2JRIA

Solution structure of the josephin domain of ataxin-3 in complex with ubiquitin molecule.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein
molecule keywords Ataxin-3
publication title Understanding the plasticity of the ubiquitin-protein recognition code: the josephin domain of ataxin-3 is a diubiquitin binding motif
rcsb
source organism Homo sapiens
total genus 44
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2jriA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2jriA01
5LL6Y 1KUQA 4A5UB 1AB3A 4DV4O 2VQEO 3RT3C 4B3MO 4LF7O 4JI5O 1DK1A 2ZM6O 1F7YA 4JI1O 4X64O 5A2QN 3O65A 4OX9O 1D2DA 5FLXN 1R6TA 3JAMN 4LF8O 4JI0O 5IT9N 4DV3O 1YZBA 4DV7O 3R66A 4AQYO 1N34O 4DV5O 4K0KO 3J81N 4GKKO 1AILA 2JRIA 4JI3O 4OPAA 4DR3O 3F5TA 2DOSA 4DR1O 4B3SO 3J7AU 4JI8O 4JI4O 4NXNO 4JI2O 1XNRO 1N36O 1XNQO 5LMNO 4LF4O 4LFBO 1J5EO 4LFAO 1A32A 1IBMO 4JI7O 3M8AA 2UXDO 4DR4O 4X62O 2VQFO 5BXZA 3SDLA 2UU9O 1HNWO 1N33O 1IBLO 2HHHO 4DR6O 4LF6O 4DR7O 2UXCO 3T1HO 4YY3O 1FJGO 2FKXA 4B3RO 2Z0AA 4X66O 1NS1A 2E5LO 1XEQA 3J80N 5H5NA 1X59A 4JYAO 5BR8O 4DV1O 3OTOO 4B3TO 4JI6O 2UXBO 1FKAO 1XMOO 2UUCO 1G1XB 4X65O 5LMUO 1N32O 1HR0O 4LF5O 4LF9O 1XMQO 4GKJO 4DUZO 1I94O 2LW7A 4DV2O 4NXMO 2ZKOA 1FYJA 2N74A 2AGAA 4DR5O 2UUBO 1IBKO 4DV0O 4DR2O 4JV5O 3T1YO 1HNZO 4LFCO 2DJVA 5IWAO 5BY1A 2UUAO 4DUYO 4KHPO 4DV6O 2F4VO 1R1BA 4OPHA 1HNXO 4YHHO
chains in the Genus database with same CATH superfamily
1ICFA 3MP2A 4OELA 1OHHG 1Z2GA 2NR5A 9PAPA 1NVPD 5CVNB 3K5MA 1AI5A 2HHNA 3BPFA 3K59A 1VMGA 1D5AA 4CC5A 1XOUA 1GN4A 3AK2A 3QNEA 4R50A 4CDEB 3BHPA 5JZEA 2EILC 3USVA 3HPLC 1ZTEA 4FVMA 3PJSK 2GHYA 2Y0IA 4I55B 4XBFA 1NR1A 4K0KO 4CZZA 5JJNB 2BCCH 4OPAA 2HWKA 4NTWA 4P6EA 1NTMH 2E76B 2P4VA 5EZYB 1TU6A 2R9AA 3ZNHA 4J7KA 3LNNA 3UO2A 3KKYA 5IYCO 2LQTA 4CBCA 4Z1MG 5DEDA 3B77A 3ABMC 3ZRXA 4JAUA 3F75A 3C3SA 2QKAA 1Y4HA 3JSNA 1AJPA 3JCZA 3LNMB 2FTDA 4OW0A 3KFQA 1WLEA 4TV8B 3RN4A 4NXNB 3AG3B 4B3RO 1RPOA 2YUAA 3JD0A 1JFFA 3FB5C 3GWOA 5CBFA 2JJ2G 5F2VO 2E5LO 1XEQA 3AK1A 1IBMB 4OXSA 3FB8C 4ZI7A 1Q81W 3WXEA 1OCRC 3D36C 5B1AC 1Y4MA 1BE3H 1TGOA 3JD1A 4PI0A 3CD6V 3PN1A 3F7YC 4YY3B 2DE0X 3T2MA 4NVPA 1Q7YW 4NXMO 4X1YA 4BIOA 4MT8A 4I5SA 3LDEA 4FM2A 3N4CA 3B79A 2DJVA 3M99A 3FD9A 2UUAO 2FRQA 4K8ZA 4YYQA 4YHHO 3KCYA 3L71H 3ZHRA 1MABG 5LL6Y 1N32B 3IEJA 1KP2A 5LBQA 4X89A 4DUZB 3CCEV 1U97A 2CK3G 5L3CA 1DK1A 4K8XA 2WLKA 1OCZB 1RSOA 4X1KA 4YIPA 3C9EA 3LSQA 1ZWIC 4HYOA 2PF4E 4BW9A 1PBHA 1VQ8V 1BS3A 5IT9N 3DF0A 4GX1A 4DV3O 3F5WC 1VF5B 1BCCH 3OGCC 3JD4A 5KHHA 3KW9A 3RVZA 4CS4A 3PDFA 5K1XA 4MI7A 4G2KA 1K9MW 1W0KG 4JI3O 2E03A 3P30A 3J7AU 1MIRA 3G4SV 4JI8O 1IDSA 1JFFB 1ZL8A 3DGEA 1H8HG 1VQLV 1NKDA 3IFXA 3ZRWB 5EC2C 2ZINA 4MS2A 5EZSA 2Q7EA 4JI7O 4ZI7B 2NQAA 4LH6A 4DR4O 5LHHA 5BXZA 2YXLA 4YHHB 2IPPB 2NQGA 2YEVA 4YYWA 3FB6C 2IW5A 4X6JA 1YK8A 1IBLO 2HHHO 1PIPA 3HB3B 4D8IA 3HKBA 4UVAA 2DW4A 4X1YB 4JI4B 2YJ8A 3A2FA 2WBFX 3A0BZ 3MTNA 3JCUZ 3M99B 4IHJA 2ZE7A 1Q6UA 1L1FA 2VQFB 2XU1A 3GB7C 4UCSA 2WWWA 4RY2A 2X0LA 4DV1O 1AP6A 3FYEB 5LMUO 4IGGA 5DM6V 2JIZG 2W0FC 1UJWB 1FJGB 5JVDA 1LUWA 1NVPB 3BCNA 4UVBA 3DXRA 1IBKO 1XHXA 1RSOB 4X1KB 1COWG 1URFA 4AXMA 2AS8A 5JJEB 5JCOA 2DQ3A 1RM1C 4XDJA 1BQ0A 3K9AA 1OCOC 2CDYA 2UUCB 2YJ9A 3CRAA 1VQ9V 2Q69A 1XMQB 2F7DA 3MTVA 2WSSG 3H8CA 1STFE 2VQEO 4D8BA 1US6A 3ZHUA 2W6IG 1BT8A 4EKWA 3WB0A 1DKIA 4X64O 5A2QN 1ZL8B 4LFCB 1H8EG 5IWAB 2DYSB 5K16A 1R6TA 4KHPB 4LF8O 4CDDB 1YK7A 4CH4A 1XL4A 2YEVB 1W59A 2F66C 4AQYO 1IXBA 4DV1B 2CTQA 2QWOB 2GV9A 2XAGA 4FIPC 1FXHA 4CC6A 4YYRA 4N23A 4QNHB 4BOZA 4PDRA 4PP1A 5GW7A 1ME3A 3HKBB 3CRRA 4TT3G 4KXRA 4QRVA 1N4CA 3ZUAA 1SP4B 5LHGA 2G8JA 4QE9A 1YALA 4IHJB 3EVKA 1R3KC 1LNQA 5HFLA 4LFAO 2MK3A 4BOSA 1Q6HA 1QBZA 3VQWA 2UXDO 3MHHC 2FMLA 5EGWA 3KCXA 2UU9O 3TNXA 2AYOA 1S4VA 2GSMB 4AILC 4J9ZB 3H9VA 2JDIG 3E86A 4MVMA 3LFYA 2GTSA 4DMXA 2GFOA 2EIKB 3CS5A 2KSDA 5JVDB 3UM7A 2FRAA 3DXRB 3EFFK 2RJZA 4P6GA 3CMAV 1AI4A 1T5EA 1XDCA 1AI7A 3SYCA 1B06A 1H2SB 2PYJA 2PZSA 4W5BA 4IL6Z 1VARA 3BFRA 4JGSA 4JI6O 2UXBO 2YXYA 1K8AW 4X65O 4CDFB 2Y69B 5GTIZ 4DK1A 2DJFB 2H94A 1NT2B 1XI1A 1FXKA 2Q0AA 4PP2E 3OUSA 2EIMB 4DV0O 1XKGA 1OCCC 4O2AA 3WFVA 1CPJA 4JYBA 4LBEC 4DV6O 2QEXV 2ODMA 3CBJA 4MTFA 2JS3A 3RYIA 3ZN1A 2UXDB 1QU7A 1TUEB 4RAIA 1NQTA 3ABLB 1FFXA 1FH0A 1VQMV 3KX1A 4PA4A 3JD2A 3RT3C 4YYUA 4RF1A 4H0LB 1EWPA 1CV8A 3AG2C 3W7WA 3OMIB 4PADA 2XAHA 3BB7A 1GM9A 3RVWA 2LFSA 1FD9A 2EINB 2UXNA 1GO3F 3G6EV 2OCCC 3OMNB 3H89A 2ZT9B 2J7QC 1R3IC 3WB1A 1K73W 3OR6C 1NB3A 4B08A 3ZN0A 3AG7A 4Q20A 2BU3A 4QGPA 4GKKO 4A5UA 2YIBA 2YSUB 3W7XA 4P2ZA 3F5TA 2ZE6A 2B9ZA 3FAVA 1MA1A 2A79B 2H7JA 1UKFA 3B40A 4DV0B 3SJQC 3APOA 5EYPA 3HD3A 5B3SC 1MDWA 1B04A 4ZBMA 4AHCA 3LUTB 4PELA 3AG4C 1TVKA 2OYQA 1CTEA 3IHPA 2NQIA 5CMUA 4KL1A 1SRYA 3L74H 1WB7A 3OD4A 4HWYA 2Y4UA 4JASA 4BQVA 2FO5A 1U96A 2YIAA 3N2GA 1J95A 3OR7C 2F95B 2QE7G 4B3SB 2BSKB 5KLVH 1FXKB 4X66O 2X6AA 5K1PA 4D8EA 2KQXA 1N36B 5LMNB 4O2AB 3A8TA 2JS5A 5KUMA 2R9MA 4FJCA 3RYIB 4X62B 4JTAB 5J2UA 2HH5A 2P4KA 3BEHA 1FFXB 5KO3A 5CHTA 5IJ9A 1SERA 4GKKB 1YDXA 1QR8A 1EBOA 4BSQA 4I7ZB 3EHBB 4OEMA 4BIUA 2DC8A 1IX9A 3KZIZ 2ITDC 1P49A 2ZKOA 2AXTZ 4PDVA 5F02A 3BPMA 4QRGA 5EK0A 4X88A 5CN0A 2XOKG 5CA1A 1HNZO 1AYUA 5KMGA 1V9PA 4MZOA 4RUFA 2R6NA 3K9SA 1YJWV 4YVAA 1XILA 2YDEA 3U8EA 2EBOA 4LF5B 4A5UB 2XU5A 4H44B 4O4JA 1AVMA 4GUAA 4B3MO 3FAVB 4FLVA 2AZ2A 2ILMA 4BWAA 3ZEDA 2UUBB 2ZM6O 4X66B 2H8PC 4O2BA 1OJHA 1DLBA 1YVWA 3E8FA 4NR1A 5EYPB 2ZCEA 3JYCA 3UQ8A 1TVKB 3BPZA 4PA7A 4UFZA 1PXVA 2BTWA 3K79A 4N21A 4N4ZA 3N2GB 1WPXA 1EFRG 2HVJC 1VSNA 5A9GA 4B7EA 3C90A 2GHUA 4OX9B 1ZLZA 2EULA 3BBAA 1RP3B 3RNVA 3S3QA 3B09A 5ITZA 4DV5B 4PJ0Z 5IJ9B 1SETA 3IC7A 3LDDA 1BHBA 3OUFA 4DR7O 2DYRB 1XREA 1SQXH 2QKCA 2AUZA 5HFMA 3S3XA 4JI2B 3PBHA 3WB2A 1Q6IA 3P5WA 1NPZA 1U9VA 4FIPA 5CA1B 5E6JA 1KC8W 3G80A 1AYVA 1J5EB 5KMGB 1AR4A 4EFEA 5H5NA 2AHYA 1SESA 1X59A 3BY6A 5DECA 4MVOA 5EBWC 4WFAV 3OTOO 4DR6B 5BMVB 1NB5A 4TV9A 1Q3EA 2ETNA 4O4JB 2ZXWC 1K4CC 4ZTBA 1AJQA 2XNDG 3MHHA 3E8GA 1Y66A 2Y4TA 4O2BB 1LR1A 3HKEA 1ATKA 5L3DA 1KD1W 4JF3A 4W4KA 3TXQA 2JGDA 2ATKC 1KFXL 1R1BA 1S76D 1M6DA 4AXLA 2BTWB 3ERVA 1MMMA 3S3RA 1RM1B 4GZRB 1BHAA 1OCOB 1KHPA 3SPHA 1JJOA 1F7YA 3SJAC 3I3TA 1SQGA 1NLJA 3B8MA 2BTQA 3T1YB 4O4LA 4QPJA 3K08A 2E75B 3ML0A 2F4VB 3QF7A 4PDMA 3ASOC 1L0LH 2DQ0A 3QVNA 4PA9A 1K5SA 4PA6A 1R6NA 5ITZB 3OMAB 1M57C 2LFRA 3M7MX 3PRPA 4UXNA 4BR6A 2BOCC 1MZEA 4R3DA 2JRIA 3N3KA 4E4EA 1L8DA 1MEGA 2RNBA 3ZHQA 4JI1B 4NXNO 3RYHA 5H2FZ 1TUBA 3A0RA 4TSFG 4LFBO 2HJFC 2B5UA 2P0RA 4W4UA 1H2MA 1ZIVA 3H1JH 1IBMO 5EIBC 5JH3A 3L72H 2N04A 1MS6A 2LW1A 1DTOA 2QSAA 4JAAA 3WG7C 2CTPA 4J80A 1GK9A 4Q8GA 2MW2B 4TV9B 3JASA 3RYFA 1E1RG 3T1HO 1Q90D 4YY3O 3CCQV 1PCIA 2BOBC 4H13B 3RVVA 4ZUXU 3L70H 4TWKA 2Q8VA 4GUNA 3HKEB 1XNQB 2QM7A 1Z5WA 4LF4B 1VQ6V 2PADA 1K33A 3CEIA 3TMPA 1BQIA 2JGDB 3J80N 1K3BB 2B1IA 2KG7A 3W7UA 4PA3A 4MTOA 2YS8A 3NR7A 4I50A 4BAYA 1N32O 2PNSA 1FFTB 4WFHA 4L8JA 5LGUA 4DYLA 3ZMZA 1ZUQA 5KA6A 4DUZO 3LXSA 2AUXA 1NTZH 4LH7A 2Q7HA 1PNMA 1E79G 2FE8A 2BTQB 5H9CA 3MJ5A 4O4LB 3MAQA 1GMGA 2JGUA 4LFBB 1NTKH 2Y5BA 2RN9A 2YI9A 5LA6A 1Y6XA 3P32A 4JYAB 2DC9A 2UXXA 5EC1C 3ZHVA 4QE7A 1K92A 1Y74A 2AHZA 2BE3A 3FFQA 5CVMA 1QVGU 4U3JA 3T1HB 4B7KA 4DR5B 1NL6A 3RYHB 1MEMA 1PPJH 1TUBB 2PREA 1RFYA 4TUYA 2EIJC 3T1CA 2IH1C 2YI8A 1SQFA 4RO2A 2QM8A 1ITOA 2A0LA 5J2TA 1M9NA 4R7CA 2ZR2A 2M7WA 2IU3A 3L73H 2FTKA 3SPJA 3H8BA 3E22A 2R9OA 3IV2A 4MW3A 5JJJB 3CP1A 3JASB 3P3NA 4XUIA 4XDLA 3RYFB 2OCCB 2YJBA 3UKMA 3BCCH 3QG5A 4JI4O 4UCRA 1YVBA 4WFGA 2R72A 1DF5A 2ZE8A 2HEPA 2YJ2A 1M56C 4MVUA 5B1NA 1HP8A 1VF7A 1VQ7V 4RF0A 1S3JA 5LHIA 4YJ2A 3L9DA 2VQFO 2KG7B 2JK5C 2OWOA 3E35A 4MVQA 4E2LA 4I50B 4UCTA 3TK1A 4OVZA 4PI3A 5B3SB 3P5UA 3AG4B 4XR7A 1FJGO 3ASNC 3I06A 5L3BA 1PPPA 3DTUB 2XU4A 3CX5F 3BC3A 5LYJA 3K5OA 4UVCA 4BS5A 3AK3A 2CIOA 4UCOA 5LA6B 3ZRVA 1V54C 1K4DC 1R73A 1WA8A 1N33B 2AIMA 1FKAO 2UUCO 4LF6B 1Y74B 1XMQO 3UO3A 2FYEA 4U3JB 1KKCA 1CVZA 5EIBD 2Z5UA 1AECA 1XQ8A 1VQOV 2Q5ZA 4WA6A 4TUYB 4LFCO 7PCKA 4G27B 5IWAO 2P7UA 4KHPO 1BL8A 4LWSA 3H1KH 5J2TB 1VQPV 1I5YA 4NTXA 4GX5A 5B1OA 4JZ2A 2C0YA 3E22B 4FLTA 1KUQA 2P5OA 3KWBX 4DV2B 1YSCA 3CH3X 4GX0A 3PW3A 2GBOA 3HHAA 5IY5B 1Y08A 3WU2Z 2XT9A 1PV0A 4W5CA 2XHBA 4BW5A 1HNXB 4YJ2B 2VWJA 4QJFB 2DCAA 2Z3YA 3CCJV 1R3JC 2QGNA 1AU2A 2Q7GA 1POPA 4PDLA 4I4TA 3OF8A 4OVZB 1X9YA 3HHIA 3QSDA 3CCMV 5LYJB 1S72V 1BP4A 2D3OW 1NH2D 3O0UA 4JI0B 2WLJA 1BQZA 4NB5A 1NQCA 4DV7B 5EBMC 2WLNA 1P7BA 2ACTA 1WA8B 4LR3A 4C7UA 4IT5A 4RKXA 4XZXA 3ABKB 2FUDA 1GECE 3U0ZA 1JPXA 1NR7A 1K3EA 2YIBD 1GTOA 1YT7A 4DR1B 1THEA 3BA8A 3LSSA 5CVOB 2NN4A 3PHUA 3BY4A 1PPDA 3RWRD 2GTAA 1VQ4V 1XNRB 2LP7A 2M6YA 2HP8A 3OM3B 1NS1A 1JQ0A 4WFBV 1U9QX 1SA0A 5H6QA 4LWSB 3P3PA 2E01A 2WLMA 2A7WA 2D2CB 1VF6C 4G54A 3CC2V 1I5XA 1E1QG 2QTSA 3I55V 2A3QA 2WLIA 1MOFA 4AI8A 3ZX6A 1MHWA 4X6HA 3SYPA 1BGOA 1CJLA 1FS0G 2IJJA 2L35A 4DR2O 3G6BA 2R9RB 4JTDB 1DF4A 4FLYA 2ZXWB 1U9XA 2E3CA 3V6EA 3W7SA 1JCHA 3K0DA 4YIOA 5BR8B 3SYQA 1F4NA 5B66Z 1HR0B 4I4TB 1AB3A 4IYIA 4TOIA 4U7OA 4FLWA 1CQDA 4R6ZA 3ZRSA 3CYOA 3H6SA 5IE9A 1N0NA 1H2KA 2XTAA 3L75H 1Z5VA 4WBNA 2HFEC 2F93B 2FQ9A 2PI4A 3QT4A 4IIJA 1K34A 3W31A 3AG3C 3K03A 3IC9A 5E1AC 4KFMA 1AYWA 4O4HA 5IYBO 5J9PC 4DR3O 4IYHA 4LF7B 2DOSA 4JI5B 4MZSA 4B3SO 2P90A 3D36A 1GH6A 1VJVA 2QR4A 3ABUA 1M57B 1PADA 2R70A 4DR2B 1BMFG 1N36O 4UCVA 5IDJA 3K8UA 5LMNO 3P5VA 1AROP 1SA0B 2FT2A 3ZMTA 3K24A 2XASA 3U11A 3E1ZB 4X62O 1VIBA 3DC6A 2P6JA 2PYLA 2N05A 2V4DA 1SS3A 2WLIB 1JA8A 1JJ2U 4L87A 3JALA 1DF0A 3ETGA 2EILB 2FYUH 3VOUA 5LGNA 2ATOA 3WG7B 1Y67A 1Y76A 2OTLV 4H37A 4ABMA 4FLXA 1PL4A 4FZ0A 5FNVA 1F2BA 3DC5A 4LCUC 2OCHA 1OCZC 3X2QC 4RQFA 1HNWB 3K5LA 4LF5O 4FMTA 4FK5C 1MG1A 4X1IA 1AU0A 5LGTA 4DR3B 5CBGA 2GDSA 2YIDA 3TJTA 3ABMB 1YI2V 4KLBA 4M0WA 4EEQA 3O1GA 2UUBO 4PD4F 1KBHA 2PI5A 1YCIA 4WBNB 1DGSA 2P86A 4IIJB 2VHSA 3VBBA 1OV9A 4OPHA 1S0VA 1TAEA 2ARHA 4B3TB 3OE7G 1XMOB 2ZNIA 3K58A 4O4HB 2O6XA 4GKJB 4WFFA 4DW1A 1AR5A 1PP9H 3CCRV 1OCRB 5B1AB 2WLHA 4JV5B 4W4LA 4OX9O 5CHVA 1WB8A 4CDCB 5FLXN 1NH2B 3CH2X 2HVKC 4GCZA 2HJDA 2RDCA 3RYCA 3SPCA 1YZBA 5KHGA 3KWZA 1U5IA 5FL7G 1PNLA 4YXWG 1EZVH 4DV5O 3FB7C 3SYOA 4I9QA 3JALB 4ICGA 1O9GA 4CS3A 3H01A 2FB5A 4JI2O 5GTHZ 1Y76B 5L3EA 2R9NA 2EZOA 1CP9A 1MNGA 3PHWA 1O9HA 3D3QA 5FNVB 1J5EO 1WP8A 4IUMA 5D5PA 4UCUA 1W0JG 2CUGA 4MVZA 2OT5A 3ICXA 2CE4A 3TXSA 4DR6O 4CH3A 4MTXA 1M56B 1FPOA 3JAWA 4X1IB 3BVOA 3CCUV 4P16A 5A24A 4X9QA 3PRMA 2Z0AA 1ORQC 2DMXA 2IM9A 1VEWA 1SKVA 3ASNB 2AVWA 1CEZA 1XBLA 1VQNV 5J2UB 2YC0A 4J42A 2OP3A 2DWEC 4I9WA 5PADA 2A06H 3SPIA 3W7TA 3E9SA 4JAVA 1QHTA 3T1YO 2KKWA 3PNRA 3B4SA 2R9IA 1PPOA 2XAQA 2F4VO 1I7FA 3CHXA 1PE6A 1EN4A 3RYCB 1GN2A 3BA9A 1SQPH 2RMKB 3OAAG 3ETQA 4UV9A 2HR3A 1BSMA 1PPNA 2Z84A 1I94B 3CWBH 1NJIW 3IFUA 4I05A 2WAMA 4JI1O 1QNMA 3F5VA 1WAZA 3CPWU 1IWDA 4G28B 2K1EA 5KHJA 4DUYB 1CPYA 2EIKC 2P06A 2CTRA 2YJCA 4IP3A 3K5NA 5CA0A 3CC4V 2ADPA 2HLDG 1GLOA 3ZIAG 1CSBB 5B5EZ 1AILA 1S5LZ 3BAAA 3B21A 4P30A 4HBNA 4DV4B 3JAWB 3WXFA 1IZ3A 3G67A 5E79Z 3STLC 5C93A 4LP8A 3HKCA 1GKFA 4X8AA 4UUJC 1XNQO 3TCUA 3GVMA 1P4RA 2OIGA 4LF4O 1Q82W 3CRQA 1V55C 1A32A 5KUKA 2LGWA 2EX3A 4QBBA 2BTOA 4CZWA 4YYSA 3OW2U 2G6DA 2IJKA 3AG1C 1QDQA 3SR2C 5BZBA 4DK0A 4WCEV 5GONA 1SZXA 4ZHQA 4QPKA 3K04A 4MTGA 2R9CA 3H1IH 1EF7A 4DMYA 1YEWA 4TQFA 3N2KA 3CC7V 3GWKC 1KQSU 1X4TA 2GUZA 4K35A 3D8CA 1WNSA 3ABTA 2QWQB 1EWMA 1H2NA 3UCSC 3CSXA 4WFEA 4JYAO 4FM0A 5IYDO 2AZ0A 2QDOA 2UXCB 2EINC 1VP7A 2ZQMA 4P9PA 2JTCA 2LW7A 2J7QA 4MSWC 4DR5O 5KAIZ 1SF9A 1ENVA 3SYAA 2ZD9A 3ZMUA 4TQDA 1ROPA 4N8WA 4YYVA 4PV1B 3JD3A 5CA0B 5DN6G 3APQA 1YTFB 1GN6A 1KFUL 5KX5A 4LF9B 1GCBA 2B1GA 1IURA 3CCVV 1AIMA 5IYZA 3HKCB 1YF2A 4RUEA 3ZMVA 4U7NA 3BOWA 3Q4HA 4RWUA 2QKSA 3W30A 1D2DA 1KB9F 4FK5A 5FPRA 2HXZA 1ME4A 5CA3A 2PUSA 1GMYA 5LXTA 3OQCA 1KU9A 1FXKC 1UFIA 3QO5A 1OCCB 3J81N 1F29A 5GONB 4ZHQB 3FX7A 2NQDB 4HNAA 4REZA 2CH7A 3JSLA 3N2KB 3KG2A 1K7DA 3ZRWA 2GUZB 3I5DA 4RQEA 2HKOA 1SZTA 2LJ2A 1JR9A 4BOUA 3AG2B 2P7TC 1PD3A 2DWDC 3OT7A 4DXWA 4K0KB 2Y6EA 1N33O 1DEUA 4Z2WA 2DC6A 4LF6O 4N79A 4J11A 2CB5A 4MVRA 2X7RB 6PADA 3S3WA 3IOQA 8PCHA 1BZKA 2CGNA 2JQGR 1S5HC 4MW8A 3ETEA 5KX5B 2OTJV 4X20A 1Q86W 2IJHA 3FYIB 5IYZB 4DV2O 4B3RB 2AGAA 4I0XA 3X2QB 3Q4HB 3OEHG 3VQVA 2EJRA 3DSQA 3MHSC 1BY8A 2E5LB 2JEUA 4P9OA 1SQQH 3TRKA 5LXTB 3CJHA 5JA7A 3MORA 4JPRA 2G8EA 1GM7A 2ADQB 1HNXO 1KP3A 4CS2A 3RVYA 2IJIA 3ZCCA 4ASUG 3NXSA 3IAYA 4F6RA 4HNAB 1SQBH 2CH7B 3PHXA 4FJCC 4FFBA 1JVMA 5EBLC 4NXMB 4D7TA 2V1DA 5B1BC 3JARA 3O65A 4LNUA 2DYRC 5AG2A 2UUAB 5KHIA 4D7SA 4JI0O 1PM9A 2Q9LA 1S77D 4BOPA 2AYNA 2NNUA 3SGIA 1AI6A 3MDSA 4DV7O 1IXMA 3OEEG 4BS6A 1ZCMA 1QLEC 1Q5OA 1XHZA 2JJ1G 2XUMA 2QWPB 5KA5A 3CRMA 4DR1O 3RBZA 5KAFZ 3OVXA 1XNRO 2QTOA 1NBMG 4DV3B 1PNKA 1M4UA 4BIZA 4WF9V 2HG5C 3JAKA 5LP6C 3HWNA 2G7YA 1M5IA 3CBKA 1IVSA 2PGGA 5EF4A 4JI3B 3OTFA 4X20B 3K9MA 5D5QA 3CXHF 1ZX3A 4JI8B 4KUMA 2FKXA 3WXGA 4I0XB 3CXCU 3CCLV 1KXRA 1PL0A 3OVZA 5LOVA 4NKGB 5CB4A 1BGYH 2WPDG 3T4ZA 4DW0A 2F23A 4FLZA 4JI7B 1KMIZ 3CJHB 3OISA 2VWKA 4DR4B 2AU1A 1QCEA 2DZZA 1ZAUA 1N0JA 1F51A 5BR8O 2BDLA 1IBLB 1D5NA 2HHHB 3O9OA 3IMAA 1HR0O 5JQGA 2L6LA 4F6RB 3CB2A 4FFBB 1YHQV 1FYJA 3JARB 2BDZA 1RPRA 4Z1VA 4LNUB 2Q6AA 3B8NA 3CCSV 3KSEA 3C3TA 3AEIA 4JZGA 1F2CA 3RW0A 3LDCA 3TETA 4O4IA 5LMUB 4ZOLA 2G38A 3D3IA 4LF7O 2ITCC 4JI5O 2F43G 2PBHA 2QJ1A 1IBKB 1HWYA 2ZDIC 2CAZC 4NTYA 2IBZH 1P7GA 1CXZB 1LUVA 4ZIBA 1K97A 1Q43A 3JAMN 3QO7A 3TGUH 4DRXA 4WURA 1UPGA 3QTCA 3IGAC 4GLXA 4KP4A 2P67A 2V7QG 2VRZA 1PVJA 3JAKB 3LSUA 3R66A 3H7DA 1F4MA 1SC5B 4D6TH 3HKDA 1SQVH 4UB8Z 2VQEB 4MM3B 1NZ6A 3BWKA 3V6CA 1H2GA 4OGQB 1M90W 1ZSPA 2X6CA 2XAFA 1WJZA 2RCVA 4FPPA 1HW7A 4X64B 2ZNJA 5LOVB 4Q6GA 5CB4B 1F23A 2PTMA 3F7VC 4LF8B 3C0RA 2DCCA 4PT5A 1Q6KA 5J94A 4GT1A 3U10A 3K0GA 2Y0PA 4AQYB 4YJ3A 3SDLA 1HNWO 5C8YA 4J7ZA 4ZKIA 5KHKA 3H1HH 5JWPA 5JQGB 3H1LH 1V55B 2BSKA 1I08A 3ASOB 1FXVA 4GYCB 3AG1B 3ZHSA 1QQCA 4J7JA 2WA3A 4H33A 1AU3A 1QVFU 1KKDA 4LFAB 1YXBA 4HXDB 3UT5A 1YITV 2B1MA 4F4LA 2UU9B 4O4IB 4B3TO 2F1MA 1XMOO 3SJCC 4FLUA 1G1XB 1WPBA 1TL9A 2PY5A 4ZOLB 4GKJO 2CGOA 4PHZA 3N3GA 5H6RA 2VHFA 1AU4A 1NU1H 1MSDA 2E74B 4JV5O 2B1NA 4BOQA 1TA8A 1B6QA 2DZYA 4DRXB 3ZJZA 4Q8HA 4FM1A 4JI6B 1KYOF 2UXBB 4X65B 2W0XA 3HKDB 1HDJA 5JH7A 3ETDA 2CTWA 2IH3C 2Q68A 2EJ7A 2O57A 1KHQA 1P84F 1YJNV 2Q4PA 4DV6B 4EFBA 1G4YB 1QR9A 1R3LC 1EM1A 3NHEA 3SJBC 3HR0A 2ZIMA 1JOYA 2XU3A 2C2AA 4YJ3B 1N8RW 2DJGB 2YICA 5C8YB 3MHSA 1L0NH 4K7CA 2VS0A 2DN9A 4K3AA 1TLOA 2R9FA 1EWOA 1FAFA 5FPOA 2HD5A 4GX2A 2LO1A 1M1KW 3R65A 3M8AA 3UT5B 1QLNA 1THZA 4JTCB 1YTFD 2DC7A 3A0HZ 2Q73A 4R8CA 3K06A 5EZQA 3STZC 2H3OA 1EN6A 2JVDA 1QOLA 1MZFA 4FFKA 2EIJB 3GCBA 4FZ1A 2UZJA 4UV8A 1R6KA 2QM4A 4MVSA 3E2EA 2WLLA 1F2AA 2ZE5A 3MD0A 1CS8A 3EXAA 1MSWD 1GM8A 4YV8A 4NYKA 1VQKV 2EZPA 3ZS8C 3FKSG 3E8BA 1U9WA 2E00A 3AI8A 3ZHTA 2DCBA 1XL6A 3IUTA 3QJ3A 2OULA 4BPVA 2DCDA 1QMYA 4J41A 2QWNB 5IY5C 5BMVA 3OGIB 1NI8A 5JH7B 3IJ4A 1I94O 2AW9A 1XUQA 5LP6A 4XDKA 3N27A 2Q67A 1AR1B 3BRCA 3BABA 3VQXA 1QXPA 3E89A 2E02A 4U3FH 3RVXA 4DUYO 3CRCA 4JYCA 2YXHA 1JQPA 2OIEA 4X6IA 1PKXA 2IBIA 1G8MA 1GRJA 3PT2A 1EN5A 2LGQA 2W6JG 5CBHA 2F1GA 3RFRA 3B2EE 5L3GA 2DYSC 4CH6A 2P22C 2XAJA 1AJNA 4DV4O 5IJ0A 4MSXA 1V54B 3K57A 2K9PA 1VQ5V 4QIWF 4EB6A 1M93A 3JATA 1HNZB 3ABKC 2ARYA 3T4DA 2Q0OC 4I07A 4CH5A 1JMKC 3RGBA 5B1BB 1GAXA 4HZ3A 1N34O 1I0HA 2JQFR 4B3MB 1WP7A 5FPWA 2WLLB 2ZM6B 4RNAA 1YIJV 1VF6A 3ZBHA 3OFNG 1QLEB 4PI2A 3KKUA 1KECA 2X6BA 3E8HA 1S5JA 1CB5A 1GN3A 1H38A 2ZDIA 1JX9A 2A9HA 2Y48A 4QRXA 3CE2A 1SNKA 2KB1A 4I55A 4QH6A 1G6UA 4LC1A 3SPGA 1EWLA 1A6RA 2UXCO 5JCOC 1H2LA 2ZR3A 1W2BU 1K5QA 1OZ0A 5LP6B 4HAMA 2RQ6A 5EZYA 1WN7A 2IU0A 3PSEA 3CMEV 4J10A 2NLJC 2Y69C 1B3QA 3THOA 2QWRB 3K3WA 4UB6Z 4F6EA 3ZMSA 2EIMC 4JYYA 1N34B 5L3FA 1AP5A 4DR7B 4LF9O 1Q8IA 1YJ9V 3P5XA 1O0EA 5IJ0B 4TV8A 2ZIOA 3E83A 2N74A 2JEXA 2OZ2A 3OF9A 2QA4V 4EB6B 3VQYA 3ABLC 1EZJA 3JATB 4J9YB 4DO2A 5BY1A 3D6SA 2FL4A 3I56V 4I04A 3G71V 5TISZ 1HUCB 2WA4A 3OTOB 3QO8A
chains in the Genus database with same CATH topology
3MP2A 5LL6Y 2BTWB 1KUQA 4A5UB 3MTVA 1AB3A 2Z84A 4DV4O 2VQEO 4D8BA 4GUAA 3RT3C 3PHXA 4B3MO 4LF7O 4RF1A 4JI5O 3IFUA 1DK1A 2ZM6O 1F7YA 4JI1O 1DKIA 4X64O 5A2QN 3BB7A 3W30A 3O65A 4OX9O 1D2DA 5FLXN 1R6TA 3JAMN 4LF8O 4JI0O 5IT9N 4BOPA 5JZEA 4WURA 3OQCA 3W31A 4DV3O 4IP3A 1PVJA 2J7QC 1YZBA 4DV7O 3R66A 4AQYO 1N34O 3PRPA 4DV5O 4K0KO 3J81N 2BU3A 2BTWA 4GKKO 1AILA 4MI7A 3B21A 4OVZB 4A5UA 4R3DA 2JRIA 4MM3B 4JI3O 4OPAA 4DR3O 2HWKA 4REZA 3F5TA 4BOZA 2DOSA 4DR1O 4B3SO 3J7AU 4JI8O 4JI4O 4NXNO 1UKFA 4RNAA 4JI2O 3ZNHA 1XNRO 1N36O 1XNQO 5LMNO 3C0RA 4LF4O 4PT5A 4LFBO 3BBAA 3PHWA 1J5EO 4LFAO 4RF0A 5EZSA 1A32A 3RNVA 1IBMO 4JI7O 4BOSA 3M8AA 4IUMA 2UXDO 4DR4O 4X62O 2VQFO 5BXZA 4BOUA 4RKXA 3SDLA 2UU9O 1HNWO 4XZXA 1N33O 5EZQA 1IBLO 2HHHO 4DR6O 4OVZA 4LF6O 4DR7O 2UZJA 2UXCO 4OW0A 3T1HO 4YY3O 1FJGO 4D8IA 4P16A 3PHUA 2FKXA 3BY4A 4B3RO 3PRMA 2Z0AA 4X66O 3PSEA 4D8EA 5E6JA 1NS1A 2E5LO 1XEQA 3TMPA 3J80N 5H5NA 4HXDB 1X59A 4JYAO 5BR8O 4DV1O 3OTOO 4B3TO 4JI6O 5KO3A 2UXBO 1FKAO 1XMOO 2UUCO 1G1XB 4X65O 5LMUO 1N32O 1HR0O 4LF5O 4LF9O 1XMQO 2JTCA 4GKJO 4DUZO 1I94O 4ZTBA 2LW7A 4DV2O 4NXMO 2ZKOA 1FYJA 2J7QA 3E9SA 2N74A 2AGAA 4M0WA 4DR5O 2UUBO 1IBKO 4DV0O 4DR2O 4JV5O 2FE8A 3T1YO 1HNZO 3MJ5A 4LFCO 2DJVA 5IWAO 4BOQA 5BY1A 2UUAO 4DUYO 4KHPO 4DV6O 2F4VO 3TRKA 1R1BA 3PT2A 4OPHA 1HNXO 4YHHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Y;  1KUQ A;  4A5U B;  1AB3 A;  4DV4 O;  2VQE O;  3RT3 C;  4B3M O;  4LF7 O;  4JI5 O;  1DK1 A;  2ZM6 O;  1F7Y A;  4JI1 O;  4X64 O;  5A2Q N;  3O65 A;  4OX9 O;  1D2D A;  5FLX N;  1R6T A;  3JAM N;  4LF8 O;  4JI0 O;  5IT9 N;  4DV3 O;  1YZB A;  4DV7 O;  3R66 A;  4AQY O;  1N34 O;  4DV5 O;  4K0K O;  3J81 N;  4GKK O;  1AIL A;  2JRI A;  4JI3 O;  4OPA A;  4DR3 O;  3F5T A;  2DOS A;  4DR1 O;  4B3S O;  3J7A U;  4JI8 O;  4JI4 O;  4NXN O;  4JI2 O;  1XNR O;  1N36 O;  1XNQ O;  5LMN O;  4LF4 O;  4LFB O;  1J5E O;  4LFA O;  1A32 A;  1IBM O;  4JI7 O;  3M8A A;  2UXD O;  4DR4 O;  4X62 O;  2VQF O;  5BXZ A;  3SDL A;  2UU9 O;  1HNW O;  1N33 O;  1IBL O;  2HHH O;  4DR6 O;  4LF6 O;  4DR7 O;  2UXC O;  3T1H O;  4YY3 O;  1FJG O;  2FKX A;  4B3R O;  2Z0A A;  4X66 O;  1NS1 A;  2E5L O;  1XEQ A;  3J80 N;  5H5N A;  1X59 A;  4JYA O;  5BR8 O;  4DV1 O;  3OTO O;  4B3T O;  4JI6 O;  2UXB O;  1FKA O;  1XMO O;  2UUC O;  1G1X B;  4X65 O;  5LMU O;  1N32 O;  1HR0 O;  4LF5 O;  4LF9 O;  1XMQ O;  4GKJ O;  4DUZ O;  1I94 O;  2LW7 A;  4DV2 O;  4NXM O;  2ZKO A;  1FYJ A;  2N74 A;  2AGA A;  4DR5 O;  2UUB O;  1IBK O;  4DV0 O;  4DR2 O;  4JV5 O;  3T1Y O;  1HNZ O;  4LFC O;  2DJV A;  5IWA O;  5BY1 A;  2UUA O;  4DUY O;  4KHP O;  4DV6 O;  2F4V O;  1R1B A;  4OPH A;  1HNX O;  4YHH O; 
#chains in the Genus database with same CATH topology
 1ICF A;  3MP2 A;  4OEL A;  1OHH G;  1Z2G A;  2NR5 A;  9PAP A;  1NVP D;  5CVN B;  3K5M A;  1AI5 A;  2HHN A;  3BPF A;  3K59 A;  1VMG A;  1D5A A;  4CC5 A;  1XOU A;  1GN4 A;  3AK2 A;  3QNE A;  4R50 A;  4CDE B;  3BHP A;  5JZE A;  2EIL C;  3USV A;  3HPL C;  1ZTE A;  4FVM A;  3PJS K;  2GHY A;  2Y0I A;  4I55 B;  4XBF A;  1NR1 A;  4K0K O;  4CZZ A;  5JJN B;  2BCC H;  4OPA A;  2HWK A;  4NTW A;  4P6E A;  1NTM H;  2E76 B;  2P4V A;  5EZY B;  1TU6 A;  2R9A A;  3ZNH A;  4J7K A;  3LNN A;  3UO2 A;  3KKY A;  5IYC O;  2LQT A;  4CBC A;  4Z1M G;  5DED A;  3B77 A;  3ABM C;  3ZRX A;  4JAU A;  3F75 A;  3C3S A;  2QKA A;  1Y4H A;  3JSN A;  1AJP A;  3JCZ A;  3LNM B;  2FTD A;  4OW0 A;  3KFQ A;  1WLE A;  4TV8 B;  3RN4 A;  4NXN B;  3AG3 B;  4B3R O;  1RPO A;  2YUA A;  3JD0 A;  1JFF A;  3FB5 C;  3GWO A;  5CBF A;  2JJ2 G;  5F2V O;  2E5L O;  1XEQ A;  3AK1 A;  1IBM B;  4OXS A;  3FB8 C;  4ZI7 A;  1Q81 W;  3WXE A;  1OCR C;  3D36 C;  5B1A C;  1Y4M A;  1BE3 H;  1TGO A;  3JD1 A;  4PI0 A;  3CD6 V;  3PN1 A;  3F7Y C;  4YY3 B;  2DE0 X;  3T2M A;  4NVP A;  1Q7Y W;  4NXM O;  4X1Y A;  4BIO A;  4MT8 A;  4I5S A;  3LDE A;  4FM2 A;  3N4C A;  3B79 A;  2DJV A;  3M99 A;  3FD9 A;  2UUA O;  2FRQ A;  4K8Z A;  4YYQ A;  4YHH O;  3KCY A;  3L71 H;  3ZHR A;  1MAB G;  5LL6 Y;  1N32 B;  3IEJ A;  1KP2 A;  5LBQ A;  4X89 A;  4DUZ B;  3CCE V;  1U97 A;  2CK3 G;  5L3C A;  1DK1 A;  4K8X A;  2WLK A;  1OCZ B;  1RSO A;  4X1K A;  4YIP A;  3C9E A;  3LSQ A;  1ZWI C;  4HYO A;  2PF4 E;  4BW9 A;  1PBH A;  1VQ8 V;  1BS3 A;  5IT9 N;  3DF0 A;  4GX1 A;  4DV3 O;  3F5W C;  1VF5 B;  1BCC H;  3OGC C;  3JD4 A;  5KHH A;  3KW9 A;  3RVZ A;  4CS4 A;  3PDF A;  5K1X A;  4MI7 A;  4G2K A;  1K9M W;  1W0K G;  4JI3 O;  2E03 A;  3P30 A;  3J7A U;  1MIR A;  3G4S V;  4JI8 O;  1IDS A;  1JFF B;  1ZL8 A;  3DGE A;  1H8H G;  1VQL V;  1NKD A;  3IFX A;  3ZRW B;  5EC2 C;  2ZIN A;  4MS2 A;  5EZS A;  2Q7E A;  4JI7 O;  4ZI7 B;  2NQA A;  4LH6 A;  4DR4 O;  5LHH A;  5BXZ A;  2YXL A;  4YHH B;  2IPP B;  2NQG A;  2YEV A;  4YYW A;  3FB6 C;  2IW5 A;  4X6J A;  1YK8 A;  1IBL O;  2HHH O;  1PIP A;  3HB3 B;  4D8I A;  3HKB A;  4UVA A;  2DW4 A;  4X1Y B;  4JI4 B;  2YJ8 A;  3A2F A;  2WBF X;  3A0B Z;  3MTN A;  3JCU Z;  3M99 B;  4IHJ A;  2ZE7 A;  1Q6U A;  1L1F A;  2VQF B;  2XU1 A;  3GB7 C;  4UCS A;  2WWW A;  4RY2 A;  2X0L A;  4DV1 O;  1AP6 A;  3FYE B;  5LMU O;  4IGG A;  5DM6 V;  2JIZ G;  2W0F C;  1UJW B;  1FJG B;  5JVD A;  1LUW A;  1NVP B;  3BCN A;  4UVB A;  3DXR A;  1IBK O;  1XHX A;  1RSO B;  4X1K B;  1COW G;  1URF A;  4AXM A;  2AS8 A;  5JJE B;  5JCO A;  2DQ3 A;  1RM1 C;  4XDJ A;  1BQ0 A;  3K9A A;  1OCO C;  2CDY A;  2UUC B;  2YJ9 A;  3CRA A;  1VQ9 V;  2Q69 A;  1XMQ B;  2F7D A;  3MTV A;  2WSS G;  3H8C A;  1STF E;  2VQE O;  4D8B A;  1US6 A;  3ZHU A;  2W6I G;  1BT8 A;  4EKW A;  3WB0 A;  1DKI A;  4X64 O;  5A2Q N;  1ZL8 B;  4LFC B;  1H8E G;  5IWA B;  2DYS B;  5K16 A;  1R6T A;  4KHP B;  4LF8 O;  4CDD B;  1YK7 A;  4CH4 A;  1XL4 A;  2YEV B;  1W59 A;  2F66 C;  4AQY O;  1IXB A;  4DV1 B;  2CTQ A;  2QWO B;  2GV9 A;  2XAG A;  4FIP C;  1FXH A;  4CC6 A;  4YYR A;  4N23 A;  4QNH B;  4BOZ A;  4PDR A;  4PP1 A;  5GW7 A;  1ME3 A;  3HKB B;  3CRR A;  4TT3 G;  4KXR A;  4QRV A;  1N4C A;  3ZUA A;  1SP4 B;  5LHG A;  2G8J A;  4QE9 A;  1YAL A;  4IHJ B;  3EVK A;  1R3K C;  1LNQ A;  5HFL A;  4LFA O;  2MK3 A;  4BOS A;  1Q6H A;  1QBZ A;  3VQW A;  2UXD O;  3MHH C;  2FML A;  5EGW A;  3KCX A;  2UU9 O;  3TNX A;  2AYO A;  1S4V A;  2GSM B;  4AIL C;  4J9Z B;  3H9V A;  2JDI G;  3E86 A;  4MVM A;  3LFY A;  2GTS A;  4DMX A;  2GFO A;  2EIK B;  3CS5 A;  2KSD A;  5JVD B;  3UM7 A;  2FRA A;  3DXR B;  3EFF K;  2RJZ A;  4P6G A;  3CMA V;  1AI4 A;  1T5E A;  1XDC A;  1AI7 A;  3SYC A;  1B06 A;  1H2S B;  2PYJ A;  2PZS A;  4W5B A;  4IL6 Z;  1VAR A;  3BFR A;  4JGS A;  4JI6 O;  2UXB O;  2YXY A;  1K8A W;  4X65 O;  4CDF B;  2Y69 B;  5GTI Z;  4DK1 A;  2DJF B;  2H94 A;  1NT2 B;  1XI1 A;  1FXK A;  2Q0A A;  4PP2 E;  3OUS A;  2EIM B;  4DV0 O;  1XKG A;  1OCC C;  4O2A A;  3WFV A;  1CPJ A;  4JYB A;  4LBE C;  4DV6 O;  2QEX V;  2ODM A;  3CBJ A;  4MTF A;  2JS3 A;  3RYI A;  3ZN1 A;  2UXD B;  1QU7 A;  1TUE B;  4RAI A;  1NQT A;  3ABL B;  1FFX A;  1FH0 A;  1VQM V;  3KX1 A;  4PA4 A;  3JD2 A;  3RT3 C;  4YYU A;  4RF1 A;  4H0L B;  1EWP A;  1CV8 A;  3AG2 C;  3W7W A;  3OMI B;  4PAD A;  2XAH A;  3BB7 A;  1GM9 A;  3RVW A;  2LFS A;  1FD9 A;  2EIN B;  2UXN A;  1GO3 F;  3G6E V;  2OCC C;  3OMN B;  3H89 A;  2ZT9 B;  2J7Q C;  1R3I C;  3WB1 A;  1K73 W;  3OR6 C;  1NB3 A;  4B08 A;  3ZN0 A;  3AG7 A;  4Q20 A;  2BU3 A;  4QGP A;  4GKK O;  4A5U A;  2YIB A;  2YSU B;  3W7X A;  4P2Z A;  3F5T A;  2ZE6 A;  2B9Z A;  3FAV A;  1MA1 A;  2A79 B;  2H7J A;  1UKF A;  3B40 A;  4DV0 B;  3SJQ C;  3APO A;  5EYP A;  3HD3 A;  5B3S C;  1MDW A;  1B04 A;  4ZBM A;  4AHC A;  3LUT B;  4PEL A;  3AG4 C;  1TVK A;  2OYQ A;  1CTE A;  3IHP A;  2NQI A;  5CMU A;  4KL1 A;  1SRY A;  3L74 H;  1WB7 A;  3OD4 A;  4HWY A;  2Y4U A;  4JAS A;  4BQV A;  2FO5 A;  1U96 A;  2YIA A;  3N2G A;  1J95 A;  3OR7 C;  2F95 B;  2QE7 G;  4B3S B;  2BSK B;  5KLV H;  1FXK B;  4X66 O;  2X6A A;  5K1P A;  4D8E A;  2KQX A;  1N36 B;  5LMN B;  4O2A B;  3A8T A;  2JS5 A;  5KUM A;  2R9M A;  4FJC A;  3RYI B;  4X62 B;  4JTA B;  5J2U A;  2HH5 A;  2P4K A;  3BEH A;  1FFX B;  5KO3 A;  5CHT A;  5IJ9 A;  1SER A;  4GKK B;  1YDX A;  1QR8 A;  1EBO A;  4BSQ A;  4I7Z B;  3EHB B;  4OEM A;  4BIU A;  2DC8 A;  1IX9 A;  3KZI Z;  2ITD C;  1P49 A;  2ZKO A;  2AXT Z;  4PDV A;  5F02 A;  3BPM A;  4QRG A;  5EK0 A;  4X88 A;  5CN0 A;  2XOK G;  5CA1 A;  1HNZ O;  1AYU A;  5KMG A;  1V9P A;  4MZO A;  4RUF A;  2R6N A;  3K9S A;  1YJW V;  4YVA A;  1XIL A;  2YDE A;  3U8E A;  2EBO A;  4LF5 B;  4A5U B;  2XU5 A;  4H44 B;  4O4J A;  1AVM A;  4GUA A;  4B3M O;  3FAV B;  4FLV A;  2AZ2 A;  2ILM A;  4BWA A;  3ZED A;  2UUB B;  2ZM6 O;  4X66 B;  2H8P C;  4O2B A;  1OJH A;  1DLB A;  1YVW A;  3E8F A;  4NR1 A;  5EYP B;  2ZCE A;  3JYC A;  3UQ8 A;  1TVK B;  3BPZ A;  4PA7 A;  4UFZ A;  1PXV A;  2BTW A;  3K79 A;  4N21 A;  4N4Z A;  3N2G B;  1WPX A;  1EFR G;  2HVJ C;  1VSN A;  5A9G A;  4B7E A;  3C90 A;  2GHU A;  4OX9 B;  1ZLZ A;  2EUL A;  3BBA A;  1RP3 B;  3RNV A;  3S3Q A;  3B09 A;  5ITZ A;  4DV5 B;  4PJ0 Z;  5IJ9 B;  1SET A;  3IC7 A;  3LDD A;  1BHB A;  3OUF A;  4DR7 O;  2DYR B;  1XRE A;  1SQX H;  2QKC A;  2AUZ A;  5HFM A;  3S3X A;  4JI2 B;  3PBH A;  3WB2 A;  1Q6I A;  3P5W A;  1NPZ A;  1U9V A;  4FIP A;  5CA1 B;  5E6J A;  1KC8 W;  3G80 A;  1AYV A;  1J5E B;  5KMG B;  1AR4 A;  4EFE A;  5H5N A;  2AHY A;  1SES A;  1X59 A;  3BY6 A;  5DEC A;  4MVO A;  5EBW C;  4WFA V;  3OTO O;  4DR6 B;  5BMV B;  1NB5 A;  4TV9 A;  1Q3E A;  2ETN A;  4O4J B;  2ZXW C;  1K4C C;  4ZTB A;  1AJQ A;  2XND G;  3MHH A;  3E8G A;  1Y66 A;  2Y4T A;  4O2B B;  1LR1 A;  3HKE A;  1ATK A;  5L3D A;  1KD1 W;  4JF3 A;  4W4K A;  3TXQ A;  2JGD A;  2ATK C;  1KFX L;  1R1B A;  1S76 D;  1M6D A;  4AXL A;  2BTW B;  3ERV A;  1MMM A;  3S3R A;  1RM1 B;  4GZR B;  1BHA A;  1OCO B;  1KHP A;  3SPH A;  1JJO A;  1F7Y A;  3SJA C;  3I3T A;  1SQG A;  1NLJ A;  3B8M A;  2BTQ A;  3T1Y B;  4O4L A;  4QPJ A;  3K08 A;  2E75 B;  3ML0 A;  2F4V B;  3QF7 A;  4PDM A;  3ASO C;  1L0L H;  2DQ0 A;  3QVN A;  4PA9 A;  1K5S A;  4PA6 A;  1R6N A;  5ITZ B;  3OMA B;  1M57 C;  2LFR A;  3M7M X;  3PRP A;  4UXN A;  4BR6 A;  2BOC C;  1MZE A;  4R3D A;  2JRI A;  3N3K A;  4E4E A;  1L8D A;  1MEG A;  2RNB A;  3ZHQ A;  4JI1 B;  4NXN O;  3RYH A;  5H2F Z;  1TUB A;  3A0R A;  4TSF G;  4LFB O;  2HJF C;  2B5U A;  2P0R A;  4W4U A;  1H2M A;  1ZIV A;  3H1J H;  1IBM O;  5EIB C;  5JH3 A;  3L72 H;  2N04 A;  1MS6 A;  2LW1 A;  1DTO A;  2QSA A;  4JAA A;  3WG7 C;  2CTP A;  4J80 A;  1GK9 A;  4Q8G A;  2MW2 B;  4TV9 B;  3JAS A;  3RYF A;  1E1R G;  3T1H O;  1Q90 D;  4YY3 O;  3CCQ V;  1PCI A;  2BOB C;  4H13 B;  3RVV A;  4ZUX U;  3L70 H;  4TWK A;  2Q8V A;  4GUN A;  3HKE B;  1XNQ B;  2QM7 A;  1Z5W A;  4LF4 B;  1VQ6 V;  2PAD A;  1K33 A;  3CEI A;  3TMP A;  1BQI A;  2JGD B;  3J80 N;  1K3B B;  2B1I A;  2KG7 A;  3W7U A;  4PA3 A;  4MTO A;  2YS8 A;  3NR7 A;  4I50 A;  4BAY A;  1N32 O;  2PNS A;  1FFT B;  4WFH A;  4L8J A;  5LGU A;  4DYL A;  3ZMZ A;  1ZUQ A;  5KA6 A;  4DUZ O;  3LXS A;  2AUX A;  1NTZ H;  4LH7 A;  2Q7H A;  1PNM A;  1E79 G;  2FE8 A;  2BTQ B;  5H9C A;  3MJ5 A;  4O4L B;  3MAQ A;  1GMG A;  2JGU A;  4LFB B;  1NTK H;  2Y5B A;  2RN9 A;  2YI9 A;  5LA6 A;  1Y6X A;  3P32 A;  4JYA B;  2DC9 A;  2UXX A;  5EC1 C;  3ZHV A;  4QE7 A;  1K92 A;  1Y74 A;  2AHZ A;  2BE3 A;  3FFQ A;  5CVM A;  1QVG U;  4U3J A;  3T1H B;  4B7K A;  4DR5 B;  1NL6 A;  3RYH B;  1MEM A;  1PPJ H;  1TUB B;  2PRE A;  1RFY A;  4TUY A;  2EIJ C;  3T1C A;  2IH1 C;  2YI8 A;  1SQF A;  4RO2 A;  2QM8 A;  1ITO A;  2A0L A;  5J2T A;  1M9N A;  4R7C A;  2ZR2 A;  2M7W A;  2IU3 A;  3L73 H;  2FTK A;  3SPJ A;  3H8B A;  3E22 A;  2R9O A;  3IV2 A;  4MW3 A;  5JJJ B;  3CP1 A;  3JAS B;  3P3N A;  4XUI A;  4XDL A;  3RYF B;  2OCC B;  2YJB A;  3UKM A;  3BCC H;  3QG5 A;  4JI4 O;  4UCR A;  1YVB A;  4WFG A;  2R72 A;  1DF5 A;  2ZE8 A;  2HEP A;  2YJ2 A;  1M56 C;  4MVU A;  5B1N A;  1HP8 A;  1VF7 A;  1VQ7 V;  4RF0 A;  1S3J A;  5LHI A;  4YJ2 A;  3L9D A;  2VQF O;  2KG7 B;  2JK5 C;  2OWO A;  3E35 A;  4MVQ A;  4E2L A;  4I50 B;  4UCT A;  3TK1 A;  4OVZ A;  4PI3 A;  5B3S B;  3P5U A;  3AG4 B;  4XR7 A;  1FJG O;  3ASN C;  3I06 A;  5L3B A;  1PPP A;  3DTU B;  2XU4 A;  3CX5 F;  3BC3 A;  5LYJ A;  3K5O A;  4UVC A;  4BS5 A;  3AK3 A;  2CIO A;  4UCO A;  5LA6 B;  3ZRV A;  1V54 C;  1K4D C;  1R73 A;  1WA8 A;  1N33 B;  2AIM A;  1FKA O;  2UUC O;  4LF6 B;  1Y74 B;  1XMQ O;  3UO3 A;  2FYE A;  4U3J B;  1KKC A;  1CVZ A;  5EIB D;  2Z5U A;  1AEC A;  1XQ8 A;  1VQO V;  2Q5Z A;  4WA6 A;  4TUY B;  4LFC O;  7PCK A;  4G27 B;  5IWA O;  2P7U A;  4KHP O;  1BL8 A;  4LWS A;  3H1K H;  5J2T B;  1VQP V;  1I5Y A;  4NTX A;  4GX5 A;  5B1O A;  4JZ2 A;  2C0Y A;  3E22 B;  4FLT A;  1KUQ A;  2P5O A;  3KWB X;  4DV2 B;  1YSC A;  3CH3 X;  4GX0 A;  3PW3 A;  2GBO A;  3HHA A;  5IY5 B;  1Y08 A;  3WU2 Z;  2XT9 A;  1PV0 A;  4W5C A;  2XHB A;  4BW5 A;  1HNX B;  4YJ2 B;  2VWJ A;  4QJF B;  2DCA A;  2Z3Y A;  3CCJ V;  1R3J C;  2QGN A;  1AU2 A;  2Q7G A;  1POP A;  4PDL A;  4I4T A;  3OF8 A;  4OVZ B;  1X9Y A;  3HHI A;  3QSD A;  3CCM V;  5LYJ B;  1S72 V;  1BP4 A;  2D3O W;  1NH2 D;  3O0U A;  4JI0 B;  2WLJ A;  1BQZ A;  4NB5 A;  1NQC A;  4DV7 B;  5EBM C;  2WLN A;  1P7B A;  2ACT A;  1WA8 B;  4LR3 A;  4C7U A;  4IT5 A;  4RKX A;  4XZX A;  3ABK B;  2FUD A;  1GEC E;  3U0Z A;  1JPX A;  1NR7 A;  1K3E A;  2YIB D;  1GTO A;  1YT7 A;  4DR1 B;  1THE A;  3BA8 A;  3LSS A;  5CVO B;  2NN4 A;  3PHU A;  3BY4 A;  1PPD A;  3RWR D;  2GTA A;  1VQ4 V;  1XNR B;  2LP7 A;  2M6Y A;  2HP8 A;  3OM3 B;  1NS1 A;  1JQ0 A;  4WFB V;  1U9Q X;  1SA0 A;  5H6Q A;  4LWS B;  3P3P A;  2E01 A;  2WLM A;  2A7W A;  2D2C B;  1VF6 C;  4G54 A;  3CC2 V;  1I5X A;  1E1Q G;  2QTS A;  3I55 V;  2A3Q A;  2WLI A;  1MOF A;  4AI8 A;  3ZX6 A;  1MHW A;  4X6H A;  3SYP A;  1BGO A;  1CJL A;  1FS0 G;  2IJJ A;  2L35 A;  4DR2 O;  3G6B A;  2R9R B;  4JTD B;  1DF4 A;  4FLY A;  2ZXW B;  1U9X A;  2E3C A;  3V6E A;  3W7S A;  1JCH A;  3K0D A;  4YIO A;  5BR8 B;  3SYQ A;  1F4N A;  5B66 Z;  1HR0 B;  4I4T B;  1AB3 A;  4IYI A;  4TOI A;  4U7O A;  4FLW A;  1CQD A;  4R6Z A;  3ZRS A;  3CYO A;  3H6S A;  5IE9 A;  1N0N A;  1H2K A;  2XTA A;  3L75 H;  1Z5V A;  4WBN A;  2HFE C;  2F93 B;  2FQ9 A;  2PI4 A;  3QT4 A;  4IIJ A;  1K34 A;  3W31 A;  3AG3 C;  3K03 A;  3IC9 A;  5E1A C;  4KFM A;  1AYW A;  4O4H A;  5IYB O;  5J9P C;  4DR3 O;  4IYH A;  4LF7 B;  2DOS A;  4JI5 B;  4MZS A;  4B3S O;  2P90 A;  3D36 A;  1GH6 A;  1VJV A;  2QR4 A;  3ABU A;  1M57 B;  1PAD A;  2R70 A;  4DR2 B;  1BMF G;  1N36 O;  4UCV A;  5IDJ A;  3K8U A;  5LMN O;  3P5V A;  1ARO P;  1SA0 B;  2FT2 A;  3ZMT A;  3K24 A;  2XAS A;  3U11 A;  3E1Z B;  4X62 O;  1VIB A;  3DC6 A;  2P6J A;  2PYL A;  2N05 A;  2V4D A;  1SS3 A;  2WLI B;  1JA8 A;  1JJ2 U;  4L87 A;  3JAL A;  1DF0 A;  3ETG A;  2EIL B;  2FYU H;  3VOU A;  5LGN A;  2ATO A;  3WG7 B;  1Y67 A;  1Y76 A;  2OTL V;  4H37 A;  4ABM A;  4FLX A;  1PL4 A;  4FZ0 A;  5FNV A;  1F2B A;  3DC5 A;  4LCU C;  2OCH A;  1OCZ C;  3X2Q C;  4RQF A;  1HNW B;  3K5L A;  4LF5 O;  4FMT A;  4FK5 C;  1MG1 A;  4X1I A;  1AU0 A;  5LGT A;  4DR3 B;  5CBG A;  2GDS A;  2YID A;  3TJT A;  3ABM B;  1YI2 V;  4KLB A;  4M0W A;  4EEQ A;  3O1G A;  2UUB O;  4PD4 F;  1KBH A;  2PI5 A;  1YCI A;  4WBN B;  1DGS A;  2P86 A;  4IIJ B;  2VHS A;  3VBB A;  1OV9 A;  4OPH A;  1S0V A;  1TAE A;  2ARH A;  4B3T B;  3OE7 G;  1XMO B;  2ZNI A;  3K58 A;  4O4H B;  2O6X A;  4GKJ B;  4WFF A;  4DW1 A;  1AR5 A;  1PP9 H;  3CCR V;  1OCR B;  5B1A B;  2WLH A;  4JV5 B;  4W4L A;  4OX9 O;  5CHV A;  1WB8 A;  4CDC B;  5FLX N;  1NH2 B;  3CH2 X;  2HVK C;  4GCZ A;  2HJD A;  2RDC A;  3RYC A;  3SPC A;  1YZB A;  5KHG A;  3KWZ A;  1U5I A;  5FL7 G;  1PNL A;  4YXW G;  1EZV H;  4DV5 O;  3FB7 C;  3SYO A;  4I9Q A;  3JAL B;  4ICG A;  1O9G A;  4CS3 A;  3H01 A;  2FB5 A;  4JI2 O;  5GTH Z;  1Y76 B;  5L3E A;  2R9N A;  2EZO A;  1CP9 A;  1MNG A;  3PHW A;  1O9H A;  3D3Q A;  5FNV B;  1J5E O;  1WP8 A;  4IUM A;  5D5P A;  4UCU A;  1W0J G;  2CUG A;  4MVZ A;  2OT5 A;  3ICX A;  2CE4 A;  3TXS A;  4DR6 O;  4CH3 A;  4MTX A;  1M56 B;  1FPO A;  3JAW A;  4X1I B;  3BVO A;  3CCU V;  4P16 A;  5A24 A;  4X9Q A;  3PRM A;  2Z0A A;  1ORQ C;  2DMX A;  2IM9 A;  1VEW A;  1SKV A;  3ASN B;  2AVW A;  1CEZ A;  1XBL A;  1VQN V;  5J2U B;  2YC0 A;  4J42 A;  2OP3 A;  2DWE C;  4I9W A;  5PAD A;  2A06 H;  3SPI A;  3W7T A;  3E9S A;  4JAV A;  1QHT A;  3T1Y O;  2KKW A;  3PNR A;  3B4S A;  2R9I A;  1PPO A;  2XAQ A;  2F4V O;  1I7F A;  3CHX A;  1PE6 A;  1EN4 A;  3RYC B;  1GN2 A;  3BA9 A;  1SQP H;  2RMK B;  3OAA G;  3ETQ A;  4UV9 A;  2HR3 A;  1BSM A;  1PPN A;  2Z84 A;  1I94 B;  3CWB H;  1NJI W;  3IFU A;  4I05 A;  2WAM A;  4JI1 O;  1QNM A;  3F5V A;  1WAZ A;  3CPW U;  1IWD A;  4G28 B;  2K1E A;  5KHJ A;  4DUY B;  1CPY A;  2EIK C;  2P06 A;  2CTR A;  2YJC A;  4IP3 A;  3K5N A;  5CA0 A;  3CC4 V;  2ADP A;  2HLD G;  1GLO A;  3ZIA G;  1CSB B;  5B5E Z;  1AIL A;  1S5L Z;  3BAA A;  3B21 A;  4P30 A;  4HBN A;  4DV4 B;  3JAW B;  3WXF A;  1IZ3 A;  3G67 A;  5E79 Z;  3STL C;  5C93 A;  4LP8 A;  3HKC A;  1GKF A;  4X8A A;  4UUJ C;  1XNQ O;  3TCU A;  3GVM A;  1P4R A;  2OIG A;  4LF4 O;  1Q82 W;  3CRQ A;  1V55 C;  1A32 A;  5KUK A;  2LGW A;  2EX3 A;  4QBB A;  2BTO A;  4CZW A;  4YYS A;  3OW2 U;  2G6D A;  2IJK A;  3AG1 C;  1QDQ A;  3SR2 C;  5BZB A;  4DK0 A;  4WCE V;  5GON A;  1SZX A;  4ZHQ A;  4QPK A;  3K04 A;  4MTG A;  2R9C A;  3H1I H;  1EF7 A;  4DMY A;  1YEW A;  4TQF A;  3N2K A;  3CC7 V;  3GWK C;  1KQS U;  1X4T A;  2GUZ A;  4K35 A;  3D8C A;  1WNS A;  3ABT A;  2QWQ B;  1EWM A;  1H2N A;  3UCS C;  3CSX A;  4WFE A;  4JYA O;  4FM0 A;  5IYD O;  2AZ0 A;  2QDO A;  2UXC B;  2EIN C;  1VP7 A;  2ZQM A;  4P9P A;  2JTC A;  2LW7 A;  2J7Q A;  4MSW C;  4DR5 O;  5KAI Z;  1SF9 A;  1ENV A;  3SYA A;  2ZD9 A;  3ZMU A;  4TQD A;  1ROP A;  4N8W A;  4YYV A;  4PV1 B;  3JD3 A;  5CA0 B;  5DN6 G;  3APQ A;  1YTF B;  1GN6 A;  1KFU L;  5KX5 A;  4LF9 B;  1GCB A;  2B1G A;  1IUR A;  3CCV V;  1AIM A;  5IYZ A;  3HKC B;  1YF2 A;  4RUE A;  3ZMV A;  4U7N A;  3BOW A;  3Q4H A;  4RWU A;  2QKS A;  3W30 A;  1D2D A;  1KB9 F;  4FK5 A;  5FPR A;  2HXZ A;  1ME4 A;  5CA3 A;  2PUS A;  1GMY A;  5LXT A;  3OQC A;  1KU9 A;  1FXK C;  1UFI A;  3QO5 A;  1OCC B;  3J81 N;  1F29 A;  5GON B;  4ZHQ B;  3FX7 A;  2NQD B;  4HNA A;  4REZ A;  2CH7 A;  3JSL A;  3N2K B;  3KG2 A;  1K7D A;  3ZRW A;  2GUZ B;  3I5D A;  4RQE A;  2HKO A;  1SZT A;  2LJ2 A;  1JR9 A;  4BOU A;  3AG2 B;  2P7T C;  1PD3 A;  2DWD C;  3OT7 A;  4DXW A;  4K0K B;  2Y6E A;  1N33 O;  1DEU A;  4Z2W A;  2DC6 A;  4LF6 O;  4N79 A;  4J11 A;  2CB5 A;  4MVR A;  2X7R B;  6PAD A;  3S3W A;  3IOQ A;  8PCH A;  1BZK A;  2CGN A;  2JQG R;  1S5H C;  4MW8 A;  3ETE A;  5KX5 B;  2OTJ V;  4X20 A;  1Q86 W;  2IJH A;  3FYI B;  5IYZ B;  4DV2 O;  4B3R B;  2AGA A;  4I0X A;  3X2Q B;  3Q4H B;  3OEH G;  3VQV A;  2EJR A;  3DSQ A;  3MHS C;  1BY8 A;  2E5L B;  2JEU A;  4P9O A;  1SQQ H;  3TRK A;  5LXT B;  3CJH A;  5JA7 A;  3MOR A;  4JPR A;  2G8E A;  1GM7 A;  2ADQ B;  1HNX O;  1KP3 A;  4CS2 A;  3RVY A;  2IJI A;  3ZCC A;  4ASU G;  3NXS A;  3IAY A;  4F6R A;  4HNA B;  1SQB H;  2CH7 B;  3PHX A;  4FJC C;  4FFB A;  1JVM A;  5EBL C;  4NXM B;  4D7T A;  2V1D A;  5B1B C;  3JAR A;  3O65 A;  4LNU A;  2DYR C;  5AG2 A;  2UUA B;  5KHI A;  4D7S A;  4JI0 O;  1PM9 A;  2Q9L A;  1S77 D;  4BOP A;  2AYN A;  2NNU A;  3SGI A;  1AI6 A;  3MDS A;  4DV7 O;  1IXM A;  3OEE G;  4BS6 A;  1ZCM A;  1QLE C;  1Q5O A;  1XHZ A;  2JJ1 G;  2XUM A;  2QWP B;  5KA5 A;  3CRM A;  4DR1 O;  3RBZ A;  5KAF Z;  3OVX A;  1XNR O;  2QTO A;  1NBM G;  4DV3 B;  1PNK A;  1M4U A;  4BIZ A;  4WF9 V;  2HG5 C;  3JAK A;  5LP6 C;  3HWN A;  2G7Y A;  1M5I A;  3CBK A;  1IVS A;  2PGG A;  5EF4 A;  4JI3 B;  3OTF A;  4X20 B;  3K9M A;  5D5Q A;  3CXH F;  1ZX3 A;  4JI8 B;  4KUM A;  2FKX A;  3WXG A;  4I0X B;  3CXC U;  3CCL V;  1KXR A;  1PL0 A;  3OVZ A;  5LOV A;  4NKG B;  5CB4 A;  1BGY H;  2WPD G;  3T4Z A;  4DW0 A;  2F23 A;  4FLZ A;  4JI7 B;  1KMI Z;  3CJH B;  3OIS A;  2VWK A;  4DR4 B;  2AU1 A;  1QCE A;  2DZZ A;  1ZAU A;  1N0J A;  1F51 A;  5BR8 O;  2BDL A;  1IBL B;  1D5N A;  2HHH B;  3O9O A;  3IMA A;  1HR0 O;  5JQG A;  2L6L A;  4F6R B;  3CB2 A;  4FFB B;  1YHQ V;  1FYJ A;  3JAR B;  2BDZ A;  1RPR A;  4Z1V A;  4LNU B;  2Q6A A;  3B8N A;  3CCS V;  3KSE A;  3C3T A;  3AEI A;  4JZG A;  1F2C A;  3RW0 A;  3LDC A;  3TET A;  4O4I A;  5LMU B;  4ZOL A;  2G38 A;  3D3I A;  4LF7 O;  2ITC C;  4JI5 O;  2F43 G;  2PBH A;  2QJ1 A;  1IBK B;  1HWY A;  2ZDI C;  2CAZ C;  4NTY A;  2IBZ H;  1P7G A;  1CXZ B;  1LUV A;  4ZIB A;  1K97 A;  1Q43 A;  3JAM N;  3QO7 A;  3TGU H;  4DRX A;  4WUR A;  1UPG A;  3QTC A;  3IGA C;  4GLX A;  4KP4 A;  2P67 A;  2V7Q G;  2VRZ A;  1PVJ A;  3JAK B;  3LSU A;  3R66 A;  3H7D A;  1F4M A;  1SC5 B;  4D6T H;  3HKD A;  1SQV H;  4UB8 Z;  2VQE B;  4MM3 B;  1NZ6 A;  3BWK A;  3V6C A;  1H2G A;  4OGQ B;  1M90 W;  1ZSP A;  2X6C A;  2XAF A;  1WJZ A;  2RCV A;  4FPP A;  1HW7 A;  4X64 B;  2ZNJ A;  5LOV B;  4Q6G A;  5CB4 B;  1F23 A;  2PTM A;  3F7V C;  4LF8 B;  3C0R A;  2DCC A;  4PT5 A;  1Q6K A;  5J94 A;  4GT1 A;  3U10 A;  3K0G A;  2Y0P A;  4AQY B;  4YJ3 A;  3SDL A;  1HNW O;  5C8Y A;  4J7Z A;  4ZKI A;  5KHK A;  3H1H H;  5JWP A;  5JQG B;  3H1L H;  1V55 B;  2BSK A;  1I08 A;  3ASO B;  1FXV A;  4GYC B;  3AG1 B;  3ZHS A;  1QQC A;  4J7J A;  2WA3 A;  4H33 A;  1AU3 A;  1QVF U;  1KKD A;  4LFA B;  1YXB A;  4HXD B;  3UT5 A;  1YIT V;  2B1M A;  4F4L A;  2UU9 B;  4O4I B;  4B3T O;  2F1M A;  1XMO O;  3SJC C;  4FLU A;  1G1X B;  1WPB A;  1TL9 A;  2PY5 A;  4ZOL B;  4GKJ O;  2CGO A;  4PHZ A;  3N3G A;  5H6R A;  2VHF A;  1AU4 A;  1NU1 H;  1MSD A;  2E74 B;  4JV5 O;  2B1N A;  4BOQ A;  1TA8 A;  1B6Q A;  2DZY A;  4DRX B;  3ZJZ A;  4Q8H A;  4FM1 A;  4JI6 B;  1KYO F;  2UXB B;  4X65 B;  2W0X A;  3HKD B;  1HDJ A;  5JH7 A;  3ETD A;  2CTW A;  2IH3 C;  2Q68 A;  2EJ7 A;  2O57 A;  1KHQ A;  1P84 F;  1YJN V;  2Q4P A;  4DV6 B;  4EFB A;  1G4Y B;  1QR9 A;  1R3L C;  1EM1 A;  3NHE A;  3SJB C;  3HR0 A;  2ZIM A;  1JOY A;  2XU3 A;  2C2A A;  4YJ3 B;  1N8R W;  2DJG B;  2YIC A;  5C8Y B;  3MHS A;  1L0N H;  4K7C A;  2VS0 A;  2DN9 A;  4K3A A;  1TLO A;  2R9F A;  1EWO A;  1FAF A;  5FPO A;  2HD5 A;  4GX2 A;  2LO1 A;  1M1K W;  3R65 A;  3M8A A;  3UT5 B;  1QLN A;  1THZ A;  4JTC B;  1YTF D;  2DC7 A;  3A0H Z;  2Q73 A;  4R8C A;  3K06 A;  5EZQ A;  3STZ C;  2H3O A;  1EN6 A;  2JVD A;  1QOL A;  1MZF A;  4FFK A;  2EIJ B;  3GCB A;  4FZ1 A;  2UZJ A;  4UV8 A;  1R6K A;  2QM4 A;  4MVS A;  3E2E A;  2WLL A;  1F2A A;  2ZE5 A;  3MD0 A;  1CS8 A;  3EXA A;  1MSW D;  1GM8 A;  4YV8 A;  4NYK A;  1VQK V;  2EZP A;  3ZS8 C;  3FKS G;  3E8B A;  1U9W A;  2E00 A;  3AI8 A;  3ZHT A;  2DCB A;  1XL6 A;  3IUT A;  3QJ3 A;  2OUL A;  4BPV A;  2DCD A;  1QMY A;  4J41 A;  2QWN B;  5IY5 C;  5BMV A;  3OGI B;  1NI8 A;  5JH7 B;  3IJ4 A;  1I94 O;  2AW9 A;  1XUQ A;  5LP6 A;  4XDK A;  3N27 A;  2Q67 A;  1AR1 B;  3BRC A;  3BAB A;  3VQX A;  1QXP A;  3E89 A;  2E02 A;  4U3F H;  3RVX A;  4DUY O;  3CRC A;  4JYC A;  2YXH A;  1JQP A;  2OIE A;  4X6I A;  1PKX A;  2IBI A;  1G8M A;  1GRJ A;  3PT2 A;  1EN5 A;  2LGQ A;  2W6J G;  5CBH A;  2F1G A;  3RFR A;  3B2E E;  5L3G A;  2DYS C;  4CH6 A;  2P22 C;  2XAJ A;  1AJN A;  4DV4 O;  5IJ0 A;  4MSX A;  1V54 B;  3K57 A;  2K9P A;  1VQ5 V;  4QIW F;  4EB6 A;  1M93 A;  3JAT A;  1HNZ B;  3ABK C;  2ARY A;  3T4D A;  2Q0O C;  4I07 A;  4CH5 A;  1JMK C;  3RGB A;  5B1B B;  1GAX A;  4HZ3 A;  1N34 O;  1I0H A;  2JQF R;  4B3M B;  1WP7 A;  5FPW A;  2WLL B;  2ZM6 B;  4RNA A;  1YIJ V;  1VF6 A;  3ZBH A;  3OFN G;  1QLE B;  4PI2 A;  3KKU A;  1KEC A;  2X6B A;  3E8H A;  1S5J A;  1CB5 A;  1GN3 A;  1H38 A;  2ZDI A;  1JX9 A;  2A9H A;  2Y48 A;  4QRX A;  3CE2 A;  1SNK A;  2KB1 A;  4I55 A;  4QH6 A;  1G6U A;  4LC1 A;  3SPG A;  1EWL A;  1A6R A;  2UXC O;  5JCO C;  1H2L A;  2ZR3 A;  1W2B U;  1K5Q A;  1OZ0 A;  5LP6 B;  4HAM A;  2RQ6 A;  5EZY A;  1WN7 A;  2IU0 A;  3PSE A;  3CME V;  4J10 A;  2NLJ C;  2Y69 C;  1B3Q A;  3THO A;  2QWR B;  3K3W A;  4UB6 Z;  4F6E A;  3ZMS A;  2EIM C;  4JYY A;  1N34 B;  5L3F A;  1AP5 A;  4DR7 B;  4LF9 O;  1Q8I A;  1YJ9 V;  3P5X A;  1O0E A;  5IJ0 B;  4TV8 A;  2ZIO A;  3E83 A;  2N74 A;  2JEX A;  2OZ2 A;  3OF9 A;  2QA4 V;  4EB6 B;  3VQY A;  3ABL C;  1EZJ A;  3JAT B;  4J9Y B;  4DO2 A;  5BY1 A;  3D6S A;  2FL4 A;  3I56 V;  4I04 A;  3G71 V;  5TIS Z;  1HUC B;  2WA4 A;  3OTO B;  3QO8 A; 
#chains in the Genus database with same CATH homology
 3MP2 A;  5LL6 Y;  2BTW B;  1KUQ A;  4A5U B;  3MTV A;  1AB3 A;  2Z84 A;  4DV4 O;  2VQE O;  4D8B A;  4GUA A;  3RT3 C;  3PHX A;  4B3M O;  4LF7 O;  4RF1 A;  4JI5 O;  3IFU A;  1DK1 A;  2ZM6 O;  1F7Y A;  4JI1 O;  1DKI A;  4X64 O;  5A2Q N;  3BB7 A;  3W30 A;  3O65 A;  4OX9 O;  1D2D A;  5FLX N;  1R6T A;  3JAM N;  4LF8 O;  4JI0 O;  5IT9 N;  4BOP A;  5JZE A;  4WUR A;  3OQC A;  3W31 A;  4DV3 O;  4IP3 A;  1PVJ A;  2J7Q C;  1YZB A;  4DV7 O;  3R66 A;  4AQY O;  1N34 O;  3PRP A;  4DV5 O;  4K0K O;  3J81 N;  2BU3 A;  2BTW A;  4GKK O;  1AIL A;  4MI7 A;  3B21 A;  4OVZ B;  4A5U A;  4R3D A;  2JRI A;  4MM3 B;  4JI3 O;  4OPA A;  4DR3 O;  2HWK A;  4REZ A;  3F5T A;  4BOZ A;  2DOS A;  4DR1 O;  4B3S O;  3J7A U;  4JI8 O;  4JI4 O;  4NXN O;  1UKF A;  4RNA A;  4JI2 O;  3ZNH A;  1XNR O;  1N36 O;  1XNQ O;  5LMN O;  3C0R A;  4LF4 O;  4PT5 A;  4LFB O;  3BBA A;  3PHW A;  1J5E O;  4LFA O;  4RF0 A;  5EZS A;  1A32 A;  3RNV A;  1IBM O;  4JI7 O;  4BOS A;  3M8A A;  4IUM A;  2UXD O;  4DR4 O;  4X62 O;  2VQF O;  5BXZ A;  4BOU A;  4RKX A;  3SDL A;  2UU9 O;  1HNW O;  4XZX A;  1N33 O;  5EZQ A;  1IBL O;  2HHH O;  4DR6 O;  4OVZ A;  4LF6 O;  4DR7 O;  2UZJ A;  2UXC O;  4OW0 A;  3T1H O;  4YY3 O;  1FJG O;  4D8I A;  4P16 A;  3PHU A;  2FKX A;  3BY4 A;  4B3R O;  3PRM A;  2Z0A A;  4X66 O;  3PSE A;  4D8E A;  5E6J A;  1NS1 A;  2E5L O;  1XEQ A;  3TMP A;  3J80 N;  5H5N A;  4HXD B;  1X59 A;  4JYA O;  5BR8 O;  4DV1 O;  3OTO O;  4B3T O;  4JI6 O;  5KO3 A;  2UXB O;  1FKA O;  1XMO O;  2UUC O;  1G1X B;  4X65 O;  5LMU O;  1N32 O;  1HR0 O;  4LF5 O;  4LF9 O;  1XMQ O;  2JTC A;  4GKJ O;  4DUZ O;  1I94 O;  4ZTB A;  2LW7 A;  4DV2 O;  4NXM O;  2ZKO A;  1FYJ A;  2J7Q A;  3E9S A;  2N74 A;  2AGA A;  4M0W A;  4DR5 O;  2UUB O;  1IBK O;  4DV0 O;  4DR2 O;  4JV5 O;  2FE8 A;  3T1Y O;  1HNZ O;  3MJ5 A;  4LFC O;  2DJV A;  5IWA O;  4BOQ A;  5BY1 A;  2UUA O;  4DUY O;  4KHP O;  4DV6 O;  2F4V O;  3TRK A;  1R1B A;  3PT2 A;  4OPH A;  1HNX O;  4YHH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...