2JRIA

Solution structure of the josephin domain of ataxin-3 in complex with ubiquitin molecule.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the plasticity of the ubiquitin-protein recognition code: the josephin domain of ataxin-3 is a diubiquitin binding motif
rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
molecule keywords Ataxin-3
total genus 44
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2jriA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2jriA01
2JRIA 4DR5O 1N34O 1XNRO 1DK1A 1IBMO 4DUYO 1R1BA 2VQEO 1XNQO 4JI2O 1R6TA 1FJGO 4LF6O 1AB3A 4JI6O 4OX9O 2UUAO 4NXMO 5BY1A 1IBKO 4LF9O 2E5LO 4JV5O 3RT3C 4B3MO 1NS1A 4LF7O 2FKXA 2N74A 3T1HO 1N32O 4K0KO 5LL6Y 4DR2O 2UUCO 1F7YA 4JI7O 4LF4O 1AILA 3SDLA 2DOSA 4DV5O 3O65A 4DV6O 5LMUO 4LFCO 4LFBO 2UU9O 4GKJO 1HNWO 4DV4O 3J80N 4JI8O 1D2DA 1FYJA 4AQYO 1N36O 2LW7A 4DR4O 2UXBO 5IWAO 4JYAO 3J7AU 4DR7O 3F5TA 1YZBA 5H5NA 4DV0O 4LFAO 5BXZA 1N33O 4DV2O 1KUQA 2AGAA 4X66O 4LF5O 4X64O 5IT9N 4OPHA 4NXNO 5A2QN 4JI3O 2UXCO 1HNXO 1HR0O 3R66A 4DUZO 2Z0AA 1IBLO 2ZKOA 1FKAO 4JI4O 1XEQA 4DV7O 5BR8O 5FLXN 1J5EO 4OPAA 2ZM6O 2DJVA 4DR3O 5LMNO 3OTOO 4X65O 4X62O 2UXDO 4YY3O 4JI0O 1XMOO 3J81N 4DV1O 3M8AA 3T1YO 2UUBO 4B3SO 4GKKO 4DR6O 4JI1O 4B3RO 2HHHO 4KHPO 4YHHO 4B3TO 4DV3O 4JI5O 2VQFO 1I94O 2F4VO 1X59A 4A5UB 4LF8O 1A32A 1XMQO 1HNZO 3JAMN 4DR1O 1G1XB
chains in the Genus database with same CATH superfamily
3IFXA 5EK0A 2OT5A 3GWOA 2HVJC 2EJRA 5CBFA 1D5NA 5PADA 2YXHA 2Y0IA 1V55C 1QLEC 5HFMA 2DYSB 1WNSA 1VQ6V 3JARA 3OF9A 1M57C 5JCOA 2YIBA 2YI9A 3E83A 3LNNA 4X1KA 4FFBB 4PT5A 4YVAA 2WLLA 1PPJH 4LP8A 4DW0A 1RSOA 2C2AA 1Q81W 2XU1A 3N2GB 2OTLV 2WSSG 3UO2A 4X89A 1K97A 4TV8A 1HNWO 3RWRD 4L8JA 5J2TA 3WB1A 5A24A 4DR5B 2VS0A 4PA9A 1KKCA 5LHHA 2PI4A 1GMGA 2V1DA 4N79A 3OVXA 2ATKC 4DR6B 2FE8A 3SYOA 2NN4A 4P30A 1TUEB 2E00A 1DF4A 3ASOC 2OIGA 3IC9A 1JOYA 1EBOA 4B7EA 4X66B 3F75A 2XU5A 3OR7C 1LUWA 2YICA 1FKAO 1RSOB 1Q8IA 4IGGA 1S5JA 5GTIZ 1KP3A 2CTWA 2ZQMA 5D5PA 1GAXA 4O4IB 1EWMA 2OCHA 4TOIA 2ODMA 4U7OA 3ZHTA 2KB1A 4JI0O 1HW7A 1H2SB 1XMOO 2RN9A 4Z2WA 1SRYA 3QJ3A 3ZS8C 1MOFA 4B3RB 4XDJA 5JH7B 2ZIOA 4I4TB 1YJNV 4FM0A 4BIUA 4K8XA 1NB3A 4DR1O 3CX5F 2HH5A 3JAWA 1PL4A 4W5CA 3I3TA 3L75H 5L3BA 1PNLA 1AU0A 4JAUA 1VQLV 4H0LB 4K8ZA 4QRXA 1QR8A 1ME4A 3OW2U 2XAGA 1QVGU 3B77A 3OVZA 2N74A 3CBKA 3P5UA 5B1AB 3KWBX 2W0FC 1PNMA 3SPIA 1W59A 5J2UA 3JARB 2Y69B 2X0LA 3O65A 1XI1A 4X6HA 1QNMA 2WWWA 1ZIVA 1MNGA 4X1YA 2XTAA 1KFUL 3VOUA 3BCCH 4EKWA 4PHZA 4GKKB 1H2NA 4FLUA 4C7UA 4JTDB 3NR7A 2UXXA 3JAWB 5ITZA 4KFMA 1O0EA 3JD0A 1XUQA 2BOBC 3RYCB 2AZ2A 1S77D 1KUQA 4FMTA 3T1YB 1I94B 4AXLA 4D6TH 2Q0AA 4MVRA 1XQ8A 4X6JA 1JVMA 2GHUA 1THZA 1BP4A 2A0LA 4EFEA 3CHXA 1OCRB 3BCNA 4DV7O 4UCTA 2BE3A 3CRMA 5KLVH 2F1MA 3MHHC 5FL7G 2E03A 2BTQA 4X65O 4GX1A 4JF3A 3E8BA 3ASNC 1SNKA 1CJLA 3MORA 1AU2A 3JAKB 3PHUA 3AG3C 3ZCCA 4RF1A 4B3SO 1CTEA 1KB9F 4F6RA 4I9QA 5IYZA 3WB0A 1GCBA 2QR4A 4FLTA 4JI1O 3APOA 2PTMA 1FXKC 3VQWA 1M56B 2Q6AA 1CVZA 1OCRC 1CS8A 5B5EZ 1X59A 4I5SA 5IYDO 2GUZA 5KUKA 4E4EA 3BABA 3BPZA 3UQ8A 4WFEA 3HKBB 1VARA 3BA8A 1JQPA 5JWPA 1YEWA 1MIRA 4O4JA 4JI4B 4QE9A 2DCBA 5JVDA 4JAAA 5LMNB 1MSDA 1Z5WA 2DZYA 4CZZA 2WPDG 1Q86W 3DGEA 1K33A 3CB2A 2G8EA 4E2LA 1KKDA 2R6NA 2ZE8A 2F7DA 5LL6Y 1N33B 5JH3A 1F7YA 3SPHA 2EJ7A 3B79A 4YJ3A 2N05A 2UXBB 2CAZC 5BR8B 2DCAA 1OCCC 4ZIBA 4GKJO 1S76D 2GV9A 4MTXA 1R6KA 3OFNG 3H1LH 1Y6XA 3HKBA 3RYCA 1NH2B 3CC7V 3T1CA 2EINB 2C0YA 4GYCB 3ABMB 1Y67A 1NU1H 2YJ2A 4QGPA 5IJ9B 1Y74A 4BAYA 4G28B 2AGAA 4X66O 2F23A 4DXWA 4OPHA 4DV0B 5IT9N 1EWLA 4MT8A 5BMVA 3BY4A 2EIJC 5BZBA 3BA9A 3SGIA 1BHAA 5EBWC 1KP2A 4FFKA 1F51A 3MDSA 1XMQB 2QWOB 1S3JA 2RDCA 2WLLB 2Y6EA 3ZIAG 3OGIB 2NNUA 3QO7A 4IHJA 3TMPA 2ADPA 5LMNO 3E22A 3SJQC 4P16A 2QKSA 3JALA 1G6UA 2E5LB 4LWSA 1EZJA 1PBHA 5CVMA 4I50B 4O2AB 1I5YA 2FRQA 2EIJB 4JI2B 5K16A 1SC5B 2EIKB 2LFSA 3ABTA 5F02A 3PT2A 1GM7A 2BTQB 3CC4V 2HKOA 4AILC 3F7VC 3OEHG 4A5UB 2XNDG 3ZMSA 2RCVA 2ACTA 1L8DA 4MTOA 2ZDIA 1MMMA 2YDEA 4B3TB 4MVZA 2Q9LA 2HXZA 3JYCA 1N34O 3IUTA 4X9QA 4LF6O 5E1AC 1DEUA 4L87A 5IE9A 3DXRA 1IBKO 1QMYA 3IAYA 2P67A 4LH6A 3GWKC 1JJ2U 2EIMB 3UT5B 1R3IC 4YYQA 2A3QA 3CE2A 1KXRA 4ZI7B 2OTJV 1HWYA 3B4SA 3KX1A 1ENVA 2WLHA 5IYCO 2YIBD 3JCZA 4WFGA 1VQ7V 3HKDB 4DV4O 2DWDC 5CBGA 1LNQA 1SQBH 3V6CA 4O2BA 3CD6V 3HHIA 1CV8A 2Y69C 3N2KA 3BWKA 4TQFA 1GN6A 2FUDA 2NQGA 1NQTA 2YJBA 1E79G 1JMKC 3A2FA 2A9HA 2VRZA 3LDDA 4MI7A 3E8HA 1SQGA 3AI8A 2LW1A 2ZIMA 1BT8A 5C8YA 5LGUA 1PXVA 3DF0A 1LUVA 3UCSC 5CA1B 5KHKA 1PPOA 2X6CA 1YALA 4CDEB 4X1KB 4YV8A 2F43G 2ZD9A 4DV1B 4P6EA 4YJ2A 2B1GA 1R3JC 2YIAA 2E3CA 1JPXA 1P7GA 5AG2A 4ZOLB 3ABLC 1BQZA 1CXZB 4LCUC 4ZBMA 1BE3H 2YC0A 2ZNIA 1MZEA 4FFBA 4PA6A 3KCYA 4FJCA 4MW8A 5H6RA 4JI5O 5CHTA 5LP6B 3S3XA 4MSXA 3AK2A 1WAZA 3JASB 1NVPD 1AU4A 1RP3B 2Z5UA 2H3OA 1HNXB 1HR0B 3LDEA 3KG2A 4DV6B 1QHTA 2H8PC 1PCIA 1XDCA 3CCVV 4JPRA 1QU7A 1QBZA 2VQEO 1FJGB 1XNQO 3K0DA 2VQEB 1FJGO 3E8FA 2UUAO 1XILA 4EB6A 4LF9O 1TVKB 4QE7A 1QVFU 1SZXA 2YUAA 4DR7B 2Y4TA 3CJHA 2JIZG 4LF7O 1JFFA 3RBZA 2QSAA 4BOUA 1ZX3A 4GUAA 3BB7A 4CDFB 5LYJB 3ETEA 1VP7A 1F4MA 1SZTA 3SDLA 1GO3F 1K73W 4TSFG 3F5WC 2B5UA 3AG4C 4BW9A 2DYRC 3G80A 3E22B 4LFBB 4GZRB 3GVMA 5EYPB 2GTAA 4K7CA 4GX0A 1N8RW 4KLBA 2KKWA 2K9PA 3K5NA 2JEUA 4J11A 4I0XB 1A6RA 1NVPB 4MZOA 4I0XA 4FIPA 3JATA 3JD3A 1NTZH 3LSUA 1DTOA 1VQOV 1M56C 2QM8A 4K3AA 3P5XA 3AG4B 1UPGA 2EIKC 2GSMB 3QTCA 4O4LB 5CHVA 2LQTA 2P4VA 4DR3O 4W4UA 2IPPB 2DQ3A 1Y08A 3OF8A 2ZE6A 1YTFB 3IFUA 2LGWA 4X62O 4YYWA 1AYVA 3FYEB 2CGNA 3ZHQA 1VQ9V 2R9FA 4WFBV 1HUCB 2JTCA 1PE6A 4Q8HA 4W4KA 4LF7B 4UB6Z 2IJIA 1IVSA 2Y48A 1B6QA 4IL6Z 3C9EA 3A0HZ 1DKIA 1Y74B 2Y4UA 1XREA 1G4YB 3W30A 2PY5A 5CA1A 4ABMA 3I5DA 2E74B 1F2AA 4TV8B 5EZQA 3ZX6A 1M5IA 1YDXA 3C3SA 1F4NA 3E8GA 2JS3A 4BQVA 4D8IA 2G6DA 1M1KW 4WA6A 4BS5A 4UB8Z 2WBFX 4U3FH 2X7RB 3K24A 3H1HH 1U9XA 3G4SV 3ETQA 3OM3B 1EFRG 1GM8A 3BAAA 4DV6O 2FYEA 4LFCO 2DMXA 2VHFA 2PYLA 5EC2C 3CMAV 3EVKA 4RNAA 5CB4B 5L3DA 3G6EV 1FFXB 1IDSA 9PAPA 4DR4O 4JAVA 1BCCH 2JS5A 1JFFB 2Q68A 4PP1A 4CH6A 2P7TC 2A79B 5J94A 2GBOA 4ICGA 4DUYB 4LH7A 5A2QN 1PD3A 2YXYA 3WFVA 4WF9V 3DSQA 3AEIA 3P30A 2AW9A 5FPWA 4JI3B 4GLXA 1KFXL 2M7WA 4YYVA 1OCZC 3TNXA 3BOWA 2AHYA 1NKDA 1JQ0A 2HJDA 1E1QG 2NR5A 2X6AA 4DO2A 3PHWA 2DE0X 4JI7B 2DJVA 3ZRWA 1N36B 5LOVB 1H2GA 3RYIA 2HVKC 3OGCC 1K5QA 4RO2A 5KHGA 3QO5A 1NTKH 1WN7A 4ZTBA 1Y4MA 1AR4A 3W7UA 5KHIA 2BDZA 2ZXWB 4FZ1A 3FAVA 4AXMA 5EIBD 4R6ZA 3USVA 5KAIZ 3C0RA 2QTOA 4Q6GA 1H38A 2Y5BA 2Q67A 1KD1W 1TUBB 2XAFA 3UM7A 5DEDA 2P06A 4K0KB 2GDSA 4ZKIA 4IP3A 4QPJA 1KU9A 2QGNA 1ORQC 1NI8A 5JA7A 5JCOC 3RVXA 3A0BZ 1COWG 1BY8A 2NLJC 3TXQA 3ICXA 3KFQA 4FVMA 2P22C 1VQNV 1STFE 1I7FA 1L0NH 5TISZ 4DV2B 2CTQA 3RVVA 1WPXA 4B3MO 4RKXA 4IHJB 4B3MB 3RYFB 2YI8A 1AI5A 4GUNA 3CRCA 4QIWF 3O0UA 4N4ZA 2R9NA 1J5EB 5J9PC 2EX3A 1L0LH 2JJ2G 1GN3A 1NPZA 2ZCEA 4D8EA 3J80N 4DV4B 2IJHA 3HHAA 1N36O 3PBHA 1U9WA 1ZSPA 3K9SA 4RAIA 4JI5B 3K8UA 3F5TA 2G8JA 4MTFA 3K3WA 2VHSA 3QT4A 4G2KA 4OX9B 1N32B 4JI8B 3ZRVA 4DR3B 4DMXA 5CB4A 2PF4E 1TA8A 1Q82W 2DYRB 3VQXA 1MSWD 1BMFG 1VF6A 3CXHF 1MA1A 4O2AA 2QKAA 2BSKB 1IZ3A 1R73A 3JSLA 2XU3A 1FFTB 4CS4A 2FT2A 2ZR3A 3CCSV 2J7QA 2DYSC 5FPOA 4PV1B 2PADA 3RN4A 3D36A 2FMLA 2G7YA 4GX2A 2HLDG 3WU2Z 1GN2A 2HFEC 5J2TB 3PNRA 1F2CA 2ARYA 3O1GA 3ERVA 4UUJC 3LSQA 2UXDO 3H1IH 4UVCA 3K0GA 2UXDB 2JGDB 4H44B 3ZEDA 4DV1O 3M8AA 4R3DA 1P4RA 1VQ5V 1OCOC 3FB7C 1QLEB 4GKKO 4QBBA 3EFFK 1EN4A 1EN6A 4UV8A 3G67A 2R9MA 4JYAB 5LOVA 3L70H 3UT5A 2AS8A 2F4VO 2RJZA 4RQEA 3N2KB 1AIMA 2WLNA 2D3OW 1HNZO 2BTWB 2JQGR 1K5SA 3BRCA 1KYOF 3DTUB 3DC5A 4N23A 3E86A 1FFXA 1GK9A 2R9AA 3ASOB 4RUEA 5CVOB 2W0XA 1ZL8B 2CK3G 2QWPB 2ZXWC 4OX9O 5DM6V 3C3TA 3P5VA 5B1NA 4BW5A 2K1EA 1GM9A 4GX5A 2XAQA 2P7UA 3ABUA 3E1ZB 4FM2A 1M9NA 4J80A 5JZEA 1W2BU 1Q6UA 4MM3B 4DV3B 1GKFA 5LGNA 4DV5O 4FIPC 1DF5A 2A7WA 5EGWA 5BMVB 1O9HA 4B3SB 1B3QA 1YK7A 3K59A 3H8CA 2O57A 3CS5A 4H33A 5H2FZ 5BXZA 2HHNA 1WLEA 2EILC 3ZMUA 1KC8W 2QA4V 1VQPV 1Q43A 3ABLB 1SQXH 1RM1C 1YIJV 5LXTA 2QM4A 1P84F 1NH2D 4FLXA 3SYCA 1FH0A 1MHWA 5KUMA 4OW0A 1UJWB 2OYQA 2ZKOA 1K3BB 3K9AA 2EZOA 4TV9A 1K3EA 2JJ1G 5DN6G 4LFAB 4JASA 2PNSA 3SYAA 2R70A 1R3KC 3RFRA 3K5OA 3PRMA 4RQFA 2BCCH 1EF7A 4P6GA 1MG1A 1YVBA 1EM1A 5LMUB 4WFHA 3L71H 4YY3B 2L35A 2EILB 4DV7B 2IW5A 1BGYH 2BSKA 4NTXA 4ZOLA 4QNHB 3AG2B 5J2UB 4F4LA 1V54C 2UUBB 1SA0B 4J42A 1PADA 3PN1A 2WAMA 8PCHA 2AYOA 4DV5B 1VMGA 4B3TO 1ZTEA 2B9ZA 1QOLA 1N0JA 2OWOA 3PHXA 4RY2A 3IJ4A 3S3WA 1AR5A 4HAMA 3MD0A 4LF8B 3L72H 1SA0A 2RQ6A 1N0NA 2JRIA 4JV5B 4LBEC 3ZNHA 4WBNA 7PCKA 4J7JA 1Y4HA 1PM9A 2BTWA 3IGAC 1XHZA 3T2MA 3H1JH 5EBLC 3CYOA 2P6JA 1VQKV 1US6A 4PDVA 4EFBA 1VQMV 2ILMA 5KHJA 3PW3A 2WLMA 5JJJB 1AJPA 1FXKA 3AK1A 3N3KA 1YSCA 2DOSA 3JD2A 1PPDA 1SQFA 2YSUB 1B06A 4CC5A 4MTGA 3BPFA 3L9DA 2Q7EA 4TT3G 1JJOA 3P3NA 1FXKB 2UXBO 4OXSA 3J7AU 1FXHA 2QWQB 1AROP 3CCQV 1Y76A 3BEHA 4GCZA 4U3JA 1VQ8V 1N33O 1TU6A 1K8AW 2AUZA 3OTOB 3ABKB 1YT7A 3CCRV 2AYNA 4FLZA 3D36C 3CCUV 4Z1VA 1CQDA 4CS3A 2OZ2A 4YJ3B 3N27A 1PL0A 2P5OA 4LNUB 1XL6A 4R50A 3VBBA 4ZHQA 4LF4B 3JD4A 1XHXA 4XZXA 3MHSA 1VJVA 4JYYA 4JTCB 1YJ9V 3FX7A 3H7DA 2Z84A 4FJCC 2R9CA 5EZSA 3HKEA 1WJZA 2HWKA 2DW4A 4KL1A 3T1YO 1AVMA 1KBHA 4G27B 4LWSB 1YHQV 1WB7A 1AI7A 3B21A 1OHHG 1YJWV 3F5VA 2HHHO 2DJFB 2FO5A 4KUMA 2VQFB 1YF2A 2ZDIC 4IT5A 3FKSG 1YK8A 5LP6A 4TQDA 2VQFO 3HWNA 4ZUXU 5EC1C 1POPA 1EWOA 1NT2B 3D8CA 5EYPA 5IJ9A 1FS0G 4HZ3A 3MAQA 1G1XB 4HNAB 3BC3A 1MS6A 1AYWA 2XUMA 3LDCA 1O9GA 2ZT9B 4XDLA 4UCSA 2DC8A 2PREA 1NBMG 2EINC 3Q4HB 1FXVA 1S4VA 3MHHA 1D5AA 1Z5VA 4QRGA 4D8BA 5KHHA 3OQCA 2AHZA 3BBAA 3V6EA 2UUCO 4LF4O 2OCCB 2WA3A 2O6XA 4YIOA 1QR9A 5K1XA 3MTVA 3IV2A 3CXCU 3MP2A 2Q5ZA 3QF7A 4LFBO 5E79Z 3JALB 1CSBB 3X2QB 4O4IA 4W5BA 4XUIA 4CH5A 1FYJA 5KA5A 3CRAA 1ZLZA 1FD9A 3ZRWB 4JYAO 4I04A 1H8EG 3T4DA 4NTYA 3CH3X 2Y0PA 3CJHB 1HNZB 1AP6A 3ZMZA 5CBHA 4RUFA 2IJKA 4LF5O 1DLBA 1SKVA 2L6LA 4DUZB 1VEWA 1VF7A 4LR3A 3HR0A 1HNXO 1HR0O 1UKFA 2DC9A 4REZA 2OP3A 2WLJA 3SPCA 3OISA 3P5WA 1OCZB 4U3JB 2HP8A 1DF0A 1N4CA 1PPPA 1WA8A 3ABKC 3IC7A 2UUAB 2YJ9A 2FTDA 3OTOO 1ITOA 1RPRA 1OZ0A 4Q8GA 3ASNB 3B2EE 4LNUA 1ZL8A 5GONB 2GTSA 1ME3A 3J81N 3LXSA 4D7TA 4OVZA 3ZRXA 2ZE5A 2MW2B 3O9OA 3RYFA 1IXMA 2AVWA 1OCOB 2ZR2A 5EBMC 3LSSA 5LA6B 3WG7B 1KMIZ 1TVKA 4YIPA 2XAHA 2AUXA 4Q20A 2YXLA 1YTFD 2WA4A 3OAAG 4JTAB 5ITZB 1RFYA 1XMOB 2ETNA 2KG7B 2R9IA 4BIOA 1CP9A 4DK0A 1Q90D 4OELA 1R6TA 1SF9A 1ZUQA 4X20B 5B1BB 1AB3A 1RPOA 3OD4A 1X9YA 5B1AC 4N21A 4BR6A 1CEZA 2Q0OC 3GCBA 2QWRB 4UVBA 1H2KA 5KMGB 1MEGA 2XT9A 4PI0A 1PPNA 2DZZA 3CMEV 3ZN0A 4DR1B 2FKXA 1S0VA 3OMAB 3OT7A 3AK3A 3HD3A 3RW0A 5KMGA 2DN9A 3LNMB 2PZSA 3WG7C 3D3IA 2JGDA 1NR1A 4UCUA 3RVZA 4FK5C 4IIJB 2ITCC 1QQCA 3ZMVA 4X65B 1Q3EA 1WB8A 5LGTA 1NLJA 3RVYA 2DC7A 2ZE7A 3JCUZ 4X1IB 1N34B 2Z3YA 2XU4A 3QSDA 4IUMA 3K9MA 3BPMA 2UUCB 3CC2V 4DV2O 3RYHB 3MHSC 4PJ0Z 2GHYA 1K4CC 3SYPA 1ATKA 3H8BA 4UCRA 3SR2C 4X88A 1I0HA 2IH1C 3CCEV 4FPPA 2AU1A 5F2VO 2UXCO 2B1MA 3AG2C 1JA8A 3R66A 4N8WA 3JD1A 3CWBH 5IYBO 1CPJA 3U11A 3TK1A 5L3EA 4I07A 4JI4O 4HBNA 1J5EO 1XL4A 2BOCC 4J9YB 6PADA 5FNVA 4CBCA 3LUTB 5LP6C 2IU0A 1AJQA 2Q7GA 4YYRA 3WXGA 1YCIA 1K92A 4DK1A 3E9SA 2D2CB 4LC1A 1EZVH 1PIPA 4I9WA 4KP4A 4DRXB 4EEQA 5GW7A 4CH4A 4DRXA 3TXSA 4YJ2B 2PYJA 4KHPO 1NQCA 4YHHO 4I4TA 4DV3O 1TUBA 3M7MX 3G71V 1FAFA 1VF5B 1J95A 4J7ZA 3QVNA 2EBOA 3M99B 4OVZB 2CDYA 4NYKA 1FPOA 1SQPH 2FQ9A 1WP8A 1BHBA 1BQ0A 4DUYO 1R1BA 5LHIA 2R9OA 3AG3B 2QDOA 2XHBA 3KW9A 3HKCB 3OUFA 1M4UA 5HFLA 4PA3A 2E75B 2Q8VA 1TLOA 1NTMH 3T1HO 1OV9A 3STZC 1AI6A 3PSEA 4I7ZB 4JI0B 1KHQA 1ZCMA 2F95B 3TGUH 1IBLB 1KHPA 4JI8O 2CTPA 1BZKA 5FPRA 4WFAV 3L74H 4R7CA 2Q4PA 4BIZA 1ICFA 5IY5C 2ZNJA 1I08A 1MZFA 4H13B 3CSXA 1SQQH 2NQIA 4BOQA 1WP7A 2Z0AA 4CH3A 2FTKA 4PDRA 1EWPA 5LYJA 4BOZA 2R9RB 4OGQB 5D5QA 1THEA 5LBQA 2NQAA 1L1FA 4AQYB 4JI1B 3OMIB 4NKGB 4QPKA 1SETA 2YS8A 3DXRB 1UFIA 2ADQB 3ZHUA 4P2ZA 5CA0A 4X20A 2UU9B 4JZGA 3TCUA 5JVDB 3K5LA 3NHEA 3CBJA 1S5LZ 2GFOA 4O4JB 3KKUA 4MVOA 3ZJZA 1QLNA 3X2QC 4TUYB 1R3LC 3W7WA 1HDJA 2JQFR 1PNKA 1U9QX 4PD4F 1W0KG 2PGGA 3SPJA 4DMYA 5IWAB 1PKXA 1I94O 2DCCA 1NZ6A 4NTWA 3APQA 1NL6A 1GRJA 2KQXA 1HNWB 3STLC 5EF4A 1VQ4V 4X8AA 4O2BB 3I06A 4X1IA 3WXEA 4DR5O 1Z2GA 2IJJA 4NXMB 1GECE 1VF6C 5EIBC 1Q5OA 3OTFA 4JI2O 1G8MA 3ZUAA 2RMKB 4MVUA 1M57B 2J7QC 5L3FA 5LA6A 2YJCA 1S72V 1AP5A 1PVJA 3HB3B 1Y76B 3FAVB 5KAFZ 4CS2A 1H2MA 1AILA 1U5IA 3F7YC 3CEIA 4PADA 4MZSA 2XOKG 2UU9O 3P3PA 1M6DA 3CH2X 5CN0A 2OCCC 2YEVB 4AQYO 1QXPA 1QCEA 4DYLA 1U9VA 4WFFA 1YZBA 3M99A 2CE4A 3B8NA 5H5NA 1V54B 2EIMC 4TWKA 1AI4A 2EZPA 2QEXV 4UXNA 2YEVA 3LFYA 3K08A 3CCJV 4CC6A 4X1YB 4DUZO 4FK5A 2OIEA 1IBLO 5CVNB 4LFCB 2OULA 3CP1A 1K7DA 2HR3A 1SESA 2YIDA 4KHPB 4JYCA 4A5UA 3D6SA 2E01A 1K34A 2G38A 3ZHSA 4EB6B 4X6IA 2P0RA 3QO8A 3K57A 1RM1B 3K06A 1K4DC 4J7KA 4JGSA 3PRPA 4YY3O 1HP8A 4BOSA 4F6RB 1NB5A 4X62B 4LF9B 3N2GA 4WBNB 2Q73A 2CH7A 3U0ZA 2P4KA 4DW1A 1S5HC 1IBMB 3BFRA 5CA0B 3E89A 3U8EA 2B1IA 3WXFA 4PA7A 1SERA 2DJGB 3FB8C 1CB5A 3RYHA 1A32A 4BWAA 1KQSU 3FB6C 1I5XA 5JQGA 3JAMN 1ROPA 1XOUA 1QDQA 1F29A 5IYZB 3TRKA 1V55B 3GB7C 3OEEG 5KA6A 4J41A 2HD5A 4XBFA 5B3SC 2IH3C 4AHCA 3THOA 3WB2A 4OEMA 2GUZB 3ML0A 2P90A 3I56V 1JCHA 2EULA 5JJNB 1K9MW 2P86A 4BS6A 5B66Z 1AYUA 3CCMV 2IBIA 2A06H 3ABMC 4LF5B 1X4TA 1N32O 1BS3A 2HEPA 3BHPA 3ZHRA 3W7SA 4FM1A 1XBLA 3R65A 4H37A 3SPGA 3TETA 1XNRB 3AG7A 1Q6KA 3W7XA 4P9PA 5LMUO 3FB5C 2E02A 2AZ0A 1PV0A 3AG1B 2CUGA 2KSDA 1GTOA 1GH6A 1YITV 4DR7O 2MK3A 3ZHVA 3UKMA 1TGOA 4HXDB 1YI2V 2F93B 3ZMTA 4CDCB 4PP2E 4JI3O 1MDWA 4XR7A 2N04A 5B1OA 2CIOA 1IBKB 3H1KH 2JVDA 3T4ZA 5LHGA 2AIMA 5KO3A 3W31A 4ASUG 4I55A 5IJ0A 1XEQA 3A8TA 2NQDB 4OPAA 2UXCB 4MS2A 2UZJA 2YJ8A 1GLOA 3H01A 3ZBHA 1XKGA 4O4HB 3OR6C 4UVAA 3U10A 3HPLC 1M93A 2FYUH 5KX5B 2W6IG 4K35A 4O4HA 3SJAC 1URFA 1W0JG 5B1BC 2LJ2A 2CGOA 3ZRSA 2WLKA 1U96A 3E35A 2XASA 4HNAA 3IOQA 4PI3A 4MVSA 3B8MA 4MSWC 4I05A 3HKEB 4RF0A 5EZYB 4M0WA 4B3RO 4CDDB 4QJFB 3OE7G 4IYHA 2RNBA 4JYBA 2DC6A 1VIBA 2V7QG 1H2LA 4X64B 1AJNA 4ZHQB 5C93A 4Z1MG 4UV9A 2FL4A 5L3CA 1XNQB 3E2EA 1ZWIC 2PUSA 4TUYA 2CH7B 2FB5A 3JATB 2JEXA 4U7NA 1F23A 1AU3A 2DWEC 1DK1A 1IBMO 2IU3A 4MVMA 3ETDA 4YXWG 5H9CA 4J9ZB 5JQGB 4JI6O 5K1PA 5IY5B 5BY1A 1SP4B 2QE7G 3N4CA 4JV5O 3RT3C 3CPWU 2W6JG 3K58A 1YVWA 1NS1A 3G6BA 3QNEA 2E76B 3SYQA 2M6YA 3BY6A 5DECA 1BQIA 3T1HB 2F1GA 3SJCC 4DR2O 4JI7O 3TJTA 1Y66A 4I50A 1GMYA 1OCCB 3K03A 5C8YB 2VWJA 1MABG 3IHPA 3ZN1A 4FLWA 1D2DA 4WURA 1ZAUA 2WLIB 2LW7A 1AECA 1NR7A 3MJ5A 5IWAO 3KSEA 2Q69A 1P49A 4LFAO 1R6NA 1IXBA 5JH7A 3A0RA 3CCLV 3L73H 2CB5A 4X64O 2LO1A 4NXNO 4MVQA 3VQYA 3PDFA 1BSMA 1JR9A 4NVPA 4QH6A 3AG1C 4R8CA 2KG7A 3IMAA 3RVWA 3DC6A 4HYOA 1BL8A 2FRAA 3B40A 5BR8O 5FLXN 2QM7A 2HG5C 3CRRA 3FYIB 4YYUA 1B04A 3NXSA 4FZ0A 3KZIZ 3KKYA 2BU3A 4F6EA 2WLIA 4BOPA 2DQ0A 4W4LA 4PA4A 3D3QA 4UCVA 2JGUA 3HKDA 5EZYA 2F66C 4MW3A 1PP9H 5CMUA 4J10A 1SQVH 3RGBA 4AI8A 4LF6B 1T5EA 5GONA 2ARHA 2BDLA 5LXTB 4FLYA 4WCEV 4UFZA 4PI2A 3K79A 3OMNB 2QJ1A 3P32A 5KX5A 2PBHA 1WPBA 3Q4HA 1XMQO 5H6QA 2JK5C 1OJHA 1IWDA 3UO3A 1GN4A 1AR1B 1VSNA 4PDMA 4I55B 2HHHB 1XNRO 2ITDC 4NXNB 1EN5A 3JAKA 3S3RA 3SJBC 3H89A 4NXMO 1Q6IA 2ZM6B 4BPVA 4BSQA 1IX9A 2E5LO 5IDJA 2H7JA 4G54A 3PJSK 4DR4B 2IM9A 3I55V 1IURA 4NR1A 5FNVB 4NB5A 4ZI7A 2H94A 4K0KO 1MEMA 1F2BA 1V9PA 4TV9B 2V4DA 4GKJB 3EHBB 3IEJA 4HWYA 3EXAA 1Q6HA 4IIJA 4P9OA 3S3QA 4JI6B 1TL9A 3H9VA 1DGSA 1U97A 3KCXA 3RNVA 3KWZA 1SS3A 4O4LA 4DV0O 3JASA 1LR1A 3JSNA 4DR2B 4PDLA 2AXTZ 2HJFC 3FD9A 1E1RG 3OUSA 4YYSA 2BTOA 2F4VB 2R72A 4JZ2A 4GT1A 5E6JA 2IBZH 1JX9A 5JJEB 2ATOA 3K5MA 4KXRA 5A9GA 3CRQA 4XDKA 4D7SA 3C90A 1P7BA 5GTHZ 2CTRA 4FLVA 4UCOA 1Q7YW 3MTNA 4QRVA 3W7TA 4B7KA 2ZM6O 3B09A 2QWNB 5L3GA 1BGOA 2LGQA 2XAJA 2DCDA 5CA3A 2VWKA 2X6BA 1TAEA 2Q7HA 2ZINA 4YHHB 3FFQA 3BVOA 5B3SB 2LFRA 2UUBO 2JDIG 4PELA 2PI5A 1KECA 1CPYA 4DR6O 3VQVA 2QTSA 3K04A 4RWUA 1H8HG 2B1NA 3N3GA 2LP7A 3RYIB 1NJIW 4IYIA 4B08A 1WA8B 4LF8O 3HKCA 4CZWA 3H6SA 3ETGA 2QKCA 1YXBA 1M90W 2UXNA 3QG5A 5IJ0B
chains in the Genus database with same CATH topology
2JRIA 4DR5O 1N34O 1XNRO 3ZNHA 1DK1A 1IBMO 4DUYO 1R1BA 2VQEO 1XNQO 5EZQA 4JI2O 1R6TA 1FJGO 4LF6O 1AB3A 4JI6O 4OX9O 2BTWA 2UUAO 4NXMO 5BY1A 1IBKO 4LF9O 2E5LO 2J7QC 4JV5O 3RT3C 4B3MO 4RKXA 4D8IA 1PVJA 1NS1A 4D8BA 4LF7O 2FKXA 2N74A 3T1HO 3OQCA 1N32O 4PT5A 4K0KO 4BOUA 4GUAA 3BBAA 3BB7A 5LL6Y 4DR2O 2UUCO 1F7YA 4JI7O 4LF4O 5JZEA 1AILA 3PSEA 4MM3B 3SDLA 3MTVA 2DOSA 4DV5O 3O65A 4DV6O 5LMUO 4LFCO 3MP2A 4LFBO 2UU9O 4GKJO 3RNVA 1HNWO 4DV4O 4RNAA 4D8EA 3J80N 4JI8O 1D2DA 4WURA 1FYJA 4AQYO 1N36O 2LW7A 3MJ5A 4DR4O 2UXBO 5IWAO 4JYAO 3J7AU 4DR7O 3F5TA 1YZBA 4IUMA 5H5NA 4DV0O 4LFAO 4HXDB 5BXZA 1N33O 4DV2O 2FE8A 1KUQA 2AGAA 4X66O 4LF5O 4X64O 5IT9N 4OPHA 4NXNO 5A2QN 3BY4A 4JI3O 4MI7A 2UXCO 1HNXO 1HR0O 4BOQA 5E6JA 3R66A 4DUZO 2Z0AA 1UKFA 5KO3A 4REZA 1IBLO 4OW0A 3W31A 2ZKOA 1FKAO 4JI4O 1XEQA 4DV7O 2J7QA 5BR8O 5FLXN 1J5EO 4OPAA 4BOZA 2UZJA 3PHWA 2ZM6O 2DJVA 4A5UA 3TMPA 4DR3O 3PRMA 4XZXA 2BU3A 5LMNO 3OTOO 3E9SA 4X65O 4BOPA 4P16A 3IFUA 4X62O 2UXDO 3PRPA 4YY3O 4BOSA 2Z84A 5EZSA 4JI0O 3PHUA 1XMOO 2HWKA 4ZTBA 3J81N 4DV1O 3M8AA 4R3DA 3T1YO 2UUBO 4RF1A 4B3SO 2JTCA 4RF0A 4GKKO 4DR6O 4JI1O 4M0WA 4OVZA 3B21A 4B3RO 2HHHO 4KHPO 3PT2A 4YHHO 4B3TO 3C0RA 4DV3O 4JI5O 3PHXA 2VQFO 1I94O 2F4VO 1X59A 1DKIA 4A5UB 4LF8O 1A32A 1XMQO 4IP3A 1HNZO 2BTWB 3JAMN 4DR1O 3W30A 4OVZB 1G1XB 3TRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  4DR5 O;  1N34 O;  1XNR O;  1DK1 A;  1IBM O;  4DUY O;  1R1B A;  2VQE O;  1XNQ O;  4JI2 O;  1R6T A;  1FJG O;  4LF6 O;  1AB3 A;  4JI6 O;  4OX9 O;  2UUA O;  4NXM O;  5BY1 A;  1IBK O;  4LF9 O;  2E5L O;  4JV5 O;  3RT3 C;  4B3M O;  1NS1 A;  4LF7 O;  2FKX A;  2N74 A;  3T1H O;  1N32 O;  4K0K O;  5LL6 Y;  4DR2 O;  2UUC O;  1F7Y A;  4JI7 O;  4LF4 O;  1AIL A;  3SDL A;  2DOS A;  4DV5 O;  3O65 A;  4DV6 O;  5LMU O;  4LFC O;  4LFB O;  2UU9 O;  4GKJ O;  1HNW O;  4DV4 O;  3J80 N;  4JI8 O;  1D2D A;  1FYJ A;  4AQY O;  1N36 O;  2LW7 A;  4DR4 O;  2UXB O;  5IWA O;  4JYA O;  3J7A U;  4DR7 O;  3F5T A;  1YZB A;  5H5N A;  4DV0 O;  4LFA O;  5BXZ A;  1N33 O;  4DV2 O;  1KUQ A;  2AGA A;  4X66 O;  4LF5 O;  4X64 O;  5IT9 N;  4OPH A;  4NXN O;  5A2Q N;  4JI3 O;  2UXC O;  1HNX O;  1HR0 O;  3R66 A;  4DUZ O;  2Z0A A;  1IBL O;  2ZKO A;  1FKA O;  4JI4 O;  1XEQ A;  4DV7 O;  5BR8 O;  5FLX N;  1J5E O;  4OPA A;  2ZM6 O;  2DJV A;  4DR3 O;  5LMN O;  3OTO O;  4X65 O;  4X62 O;  2UXD O;  4YY3 O;  4JI0 O;  1XMO O;  3J81 N;  4DV1 O;  3M8A A;  3T1Y O;  2UUB O;  4B3S O;  4GKK O;  4DR6 O;  4JI1 O;  4B3R O;  2HHH O;  4KHP O;  4YHH O;  4B3T O;  4DV3 O;  4JI5 O;  2VQF O;  1I94 O;  2F4V O;  1X59 A;  4A5U B;  4LF8 O;  1A32 A;  1XMQ O;  1HNZ O;  3JAM N;  4DR1 O;  1G1X B; 
#chains in the Genus database with same CATH topology
 3IFX A;  5EK0 A;  2OT5 A;  3GWO A;  2HVJ C;  2EJR A;  5CBF A;  1D5N A;  5PAD A;  2YXH A;  2Y0I A;  1V55 C;  1QLE C;  5HFM A;  2DYS B;  1WNS A;  1VQ6 V;  3JAR A;  3OF9 A;  1M57 C;  5JCO A;  2YIB A;  2YI9 A;  3E83 A;  3LNN A;  4X1K A;  4FFB B;  4PT5 A;  4YVA A;  2WLL A;  1PPJ H;  4LP8 A;  4DW0 A;  1RSO A;  2C2A A;  1Q81 W;  2XU1 A;  3N2G B;  2OTL V;  2WSS G;  3UO2 A;  4X89 A;  1K97 A;  4TV8 A;  1HNW O;  3RWR D;  4L8J A;  5J2T A;  3WB1 A;  5A24 A;  4DR5 B;  2VS0 A;  4PA9 A;  1KKC A;  5LHH A;  2PI4 A;  1GMG A;  2V1D A;  4N79 A;  3OVX A;  2ATK C;  4DR6 B;  2FE8 A;  3SYO A;  2NN4 A;  4P30 A;  1TUE B;  2E00 A;  1DF4 A;  3ASO C;  2OIG A;  3IC9 A;  1JOY A;  1EBO A;  4B7E A;  4X66 B;  3F75 A;  2XU5 A;  3OR7 C;  1LUW A;  2YIC A;  1FKA O;  1RSO B;  1Q8I A;  4IGG A;  1S5J A;  5GTI Z;  1KP3 A;  2CTW A;  2ZQM A;  5D5P A;  1GAX A;  4O4I B;  1EWM A;  2OCH A;  4TOI A;  2ODM A;  4U7O A;  3ZHT A;  2KB1 A;  4JI0 O;  1HW7 A;  1H2S B;  1XMO O;  2RN9 A;  4Z2W A;  1SRY A;  3QJ3 A;  3ZS8 C;  1MOF A;  4B3R B;  4XDJ A;  5JH7 B;  2ZIO A;  4I4T B;  1YJN V;  4FM0 A;  4BIU A;  4K8X A;  1NB3 A;  4DR1 O;  3CX5 F;  2HH5 A;  3JAW A;  1PL4 A;  4W5C A;  3I3T A;  3L75 H;  5L3B A;  1PNL A;  1AU0 A;  4JAU A;  1VQL V;  4H0L B;  4K8Z A;  4QRX A;  1QR8 A;  1ME4 A;  3OW2 U;  2XAG A;  1QVG U;  3B77 A;  3OVZ A;  2N74 A;  3CBK A;  3P5U A;  5B1A B;  3KWB X;  2W0F C;  1PNM A;  3SPI A;  1W59 A;  5J2U A;  3JAR B;  2Y69 B;  2X0L A;  3O65 A;  1XI1 A;  4X6H A;  1QNM A;  2WWW A;  1ZIV A;  1MNG A;  4X1Y A;  2XTA A;  1KFU L;  3VOU A;  3BCC H;  4EKW A;  4PHZ A;  4GKK B;  1H2N A;  4FLU A;  4C7U A;  4JTD B;  3NR7 A;  2UXX A;  3JAW B;  5ITZ A;  4KFM A;  1O0E A;  3JD0 A;  1XUQ A;  2BOB C;  3RYC B;  2AZ2 A;  1S77 D;  1KUQ A;  4FMT A;  3T1Y B;  1I94 B;  4AXL A;  4D6T H;  2Q0A A;  4MVR A;  1XQ8 A;  4X6J A;  1JVM A;  2GHU A;  1THZ A;  1BP4 A;  2A0L A;  4EFE A;  3CHX A;  1OCR B;  3BCN A;  4DV7 O;  4UCT A;  2BE3 A;  3CRM A;  5KLV H;  2F1M A;  3MHH C;  5FL7 G;  2E03 A;  2BTQ A;  4X65 O;  4GX1 A;  4JF3 A;  3E8B A;  3ASN C;  1SNK A;  1CJL A;  3MOR A;  1AU2 A;  3JAK B;  3PHU A;  3AG3 C;  3ZCC A;  4RF1 A;  4B3S O;  1CTE A;  1KB9 F;  4F6R A;  4I9Q A;  5IYZ A;  3WB0 A;  1GCB A;  2QR4 A;  4FLT A;  4JI1 O;  3APO A;  2PTM A;  1FXK C;  3VQW A;  1M56 B;  2Q6A A;  1CVZ A;  1OCR C;  1CS8 A;  5B5E Z;  1X59 A;  4I5S A;  5IYD O;  2GUZ A;  5KUK A;  4E4E A;  3BAB A;  3BPZ A;  3UQ8 A;  4WFE A;  3HKB B;  1VAR A;  3BA8 A;  1JQP A;  5JWP A;  1YEW A;  1MIR A;  4O4J A;  4JI4 B;  4QE9 A;  2DCB A;  5JVD A;  4JAA A;  5LMN B;  1MSD A;  1Z5W A;  2DZY A;  4CZZ A;  2WPD G;  1Q86 W;  3DGE A;  1K33 A;  3CB2 A;  2G8E A;  4E2L A;  1KKD A;  2R6N A;  2ZE8 A;  2F7D A;  5LL6 Y;  1N33 B;  5JH3 A;  1F7Y A;  3SPH A;  2EJ7 A;  3B79 A;  4YJ3 A;  2N05 A;  2UXB B;  2CAZ C;  5BR8 B;  2DCA A;  1OCC C;  4ZIB A;  4GKJ O;  1S76 D;  2GV9 A;  4MTX A;  1R6K A;  3OFN G;  3H1L H;  1Y6X A;  3HKB A;  3RYC A;  1NH2 B;  3CC7 V;  3T1C A;  2EIN B;  2C0Y A;  4GYC B;  3ABM B;  1Y67 A;  1NU1 H;  2YJ2 A;  4QGP A;  5IJ9 B;  1Y74 A;  4BAY A;  4G28 B;  2AGA A;  4X66 O;  2F23 A;  4DXW A;  4OPH A;  4DV0 B;  5IT9 N;  1EWL A;  4MT8 A;  5BMV A;  3BY4 A;  2EIJ C;  5BZB A;  3BA9 A;  3SGI A;  1BHA A;  5EBW C;  1KP2 A;  4FFK A;  1F51 A;  3MDS A;  1XMQ B;  2QWO B;  1S3J A;  2RDC A;  2WLL B;  2Y6E A;  3ZIA G;  3OGI B;  2NNU A;  3QO7 A;  4IHJ A;  3TMP A;  2ADP A;  5LMN O;  3E22 A;  3SJQ C;  4P16 A;  2QKS A;  3JAL A;  1G6U A;  2E5L B;  4LWS A;  1EZJ A;  1PBH A;  5CVM A;  4I50 B;  4O2A B;  1I5Y A;  2FRQ A;  2EIJ B;  4JI2 B;  5K16 A;  1SC5 B;  2EIK B;  2LFS A;  3ABT A;  5F02 A;  3PT2 A;  1GM7 A;  2BTQ B;  3CC4 V;  2HKO A;  4AIL C;  3F7V C;  3OEH G;  4A5U B;  2XND G;  3ZMS A;  2RCV A;  2ACT A;  1L8D A;  4MTO A;  2ZDI A;  1MMM A;  2YDE A;  4B3T B;  4MVZ A;  2Q9L A;  2HXZ A;  3JYC A;  1N34 O;  3IUT A;  4X9Q A;  4LF6 O;  5E1A C;  1DEU A;  4L87 A;  5IE9 A;  3DXR A;  1IBK O;  1QMY A;  3IAY A;  2P67 A;  4LH6 A;  3GWK C;  1JJ2 U;  2EIM B;  3UT5 B;  1R3I C;  4YYQ A;  2A3Q A;  3CE2 A;  1KXR A;  4ZI7 B;  2OTJ V;  1HWY A;  3B4S A;  3KX1 A;  1ENV A;  2WLH A;  5IYC O;  2YIB D;  3JCZ A;  4WFG A;  1VQ7 V;  3HKD B;  4DV4 O;  2DWD C;  5CBG A;  1LNQ A;  1SQB H;  3V6C A;  4O2B A;  3CD6 V;  3HHI A;  1CV8 A;  2Y69 C;  3N2K A;  3BWK A;  4TQF A;  1GN6 A;  2FUD A;  2NQG A;  1NQT A;  2YJB A;  1E79 G;  1JMK C;  3A2F A;  2A9H A;  2VRZ A;  3LDD A;  4MI7 A;  3E8H A;  1SQG A;  3AI8 A;  2LW1 A;  2ZIM A;  1BT8 A;  5C8Y A;  5LGU A;  1PXV A;  3DF0 A;  1LUV A;  3UCS C;  5CA1 B;  5KHK A;  1PPO A;  2X6C A;  1YAL A;  4CDE B;  4X1K B;  4YV8 A;  2F43 G;  2ZD9 A;  4DV1 B;  4P6E A;  4YJ2 A;  2B1G A;  1R3J C;  2YIA A;  2E3C A;  1JPX A;  1P7G A;  5AG2 A;  4ZOL B;  3ABL C;  1BQZ A;  1CXZ B;  4LCU C;  4ZBM A;  1BE3 H;  2YC0 A;  2ZNI A;  1MZE A;  4FFB A;  4PA6 A;  3KCY A;  4FJC A;  4MW8 A;  5H6R A;  4JI5 O;  5CHT A;  5LP6 B;  3S3X A;  4MSX A;  3AK2 A;  1WAZ A;  3JAS B;  1NVP D;  1AU4 A;  1RP3 B;  2Z5U A;  2H3O A;  1HNX B;  1HR0 B;  3LDE A;  3KG2 A;  4DV6 B;  1QHT A;  2H8P C;  1PCI A;  1XDC A;  3CCV V;  4JPR A;  1QU7 A;  1QBZ A;  2VQE O;  1FJG B;  1XNQ O;  3K0D A;  2VQE B;  1FJG O;  3E8F A;  2UUA O;  1XIL A;  4EB6 A;  4LF9 O;  1TVK B;  4QE7 A;  1QVF U;  1SZX A;  2YUA A;  4DR7 B;  2Y4T A;  3CJH A;  2JIZ G;  4LF7 O;  1JFF A;  3RBZ A;  2QSA A;  4BOU A;  1ZX3 A;  4GUA A;  3BB7 A;  4CDF B;  5LYJ B;  3ETE A;  1VP7 A;  1F4M A;  1SZT A;  3SDL A;  1GO3 F;  1K73 W;  4TSF G;  3F5W C;  2B5U A;  3AG4 C;  4BW9 A;  2DYR C;  3G80 A;  3E22 B;  4LFB B;  4GZR B;  3GVM A;  5EYP B;  2GTA A;  4K7C A;  4GX0 A;  1N8R W;  4KLB A;  2KKW A;  2K9P A;  3K5N A;  2JEU A;  4J11 A;  4I0X B;  1A6R A;  1NVP B;  4MZO A;  4I0X A;  4FIP A;  3JAT A;  3JD3 A;  1NTZ H;  3LSU A;  1DTO A;  1VQO V;  1M56 C;  2QM8 A;  4K3A A;  3P5X A;  3AG4 B;  1UPG A;  2EIK C;  2GSM B;  3QTC A;  4O4L B;  5CHV A;  2LQT A;  2P4V A;  4DR3 O;  4W4U A;  2IPP B;  2DQ3 A;  1Y08 A;  3OF8 A;  2ZE6 A;  1YTF B;  3IFU A;  2LGW A;  4X62 O;  4YYW A;  1AYV A;  3FYE B;  2CGN A;  3ZHQ A;  1VQ9 V;  2R9F A;  4WFB V;  1HUC B;  2JTC A;  1PE6 A;  4Q8H A;  4W4K A;  4LF7 B;  4UB6 Z;  2IJI A;  1IVS A;  2Y48 A;  1B6Q A;  4IL6 Z;  3C9E A;  3A0H Z;  1DKI A;  1Y74 B;  2Y4U A;  1XRE A;  1G4Y B;  3W30 A;  2PY5 A;  5CA1 A;  4ABM A;  3I5D A;  2E74 B;  1F2A A;  4TV8 B;  5EZQ A;  3ZX6 A;  1M5I A;  1YDX A;  3C3S A;  1F4N A;  3E8G A;  2JS3 A;  4BQV A;  4D8I A;  2G6D A;  1M1K W;  4WA6 A;  4BS5 A;  4UB8 Z;  2WBF X;  4U3F H;  2X7R B;  3K24 A;  3H1H H;  1U9X A;  3G4S V;  3ETQ A;  3OM3 B;  1EFR G;  1GM8 A;  3BAA A;  4DV6 O;  2FYE A;  4LFC O;  2DMX A;  2VHF A;  2PYL A;  5EC2 C;  3CMA V;  3EVK A;  4RNA A;  5CB4 B;  5L3D A;  3G6E V;  1FFX B;  1IDS A;  9PAP A;  4DR4 O;  4JAV A;  1BCC H;  2JS5 A;  1JFF B;  2Q68 A;  4PP1 A;  4CH6 A;  2P7T C;  2A79 B;  5J94 A;  2GBO A;  4ICG A;  4DUY B;  4LH7 A;  5A2Q N;  1PD3 A;  2YXY A;  3WFV A;  4WF9 V;  3DSQ A;  3AEI A;  3P30 A;  2AW9 A;  5FPW A;  4JI3 B;  4GLX A;  1KFX L;  2M7W A;  4YYV A;  1OCZ C;  3TNX A;  3BOW A;  2AHY A;  1NKD A;  1JQ0 A;  2HJD A;  1E1Q G;  2NR5 A;  2X6A A;  4DO2 A;  3PHW A;  2DE0 X;  4JI7 B;  2DJV A;  3ZRW A;  1N36 B;  5LOV B;  1H2G A;  3RYI A;  2HVK C;  3OGC C;  1K5Q A;  4RO2 A;  5KHG A;  3QO5 A;  1NTK H;  1WN7 A;  4ZTB A;  1Y4M A;  1AR4 A;  3W7U A;  5KHI A;  2BDZ A;  2ZXW B;  4FZ1 A;  3FAV A;  4AXM A;  5EIB D;  4R6Z A;  3USV A;  5KAI Z;  3C0R A;  2QTO A;  4Q6G A;  1H38 A;  2Y5B A;  2Q67 A;  1KD1 W;  1TUB B;  2XAF A;  3UM7 A;  5DED A;  2P06 A;  4K0K B;  2GDS A;  4ZKI A;  4IP3 A;  4QPJ A;  1KU9 A;  2QGN A;  1ORQ C;  1NI8 A;  5JA7 A;  5JCO C;  3RVX A;  3A0B Z;  1COW G;  1BY8 A;  2NLJ C;  3TXQ A;  3ICX A;  3KFQ A;  4FVM A;  2P22 C;  1VQN V;  1STF E;  1I7F A;  1L0N H;  5TIS Z;  4DV2 B;  2CTQ A;  3RVV A;  1WPX A;  4B3M O;  4RKX A;  4IHJ B;  4B3M B;  3RYF B;  2YI8 A;  1AI5 A;  4GUN A;  3CRC A;  4QIW F;  3O0U A;  4N4Z A;  2R9N A;  1J5E B;  5J9P C;  2EX3 A;  1L0L H;  2JJ2 G;  1GN3 A;  1NPZ A;  2ZCE A;  4D8E A;  3J80 N;  4DV4 B;  2IJH A;  3HHA A;  1N36 O;  3PBH A;  1U9W A;  1ZSP A;  3K9S A;  4RAI A;  4JI5 B;  3K8U A;  3F5T A;  2G8J A;  4MTF A;  3K3W A;  2VHS A;  3QT4 A;  4G2K A;  4OX9 B;  1N32 B;  4JI8 B;  3ZRV A;  4DR3 B;  4DMX A;  5CB4 A;  2PF4 E;  1TA8 A;  1Q82 W;  2DYR B;  3VQX A;  1MSW D;  1BMF G;  1VF6 A;  3CXH F;  1MA1 A;  4O2A A;  2QKA A;  2BSK B;  1IZ3 A;  1R73 A;  3JSL A;  2XU3 A;  1FFT B;  4CS4 A;  2FT2 A;  2ZR3 A;  3CCS V;  2J7Q A;  2DYS C;  5FPO A;  4PV1 B;  2PAD A;  3RN4 A;  3D36 A;  2FML A;  2G7Y A;  4GX2 A;  2HLD G;  3WU2 Z;  1GN2 A;  2HFE C;  5J2T B;  3PNR A;  1F2C A;  2ARY A;  3O1G A;  3ERV A;  4UUJ C;  3LSQ A;  2UXD O;  3H1I H;  4UVC A;  3K0G A;  2UXD B;  2JGD B;  4H44 B;  3ZED A;  4DV1 O;  3M8A A;  4R3D A;  1P4R A;  1VQ5 V;  1OCO C;  3FB7 C;  1QLE B;  4GKK O;  4QBB A;  3EFF K;  1EN4 A;  1EN6 A;  4UV8 A;  3G67 A;  2R9M A;  4JYA B;  5LOV A;  3L70 H;  3UT5 A;  2AS8 A;  2F4V O;  2RJZ A;  4RQE A;  3N2K B;  1AIM A;  2WLN A;  2D3O W;  1HNZ O;  2BTW B;  2JQG R;  1K5S A;  3BRC A;  1KYO F;  3DTU B;  3DC5 A;  4N23 A;  3E86 A;  1FFX A;  1GK9 A;  2R9A A;  3ASO B;  4RUE A;  5CVO B;  2W0X A;  1ZL8 B;  2CK3 G;  2QWP B;  2ZXW C;  4OX9 O;  5DM6 V;  3C3T A;  3P5V A;  5B1N A;  4BW5 A;  2K1E A;  1GM9 A;  4GX5 A;  2XAQ A;  2P7U A;  3ABU A;  3E1Z B;  4FM2 A;  1M9N A;  4J80 A;  5JZE A;  1W2B U;  1Q6U A;  4MM3 B;  4DV3 B;  1GKF A;  5LGN A;  4DV5 O;  4FIP C;  1DF5 A;  2A7W A;  5EGW A;  5BMV B;  1O9H A;  4B3S B;  1B3Q A;  1YK7 A;  3K59 A;  3H8C A;  2O57 A;  3CS5 A;  4H33 A;  5H2F Z;  5BXZ A;  2HHN A;  1WLE A;  2EIL C;  3ZMU A;  1KC8 W;  2QA4 V;  1VQP V;  1Q43 A;  3ABL B;  1SQX H;  1RM1 C;  1YIJ V;  5LXT A;  2QM4 A;  1P84 F;  1NH2 D;  4FLX A;  3SYC A;  1FH0 A;  1MHW A;  5KUM A;  4OW0 A;  1UJW B;  2OYQ A;  2ZKO A;  1K3B B;  3K9A A;  2EZO A;  4TV9 A;  1K3E A;  2JJ1 G;  5DN6 G;  4LFA B;  4JAS A;  2PNS A;  3SYA A;  2R70 A;  1R3K C;  3RFR A;  3K5O A;  3PRM A;  4RQF A;  2BCC H;  1EF7 A;  4P6G A;  1MG1 A;  1YVB A;  1EM1 A;  5LMU B;  4WFH A;  3L71 H;  4YY3 B;  2L35 A;  2EIL B;  4DV7 B;  2IW5 A;  1BGY H;  2BSK A;  4NTX A;  4ZOL A;  4QNH B;  3AG2 B;  5J2U B;  4F4L A;  1V54 C;  2UUB B;  1SA0 B;  4J42 A;  1PAD A;  3PN1 A;  2WAM A;  8PCH A;  2AYO A;  4DV5 B;  1VMG A;  4B3T O;  1ZTE A;  2B9Z A;  1QOL A;  1N0J A;  2OWO A;  3PHX A;  4RY2 A;  3IJ4 A;  3S3W A;  1AR5 A;  4HAM A;  3MD0 A;  4LF8 B;  3L72 H;  1SA0 A;  2RQ6 A;  1N0N A;  2JRI A;  4JV5 B;  4LBE C;  3ZNH A;  4WBN A;  7PCK A;  4J7J A;  1Y4H A;  1PM9 A;  2BTW A;  3IGA C;  1XHZ A;  3T2M A;  3H1J H;  5EBL C;  3CYO A;  2P6J A;  1VQK V;  1US6 A;  4PDV A;  4EFB A;  1VQM V;  2ILM A;  5KHJ A;  3PW3 A;  2WLM A;  5JJJ B;  1AJP A;  1FXK A;  3AK1 A;  3N3K A;  1YSC A;  2DOS A;  3JD2 A;  1PPD A;  1SQF A;  2YSU B;  1B06 A;  4CC5 A;  4MTG A;  3BPF A;  3L9D A;  2Q7E A;  4TT3 G;  1JJO A;  3P3N A;  1FXK B;  2UXB O;  4OXS A;  3J7A U;  1FXH A;  2QWQ B;  1ARO P;  3CCQ V;  1Y76 A;  3BEH A;  4GCZ A;  4U3J A;  1VQ8 V;  1N33 O;  1TU6 A;  1K8A W;  2AUZ A;  3OTO B;  3ABK B;  1YT7 A;  3CCR V;  2AYN A;  4FLZ A;  3D36 C;  3CCU V;  4Z1V A;  1CQD A;  4CS3 A;  2OZ2 A;  4YJ3 B;  3N27 A;  1PL0 A;  2P5O A;  4LNU B;  1XL6 A;  4R50 A;  3VBB A;  4ZHQ A;  4LF4 B;  3JD4 A;  1XHX A;  4XZX A;  3MHS A;  1VJV A;  4JYY A;  4JTC B;  1YJ9 V;  3FX7 A;  3H7D A;  2Z84 A;  4FJC C;  2R9C A;  5EZS A;  3HKE A;  1WJZ A;  2HWK A;  2DW4 A;  4KL1 A;  3T1Y O;  1AVM A;  1KBH A;  4G27 B;  4LWS B;  1YHQ V;  1WB7 A;  1AI7 A;  3B21 A;  1OHH G;  1YJW V;  3F5V A;  2HHH O;  2DJF B;  2FO5 A;  4KUM A;  2VQF B;  1YF2 A;  2ZDI C;  4IT5 A;  3FKS G;  1YK8 A;  5LP6 A;  4TQD A;  2VQF O;  3HWN A;  4ZUX U;  5EC1 C;  1POP A;  1EWO A;  1NT2 B;  3D8C A;  5EYP A;  5IJ9 A;  1FS0 G;  4HZ3 A;  3MAQ A;  1G1X B;  4HNA B;  3BC3 A;  1MS6 A;  1AYW A;  2XUM A;  3LDC A;  1O9G A;  2ZT9 B;  4XDL A;  4UCS A;  2DC8 A;  2PRE A;  1NBM G;  2EIN C;  3Q4H B;  1FXV A;  1S4V A;  3MHH A;  1D5A A;  1Z5V A;  4QRG A;  4D8B A;  5KHH A;  3OQC A;  2AHZ A;  3BBA A;  3V6E A;  2UUC O;  4LF4 O;  2OCC B;  2WA3 A;  2O6X A;  4YIO A;  1QR9 A;  5K1X A;  3MTV A;  3IV2 A;  3CXC U;  3MP2 A;  2Q5Z A;  3QF7 A;  4LFB O;  5E79 Z;  3JAL B;  1CSB B;  3X2Q B;  4O4I A;  4W5B A;  4XUI A;  4CH5 A;  1FYJ A;  5KA5 A;  3CRA A;  1ZLZ A;  1FD9 A;  3ZRW B;  4JYA O;  4I04 A;  1H8E G;  3T4D A;  4NTY A;  3CH3 X;  2Y0P A;  3CJH B;  1HNZ B;  1AP6 A;  3ZMZ A;  5CBH A;  4RUF A;  2IJK A;  4LF5 O;  1DLB A;  1SKV A;  2L6L A;  4DUZ B;  1VEW A;  1VF7 A;  4LR3 A;  3HR0 A;  1HNX O;  1HR0 O;  1UKF A;  2DC9 A;  4REZ A;  2OP3 A;  2WLJ A;  3SPC A;  3OIS A;  3P5W A;  1OCZ B;  4U3J B;  2HP8 A;  1DF0 A;  1N4C A;  1PPP A;  1WA8 A;  3ABK C;  3IC7 A;  2UUA B;  2YJ9 A;  2FTD A;  3OTO O;  1ITO A;  1RPR A;  1OZ0 A;  4Q8G A;  3ASN B;  3B2E E;  4LNU A;  1ZL8 A;  5GON B;  2GTS A;  1ME3 A;  3J81 N;  3LXS A;  4D7T A;  4OVZ A;  3ZRX A;  2ZE5 A;  2MW2 B;  3O9O A;  3RYF A;  1IXM A;  2AVW A;  1OCO B;  2ZR2 A;  5EBM C;  3LSS A;  5LA6 B;  3WG7 B;  1KMI Z;  1TVK A;  4YIP A;  2XAH A;  2AUX A;  4Q20 A;  2YXL A;  1YTF D;  2WA4 A;  3OAA G;  4JTA B;  5ITZ B;  1RFY A;  1XMO B;  2ETN A;  2KG7 B;  2R9I A;  4BIO A;  1CP9 A;  4DK0 A;  1Q90 D;  4OEL A;  1R6T A;  1SF9 A;  1ZUQ A;  4X20 B;  5B1B B;  1AB3 A;  1RPO A;  3OD4 A;  1X9Y A;  5B1A C;  4N21 A;  4BR6 A;  1CEZ A;  2Q0O C;  3GCB A;  2QWR B;  4UVB A;  1H2K A;  5KMG B;  1MEG A;  2XT9 A;  4PI0 A;  1PPN A;  2DZZ A;  3CME V;  3ZN0 A;  4DR1 B;  2FKX A;  1S0V A;  3OMA B;  3OT7 A;  3AK3 A;  3HD3 A;  3RW0 A;  5KMG A;  2DN9 A;  3LNM B;  2PZS A;  3WG7 C;  3D3I A;  2JGD A;  1NR1 A;  4UCU A;  3RVZ A;  4FK5 C;  4IIJ B;  2ITC C;  1QQC A;  3ZMV A;  4X65 B;  1Q3E A;  1WB8 A;  5LGT A;  1NLJ A;  3RVY A;  2DC7 A;  2ZE7 A;  3JCU Z;  4X1I B;  1N34 B;  2Z3Y A;  2XU4 A;  3QSD A;  4IUM A;  3K9M A;  3BPM A;  2UUC B;  3CC2 V;  4DV2 O;  3RYH B;  3MHS C;  4PJ0 Z;  2GHY A;  1K4C C;  3SYP A;  1ATK A;  3H8B A;  4UCR A;  3SR2 C;  4X88 A;  1I0H A;  2IH1 C;  3CCE V;  4FPP A;  2AU1 A;  5F2V O;  2UXC O;  2B1M A;  3AG2 C;  1JA8 A;  3R66 A;  4N8W A;  3JD1 A;  3CWB H;  5IYB O;  1CPJ A;  3U11 A;  3TK1 A;  5L3E A;  4I07 A;  4JI4 O;  4HBN A;  1J5E O;  1XL4 A;  2BOC C;  4J9Y B;  6PAD A;  5FNV A;  4CBC A;  3LUT B;  5LP6 C;  2IU0 A;  1AJQ A;  2Q7G A;  4YYR A;  3WXG A;  1YCI A;  1K92 A;  4DK1 A;  3E9S A;  2D2C B;  4LC1 A;  1EZV H;  1PIP A;  4I9W A;  4KP4 A;  4DRX B;  4EEQ A;  5GW7 A;  4CH4 A;  4DRX A;  3TXS A;  4YJ2 B;  2PYJ A;  4KHP O;  1NQC A;  4YHH O;  4I4T A;  4DV3 O;  1TUB A;  3M7M X;  3G71 V;  1FAF A;  1VF5 B;  1J95 A;  4J7Z A;  3QVN A;  2EBO A;  3M99 B;  4OVZ B;  2CDY A;  4NYK A;  1FPO A;  1SQP H;  2FQ9 A;  1WP8 A;  1BHB A;  1BQ0 A;  4DUY O;  1R1B A;  5LHI A;  2R9O A;  3AG3 B;  2QDO A;  2XHB A;  3KW9 A;  3HKC B;  3OUF A;  1M4U A;  5HFL A;  4PA3 A;  2E75 B;  2Q8V A;  1TLO A;  1NTM H;  3T1H O;  1OV9 A;  3STZ C;  1AI6 A;  3PSE A;  4I7Z B;  4JI0 B;  1KHQ A;  1ZCM A;  2F95 B;  3TGU H;  1IBL B;  1KHP A;  4JI8 O;  2CTP A;  1BZK A;  5FPR A;  4WFA V;  3L74 H;  4R7C A;  2Q4P A;  4BIZ A;  1ICF A;  5IY5 C;  2ZNJ A;  1I08 A;  1MZF A;  4H13 B;  3CSX A;  1SQQ H;  2NQI A;  4BOQ A;  1WP7 A;  2Z0A A;  4CH3 A;  2FTK A;  4PDR A;  1EWP A;  5LYJ A;  4BOZ A;  2R9R B;  4OGQ B;  5D5Q A;  1THE A;  5LBQ A;  2NQA A;  1L1F A;  4AQY B;  4JI1 B;  3OMI B;  4NKG B;  4QPK A;  1SET A;  2YS8 A;  3DXR B;  1UFI A;  2ADQ B;  3ZHU A;  4P2Z A;  5CA0 A;  4X20 A;  2UU9 B;  4JZG A;  3TCU A;  5JVD B;  3K5L A;  3NHE A;  3CBJ A;  1S5L Z;  2GFO A;  4O4J B;  3KKU A;  4MVO A;  3ZJZ A;  1QLN A;  3X2Q C;  4TUY B;  1R3L C;  3W7W A;  1HDJ A;  2JQF R;  1PNK A;  1U9Q X;  4PD4 F;  1W0K G;  2PGG A;  3SPJ A;  4DMY A;  5IWA B;  1PKX A;  1I94 O;  2DCC A;  1NZ6 A;  4NTW A;  3APQ A;  1NL6 A;  1GRJ A;  2KQX A;  1HNW B;  3STL C;  5EF4 A;  1VQ4 V;  4X8A A;  4O2B B;  3I06 A;  4X1I A;  3WXE A;  4DR5 O;  1Z2G A;  2IJJ A;  4NXM B;  1GEC E;  1VF6 C;  5EIB C;  1Q5O A;  3OTF A;  4JI2 O;  1G8M A;  3ZUA A;  2RMK B;  4MVU A;  1M57 B;  2J7Q C;  5L3F A;  5LA6 A;  2YJC A;  1S72 V;  1AP5 A;  1PVJ A;  3HB3 B;  1Y76 B;  3FAV B;  5KAF Z;  4CS2 A;  1H2M A;  1AIL A;  1U5I A;  3F7Y C;  3CEI A;  4PAD A;  4MZS A;  2XOK G;  2UU9 O;  3P3P A;  1M6D A;  3CH2 X;  5CN0 A;  2OCC C;  2YEV B;  4AQY O;  1QXP A;  1QCE A;  4DYL A;  1U9V A;  4WFF A;  1YZB A;  3M99 A;  2CE4 A;  3B8N A;  5H5N A;  1V54 B;  2EIM C;  4TWK A;  1AI4 A;  2EZP A;  2QEX V;  4UXN A;  2YEV A;  3LFY A;  3K08 A;  3CCJ V;  4CC6 A;  4X1Y B;  4DUZ O;  4FK5 A;  2OIE A;  1IBL O;  5CVN B;  4LFC B;  2OUL A;  3CP1 A;  1K7D A;  2HR3 A;  1SES A;  2YID A;  4KHP B;  4JYC A;  4A5U A;  3D6S A;  2E01 A;  1K34 A;  2G38 A;  3ZHS A;  4EB6 B;  4X6I A;  2P0R A;  3QO8 A;  3K57 A;  1RM1 B;  3K06 A;  1K4D C;  4J7K A;  4JGS A;  3PRP A;  4YY3 O;  1HP8 A;  4BOS A;  4F6R B;  1NB5 A;  4X62 B;  4LF9 B;  3N2G A;  4WBN B;  2Q73 A;  2CH7 A;  3U0Z A;  2P4K A;  4DW1 A;  1S5H C;  1IBM B;  3BFR A;  5CA0 B;  3E89 A;  3U8E A;  2B1I A;  3WXF A;  4PA7 A;  1SER A;  2DJG B;  3FB8 C;  1CB5 A;  3RYH A;  1A32 A;  4BWA A;  1KQS U;  3FB6 C;  1I5X A;  5JQG A;  3JAM N;  1ROP A;  1XOU A;  1QDQ A;  1F29 A;  5IYZ B;  3TRK A;  1V55 B;  3GB7 C;  3OEE G;  5KA6 A;  4J41 A;  2HD5 A;  4XBF A;  5B3S C;  2IH3 C;  4AHC A;  3THO A;  3WB2 A;  4OEM A;  2GUZ B;  3ML0 A;  2P90 A;  3I56 V;  1JCH A;  2EUL A;  5JJN B;  1K9M W;  2P86 A;  4BS6 A;  5B66 Z;  1AYU A;  3CCM V;  2IBI A;  2A06 H;  3ABM C;  4LF5 B;  1X4T A;  1N32 O;  1BS3 A;  2HEP A;  3BHP A;  3ZHR A;  3W7S A;  4FM1 A;  1XBL A;  3R65 A;  4H37 A;  3SPG A;  3TET A;  1XNR B;  3AG7 A;  1Q6K A;  3W7X A;  4P9P A;  5LMU O;  3FB5 C;  2E02 A;  2AZ0 A;  1PV0 A;  3AG1 B;  2CUG A;  2KSD A;  1GTO A;  1GH6 A;  1YIT V;  4DR7 O;  2MK3 A;  3ZHV A;  3UKM A;  1TGO A;  4HXD B;  1YI2 V;  2F93 B;  3ZMT A;  4CDC B;  4PP2 E;  4JI3 O;  1MDW A;  4XR7 A;  2N04 A;  5B1O A;  2CIO A;  1IBK B;  3H1K H;  2JVD A;  3T4Z A;  5LHG A;  2AIM A;  5KO3 A;  3W31 A;  4ASU G;  4I55 A;  5IJ0 A;  1XEQ A;  3A8T A;  2NQD B;  4OPA A;  2UXC B;  4MS2 A;  2UZJ A;  2YJ8 A;  1GLO A;  3H01 A;  3ZBH A;  1XKG A;  4O4H B;  3OR6 C;  4UVA A;  3U10 A;  3HPL C;  1M93 A;  2FYU H;  5KX5 B;  2W6I G;  4K35 A;  4O4H A;  3SJA C;  1URF A;  1W0J G;  5B1B C;  2LJ2 A;  2CGO A;  3ZRS A;  2WLK A;  1U96 A;  3E35 A;  2XAS A;  4HNA A;  3IOQ A;  4PI3 A;  4MVS A;  3B8M A;  4MSW C;  4I05 A;  3HKE B;  4RF0 A;  5EZY B;  4M0W A;  4B3R O;  4CDD B;  4QJF B;  3OE7 G;  4IYH A;  2RNB A;  4JYB A;  2DC6 A;  1VIB A;  2V7Q G;  1H2L A;  4X64 B;  1AJN A;  4ZHQ B;  5C93 A;  4Z1M G;  4UV9 A;  2FL4 A;  5L3C A;  1XNQ B;  3E2E A;  1ZWI C;  2PUS A;  4TUY A;  2CH7 B;  2FB5 A;  3JAT B;  2JEX A;  4U7N A;  1F23 A;  1AU3 A;  2DWE C;  1DK1 A;  1IBM O;  2IU3 A;  4MVM A;  3ETD A;  4YXW G;  5H9C A;  4J9Z B;  5JQG B;  4JI6 O;  5K1P A;  5IY5 B;  5BY1 A;  1SP4 B;  2QE7 G;  3N4C A;  4JV5 O;  3RT3 C;  3CPW U;  2W6J G;  3K58 A;  1YVW A;  1NS1 A;  3G6B A;  3QNE A;  2E76 B;  3SYQ A;  2M6Y A;  3BY6 A;  5DEC A;  1BQI A;  3T1H B;  2F1G A;  3SJC C;  4DR2 O;  4JI7 O;  3TJT A;  1Y66 A;  4I50 A;  1GMY A;  1OCC B;  3K03 A;  5C8Y B;  2VWJ A;  1MAB G;  3IHP A;  3ZN1 A;  4FLW A;  1D2D A;  4WUR A;  1ZAU A;  2WLI B;  2LW7 A;  1AEC A;  1NR7 A;  3MJ5 A;  5IWA O;  3KSE A;  2Q69 A;  1P49 A;  4LFA O;  1R6N A;  1IXB A;  5JH7 A;  3A0R A;  3CCL V;  3L73 H;  2CB5 A;  4X64 O;  2LO1 A;  4NXN O;  4MVQ A;  3VQY A;  3PDF A;  1BSM A;  1JR9 A;  4NVP A;  4QH6 A;  3AG1 C;  4R8C A;  2KG7 A;  3IMA A;  3RVW A;  3DC6 A;  4HYO A;  1BL8 A;  2FRA A;  3B40 A;  5BR8 O;  5FLX N;  2QM7 A;  2HG5 C;  3CRR A;  3FYI B;  4YYU A;  1B04 A;  3NXS A;  4FZ0 A;  3KZI Z;  3KKY A;  2BU3 A;  4F6E A;  2WLI A;  4BOP A;  2DQ0 A;  4W4L A;  4PA4 A;  3D3Q A;  4UCV A;  2JGU A;  3HKD A;  5EZY A;  2F66 C;  4MW3 A;  1PP9 H;  5CMU A;  4J10 A;  1SQV H;  3RGB A;  4AI8 A;  4LF6 B;  1T5E A;  5GON A;  2ARH A;  2BDL A;  5LXT B;  4FLY A;  4WCE V;  4UFZ A;  4PI2 A;  3K79 A;  3OMN B;  2QJ1 A;  3P32 A;  5KX5 A;  2PBH A;  1WPB A;  3Q4H A;  1XMQ O;  5H6Q A;  2JK5 C;  1OJH A;  1IWD A;  3UO3 A;  1GN4 A;  1AR1 B;  1VSN A;  4PDM A;  4I55 B;  2HHH B;  1XNR O;  2ITD C;  4NXN B;  1EN5 A;  3JAK A;  3S3R A;  3SJB C;  3H89 A;  4NXM O;  1Q6I A;  2ZM6 B;  4BPV A;  4BSQ A;  1IX9 A;  2E5L O;  5IDJ A;  2H7J A;  4G54 A;  3PJS K;  4DR4 B;  2IM9 A;  3I55 V;  1IUR A;  4NR1 A;  5FNV B;  4NB5 A;  4ZI7 A;  2H94 A;  4K0K O;  1MEM A;  1F2B A;  1V9P A;  4TV9 B;  2V4D A;  4GKJ B;  3EHB B;  3IEJ A;  4HWY A;  3EXA A;  1Q6H A;  4IIJ A;  4P9O A;  3S3Q A;  4JI6 B;  1TL9 A;  3H9V A;  1DGS A;  1U97 A;  3KCX A;  3RNV A;  3KWZ A;  1SS3 A;  4O4L A;  4DV0 O;  3JAS A;  1LR1 A;  3JSN A;  4DR2 B;  4PDL A;  2AXT Z;  2HJF C;  3FD9 A;  1E1R G;  3OUS A;  4YYS A;  2BTO A;  2F4V B;  2R72 A;  4JZ2 A;  4GT1 A;  5E6J A;  2IBZ H;  1JX9 A;  5JJE B;  2ATO A;  3K5M A;  4KXR A;  5A9G A;  3CRQ A;  4XDK A;  4D7S A;  3C90 A;  1P7B A;  5GTH Z;  2CTR A;  4FLV A;  4UCO A;  1Q7Y W;  3MTN A;  4QRV A;  3W7T A;  4B7K A;  2ZM6 O;  3B09 A;  2QWN B;  5L3G A;  1BGO A;  2LGQ A;  2XAJ A;  2DCD A;  5CA3 A;  2VWK A;  2X6B A;  1TAE A;  2Q7H A;  2ZIN A;  4YHH B;  3FFQ A;  3BVO A;  5B3S B;  2LFR A;  2UUB O;  2JDI G;  4PEL A;  2PI5 A;  1KEC A;  1CPY A;  4DR6 O;  3VQV A;  2QTS A;  3K04 A;  4RWU A;  1H8H G;  2B1N A;  3N3G A;  2LP7 A;  3RYI B;  1NJI W;  4IYI A;  4B08 A;  1WA8 B;  4LF8 O;  3HKC A;  4CZW A;  3H6S A;  3ETG A;  2QKC A;  1YXB A;  1M90 W;  2UXN A;  3QG5 A;  5IJ0 B; 
#chains in the Genus database with same CATH homology
 2JRI A;  4DR5 O;  1N34 O;  1XNR O;  3ZNH A;  1DK1 A;  1IBM O;  4DUY O;  1R1B A;  2VQE O;  1XNQ O;  5EZQ A;  4JI2 O;  1R6T A;  1FJG O;  4LF6 O;  1AB3 A;  4JI6 O;  4OX9 O;  2BTW A;  2UUA O;  4NXM O;  5BY1 A;  1IBK O;  4LF9 O;  2E5L O;  2J7Q C;  4JV5 O;  3RT3 C;  4B3M O;  4RKX A;  4D8I A;  1PVJ A;  1NS1 A;  4D8B A;  4LF7 O;  2FKX A;  2N74 A;  3T1H O;  3OQC A;  1N32 O;  4PT5 A;  4K0K O;  4BOU A;  4GUA A;  3BBA A;  3BB7 A;  5LL6 Y;  4DR2 O;  2UUC O;  1F7Y A;  4JI7 O;  4LF4 O;  5JZE A;  1AIL A;  3PSE A;  4MM3 B;  3SDL A;  3MTV A;  2DOS A;  4DV5 O;  3O65 A;  4DV6 O;  5LMU O;  4LFC O;  3MP2 A;  4LFB O;  2UU9 O;  4GKJ O;  3RNV A;  1HNW O;  4DV4 O;  4RNA A;  4D8E A;  3J80 N;  4JI8 O;  1D2D A;  4WUR A;  1FYJ A;  4AQY O;  1N36 O;  2LW7 A;  3MJ5 A;  4DR4 O;  2UXB O;  5IWA O;  4JYA O;  3J7A U;  4DR7 O;  3F5T A;  1YZB A;  4IUM A;  5H5N A;  4DV0 O;  4LFA O;  4HXD B;  5BXZ A;  1N33 O;  4DV2 O;  2FE8 A;  1KUQ A;  2AGA A;  4X66 O;  4LF5 O;  4X64 O;  5IT9 N;  4OPH A;  4NXN O;  5A2Q N;  3BY4 A;  4JI3 O;  4MI7 A;  2UXC O;  1HNX O;  1HR0 O;  4BOQ A;  5E6J A;  3R66 A;  4DUZ O;  2Z0A A;  1UKF A;  5KO3 A;  4REZ A;  1IBL O;  4OW0 A;  3W31 A;  2ZKO A;  1FKA O;  4JI4 O;  1XEQ A;  4DV7 O;  2J7Q A;  5BR8 O;  5FLX N;  1J5E O;  4OPA A;  4BOZ A;  2UZJ A;  3PHW A;  2ZM6 O;  2DJV A;  4A5U A;  3TMP A;  4DR3 O;  3PRM A;  4XZX A;  2BU3 A;  5LMN O;  3OTO O;  3E9S A;  4X65 O;  4BOP A;  4P16 A;  3IFU A;  4X62 O;  2UXD O;  3PRP A;  4YY3 O;  4BOS A;  2Z84 A;  5EZS A;  4JI0 O;  3PHU A;  1XMO O;  2HWK A;  4ZTB A;  3J81 N;  4DV1 O;  3M8A A;  4R3D A;  3T1Y O;  2UUB O;  4RF1 A;  4B3S O;  2JTC A;  4RF0 A;  4GKK O;  4DR6 O;  4JI1 O;  4M0W A;  4OVZ A;  3B21 A;  4B3R O;  2HHH O;  4KHP O;  3PT2 A;  4YHH O;  4B3T O;  3C0R A;  4DV3 O;  4JI5 O;  3PHX A;  2VQF O;  1I94 O;  2F4V O;  1X59 A;  1DKI A;  4A5U B;  4LF8 O;  1A32 A;  1XMQ O;  4IP3 A;  1HNZ O;  2BTW B;  3JAM N;  4DR1 O;  3W30 A;  4OVZ B;  1G1X B;  3TRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...