGUA 1MEMA 1YIJV 2FRQA 1BHBA 2E5LO 2FL4A 3K5NA 2E03A 1G4YB 1NS1A 2R9FA 2MW2B 3G6BA 5K1PA 1PPOA 4BAYA 3ASNC 1WA8A 2V4DA 1SZTA 3A0RA 1VJVA 2VHFA 5LGNA 2Q6AA 2QM8A 1B6QA 3L70H 1M56C 1YHQV 3OVXA 1OCZC 1AU2A 4OW0A 2XT9A 2RJZA 1CTEA 2YI9A 4A5UA 1XNQB 2YUAA 3D36A 4PA7A 2YJBA 2O57A 4K7CA 1AR5A 5K16A 1G6UA 2OTJV 1PNKA 2Z84A 3PN1A 1BMFG 4DMXA 4DV4O 5DM6V 1QHTA 1N32O 5H6RA 3FKSG 5CA3A 3B8NA 4YIOA 2Y69B 2ZE7A 4J7KA 3JD1A 4PV1B 4X1KA 3PBHA 3Q4HA 3OW2U 1UJWB 4Z2WA 1FFTB 3ZRWA 3RYFB 2OIEA 1KB9F 3RVZA 2DMXA 3CMEV 2DYSB 1RP3B 4EKWA 1PVJA 1AU4A 2YIAA 3APQA 3GCBA 2R9RB 3NHEA 2IH1C 4DR2O 2GHUA 4F6EA 4K3AA 4EB6B 4QE7A 1QLEB 2B5UA 1THEA 3B40A 3JYCA 2EX3A 1JVMA 1HWYA 3L9DA 3VQYA 3CWBH 2QWOB 1N34B 4FMTA 1XBLA 4DV3B 1FXVA 1U9VA 4YJ2B 4OEMA 1WP8A 4MTXA 4B3RO 5JH7B 5KX5B 2LW7A 3B09A 2IPPB 1N32B 5CN0A 5JVDA 1K5SA 5D5PA 1VSNA 3JALB 2EIJC 2JJ1G 1KHPA 2VQEB 1H8HG 1KFUL 2F1GA 1JJOA 1MS6A 5GW7A 3QO5A 2R9MA 2PF4E 2EIKC 3O1GA 3CSXA 1MHWA 2DW4A 5F2VO 4J10A 2EINB 3OUSA 4OVZB 4X66O 1F51A 4CC6A 5CB4A 3W7SA 4XBFA 4NKGB 2FYUH 4JV5B 3DC5A 1K5QA 1KECA 2ADPA 3BAAA 2RQ6A 3FYEB 2A7WA 2CAZC 4JYYA 1RPOA 1V54B 3IJ4A 5LMUO 3K58A 3CH3X 4K0KO 2WSSG 1FJGO 4MZSA 3BC3A 4L87A 2XAQA 1UFIA 4JGSA 4LC1A 1O0EA 5B1OA 3E1ZB 4UVBA 3ETQA 1R6TA 4GKKB 3F7VC 2DJVA 2KQXA 3AG1C 2QEXV 2YEVA 4XDKA 1I5YA 5BR8B 2HHHO 4FK5C 1CS8A 2QKSA 3S3WA 2EJRA 2H94A 5EK0A 3ZS8C 2CIOA 2CE4A 3ABKB 5EBLC 4NTXA 5KHIA 5BR8O 2JS3A 5JJEB 4AHCA 1Q3EA 3BA9A 1CB5A 1JQ0A 1K3EA 5C8YB 2F7DA 2XNDG 2FTKA 2GV9A 4TUYA 3QTCA 3STLC 2WLKA 2IW5A 4I7ZB 4D7TA 2UUBO 3A8TA 1AJQA 3O9OA 4FZ1A 3CXCU 4X1IA 1N4CA 4Q6GA 4BW9A 1NH2D 3HKBA 1IX9A 5KO3A 4UV8A 4JI0B 3MD0A 1R1BA 2NR5A 2Y4TA 2WLNA 3CCVV 5EIBD 3AG4B 1U5IA 4ZTBA 4JI5B 1BZKA 3O65A 4I4TA 3HKCB 4IHJB 3F5WC 2A79B 2Y6EA 3AG3B 4DR5B 4DV1B 4NXMO 3T1YB 1Q5OA 2GHYA 5IE9A 1Y76B 3QF7A 4FLYA 2PYJA 2W6IG 1XEQA 2WAMA 1FYJA 2CH7B 3BA8A 1AI7A 2FRAA 2G8JA 3KG2A 2XAJA 1XHXA 3OR7C 1M4UA 2YJ2A 2NQGA 2XU4A 1NR7A 2DYSC 4PI3A 1HUCB 4ZOLA 2HHHB 2CTRA 1P84F 4AXMA 1YEWA 4RO2A 2G6DA 4DR3O 1IZ3A 2R9CA 3B4SA 2ZXWB 3R65A 5GTHZ 3G6EV 4X62O 4CDCB 4XDLA 2QKAA 3W7WA 4O4IB 4DR2B 1ZSPA 3JAKB 3QNEA 5GONB 1TLOA 4ABMA 1QVGU 1SKVA 1YSCA 2UU9O 4WF9V 1BSMA 4X65B 1F23A 4CZZA 5L3BA 3TJTA 4FFBA 4HZ3A 2HD5A 2P7UA 5CA0B 3BCCH 2XAFA 4BQVA 3P30A 3N2KB 1OCCC 5L3EA 3RBZA 1LNQA 3X2QB 1R6KA 4MTGA 4H13B 3UO3A 1VMGA 2QA4V 2V7QG 2P5OA 4GUNA 1XMOB 1GM9A 1QR8A 3OUFA 3SJAC 5KUMA 1Y6XA 1M90W 4LF7O 4BOSA 2Q0AA 3K04A 5KAFZ 3RVYA 2CGOA 2G38A 3DF0A 4BIUA 1QQCA 2BDLA 2ILMA 3ZCCA 2FKXA 1V55C 3OF8A 2QTOA 4CS2A 3ZHTA 2WLIA 3K8UA 2JJ2G 1R3LC 4AXLA 3BCNA 1I94B 1FFXA 2CDYA 3JATB 5CA1B 3PRPA 2VQFO 2GFOA 2LJ2A 1K4CC 3EXAA 2FB5A 1HNZO 4IT5A 5FL7G 1EWPA 2Q0OC 5EZYB 2E01A 4P30A 1ZUQA 4X88A 3E22A 1SESA 4ZI7B 1VQ4V 5JJNB 1NVPD 5CMUA 3K59A 2HP8A 3ASOC 4B3RB 5EBMC 2J7QC 2B1IA 5LXTB 2WWWA 2IH3C 1EWOA 4XZXA 4MVQA 4XDJA 2QWNB 4LF4B 3LSSA 3AG3C 4GX1A 4AQYB 3G4SV 2VS0A 4X64B 3N2GB 1OV9A 3JAWA 4ZHQA 2JIZG 4I50B 4N79A 4O4HA 4IUMA 3ZIAG 3CEIA 2GSMB 2W0FC 3JCUZ 3H1IH 4JAVA 4O4LB 4JI7O 3SPJA 4O2BA 2AVWA 3TRKA 4F6RA 1SERA 3C90A 3ZHSA 2ZR3A 2OZ2A 1AU0A 2M6YA 5AG2A 1VF7A 2H8PC 2WLJA 3CRAA 4X1YB 3B79A 4LFAO 3LDCA 5KHJA 1ME3A 3FX7A 1ORQC 2OP3A 2GDSA 1NQTA 3DSQA 4G2KA 5LA6B 3RWRD 3RGBA 1GKFA 5LP6A 3RYCA 2DCAA 4RF1A 1BP4A 3RW0A 5HFLA 1WNSA 2DWDC 3SDLA 3CPWU 1STFE 1M93A 1NBMG 4D8EA 3SJQC 5J2UA 3MHHC 5LHHA 2HR3A 3ZMVA 1XHZA 1AR1B 5A2QN 2FT2A 1T5EA 4JI4B 4KUMA 4DRXB 4I9WA 2A3QA 1AI5A 1B06A 3CCEV 1X4TA 5J2TA 2LP7A 1IDSA 4MVRA 2DQ3A 2OTLV 3R66A 2HJFC 4FFKA 4DR7O 4RY2A 2Q7GA 2IU3A 4J11A 4TOIA 2QWQB 1W0JG 5IYBO 4FLWA 2YXHA 1FXKA 2RN9A 4GYCB 3CB2A 1YXBA 3ML0A 3WXGA 1OCOC 4FLXA 5JCOC 3IHPA 2ZQMA 1MSWD 1KXRA 4Z1VA 4DV6B 1F29A 2BTQA 3A0BZ 1PL0A 1AYUA 1LUVA 3U8EA 3GVMA 1PD3A 3SPGA 4R7CA 5IJ0A 2DZZA 2P6JA 4DUZB 2ATOA 4D8IA 3THOA 3W7TA 3AG7A 1Q7YW 1TUBA 1H2SB 4PDVA 3E8HA 1S5HC 1VF6C 3KKYA 3PNRA 5IYDO 2DC8A 2NQIA 4JTAB 3BY6A 4MT8A 2B1MA 5EF4A 2CTWA 3CE2A 2OULA 4DR5O 4OPHA 5L3DA 1O9GA 2QGNA 5H5NA 3ZNHA 4JI6B 5LYJA 4X66B 4M0WA 2ITDC 1N36B 5F02A 2EBOA 2YIDA 4HYOA 1ATKA 1Y67A 4IGGA 2OYQA 4FLUA 3J81N 3ZUAA 4GCZA 4W5CA 2P22C 4RKXA 1XOUA 1QCEA 5E1AC 1VQ8V 5L3GA 5EZSA 5L3CA 6PADA 2FMLA 2HVJC 1FH0A 4JI1B 2EIMB 2UUAO 4A5UB 2YXYA 5B1BB 2UXBB 2LGWA 1CP9A 1KYOF 3TETA 4FM1A 1IURA 2HJDA 8PCHA 2FUDA 1OJHA 4DV0B 4MVMA 3AK1A 4PA9A 4PHZA 1K4DC 3HKBB 4X1KB 5FPOA 1K7DA 5GTIZ 3S3QA 4LF8O 1VP7A 3JSLA 1YCIA 3RYIA 2BOBC 4UCRA 1NTKH 4IYHA 4U7NA 4DR4B 1GN4A 4E4EA 4AQYO 1AROP 1I7FA 4UFZA 2YDEA 4WFGA 2UUCB 3AG2B 4HNAA 1ZAUA 2QKCA 5H6QA 2JVDA 1Y74B 3ASNB 4FPPA 5LMUB 4DMYA 2AHYA 1DEUA 1DLBA 3H01A 4PJ0Z 1VQMV 2OT5A 1Q6KA 1BGOA 3P3PA 1MG1A 3IGAC 2R6NA 2R9OA 4CDFB 3PJSK 4LF9O 4FK5A 2H3OA 4QE9A 3TXQA 3E35A
chains in the Genus database with same CATH topology
3OTOO 2J7QC 4D8IA 5JZEA 4X64O 5FLXN 3T1HO 4K0KO 4LF5O 1FJGO 5IT9N 4A5UA 2DOSA 1UKFA 4XZXA 4JI5O 3J80N 3BB7A 2Z84A 4B3SO 3PRMA 4DV4O 2UXDO 1N32O 4JI6O 4DR5O 4OPHA 4DUZO 3W30A 4D8BA 2ZM6O 4JI3O 1R6TA 2BU3A 1HR0O 2DJVA 4DR6O 4RNAA 2Z0AA 3JAMN 4DR3O 4REZA 4P16A 4IUMA 3RNVA 4YY3O 5H5NA 3ZNHA 2UXBO 4X62O 2HHHO 3PT2A 4LF6O 4JI7O 4LFCO 3TMPA 4OX9O 4M0WA 1G1XB 1PVJA 2UU9O 3MP2A 3TRKA 4BOQA 5IWAO 1A32A 1I94O 1N34O 1XNQO 4JYAO 4GKJO 1D2DA 4OVZA 4BOZA 3J81N 3PHUA 2FE8A 4MM3B 4DR2O 5LMNO 2HWKA 5EZQA 4RKXA 5BR8O 5LL6Y 3PSEA 1HNWO 3IFUA 5EZSA 4JI2O 4LFAO 1AILA 3BY4A 3BBAA 3PHXA 1YZBA 4OPAA 4X65O 4DR1O 1DKIA 4BOUA 4DV0O 4MI7A 4KHPO 3J7AU 4RF1A 3MTVA 3C0RA 4B3TO 2AGAA 4DV5O 4A5UB 1FKAO 2UUAO 5E6JA 3SDLA 3RT3C 5BY1A 2UUCO 2UUBO 4LF7O 4BOSA 2BTWB 4D8EA 3PHWA 1N33O 2JTCA 4JI8O 4B3RO 1X59A 4JI1O 2ZKOA 2LW7A 4JI0O 4DUYO 2UXCO 4GUAA 1N36O 1XMQO 5A2QN 4PT5A 4NXNO 4DV3O 4DV6O 3T1YO 3F5TA 2JRIA 4LF8O 2F4VO 4B3MO 5KO3A 4WURA 2FKXA 2J7QA 1HNXO 4YHHO 4GKKO 3R66A 5BXZA 1KUQA 4HXDB 1R1BA 4DR7O 2UZJA 4LFBO 4AQYO 4DV1O 4OVZB 4JV5O 1IBMO 1AB3A 4ZTBA 4X66O 3O65A 1IBKO 1XMOO 3PRPA 4DV2O 2E5LO 3W31A 2VQFO 4DR4O 1F7YA 1HNZO 1NS1A 1IBLO 4DV7O 1XNRO 4NXMO 4RF0A 3MJ5A 3OQCA 3M8AA 3B21A 1J5EO 4JI4O 3E9SA 4BOPA 4R3DA 4LF9O 2VQEO 4IP3A 2BTWA 1XEQA 2N74A 5LMUO 1DK1A 1FYJA 4OW0A 4LF4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO O;  4X64 O;  5FLX N;  3T1H O;  4K0K O;  4LF5 O;  1FJG O;  5IT9 N;  2DOS A;  4JI5 O;  3J80 N;  4B3S O;  4DV4 O;  2UXD O;  1N32 O;  4JI6 O;  4DR5 O;  4OPH A;  4DUZ O;  2ZM6 O;  4JI3 O;  1R6T A;  1HR0 O;  2DJV A;  4DR6 O;  2Z0A A;  3JAM N;  4DR3 O;  4YY3 O;  5H5N A;  2UXB O;  4X62 O;  2HHH O;  4LF6 O;  4JI7 O;  4LFC O;  4OX9 O;  1G1X B;  2UU9 O;  5IWA O;  1A32 A;  1I94 O;  1N34 O;  1XNQ O;  4JYA O;  4GKJ O;  1D2D A;  3J81 N;  4DR2 O;  5LMN O;  5BR8 O;  5LL6 Y;  1HNW O;  4JI2 O;  4LFA O;  1AIL A;  1YZB A;  4OPA A;  4X65 O;  4DR1 O;  4DV0 O;  4KHP O;  3J7A U;  4B3T O;  2AGA A;  4DV5 O;  4A5U B;  1FKA O;  2UUA O;  3SDL A;  3RT3 C;  5BY1 A;  2UUC O;  2UUB O;  4LF7 O;  1N33 O;  4JI8 O;  4B3R O;  1X59 A;  4JI1 O;  2ZKO A;  2LW7 A;  4JI0 O;  4DUY O;  2UXC O;  1N36 O;  1XMQ O;  5A2Q N;  4NXN O;  4DV3 O;  4DV6 O;  3T1Y O;  3F5T A;  2JRI A;  4LF8 O;  2F4V O;  4B3M O;  2FKX A;  1HNX O;  4YHH O;  4GKK O;  3R66 A;  5BXZ A;  1KUQ A;  1R1B A;  4DR7 O;  4LFB O;  4AQY O;  4DV1 O;  4JV5 O;  1IBM O;  1AB3 A;  4X66 O;  3O65 A;  1IBK O;  1XMO O;  4DV2 O;  2E5L O;  2VQF O;  4DR4 O;  1F7Y A;  1HNZ O;  1NS1 A;  1IBL O;  4DV7 O;  1XNR O;  4NXM O;  3M8A A;  1J5E O;  4JI4 O;  4LF9 O;  2VQE O;  1XEQ A;  2N74 A;  5LMU O;  1DK1 A;  1FYJ A;  4LF4 O; 
#chains in the Genus database with same CATH topology
 1VQP V;  1Q81 W;  4X20 A;  3ZMZ A;  2Q7H A;  2PYL A;  3I5D A;  4B08 A;  3AEI A;  3EFF K;  4JAA A;  4WFA V;  1PPP A;  1U9W A;  3CHX A;  4JI6 O;  4YYS A;  2G8E A;  3W30 A;  4D8B A;  4DR6 O;  2WA3 A;  2QTS A;  4X89 A;  3JAR A;  3OMA B;  3ZHU A;  4P16 A;  2WLL A;  4X6H A;  3UCS C;  3QSD A;  3ZMS A;  2R70 A;  2P4K A;  2ZXW C;  3F7Y C;  2D2C B;  2FQ9 A;  5JCO A;  4BOQ A;  4LFB B;  5CBF A;  3JSN A;  4OX9 B;  2NQA A;  1K33 A;  1BT8 A;  5LMN O;  4TWK A;  5LL6 Y;  2F4V B;  4U7O A;  3G67 A;  2YSU B;  2OWO A;  4MI7 A;  2CTP A;  5IY5 C;  1JOY A;  2IU0 A;  1DF0 A;  1CV8 A;  2CGN A;  3DGE A;  4LNU B;  1IBK B;  2BTW B;  4JI8 O;  1JR9 A;  3CBJ A;  2CK3 G;  1XMQ O;  1F2C A;  4UUJ C;  3K06 A;  1SA0 A;  5DEC A;  3G80 A;  5ITZ B;  3CCR V;  3KCY A;  2EIN C;  4NB5 A;  4DR7 B;  2OCH A;  3BVO A;  1NQC A;  3OVZ A;  2YEV B;  1KFX L;  1K9M W;  3N3G A;  3M7M X;  4CH5 A;  1WLE A;  2Q7E A;  4UCO A;  4YHH O;  1HNX O;  1S77 D;  2CB5 A;  5H9C A;  4UXN A;  1MEG A;  1K92 A;  1VQ6 V;  3CRR A;  1MDW A;  4JTD B;  2QSA A;  1XMO O;  5EZY A;  4FLV A;  1J95 A;  1Y08 A;  3VQX A;  4W4K A;  4WFE A;  2AZ0 A;  4MSW C;  1IBL O;  3CC7 V;  5B1A C;  1BS3 A;  4JI3 B;  2OIG A;  2Q67 A;  1K3B B;  3ZBH A;  1YDX A;  4X6J A;  1YAL A;  2JS5 A;  2B9Z A;  4BOP A;  2F66 C;  4QPK A;  2Q9L A;  3GB7 C;  5IWA B;  1GAX A;  2UUB B;  2UU9 B;  4O2A B;  2NN4 A;  2DC6 A;  4NTW A;  4LH7 A;  2DOS A;  4JI5 O;  3J80 N;  3X2Q C;  4ZHQ B;  2QDO A;  4MW3 A;  1IXB A;  1TL9 A;  3PRM A;  3O0U A;  1F2B A;  4ZUX U;  3ASO B;  4KHP B;  3L72 H;  4N23 A;  2ZD9 A;  4H37 A;  2ETN A;  2BSK A;  3FAV B;  4UV9 A;  2UXB O;  4YYW A;  2Q4P A;  4NR1 A;  1GN3 A;  1ZIV A;  1I5X A;  2RCV A;  4TQF A;  1G1X B;  4EFB A;  3ABK C;  2R72 A;  2DC7 A;  1W59 A;  4JYA O;  4MVU A;  1ICF A;  2FE8 A;  1M5I A;  2V1D A;  4CH4 A;  1RSO B;  3H1L H;  1KBH A;  4R50 A;  4NVP A;  1ENV A;  3RFR A;  2L6L A;  5LP6 B;  1BL8 A;  5EYP A;  3RYC B;  4IIJ B;  3K5O A;  4KHP O;  2CH7 A;  5LP6 C;  1K8A W;  3JAS A;  2X0L A;  1M57 B;  3MHS A;  1L1F A;  1FKA O;  1VF5 B;  2CUG A;  5LOV A;  4PA4 A;  4LF5 B;  1VQ5 V;  4OEL A;  3P5W A;  4DUY O;  1QLN A;  2IBI A;  1V9P A;  4PT5 A;  4TV8 A;  3D3I A;  1J5E B;  4RWU A;  5EC1 C;  3D36 C;  3V6E A;  1Y4M A;  4YYQ A;  3CRM A;  4BIZ A;  3UQ8 A;  4GKK O;  1KUQ A;  4I9Q A;  1COW G;  1VAR A;  2PNS A;  1MOF A;  3E86 A;  3BEH A;  4P6E A;  2LQT A;  2ZE8 A;  1FXK B;  3KWB X;  1L0N H;  5IY5 B;  2YIB A;  4DV1 O;  2HLD G;  3T4Z A;  3QVN A;  4YJ3 B;  3CCU V;  4PD4 F;  1BY8 A;  4IYI A;  1NB3 A;  2B1G A;  1FD9 A;  4KLB A;  1VQ7 V;  3KFQ A;  1L8D A;  3HB3 B;  4G54 A;  1L0L H;  2P4V A;  2Z5U A;  5JQG B;  3FB6 C;  1U9Q X;  3LSQ A;  4X64 O;  4TV9 A;  4I55 A;  4LF5 O;  4NXN B;  1UKF A;  3ZRV A;  1Q6I A;  5FNV A;  3BB7 A;  2DYR B;  1CXZ B;  3M99 B;  1SQP H;  2A06 H;  1Y4H A;  4X62 B;  3BPF A;  2DYR C;  2WA4 A;  3ABT A;  2XOK G;  3ZRW B;  1SF9 A;  1XL4 A;  3N4C A;  3K08 A;  1ZLZ A;  2Q73 A;  2F43 G;  1GEC E;  3P3N A;  1AI6 A;  1F4M A;  4E2L A;  1N33 B;  3LDD A;  3TMP A;  2UXX A;  1THZ A;  2GUZ B;  3CX5 F;  1X9Y A;  3HHI A;  3HHA A;  2BOC C;  2ZE6 A;  3OEH G;  4EB6 A;  3JD3 A;  5JWP A;  3SYO A;  2UUA B;  1S5L Z;  1DTO A;  3W7U A;  3PSE A;  1XRE A;  3BAB A;  3QO8 A;  2DJG B;  1AVM A;  4OPA A;  5A9G A;  2XAS A;  2C2A A;  2BCC H;  2OCC B;  1VQL V;  3ZHR A;  4GX5 A;  3RT3 C;  3OIS A;  2XU3 A;  3QJ3 A;  1S5J A;  2A9H A;  4NXN O;  3A0H Z;  4CDE B;  1G8M A;  1AJP A;  1JFF A;  5LGU A;  1WPB A;  3C3T A;  1BQI A;  3OTO B;  2BE3 A;  2ACT A;  2HKO A;  1BHA A;  1PE6 A;  1DGS A;  3OAA G;  1SQX H;  1NZ6 A;  3BHP A;  5JA7 A;  4J9Z B;  3RYF A;  1PCI A;  3P32 A;  4FLT A;  4LF7 B;  3OEE G;  4LF9 B;  2LGQ A;  3VBB A;  4DR4 O;  3QT4 A;  4LP8 A;  2UXN A;  1UPG A;  3CP1 A;  1U97 A;  1XQ8 A;  5IJ9 B;  2N74 A;  3K9M A;  3KZI Z;  3OD4 A;  1ZL8 A;  2IJK A;  4LF4 O;  4JI8 B;  1TAE A;  4YYV A;  2KG7 B;  5IT9 N;  1MSD A;  1TVK A;  1PPN A;  1GM8 A;  3KCX A;  1MNG A;  2EZP A;  4YJ2 A;  1B04 A;  5JH7 A;  1VQO V;  5KX5 A;  4LF8 B;  4B7K A;  2X6A A;  1W0K G;  4MTO A;  2UXD O;  1QBZ A;  3AI8 A;  2LFR A;  5LHI A;  2AUZ A;  4YXW G;  5JVD B;  3SPH A;  1R3J C;  5HFM A;  1ME4 A;  3K57 A;  4ZBM A;  2D3O W;  2QM4 A;  4LFC O;  1Q82 W;  1NPZ A;  5EGW A;  2AYN A;  1H2G A;  3TCU A;  5IWA O;  4UCT A;  1I94 O;  3CC2 V;  4C7U A;  4GKJ O;  4OVZ A;  3PHU A;  2P67 A;  2AW9 A;  5CB4 B;  4G28 B;  2YS8 A;  1YTF D;  4BSQ A;  3PHX A;  1AIL A;  4P2Z A;  1S0V A;  1YZB A;  3OGC C;  5IJ0 B;  4X65 O;  1DKI A;  1KP2 A;  2ARY A;  4LWS A;  3RVV A;  2P06 A;  4PDR A;  1Z5W A;  3AG4 C;  2F93 B;  3WXE A;  2LFS A;  4QRX A;  1SA0 B;  1XUQ A;  1AU3 A;  1PNL A;  5CVO B;  1GLO A;  3OGI B;  1CEZ A;  1Q6U A;  2DZY A;  1MAB G;  3Q4H B;  2DC9 A;  4I0X A;  4YVA A;  1Q90 D;  4DUY B;  1E1R G;  2JGD B;  1NB5 A;  2E02 A;  1F2A A;  2UXC B;  4JTC B;  1AP6 A;  1R6N A;  1DF4 A;  1FAF A;  4IHJ A;  3C9E A;  1WB8 A;  3H1K H;  2F1M A;  2PY5 A;  2ZDI A;  1LUW A;  1SQQ H;  4U3F H;  1N0J A;  4RF0 A;  4GT1 A;  4K35 A;  2FYE A;  4DR3 B;  1U9X A;  1V55 B;  2EUL A;  1WA8 B;  4UVA A;  4O2A A;  3E8B A;  3E89 A;  5C8Y A;  3OTO O;  2ZIN A;  4TUY B;  5B3S C;  2WPD G;  9PAP A;  2YC0 A;  1HW7 A;  3ZMT A;  2GTS A;  3U0Z A;  3T1C A;  5B5E Z;  4PI0 A;  3ZED A;  5KLV H;  4EEQ A;  4K0K B;  4WA6 A;  1AI4 A;  2Q69 A;  3NR7 A;  1HR0 O;  3HKD B;  1PPJ H;  1NL6 A;  4B3S B;  3HKE A;  1FS0 G;  1CPJ A;  4N21 A;  3ABL C;  2DCB A;  3C3S A;  1Y74 A;  5LMN B;  5BMV B;  1VIB A;  4IL6 Z;  4I05 A;  2AXT Z;  1Z5V A;  1LR1 A;  2EIM C;  1XNQ O;  3UO2 A;  1R73 A;  3N2K A;  4JYB A;  4JI7 B;  1WN7 A;  4YYU A;  2HWK A;  5L3F A;  4FIP C;  1KKC A;  3ZMU A;  1KKD A;  3CCJ V;  4DR6 B;  2AGA A;  4DV5 O;  5BY1 A;  1P49 A;  3JCZ A;  1WAZ A;  3SR2 C;  1YJW V;  4RAI A;  2ZKO A;  3U10 A;  1XI1 A;  4AI8 A;  2VWK A;  4P9O A;  1DF5 A;  2DN9 A;  2PRE A;  3OMI B;  1YT7 A;  4TSF G;  5KHK A;  3SYC A;  2P7T C;  2ZM6 B;  3WU2 Z;  3JAR B;  1A6R A;  1EZJ A;  2ZIM A;  2WLI B;  5LHG A;  4ZOL B;  3FFQ A;  3JD0 A;  4DW1 A;  4YJ3 A;  4LFB O;  3D3Q A;  4MVO A;  1S72 V;  1JX9 A;  4X9Q A;  3LXS A;  5EIB C;  3RYH B;  3SYQ A;  4DK0 A;  3IUT A;  2HXZ A;  3TXS A;  1YVW A;  4RQE A;  1OZ0 A;  4MW8 A;  1R3I C;  3MJ5 A;  4FVM A;  3B21 A;  4JI4 O;  3IC7 A;  3E9S A;  4XR7 A;  1P7G A;  1YI2 V;  4DV7 B;  4IP3 A;  2QR4 A;  2BTW A;  3ABM B;  2HVK C;  1DK1 A;  1ITO A;  3MDS A;  3QG5 A;  4DV4 B;  3I55 V;  5KHG A;  1BCC H;  1SQF A;  3T2M A;  5KMG B;  1CPY A;  1NVP B;  1GRJ A;  2Y0P A;  3BPM A;  1IBL B;  1NTZ H;  3A2F A;  3K9S A;  1PAD A;  2VHS A;  3QO7 A;  4YIP A;  1D5N A;  4UCU A;  4B3M B;  4YY3 O;  4O2B B;  2GUZ A;  1YJ9 V;  1RFY A;  4F6R B;  1RM1 C;  1NT2 B;  1PV0 A;  4K8X A;  2DCD A;  3WB2 A;  2R9I A;  2E74 B;  3CJH B;  4KXR A;  3PDF A;  2JDI G;  3UKM A;  1Z2G A;  3VOU A;  5EBW C;  4N8W A;  1FFX B;  4ICG A;  3OR6 C;  4PDM A;  4FM2 A;  1HNW O;  3IFU A;  4J41 A;  4JI2 O;  5IYZ A;  1W2B U;  3LDE A;  4DK1 A;  4BOU A;  4FZ0 A;  4B7E A;  4QBB A;  3J7A U;  2Y4U A;  5CBG A;  2IJH A;  2UXD B;  3LFY A;  2OCC C;  4BPV A;  2O6X A;  3D8C A;  3ABL B;  1CJL A;  1QVF U;  4L8J A;  4ZI7 A;  4UCS A;  4ZKI A;  1NKD A;  4LR3 A;  3H9V A;  3HPL C;  2PI4 A;  1R3K C;  4FJC A;  5LXT A;  1GMY A;  4DV3 O;  3BWK A;  3RN4 A;  3EVK A;  3DXR B;  5J2T B;  1I0H A;  5B1B C;  2X7R B;  4WUR A;  2NQD B;  1HNZ B;  2ITC C;  3L75 H;  4JF3 A;  3H6S A;  2PGG A;  1Q8I A;  2X6C A;  1BE3 H;  3ZRS A;  4W5B A;  1AB3 A;  4ZIB A;  4FFB B;  1CVZ A;  1K73 W;  5CA0 A;  2ZNJ A;  3LSU A;  4OXS A;  2PI5 A;  1NLJ A;  4LFA B;  2PBH A;  2RDC A;  3K3W A;  2XHB A;  1BQ0 A;  3B77 A;  2Q5Z A;  2YJ8 A;  2E5L B;  1GM7 A;  3JAS B;  5KA6 A;  1SNK A;  4PEL A;  1SRY A;  5LOV B;  3AG2 C;  4HWY A;  4DR1 B;  4HAM A;  1CQD A;  1H2K A;  1EBO A;  4QPJ A;  1E79 G;  1XKG A;  1U96 A;  4U3J A;  1Y76 A;  1SS3 A;  3ZRX A;  3CXH F;  2EIL B;  2E76 B;  3ICX A;  4GKJ B;  2X6B A;  1D5A A;  3S3X A;  3EHB B;  3CH2 X;  2IM9 A;  3K03 A;  4P9P A;  3AK2 A;  4D6T H;  1N8R W;  4B3S O;  3FYI B;  2VRZ A;  5DN6 G;  3RVX A;  1OCZ B;  3CC4 V;  3HD3 A;  1H2N A;  4PI2 A;  3SGI A;  2DCC A;  5CHT A;  4RNA A;  2W6J G;  1SQB H;  3CCS V;  4BR6 A;  1KHQ A;  4PP2 E;  1JJ2 U;  4QJF B;  3G71 V;  3KX1 A;  3BPZ A;  5FPR A;  3BRC A;  2IJI A;  2XTA A;  1PXV A;  2P86 A;  2HEP A;  3HR0 A;  4LCU C;  1B3Q A;  1A32 A;  4O4I A;  1BQZ A;  3LNN A;  2Y48 A;  5GON A;  4NYK A;  1D2D A;  4BOZ A;  4I04 A;  3ZJZ A;  4LWS B;  2Y0I A;  5PAD A;  2C0Y A;  5KA5 A;  2R9N A;  1JA8 A;  4DV0 O;  5J94 A;  2Y5B A;  1M57 C;  4ASU G;  1POP A;  5KUK A;  2BTQ B;  3OT7 A;  2NLJ C;  4B3T O;  4I55 B;  2W0X A;  4WFB V;  4GLX A;  1IBM B;  3I3T A;  5DED A;  1PL4 A;  5FNV B;  1EN6 A;  2WLH A;  4JI1 O;  2JQG R;  4PP1 A;  3SPC A;  4GUA A;  1P7B A;  3ABU A;  3OM3 B;  1YK8 A;  4YV8 A;  3RYI B;  2JGD A;  1M56 B;  3E2E A;  3W7X A;  2LW1 A;  4DO2 A;  4Q20 A;  4MTF A;  1YF2 A;  5KAI Z;  4QIW F;  5BXZ A;  2AYO A;  3ABM C;  3F5V A;  1H38 A;  4O4J A;  1URF A;  2EIK B;  4J9Y B;  2BDZ A;  5KHH A;  2AHZ A;  1VQN V;  5LYJ B;  4X1Y A;  1EZV H;  2XU1 A;  3CS5 A;  3JAT A;  4JZG A;  4DV7 O;  2WBF X;  1XNR O;  1OHH G;  3NXS A;  1OCO B;  3OQC A;  4JAS A;  4F4L A;  4QGP A;  2LO1 A;  3F75 A;  2YXL A;  1TA8 A;  3E22 B;  3JD4 A;  1H2M A;  2G7Y A;  3E8F A;  1PP9 H;  3KWZ A;  5J9P C;  4MZO A;  1QXP A;  3WB0 A;  1WB7 A;  1I08 A;  1QMY A;  4RQF A;  1ZTE A;  1Q6H A;  4BIO A;  1RM1 B;  4RUF A;  2E00 A;  2WLL B;  4DUZ O;  4WCE V;  2N04 A;  4PDL A;  4YHH B;  3N2G A;  2BU3 A;  1H8E G;  3HKE B;  3MHS C;  5JJJ B;  4PA6 A;  4WBN A;  4I50 A;  4DW0 A;  1Q86 W;  1N0N A;  1NU1 H;  3P5U A;  4LF6 O;  1OCC B;  3K0G A;  5K1X A;  3FB8 C;  3MTN A;  4O4L A;  1N34 O;  3CYO A;  4W4L A;  1GN2 A;  1E1Q G;  4DV5 B;  1MMM A;  4LH6 A;  3ERV A;  5JH3 A;  3IMA A;  1FXH A;  2DQ0 A;  5A24 A;  4B3T B;  4KP4 A;  1K97 A;  1O9H A;  3BY4 A;  2QJ1 A;  1XNR B;  1GN6 A;  5IJ9 A;  5LBQ A;  4Q8G A;  3UT5 A;  2YJ9 A;  4LNU A;  2AS8 A;  2KB1 A;  2KG7 A;  1GH6 A;  1TUB B;  2XAH A;  4LBE C;  5E6J A;  5CHV A;  1VEW A;  1TVK B;  4DXW A;  2FTD A;  2XUM A;  1KU9 A;  1FJG B;  3PHW A;  1TUE B;  1X59 A;  4CBC A;  1S76 D;  4JI0 O;  2ADQ B;  1PPD A;  4D7S A;  3WG7 B;  5J2U B;  1QU7 A;  2DWE C;  4J7Z A;  3CMA V;  1YJN V;  5B1A B;  1Y66 A;  1VQ9 V;  2JRI A;  3ZHQ A;  3FB5 C;  5IDJ A;  2JQF R;  3U11 A;  1AEC A;  3KW9 A;  1GK9 A;  1JQP A;  4XUI A;  3OE7 G;  2ARH A;  4BS5 A;  4MVZ A;  1IBM O;  1EWM A;  2QM7 A;  2WLM A;  2MK3 A;  5BZB A;  3W31 A;  3FB7 C;  4H44 B;  3L73 H;  3L71 H;  1AYV A;  2EIL C;  1SET A;  4JZ2 A;  1FXK C;  1JPX A;  4DV2 B;  3M8A A;  3OMN B;  4BW5 A;  1J5E O;  1SP4 B;  3OF9 A;  3V6C A;  4DYL A;  4R3D A;  3E8G A;  5LGT A;  3DTU B;  2EIJ B;  4KFM A;  4X8A A;  2Y69 C;  2A0L A;  2YIC A;  3I06 A;  3T1H O;  2QWR B;  4JYA B;  2YJC A;  7PCK A;  1IVS A;  1HNW B;  3ZN0 A;  2JEX A;  1ZWI C;  5CVM A;  5C93 A;  2ZM6 O;  1KC8 W;  2HHN A;  3SJB C;  2Z0A A;  3JAM N;  3BOW A;  1H2L A;  3RVW A;  1FPO A;  3CJH A;  2E75 B;  3PT2 A;  3TK1 A;  1IXM A;  1QLE C;  4OX9 O;  1K34 A;  2K1E A;  4JPR A;  3IOQ A;  2NNU A;  4YY3 B;  3H8B A;  2K9P A;  1MIR A;  4Q8H A;  4MS2 A;  2HG5 C;  3UM7 A;  4NXM B;  3E83 A;  3P5V A;  1GCB A;  1MZE A;  2YI8 A;  4K8Z A;  4OGQ B;  4MVS A;  3T4D A;  4N4Z A;  3ETG A;  3LNM B;  2AUX A;  1QNM A;  1P4R A;  3C0R A;  4X20 B;  1ZX3 A;  3AG1 B;  3H7D A;  2JTC A;  3LUT B;  1N36 O;  1KMI Z;  3WXF A;  4CS3 A;  4DV6 O;  2XU5 A;  3HKD A;  5CVN B;  3F5T A;  3IFX A;  4HBN A;  4QRG A;  3IEJ A;  1GO3 F;  4B3M O;  2RMK B;  4BS6 A;  1WJZ A;  2J7Q A;  3ZX6 A;  3IAY A;  3JAL A;  5E79 Z;  2N05 A;  4CC5 A;  5BMV A;  4HXD B;  4W4U A;  4TQD A;  2UZJ A;  2GBO A;  1AR4 A;  1ROP A;  3JD2 A;  2BSK B;  3FAV A;  4JV5 O;  4X6I A;  2H7J A;  3P5X A;  3APO A;  1AYW A;  3B2E E;  3JAK A;  4DV2 O;  3WG7 C;  2E3C A;  1VF6 A;  4UB6 Z;  4HNA B;  4JI2 B;  1S4V A;  4FLZ A;  1RSO A;  4PA3 A;  3H89 A;  1PNM A;  4R8C A;  1SZX A;  4AIL C;  2DJF B;  3S3R A;  2VQE O;  5EYP B;  4FM0 A;  1VQK V;  4IIJ A;  5B3S B;  3ETD A;  2ZR2 A;  5JZE A;  2ZNI A;  2RNB A;  2IBZ H;  4KL1 A;  5FLX N;  1US6 A;  3VQV A;  4G27 B;  4UB8 Z;  1YVB A;  2QWP B;  4Z1M G;  1KQS U;  3TNX A;  5ITZ A;  2XAG A;  3CBK A;  1YTF B;  3N27 A;  3SYA A;  1XIL A;  1WP7 A;  3IV2 A;  1NR1 A;  3K5M A;  5TIS Z;  2PZS A;  4REZ A;  3MAQ A;  1Q43 A;  3RNV A;  3I56 V;  2F95 B;  2GTA A;  4QNH B;  2P90 A;  3D6S A;  2F23 A;  3RYH A;  3MP2 A;  3PW3 A;  1HR0 B;  3SJC C;  3CCQ V;  2AIM A;  1AP5 A;  4MM3 B;  1CSB B;  5CA1 A;  4CH3 A;  2EJ7 A;  1EN4 A;  5D5Q A;  4DR1 O;  1EN5 A;  2L35 A;  2FO5 A;  2ZCE A;  4UCV A;  1EWL A;  2JK5 C;  3MTV A;  3DC6 A;  4J80 A;  2ZT9 B;  2EZO A;  2BTO A;  1SQV H;  1QDQ A;  5JQG A;  4LFC B;  5KMG A;  4MSX A;  3ETE A;  1SQG A;  1M1K W;  4TV9 B;  3CD6 V;  1QR9 A;  4CDD B;  2PTM A;  1NI8 A;  1NTM H;  2ZDI C;  1XL6 A;  2PAD A;  1KP3 A;  2ODM A;  4X1I B;  4H0L B;  2VQF B;  3M99 A;  1IWD A;  1RPR A;  4R6Z A;  4O4J B;  3JAW B;  4BWA A;  3B8M A;  4O4H B;  3WB1 A;  3HWN A;  5CBH A;  3VQW A;  5B1N A;  2JEU A;  1IBK O;  2AZ2 A;  1PKX A;  5IYC O;  1NH2 B;  2Z3Y A;  1TU6 A;  4JAU A;  3USV A;  1JCH A;  5IYZ B;  1F7Y A;  2HFE C;  4RUE A;  4FJC C;  4I4T B;  3GWK C;  3HKC A;  3L74 H;  3CCM V;  1YIT V;  3K5L A;  3H1J H;  1BGY H;  4WFF A;  2VWJ A;  1ZL8 B;  4NTY A;  4YYR A;  1AJN A;  3K24 A;  3N3K A;  4QH6 A;  2KSD A;  2DE0 X;  3K9A A;  2B1N A;  3CCL V;  3GWO A;  3MOR A;  4P6G A;  1EM1 A;  5LA6 A;  1SC5 B;  1JMK C;  3SPI A;  3STZ C;  4JYC A;  4TV8 B;  4CZW A;  3DXR A;  2PUS A;  1GMG A;  4GX0 A;  1OCR B;  2KKW A;  3IC9 A;  2R9A A;  3MHH A;  3TGU H;  1OCR C;  4WBN B;  2ZE5 A;  4DRX A;  4JI3 O;  3KKU A;  1GTO A;  1ZCM A;  1JFF B;  1V54 C;  4CH6 A;  2M7W A;  3FD9 A;  2ZIO A;  2HH5 A;  3OFN G;  3KSE A;  1PIP A;  4TT3 G;  2AU1 A;  2QE7 G;  4EFE A;  3ZN1 A;  4GX2 A;  1AIM A;  4J42 A;  3AK3 A;  3BFR A;  1KD1 W;  1HNX B;  5EZQ A;  1PM9 A;  1EFR G;  2IJJ A;  1TGO A;  4I07 A;  3UT5 B;  5EC2 C;  3BBA A;  3ZHV A;  4U3J B;  3K79 A;  1XMQ B;  2ATK C;  1MA1 A;  2UUC O;  2Q8V A;  5FPW A;  3CRQ A;  1N33 O;  1F4N A;  5H2F Z;  1WPX A;  4H33 A;  4PAD A;  2UXC O;  1PBH A;  3H1H H;  1MZF A;  4LF6 B;  4I0X B;  3SYP A;  2CTQ A;  1QOL A;  3OTF A;  3T1Y O;  1M6D A;  4J7J A;  1YK7 A;  3WFV A;  3H8C A;  2F4V O;  5B66 Z;  2Q68 A;  1HP8 A;  4QRV A;  1NJI W;  1HDJ A;  3K0D A;  1S3J A;  1EF7 A;  2YIB D;  4CS4 A;  4I5S A;  4GZR B;  3CRC A;  4UVC A;  4FIP A;  1XDC A;  1M9N A;  3T1H B;  4WFH A;  2P0R A;  2JGU A;  1MEM A;  1YIJ V;  2FRQ A;  1BHB A;  2E5L O;  2FL4 A;  3K5N A;  2E03 A;  1G4Y B;  1NS1 A;  2R9F A;  2MW2 B;  3G6B A;  5K1P A;  1PPO A;  4BAY A;  3ASN C;  1WA8 A;  2V4D A;  1SZT A;  3A0R A;  1VJV A;  2VHF A;  5LGN A;  2Q6A A;  2QM8 A;  1B6Q A;  3L70 H;  1M56 C;  1YHQ V;  3OVX A;  1OCZ C;  1AU2 A;  4OW0 A;  2XT9 A;  2RJZ A;  1CTE A;  2YI9 A;  4A5U A;  1XNQ B;  2YUA A;  3D36 A;  4PA7 A;  2YJB A;  2O57 A;  4K7C A;  1AR5 A;  5K16 A;  1G6U A;  2OTJ V;  1PNK A;  2Z84 A;  3PN1 A;  1BMF G;  4DMX A;  4DV4 O;  5DM6 V;  1QHT A;  1N32 O;  5H6R A;  3FKS G;  5CA3 A;  3B8N A;  4YIO A;  2Y69 B;  2ZE7 A;  4J7K A;  3JD1 A;  4PV1 B;  4X1K A;  3PBH A;  3Q4H A;  3OW2 U;  1UJW B;  4Z2W A;  1FFT B;  3ZRW A;  3RYF B;  2OIE A;  1KB9 F;  3RVZ A;  2DMX A;  3CME V;  2DYS B;  1RP3 B;  4EKW A;  1PVJ A;  1AU4 A;  2YIA A;  3APQ A;  3GCB A;  2R9R B;  3NHE A;  2IH1 C;  4DR2 O;  2GHU A;  4F6E A;  4K3A A;  4EB6 B;  4QE7 A;  1QLE B;  2B5U A;  1THE A;  3B40 A;  3JYC A;  2EX3 A;  1JVM A;  1HWY A;  3L9D A;  3VQY A;  3CWB H;  2QWO B;  1N34 B;  4FMT A;  1XBL A;  4DV3 B;  1FXV A;  1U9V A;  4YJ2 B;  4OEM A;  1WP8 A;  4MTX A;  4B3R O;  5JH7 B;  5KX5 B;  2LW7 A;  3B09 A;  2IPP B;  1N32 B;  5CN0 A;  5JVD A;  1K5S A;  5D5P A;  1VSN A;  3JAL B;  2EIJ C;  2JJ1 G;  1KHP A;  2VQE B;  1H8H G;  1KFU L;  2F1G A;  1JJO A;  1MS6 A;  5GW7 A;  3QO5 A;  2R9M A;  2PF4 E;  2EIK C;  3O1G A;  3CSX A;  1MHW A;  2DW4 A;  5F2V O;  4J10 A;  2EIN B;  3OUS A;  4OVZ B;  4X66 O;  1F51 A;  4CC6 A;  5CB4 A;  3W7S A;  4XBF A;  4NKG B;  2FYU H;  4JV5 B;  3DC5 A;  1K5Q A;  1KEC A;  2ADP A;  3BAA A;  2RQ6 A;  3FYE B;  2A7W A;  2CAZ C;  4JYY A;  1RPO A;  1V54 B;  3IJ4 A;  5LMU O;  3K58 A;  3CH3 X;  4K0K O;  2WSS G;  1FJG O;  4MZS A;  3BC3 A;  4L87 A;  2XAQ A;  1UFI A;  4JGS A;  4LC1 A;  1O0E A;  5B1O A;  3E1Z B;  4UVB A;  3ETQ A;  1R6T A;  4GKK B;  3F7V C;  2DJV A;  2KQX A;  3AG1 C;  2QEX V;  2YEV A;  4XDK A;  1I5Y A;  5BR8 B;  2HHH O;  4FK5 C;  1CS8 A;  2QKS A;  3S3W A;  2EJR A;  2H94 A;  5EK0 A;  3ZS8 C;  2CIO A;  2CE4 A;  3ABK B;  5EBL C;  4NTX A;  5KHI A;  5BR8 O;  2JS3 A;  5JJE B;  4AHC A;  1Q3E A;  3BA9 A;  1CB5 A;  1JQ0 A;  1K3E A;  5C8Y B;  2F7D A;  2XND G;  2FTK A;  2GV9 A;  4TUY A;  3QTC A;  3STL C;  2WLK A;  2IW5 A;  4I7Z B;  4D7T A;  2UUB O;  3A8T A;  1AJQ A;  3O9O A;  4FZ1 A;  3CXC U;  4X1I A;  1N4C A;  4Q6G A;  4BW9 A;  1NH2 D;  3HKB A;  1IX9 A;  5KO3 A;  4UV8 A;  4JI0 B;  3MD0 A;  1R1B A;  2NR5 A;  2Y4T A;  2WLN A;  3CCV V;  5EIB D;  3AG4 B;  1U5I A;  4ZTB A;  4JI5 B;  1BZK A;  3O65 A;  4I4T A;  3HKC B;  4IHJ B;  3F5W C;  2A79 B;  2Y6E A;  3AG3 B;  4DR5 B;  4DV1 B;  4NXM O;  3T1Y B;  1Q5O A;  2GHY A;  5IE9 A;  1Y76 B;  3QF7 A;  4FLY A;  2PYJ A;  2W6I G;  1XEQ A;  2WAM A;  1FYJ A;  2CH7 B;  3BA8 A;  1AI7 A;  2FRA A;  2G8J A;  3KG2 A;  2XAJ A;  1XHX A;  3OR7 C;  1M4U A;  2YJ2 A;  2NQG A;  2XU4 A;  1NR7 A;  2DYS C;  4PI3 A;  1HUC B;  4ZOL A;  2HHH B;  2CTR A;  1P84 F;  4AXM A;  1YEW A;  4RO2 A;  2G6D A;  4DR3 O;  1IZ3 A;  2R9C A;  3B4S A;  2ZXW B;  3R65 A;  5GTH Z;  3G6E V;  4X62 O;  4CDC B;  4XDL A;  2QKA A;  3W7W A;  4O4I B;  4DR2 B;  1ZSP A;  3JAK B;  3QNE A;  5GON B;  1TLO A;  4ABM A;  1QVG U;  1SKV A;  1YSC A;  2UU9 O;  4WF9 V;  1BSM A;  4X65 B;  1F23 A;  4CZZ A;  5L3B A;  3TJT A;  4FFB A;  4HZ3 A;  2HD5 A;  2P7U A;  5CA0 B;  3BCC H;  2XAF A;  4BQV A;  3P30 A;  3N2K B;  1OCC C;  5L3E A;  3RBZ A;  1LNQ A;  3X2Q B;  1R6K A;  4MTG A;  4H13 B;  3UO3 A;  1VMG A;  2QA4 V;  2V7Q G;  2P5O A;  4GUN A;  1XMO B;  1GM9 A;  1QR8 A;  3OUF A;  3SJA C;  5KUM A;  1Y6X A;  1M90 W;  4LF7 O;  4BOS A;  2Q0A A;  3K04 A;  5KAF Z;  3RVY A;  2CGO A;  2G38 A;  3DF0 A;  4BIU A;  1QQC A;  2BDL A;  2ILM A;  3ZCC A;  2FKX A;  1V55 C;  3OF8 A;  2QTO A;  4CS2 A;  3ZHT A;  2WLI A;  3K8U A;  2JJ2 G;  1R3L C;  4AXL A;  3BCN A;  1I94 B;  1FFX A;  2CDY A;  3JAT B;  5CA1 B;  3PRP A;  2VQF O;  2GFO A;  2LJ2 A;  1K4C C;  3EXA A;  2FB5 A;  1HNZ O;  4IT5 A;  5FL7 G;  1EWP A;  2Q0O C;  5EZY B;  2E01 A;  4P30 A;  1ZUQ A;  4X88 A;  3E22 A;  1SES A;  4ZI7 B;  1VQ4 V;  5JJN B;  1NVP D;  5CMU A;  3K59 A;  2HP8 A;  3ASO C;  4B3R B;  5EBM C;  2J7Q C;  2B1I A;  5LXT B;  2WWW A;  2IH3 C;  1EWO A;  4XZX A;  4MVQ A;  4XDJ A;  2QWN B;  4LF4 B;  3LSS A;  3AG3 C;  4GX1 A;  4AQY B;  3G4S V;  2VS0 A;  4X64 B;  3N2G B;  1OV9 A;  3JAW A;  4ZHQ A;  2JIZ G;  4I50 B;  4N79 A;  4O4H A;  4IUM A;  3ZIA G;  3CEI A;  2GSM B;  2W0F C;  3JCU Z;  3H1I H;  4JAV A;  4O4L B;  4JI7 O;  3SPJ A;  4O2B A;  2AVW A;  3TRK A;  4F6R A;  1SER A;  3C90 A;  3ZHS A;  2ZR3 A;  2OZ2 A;  1AU0 A;  2M6Y A;  5AG2 A;  1VF7 A;  2H8P C;  2WLJ A;  3CRA A;  4X1Y B;  3B79 A;  4LFA O;  3LDC A;  5KHJ A;  1ME3 A;  3FX7 A;  1ORQ C;  2OP3 A;  2GDS A;  1NQT A;  3DSQ A;  4G2K A;  5LA6 B;  3RWR D;  3RGB A;  1GKF A;  5LP6 A;  3RYC A;  2DCA A;  4RF1 A;  1BP4 A;  3RW0 A;  5HFL A;  1WNS A;  2DWD C;  3SDL A;  3CPW U;  1STF E;  1M93 A;  1NBM G;  4D8E A;  3SJQ C;  5J2U A;  3MHH C;  5LHH A;  2HR3 A;  3ZMV A;  1XHZ A;  1AR1 B;  5A2Q N;  2FT2 A;  1T5E A;  4JI4 B;  4KUM A;  4DRX B;  4I9W A;  2A3Q A;  1AI5 A;  1B06 A;  3CCE V;  1X4T A;  5J2T A;  2LP7 A;  1IDS A;  4MVR A;  2DQ3 A;  2OTL V;  3R66 A;  2HJF C;  4FFK A;  4DR7 O;  4RY2 A;  2Q7G A;  2IU3 A;  4J11 A;  4TOI A;  2QWQ B;  1W0J G;  5IYB O;  4FLW A;  2YXH A;  1FXK A;  2RN9 A;  4GYC B;  3CB2 A;  1YXB A;  3ML0 A;  3WXG A;  1OCO C;  4FLX A;  5JCO C;  3IHP A;  2ZQM A;  1MSW D;  1KXR A;  4Z1V A;  4DV6 B;  1F29 A;  2BTQ A;  3A0B Z;  1PL0 A;  1AYU A;  1LUV A;  3U8E A;  3GVM A;  1PD3 A;  3SPG A;  4R7C A;  5IJ0 A;  2DZZ A;  2P6J A;  4DUZ B;  2ATO A;  4D8I A;  3THO A;  3W7T A;  3AG7 A;  1Q7Y W;  1TUB A;  1H2S B;  4PDV A;  3E8H A;  1S5H C;  1VF6 C;  3KKY A;  3PNR A;  5IYD O;  2DC8 A;  2NQI A;  4JTA B;  3BY6 A;  4MT8 A;  2B1M A;  5EF4 A;  2CTW A;  3CE2 A;  2OUL A;  4DR5 O;  4OPH A;  5L3D A;  1O9G A;  2QGN A;  5H5N A;  3ZNH A;  4JI6 B;  5LYJ A;  4X66 B;  4M0W A;  2ITD C;  1N36 B;  5F02 A;  2EBO A;  2YID A;  4HYO A;  1ATK A;  1Y67 A;  4IGG A;  2OYQ A;  4FLU A;  3J81 N;  3ZUA A;  4GCZ A;  4W5C A;  2P22 C;  4RKX A;  1XOU A;  1QCE A;  5E1A C;  1VQ8 V;  5L3G A;  5EZS A;  5L3C A;  6PAD A;  2FML A;  2HVJ C;  1FH0 A;  4JI1 B;  2EIM B;  2UUA O;  4A5U B;  2YXY A;  5B1B B;  2UXB B;  2LGW A;  1CP9 A;  1KYO F;  3TET A;  4FM1 A;  1IUR A;  2HJD A;  8PCH A;  2FUD A;  1OJH A;  4DV0 B;  4MVM A;  3AK1 A;  4PA9 A;  4PHZ A;  1K4D C;  3HKB B;  4X1K B;  5FPO A;  1K7D A;  5GTI Z;  3S3Q A;  4LF8 O;  1VP7 A;  3JSL A;  1YCI A;  3RYI A;  2BOB C;  4UCR A;  1NTK H;  4IYH A;  4U7N A;  4DR4 B;  1GN4 A;  4E4E A;  4AQY O;  1ARO P;  1I7F A;  4UFZ A;  2YDE A;  4WFG A;  2UUC B;  3AG2 B;  4HNA A;  1ZAU A;  2QKC A;  5H6Q A;  2JVD A;  1Y74 B;  3ASN B;  4FPP A;  5LMU B;  4DMY A;  2AHY A;  1DEU A;  1DLB A;  3H01 A;  4PJ0 Z;  1VQM V;  2OT5 A;  1Q6K A;  1BGO A;  3P3P A;  1MG1 A;  3IGA C;  2R6N A;  2R9O A;  4CDF B;  3PJS K;  4LF9 O;  4FK5 A;  2H3O A;  4QE9 A;  3TXQ A;  3E35 A; 
#chains in the Genus database with same CATH homology
 3OTO O;  2J7Q C;  4D8I A;  5JZE A;  4X64 O;  5FLX N;  3T1H O;  4K0K O;  4LF5 O;  1FJG O;  5IT9 N;  4A5U A;  2DOS A;  1UKF A;  4XZX A;  4JI5 O;  3J80 N;  3BB7 A;  2Z84 A;  4B3S O;  3PRM A;  4DV4 O;  2UXD O;  1N32 O;  4JI6 O;  4DR5 O;  4OPH A;  4DUZ O;  3W30 A;  4D8B A;  2ZM6 O;  4JI3 O;  1R6T A;  2BU3 A;  1HR0 O;  2DJV A;  4DR6 O;  4RNA A;  2Z0A A;  3JAM N;  4DR3 O;  4REZ A;  4P16 A;  4IUM A;  3RNV A;  4YY3 O;  5H5N A;  3ZNH A;  2UXB O;  4X62 O;  2HHH O;  3PT2 A;  4LF6 O;  4JI7 O;  4LFC O;  3TMP A;  4OX9 O;  4M0W A;  1G1X B;  1PVJ A;  2UU9 O;  3MP2 A;  3TRK A;  4BOQ A;  5IWA O;  1A32 A;  1I94 O;  1N34 O;  1XNQ O;  4JYA O;  4GKJ O;  1D2D A;  4OVZ A;  4BOZ A;  3J81 N;  3PHU A;  2FE8 A;  4MM3 B;  4DR2 O;  5LMN O;  2HWK A;  5EZQ A;  4RKX A;  5BR8 O;  5LL6 Y;  3PSE A;  1HNW O;  3IFU A;  5EZS A;  4JI2 O;  4LFA O;  1AIL A;  3BY4 A;  3BBA A;  3PHX A;  1YZB A;  4OPA A;  4X65 O;  4DR1 O;  1DKI A;  4BOU A;  4DV0 O;  4MI7 A;  4KHP O;  3J7A U;  4RF1 A;  3MTV A;  3C0R A;  4B3T O;  2AGA A;  4DV5 O;  4A5U B;  1FKA O;  2UUA O;  5E6J A;  3SDL A;  3RT3 C;  5BY1 A;  2UUC O;  2UUB O;  4LF7 O;  4BOS A;  2BTW B;  4D8E A;  3PHW A;  1N33 O;  2JTC A;  4JI8 O;  4B3R O;  1X59 A;  4JI1 O;  2ZKO A;  2LW7 A;  4JI0 O;  4DUY O;  2UXC O;  4GUA A;  1N36 O;  1XMQ O;  5A2Q N;  4PT5 A;  4NXN O;  4DV3 O;  4DV6 O;  3T1Y O;  3F5T A;  2JRI A;  4LF8 O;  2F4V O;  4B3M O;  5KO3 A;  4WUR A;  2FKX A;  2J7Q A;  1HNX O;  4YHH O;  4GKK O;  3R66 A;  5BXZ A;  1KUQ A;  4HXD B;  1R1B A;  4DR7 O;  2UZJ A;  4LFB O;  4AQY O;  4DV1 O;  4OVZ B;  4JV5 O;  1IBM O;  1AB3 A;  4ZTB A;  4X66 O;  3O65 A;  1IBK O;  1XMO O;  3PRP A;  4DV2 O;  2E5L O;  3W31 A;  2VQF O;  4DR4 O;  1F7Y A;  1HNZ O;  1NS1 A;  1IBL O;  4DV7 O;  1XNR O;  4NXM O;  4RF0 A;  3MJ5 A;  3OQC A;  3M8A A;  3B21 A;  1J5E O;  4JI4 O;  3E9S A;  4BOP A;  4R3D A;  4LF9 O;  2VQE O;  4IP3 A;  2BTW A;  1XEQ A;  2N74 A;  5LMU O;  1DK1 A;  1FYJ A;  4OW0 A;  4LF4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...