2JRIA

Solution structure of the josephin domain of ataxin-3 in complex with ubiquitin molecule.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
182
structure length
182
Chain Sequence
b'MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ataxin-3
molecule tags Hydrolase/signaling protein
source organism Homo sapiens
publication title Understanding the plasticity of the ubiquitin-protein recognition code: the josephin domain of ataxin-3 is a diubiquitin binding motif
rcsb
total genus 44
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2jriA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2jriA01
4DV0O 5BXZA 4GKKO 2DOSA 4NXNO 2VQFO 4DR1O 3OTOO 4B3TO 1IBLO 4X64O 4JI2O 1XEQA 2UXBO 4JI5O 4LF9O 4LF5O 1X59A 4LFAO 4LFBO 4DR3O 1I94O 2ZKOA 4JI8O 4A5UB 2UXCO 3JAMN 3J7AU 1KUQA 1XMOO 1R6TA 4JI3O 1F7YA 5IWAO 2JRIA 2AGAA 4LF7O 5BR8O 4DV6O 3R66A 1N36O 5A2QN 1FJGO 3T1HO 4YY3O 1N33O 3F5TA 2VQEO 4X66O 4NXMO 1XNRO 2Z0AA 1DK1A 4B3RO 2N74A 4B3SO 2DJVA 4YHHO 1AILA 3M8AA 4OX9O 4JI1O 4GKJO 4JI4O 4B3MO 4DV1O 1IBMO 4OPAA 4DV2O 3SDLA 1AB3A 2UXDO 1R1BA 4DR5O 4DV7O 1HNXO 2UUBO 4JI6O 2E5LO 1HNZO 4DR7O 2LW7A 1HR0O 1N32O 3RT3C 1D2DA 5IT9N 4JYAO 4JV5O 2FKXA 4AQYO 4DV3O 5H5NA 3J81N 5FLXN 4X62O 4DR2O 4OPHA 1XNQO 1G1XB 3T1YO 4LF6O 4KHPO 5LL6Y 4JI7O 4DUYO 4DV5O 4DUZO 1FYJA 4DR6O 1HNWO 3J80N 5LMUO 4JI0O 2UUCO 2HHHO 1A32A 2UUAO 4LFCO 2ZM6O 4DV4O 4X65O 2UU9O 1NS1A 4LF8O 1N34O 5LMNO 5BY1A 1IBKO 1XMQO 1J5EO 4K0KO 1YZBA 4LF4O 2F4VO 4DR4O 1FKAO 3O65A
chains in the Genus database with same CATH superfamily
4AXMA 2DOSA 1NJIW 5EGWA 3DC6A 2NR5A 3HKEA 3SPHA 2JK5C 4LWSA 1URFA 1HNXB 1MIRA 4TV9B 3LXSA 3LSQA 2PUSA 1T5EA 4RUFA 4K35A 2YEVB 5J2TB 1GM9A 4RO2A 1A6RA 2XASA 3K8UA 2F23A 3T1CA 4QPKA 1NLJA 2GV9A 3ZRWB 2ZIOA 3GWKC 2WA3A 5BR8O 3O1GA 3ZNHA 3AI8A 4ZHQB 4UCTA 1SNKA 3FAVA 3L72H 1NH2B 1N33O 2DCBA 4EB6B 3IHPA 1SQFA 1YF2A 4PDMA 4KHPB 2N74A 2DW4A 4I4TB 1I94B 1M56B 3RNVA 4AXLA 4ZKIA 1AI6A 4HXDB 1WN7A 2O6XA 3D6SA 1V54C 3SPJA 3F75A 1IBMO 1WAZA 3CC2V 1HDJA 4XR7A 3CHXA 4DR5O 3CXCU 2IPPB 1YJWV 1AI4A 1S76D 1DLBA 1N32O 3JD4A 5JCOA 3CRQA 1M4UA 4DV3B 2WLNA 4KL1A 3PHUA 3X2QC 4AQYO 1H2GA 3N3KA 1Y74A 3AG1C 1H2SB 1GCBA 3RVYA 1XNQO 1SQVH 1KHQA 2WWWA 3QVNA 4G2KA 2GBOA 4MVQA 2VHSA 4UCUA 1V9PA 3CE2A 1XL6A 2UUCO 4X66B 3IV2A 4YJ3A 2ZE7A 3ABLB 4FLXA 4I04A 3W30A 2UU9B 2FT2A 2CK3G 1M1KW 1KQSU 3PHWA 4QNHB 2QJ1A 2EZOA 4RQFA 4JV5B 4IYIA 3H7DA 4KLBA 2D3OW 4BW5A 1EN5A 1H8EG 3B77A 3OGIB 3G4SV 1K4DC 3OMIB 3T4ZA 3P30A 2PYLA 5H9CA 3PNRA 2LP7A 4YYVA 2HLDG 5DECA 3VBBA 4ABMA 3U0ZA 1XEQA 4HBNA 4LF9O 1DF0A 3ZRVA 5B1AB 4AILC 2EIMC 3OUFA 2UXXA 4LC1A 1CVZA 1R6TA 5LP6C 1Z5VA 1AP6A 1B06A 2IJIA 4PELA 4BAYA 1JPXA 5BZBA 3AG3B 3ABMB 3CSXA 5K16A 5FPRA 2E75B 1THZA 2R9NA 4RKXA 2Q73A 3FFQA 3OD4A 2BTQA 5J2TA 1MZEA 1PM9A 3CBKA 3KX1A 2P06A 4U3FH 4YY3O 1VQOV 4HNAB 4X66O 2ATOA 2BTWA 3C3TA 4TWKA 2JS3A 1OCOC 3WFVA 1RP3B 1AYWA 2P4VA 2JJ1G 1CXZB 2Y5BA 4GKJO 3E8GA 3FB6C 1WJZA 4XUIA 4B3MO 1XILA 3CCJV 1UPGA 3UT5B 2ODMA 1G4YB 1TUBB 2WLMA 5JJEB 3V6EA 2D2CB 3OQCA 3CPWU 2OCCB 1U9QX 3P5VA 2KG7A 4O4JA 1N8RW 3KKYA 1PVJA 1J95A 3HKBA 1SRYA 1ORQC 2Y6EA 2HR3A 1OCRC 3FX7A 4UFZA 2HG5C 2FKXA 4DV3O 3LFYA 3JARB 4LNUA 1WB8A 1LUWA 2LGWA 4PDLA 5IE9A 1YK8A 4JI7O 3SR2C 4HZ3A 2Q7EA 5BMVB 3J80N 3MHHA 3W7WA 2OTLV 2Q0AA 2ZXWC 3S3WA 2QM8A 4K7CA 1RM1C 1IDSA 3A2FA 2UUCB 1H2LA 4CDEB 4MVSA 2QWNB 5BY1A 3ICXA 3OVZA 1FFTB 1OCCB 2HKOA 1S4VA 3CMEV 4DYLA 4LF4O 2F4VO 2YJCA 5LXTB 5GONB 1FKAO 4DV0O 1OHHG 4R50A 4UXNA 3VQWA 1M93A 2ARHA 1QOLA 5L3GA 1BQIA 2AYOA 2WLLB 3DXRB 3H8BA 4X1YA 2E5LB 2KB1A 1QHTA 3RYCB 3FYIB 3OE7G 5CA0A 3JAMN 2HFEC 2YDEA 3G71V 1EWMA 4BS6A 3DF0A 2JS5A 4UB8Z 1XMQB 4PA6A 3UQ8A 2JRIA 1W0KG 2DC7A 2VQEB 3EVKA 1PPNA 2Y4UA 2GHYA 4TOIA 4OW0A 3T1YB 4PA4A 4X1YB 3IC9A 1YSCA 3E83A 4GZRB 4YJ2A 3B21A 3AG2B 3ZBHA 4B3SO 4F6RB 5KLVH 5FL7G 3K9SA 1OCZB 1AILA 4UCVA 2NQDB 1NQCA 2BTQB 3BY6A 1KYOF 4GUNA 3PDFA 3JAKA 1Z5WA 3CCVV 3QJ3A 3LSUA 4BOSA 4FM2A 3M7MX 4RF1A 2FMLA 3ASOB 3GB7C 4JI6O 3HD3A 4Q6GA 4MS2A 4GYCB 4N79A 3A0HZ 4NTXA 2IBIA 3QNEA 2H8PC 3JD1A 4Z1VA 5CBFA 1GKFA 3HHAA 4HWYA 1VIBA 1N32B 3E89A 4P9PA 4X65B 1VQ4V 5KHJA 2Z3YA 1N34B 2QWRB 2EIKC 2Q67A 3CX5F 4U7OA 2F93B 1S5LZ 4D7TA 3OISA 1NB5A 3MDSA 2HHHO 4LFCO 3UM7A 1D5NA 1GN6A 3PSEA 4MT8A 4OX9B 3IMAA 4LFAB 5KO3A 2DZZA 4YYWA 1L0NH 4DRXB 2ATKC 4REZA 4U3JB 2DYSC 4G28B 2WLLA 5JA7A 4JASA 4CH4A 1AP5A 4CDDB 4E2LA 4DR4O 3NXSA 3U11A 4RAIA 1MEMA 3KSEA 2WLKA 3KG2A 3ZMTA 3STZC 4TV8B 1ICFA 3KKUA 3JD3A 2Q9LA 3KWBX 1GTOA 2CGNA 1SZXA 5L3DA 2JJ2G 1XDCA 2Y69B 1JFFA 2QKCA 4XDKA 1Y08A 4O4HB 3K9AA 3S3XA 1SF9A 1SKVA 3DXRA 1M5IA 2QM7A 1Q43A 3QSDA 4CS4A 1CTEA 1NB3A 3TNXA 3K5NA 3CH2X 2DC8A 5L3CA 5CB4B 4RQEA 2V4DA 3CBJA 2XU5A 1GO3F 4YIOA 4B3SB 1JJOA 2DYRB 3F7YC 3TXSA 2HHHB 4XZXA 2NQAA 2LO1A 3JALB 2AZ2A 4IHJB 2JVDA 2XAHA 1MNGA 4EFBA 3M99A 2LQTA 4AI8A 4D8IA 3ETGA 2CGOA 4LF5B 4GX0A 3KFQA 2IU3A 3IJ4A 5E6JA 1R3KC 1R1BA 2EX3A 4O4LB 3WU2Z 5CHVA 5C8YA 4AHCA 2IH1C 2WLIA 5IJ0A 1KHPA 2BOBC 5IYDO 5IT9N 3WB0A 3PHXA 2RQ6A 2H94A 4ZIBA 1PCIA 5KA5A 1ZL8A 4H37A 1BSMA 3JD2A 1HW7A 2PI4A 3BC3A 1G1XB 4BW9A 3ABTA 2HH5A 1NBMG 2EINB 3CH3X 3ZEDA 1M90W 1FYJA 3RVVA 3UCSC 2ZNIA 4GX1A 1FS0G 1Q6UA 5IJ0B 1Q6KA 1U5IA 4JF3A 2A7WA 3N2GA 1ZLZA 4JYBA 4XBFA 3ZMZA 1U9WA 2Y0PA 1SQXH 2W0FC 4JI5B 1OCCC 5LGNA 2WPDG 1H2NA 1IBKO 3FYEB 4FLUA 2ZT9B 3A0RA 3SYCA 3OF8A 1Z2GA 1S77D 4PI2A 1VQPV 1AVMA 1SQQH 4BSQA 1XI1A 4OGQB 4LH7A 1AECA 1VQMV 3N2GB 4X20B 2AHYA 1S72V 5LA6B 1SC5B 1D5AA 1JX9A 4NVPA 4IT5A 1QNMA 1IBMB 1GM7A 1QVFU 1Q7YW 1U9XA 2NQGA 2E74B 3MORA 3T1HB 3H1IH 4PV1B 1Q6HA 3RVXA 4YYQA 1TVKB 1VMGA 2P4KA 3EXAA 3RYIA 3W7TA 5KHHA 1W0JG 2K1EA 2VQEO 3WXFA 4WFEA 4WFBV 2R6NA 1YALA 2NN4A 4DR6B 4YHHO 1PNMA 4JI3B 2O57A 3VQXA 2ZNJA 3BRCA 4JI1O 2OULA 3AG1B 1CSBB 2ZQMA 4FLTA 4R8CA 4DV1O 4BOPA 1PADA 2B9ZA 4EEQA 1M9NA 3BVOA 2X6AA 3BBAA 1UKFA 5L3FA 4IHJA 3RGBA 1I5YA 1QU7A 4J80A 2QWPB 2GTAA 4B7KA 3CCLV 1MEGA 4FFKA 1NZ6A 2XTAA 4O2BB 5H5NA 3RYFA 3I3TA 5CN0A 4DR2O 1AYVA 2CTPA 2QDOA 3ZN1A 1B6QA 4LF6O 5LL6Y 3ZN0A 1Y76B 4WFGA 3K03A 1JOYA 2VHFA 3LNNA 2FRAA 1E1QG 3H6SA 3CJHB 3JCZA 2OIEA 1I0HA 1RSOB 3X2QB 1H2MA 3IAYA 1SS3A 2ZE8A 1BS3A 4BS5A 1H38A 4X64B 3WB2A 1XHZA 1J5EO 3S3RA 1MHWA 1AI7A 4HAMA 1GN2A 1GM8A 2KQXA 4I07A 1TA8A 1Y67A 3AG3C 2FUDA 1MS6A 1VF6C 1ZX3A 5B1BB 1AJPA 3ABLC 4PDRA 2UXCB 7PCKA 2CE4A 4UCSA 1SA0B 5EBWC 1YIJV 2BTWB 2YIBD 2K9PA 2ZKOA 3HHIA 3KZIZ 4J9ZB 4O2AA 2FTDA 3CCEV 2LJ2A 1OZ0A 5CVMA 2G6DA 3O0UA 3P3NA 3AK1A 1VQ5V 2JDIG 3AEIA 1N36O 4G54A 1WPXA 3W7UA 4RUEA 1QQCA 2XU3A 4MVRA 1NU1H 2WLHA 4MZSA 3F5WC 3H9VA 4FMTA 1QBZA 2AU1A 3JSLA 3G6EV 2E03A 2F1GA 5EYPB 3JARA 1U9VA 2N05A 3JATA 2UUAB 3IC7A 4TT3G 3ZHTA 2Q0OC 4ZI7B 1R73A 2CH7B 3ZIAG 3U8EA 5E1AC 3MD0A 3HWNA 4DV0B 5J2UB 2YUAA 3B40A 1P84F 1F4NA 4J10A 1HNZB 4JYAO 2PGGA 3ZHRA 3ZHSA 4CC6A 2R72A 1HWYA 2EILB 2A0LA 2AW9A 4FZ1A 2FQ9A 2IW5A 1CPYA 4X62O 4YJ3B 5EBMC 1L0LH 3L74H 5B66Z 2AHZA 5LXTA 1K34A 3C3SA 2P0RA 3ASNC 2RNBA 3IEJA 4N4ZA 4DV2B 4K0KB 5LMUO 1EN6A 2YXHA 2DCAA 4O2BA 1F2BA 2QWQB 4PA9A 1YK7A 4LWSB 2B1MA 3ZUAA 2E76B 1OCRB 3C90A 4DV4O 1DF5A 1K8AW 3EHBB 1R3IC 1CS8A 2GFOA 2AYNA 2JGDB 1P49A 2YEVA 4YVAA 1Y66A 1K3EA 1FXKC 2Q69A 4QH6A 5TISZ 2DJFB 1FXVA 3JASB 5D5QA 3CCQV 1SESA 3RN4A 1NI8A 4DR1O 2IJJA 3CC7V 1MMMA 1P7GA 3TXQA 2HVJC 3ZCCA 2YS8A 3JYCA 2ZIMA 4NTWA 1KKCA 2IBZH 1VJVA 3ZX6A 2UXBB 2ACTA 4A5UB 5J9PC 2Y69C 1YTFB 2ILMA 3QO8A 4JYYA 4HNAA 3QO7A 4JTCB 2EIJB 1XHXA 2Q6AA 2C0YA 1YT7A 4KFMA 1GLOA 4BOQA 4WBNB 3K0GA 5KUKA 2IJHA 5EC2C 3JATB 4PI0A 4IYHA 4DMYA 4O2AB 3UT5A 2G8EA 5GTIZ 1FAFA 3E86A 2Z0AA 2XUMA 1FPOA 4NTYA 2E3CA 2DJVA 4IP3A 1XBLA 1Y74B 4OX9O 3HKBB 4NYKA 3OMAB 1V54B 1ITOA 4X89A 4JAAA 1F51A 5C93A 3PJSK 1HNZO 2RN9A 1PL4A 3FAVB 2QTSA 1P7BA 3G80A 1D2DA 4DRXA 4MTXA 2OP3A 3N27A 1TGOA 1MA1A 1VQNV 5FNVA 4O4IB 5K1PA 4OPHA 1IWDA 4P9OA 5JH7B 5JVDB 5CVOB 5EZQA 5J94A 4DUYO 5F02A 4DUZO 2ZXWB 2EINC 3N3GA 3D3QA 1RM1B 4J7KA 2XAQA 3T2MA 3TK1A 5JCOC 4CBCA 3RVWA 1FD9A 3F5VA 3MAQA 1K4CC 1EF7A 1AU3A 3E8BA 2P90A 2A3QA 4LF8O 4JI7B 5FNVB 5B3SC 5EZSA 5BMVA 4MW8A 4O4HA 4QJFB 2E00A 4Q8GA 4DR1B 3HPLC 3L73H 4CC5A 4CH6A 2GSMB 3OEHG 4QRXA 1K5QA 2WA4A 1F2AA 4X88A 3ZHQA 2UXBO 4Q20A 3TJTA 4BR6A 3ZJZA 1X59A 4F6EA 4ICGA 1E1RG 2UXCO 4OVZA 1YHQV 4YJ2B 1XNRB 3J7AU 4DK0A 5PADA 4W4KA 1GRJA 4J7ZA 4FFBB 2Q7GA 2CTWA 4F6RA 2NQIA 1EN4A 2EJRA 3RYCA 1BP4A 2DWEC 2ZE6A 4M0WA 3E22B 4GT1A 1F2CA 1DGSA 1YJNV 5C8YB 5A2QN 1FJGO 1ZWIC 4W4LA 1TL9A 2PF4E 3GWOA 2BU3A 4PDVA 3SPGA 3K59A 5LMUB 1BZKA 3KCXA 3H1LH 3MTVA 3ZMUA 1OCOB 4OVZB 4OEMA 3W7SA 3D36A 4OPAA 4TQDA 3SDLA 3ZHUA 2JQFR 2B1GA 2XU4A 5H6RA 4FLYA 1G6UA 2OCCC 5ITZA 3JAWB 3CCRV 4WURA 4UVCA 4J7JA 3C9EA 1W59A 4B3MB 3ASNB 2OT5A 2QTOA 2YI9A 2P67A 3B2EE 1NPZA 3MHHC 4OXSA 4DK1A 4H33A 4PA7A 3SJAC 2KG7B 3BFRA 4O4JB 4DUZB 1EWOA 2YIBA 3TGUH 4CS3A 4O4IA 1GMGA 3CEIA 1U96A 3I06A 2W6JG 2IJKA 4QIWF 5EF4A 1KBHA 2RCVA 4J9YB 1N34O 4BIZA 4FPPA 3CWBH 4TSFG 4WFAV 2ARYA 2EIMB 3SYOA 1Y4HA 5CA0B 3CXHF 1W2BU 5JJJB 2CDYA 2FYUH 5CBGA 2ADPA 5KHGA 1K7DA 1EZVH 5CBHA 5B1NA 4FLWA 1BE3H 3H89A 1PPOA 3OF9A 1O9HA 4JI1B 1RPRA 1B04A 4J42A 1PBHA 2M7WA 1KUQA 2EIJC 2QA4V 4KXRA 4ZOLA 2A06H 4ASUG 3JALA 3LNMB 2ITCC 3OAAG 3AK2A 4LF7O 4NXMB 5LGUA 2FB5A 1GECE 2PREA 2IH3C 3HKCB 3M99B 1O0EA 2CUGA 3B8NA 4EFEA 1ME4A 4MVUA 3BPMA 1Q81W 1OV9A 4LF6B 1B3QA 1QLEB 2DC6A 3BCCH 5KHKA 1ZTEA 4X1IA 1K5SA 1GK9A 2DQ3A 3JAWA 1ZCMA 4MSXA 2X6BA 2JTCA 4LFCB 1OCZC 4JYCA 2B1NA 4LCUC 1S0VA 1VF5B 4DV7O 3K5MA 2FYEA 3ZS8C 5KX5A 4BOUA 1AU0A 3K04A 1Q5OA 3KCYA 1VSNA 5IYZB 4IL6Z 4U3JA 4JV5O 1R6NA 4K3AA 4FVMA 5ITZB 1GN4A 4DV5O 1DF4A 3I5DA 3FB5C 2EIKB 5K1XA 5LMNB 1NVPB 4FM1A 1POPA 2H3OA 1YEWA 4PD4F 4U7NA 4OELA 4IUMA 5KAFZ 2Y48A 1XMQO 3USVA 1YZBA 3K79A 5FPWA 3AG4C 1N36B 1US6A 4JZ2A 4WFHA 3F7VC 3G6BA 1GN3A 5CB4A 1JQ0A 1IBKB 4JAUA 3ZMVA 1DKIA 1K97A 1PNLA 1R3JC 2J7QA 1AIMA 1AR5A 4LF5O 3A0BZ 4ZBMA 5IJ9B 3WG7C 4GKJB 1NQTA 3OM3B 4CDCB 2FTKA 1XMOO 3OGCC 4X20A 1HP8A 3W31A 4GX2A 2AGAA 2FE8A 1OJHA 3B79A 5DM6V 2YXYA 2CH7A 3FKSG 4TV8A 4D7SA 3N4CA 4X62B 1EFRG 4BQVA 1EWPA 1DK1A 2CTRA 3RFRA 1BQ0A 2Q68A 4N8WA 3CRRA 3H1JH 4MVZA 4DV4B 2QKSA 4XDJA 2P6JA 1KFXL 4MTFA 2DCDA 3HKDB 1PV0A 1GH6A 1EM1A 3CC4V 3K58A 1K9MW 1BMFG 1SERA 4FJCA 4B3TB 2JEXA 2R70A 1FH0A 1XUQA 1KP3A 2QWOB 4PP1A 3D3IA 4WFFA 1SETA 5GW7A 2OZ2A 4I50A 4BWAA 1AU4A 3RYHB 1VQ8V 3L9DA 4PADA 4D6TH 1AJNA 2PADA 2DYSB 4LF4B 2F4VB 8PCHA 2HHNA 3HKDA 5A9GA 1VQLV 2B1IA 3CRMA 5KX5B 2Z5UA 2DJGB 1FXKB 3OUSA 4I0XB 4I9QA 4JGSA 4H0LB 2L6LA 1ENVA 1YCIA 1H2KA 1NTMH 2YC0A 4CH3A 2LGQA 1BGYH 4X65O 3RWRD 3AK3A 1RFYA 1KU9A 4J11A 1ATKA 3OMNB 2FO5A 4IIJB 1AR4A 3A8TA 3SPCA 1IX9A 4F4LA 2JQGR 1XOUA 3VQVA 2YIAA 2WAMA 1SA0A 5JH3A 3QT4A 2JIZG 2VQFO 1SZTA 3OTOO 4WBNA 2P5OA 5JWPA 1IBLO 3MTNA 1KECA 1IZ3A 1NR1A 4JI5O 3NHEA 3OFNG 1BHBA 4DO2A 3C0RA 1I94O 4P2ZA 2NNUA 2ZM6B 2X0LA 4MVOA 3I56V 1SP4B 3MHSA 2XNDG 4QE7A 4QGPA 4E4EA 1NH2D 5HFLA 2R9OA 5IWAO 2YXLA 3RVZA 1JR9A 2BE3A 1BQZA 4DV6O 2DQ0A 1L8DA 3OR7C 4DR2B 1K92A 1Q90D 2DZYA 3K08A 3LSSA 4LF7B 2G38A 4NXMO 1QVGU 4QRVA 2DC9A 3P32A 3RYFB 3OR6C 4LF9B 1MOFA 5J2UA 5JQGA 4MW3A 2Y4TA 3ETQA 5JH7A 4I50B 4JI2B 3ZRWA 2M6YA 4P16A 1BHAA 4DW0A 4BIOA 3FD9A 3ZRXA 3ZHVA 2B5UA 1M57B 3LDEA 2N04A 4ZHQA 3CJHA 4LFBB 3ABKB 3MJ5A 2RDCA 2YICA 3RT3C 3E9SA 2XHBA 3IGAC 4I0XA 2P7UA 2UZJA 2E02A 4WA6A 1MDWA 2BSKB 3OEEG 2PY5A 3LUTB 3K5OA 1PPPA 2PI5A 5B3SB 2R9RB 4B3RB 3BWKA 2HXZA 3ETEA 4MVMA 2IU0A 2E01A 3B4SA 5EIBC 4TUYB 2LFSA 5IWAB 5GTHZ 2CAZC 1HUCB 2R9FA 4X1KB 4JI0O 1ME3A 1GMYA 1PPJH 4EKWA 2ZE5A 1MZFA 4HYOA 2CIOA 1UFIA 1NS1A 2XAGA 5LMNO 1IXMA 1VQ7V 3K57A 3ERVA 1FJGB 3L71H 1PKXA 4K0KO 4RNAA 3RBZA 1QCEA 2VRZA 1Y76A 4W5BA 1COWG 4AQYB 2ZDIC 2PBHA 2F66C 3DGEA 4LR3A 2JGDA 2ETNA 1YJ9V 4PA3A 4YIPA 4UCRA 3BY4A 4CZWA 4CZZA 3K3WA 5KA6A 4DV7B 4I5SA 1R3LC 3WXGA 1PXVA 4W5CA 2PYJA 4PT5A 1KMIZ 2X6CA 3WG7B 2F1MA 5EZYB 4JI8O 4D8EA 1NL6A 2P86A 1PNKA 2GTSA 1F7YA 1AJQA 1X9YA 4PJ0Z 2QEXV 4TV9A 4DV6B 1O9GA 2AUZA 3R66A 3E8FA 3BCNA 5LYJA 2XAFA 3T1HO 1JQPA 1IVSA 1MG1A 1S3JA 3H01A 1MABG 4UV8A 5JZEA 4GX5A 2R9MA 3N2KB 1VF7A 1KC8W 4NR1A 2A9HA 2EJ7A 1CP9A 5LP6A 2UXNA 2LW1A 3IFUA 4N21A 2ADQB 5LHHA 1VARA 2UXDO 2YJBA 1MSDA 3H8CA 2QM4A 3NR7A 2UUBO 2HJDA 3CCUV 3BPFA 5JQGB 5LYJB 3OTFA 4CDFB 1QLNA 5CMUA 1VQ6V 3E2EA 4D8BA 4P30A 1IBLB 3VQYA 5JJNB 3PW3A 3N2KA 4H13B 2EZPA 5KUMA 2HJFC 4FIPC 1Q8IA 2AUXA 2WBFX 2W6IG 4X6HA 4BOZA 1M6DA 1NKDA 1MSWD 4MI7A 2A79B 2J7QC 3K9MA 2YSUB 1IURA 1JMKC 1XKGA 6PADA 2HEPA 4QE9A 3GVMA 1YDXA 4L87A 4X9QA 3WB1A 1KP2A 1PL0A 4A5UA 1AI5A 2JEUA 3B09A 1YI2V 1GAXA 3JSNA 5LGTA 5BXZA 4GKKO 3DC5A 5E79Z 4YYUA 4B3TO 4FK5A 2V1DA 1HR0B 1PIPA 1IXBA 4X64O 2MK3A 1BY8A 2ZDIA 4JI2O 5LOVB 1PP9H 1Q6IA 5FPOA 4X6IA 3MP2A 3PRPA 1FXHA 5LHIA 4YHHB 4K8ZA 4UVAA 4LFAO 4DR3O 2G8JA 1R6KA 3CYOA 5B1AC 3T4DA 4JI3O 1HNWB 3JASA 1F23A 4WCEV 1BCCH 4H44B 4KUMA 1EWLA 1N4CA 3TMPA 1EBOA 2V7QG 1DTOA 4IGGA 3TCUA 4DV5B 3AG2C 1NTZH 4R3DA 3IFXA 1XNRO 1Y4MA 5H2FZ 4FLZA 1VP7A 3ZMSA 2EILC 1LUVA 4DMXA 3M8AA 3CRAA 1QR9A 1N0NA 4JI4O 3BPZA 5JVDA 1QXPA 1V55C 2VS0A 3UO2A 3STLC 4LNUB 3ASOC 2VQFB 5KMGB 2R9IA 1PD3A 2AIMA 4Z2WA 2NLJC 1AYUA 4P6EA 2IM9A 4EB6A 1M56C 4I4TA 3G67A 4Q8HA 1TUBA 5FLXN 2YJ9A 4LP8A 1CQDA 3W7XA 2CTQA 2XAJA 3K06A 1BL8A 4KHPO 2VWJA 5L3EA 2YI8A 1CV8A 1VF6A 4L8JA 1HNWO 1SQBH 5KMGA 2Z84A 4PI3A 1NR7A 4UVBA 5IY5C 2P7TC 2L35A 4UV9A 2AVWA 3GCBA 1WA8A 2ZR3A 2WSSG 3BHPA 5IJ9A 4PHZA 2GUZA 3BA9A 2KSDA 4DUYB 3O65A 4FFBA 4W4UA 2PZSA 4NXNO 3B8MA 1KFUL 1XNQB 3E22A 4B7EA 2RJZA 1AR1B 3KWZA 3ABUA 2Q4PA 4I7ZB 4FZ0A 4DR3B 5GONA 4LF8B 1Q82W 4QBBA 3BABA 3E35A 3BB7A 5F2VO 1BT8A 4JPRA 4RWUA 4UB6Z 2G7YA 5A24A 3K5LA 4C7UA 2CB5A 5LOVA 3ETDA 1WP7A 3K0DA 5IYBO 4UCOA 1CPJA 4GCZA 4I9WA 3CRCA 2BCCH 3L75H 1JA8A 4DR4B 2DYRC 2DE0X 5D5PA 4CH5A 2XOKG 2Q5ZA 1BGOA 3F5TA 4ZOLB 1KKDA 3K24A 3KW9A 4GLXA 1XL4A 3FB8C 1KXRA 1ZL8B 4WF9V 4FM0A 3CD6V 1STFE 5CA3A 3E1ZB 1CB5A 5IYZA 5B5EZ 3D36C 1CEZA 4JAVA 3P5WA 1LR1A 4DV2O 4FK5C 1FXKA 3CP1A 4XDLA 1Y6XA 3THOA 1SQPH 1HNXO 1JCHA 4YV8A 2OIGA 4FJCC 2Y0IA 4N23A 2LW7A 2VWKA 3PBHA 1THEA 4P6GA 4G27B 3TETA 1L1FA 3JAKB 4TQFA 2AS8A 1ZUQA 4Z1MG 4R6ZA 3OTOB 3PT2A 1V55B 1WA8B 4CS2A 1I08A 3PRMA 2EULA 2YJ8A 2GHUA 4ZTBA 3TRKA 5EC1C 1K3BB 3RW0A 4DV1B 1VEWA 2GUZB 2HWKA 1WPBA 1WNSA 4MZOA 3FB7C 1CJLA 1QDQA 2BDZA 2AXTZ 2ZD9A 2JGUA 2Q7HA 2HD5A 1UJWB 4R7CA 5LHGA 3P5UA 3IOQA 4MM3B 3QTCA 1TLOA 1JJ2U 3SJCC 4JI0B 1LNQA 2DWDC 3BA8A 3SPIA 1F4MA 3LDDA 1X4TA 2DCCA 5HFMA 3CCSV 1TVKA 4DR5B 3DSQA 3SGIA 2LFRA 2FL4A 3CCMV 2HVKC 2ZCEA 2DMXA 2ZINA 3HKCA 1KB9F 2QGNA 2HP8A 2UUBB 5KAIZ 4B08A 4JI4B 3OW2U 5DN6G 5IYCO 4LFBO 2ITDC 4DW1A 3ABMC 3SYAA 3CB2A 1J5EB 1RPOA 3H1KH 4X6JA 3QF7A 4JTDB 1P4RA 5H6QA 5B1BC 1Q3EA 1YITV 4JZGA 2BTOA 3APOA 1QMYA 4I55A 2W0XA 5LA6A 1NVPD 1NT2B 1K33A 1NTKH 4B3RO 3MHSC 4O4LA 1TU6A 1G8MA 2BSKA 1AROP 2WLJA 4K8XA 1QLEC 2BOCC 1JVMA 2PTMA 3LDCA 4DXWA 4JYAB 3CMAV 2H7JA 1AB3A 3QO5A 3V6CA 3L70H 1H8HG 1PE6A 3BOWA 2GDSA 5DEDA 2MW2B 4DR7O 1F29A 1HR0O 1I5XA 3JCUZ 1RSOA 4NXNB 4NB5A 3SJBC 2UXDB 3I55V 5CA1B 4X1IB 4JTAB 4RY2A 1TAEA 2YJ2A 3SJQC 1ROPA 5EBLC 3T1YO 2WLIB 3UKMA 3HR0A 5CVNB 1YVBA 1N33B 2XU1A 3Q4HA 2F7DA 1M57C 4DR6O 4MTGA 3OVXA 3P3PA 1DEUA 1ZIVA 4MTOA 1A32A 1TUEB 4JI8B 3BEHA 4J41A 1QR8A 2X7RB 2QSAA 5CA1A 5EZYA 5L3BA 3OT7A 3EFFK 1N0JA 1I7FA 2OTJV 4RF0A 2AZ0A 2QR4A 1SQGA 3ML0A 2ZR2A 2XT9A 2Q8VA 2PNSA 4IIJA 1WLEA 4MSWC 2OCHA 1AU2A 1WP8A 4GKKB 3AG7A 3RYIB 4QPJA 5EYPA 3DTUB 4BIUA 1YVWA 2FRQA 3O9OA 2YIDA 5KHIA 1K73W 3BAAA 2BDLA 4QRGA 3R65A 5LP6B 1FFXA 1ZAUA 4FIPA 4YYRA 1E79G 3UO3A 5IDJA 5CHTA 3WXEA 9PAPA 4BPVA 4PP2E 2F43G 1KD1W 3RYHA 5B1OA 1JFFB 3QG5A 4JI6B 4YYSA 4I55B 3U10A 1YTFD 1U97A 3SYQA 1Q86W 3E8HA 4DR7B 1FFXB 3JD0A 4NKGB 3ABKC 2E5LO 2KKWA 2DN9A 4LH6A 3VOUA 3APQA 3H1HH 2R9AA 2OYQA 4YXWG 2QE7G 4TUYA 2R9CA 3IUTA 4LBEC 1VQKV 3P5XA 3J81N 5EIBD 1ZSPA 2C2AA 2P22C 3CS5A 3D8CA 1XQ8A 1S5HC 1VQ9V 1WB7A 4X8AA 5LBQA 5BR8B 4UUJC 4YY3B 4ZUXU 3AG4B 2F95B 4ZI7A 1YXBA 4GUAA 1XREA 3HKEB 5EK0A 4KP4A 3ZRSA 4I05A 2UUAO 4FLVA 2ZM6O 3SYPA 5AG2A 5IY5B 2RMKB 2UU9O 2OWOA 3PN1A 1XMOB 3Q4HB 3S3QA 1PPDA 1S5JA 2QKAA 3HB3B 2EBOA 4X1KA 1EZJA
chains in the Genus database with same CATH topology
4DV0O 4RF0A 5BXZA 4GKKO 2DOSA 4NXNO 2VQFO 4DR1O 3OTOO 4B3TO 3BY4A 1IBLO 4X64O 4JI2O 1XEQA 1DKIA 2UXBO 4JI5O 2J7QA 3MP2A 3PRPA 4PT5A 4LF9O 3BB7A 4LF5O 2BTWB 1X59A 4LFAO 4LFBO 4DR3O 3C0RA 1I94O 2ZKOA 4JI8O 4D8EA 4A5UB 2UXCO 3JAMN 3J7AU 1KUQA 4OVZA 1XMOO 1R6TA 4JI3O 1F7YA 5IWAO 3W31A 4R3DA 2JRIA 4BOQA 2AGAA 2FE8A 4LF7O 5BR8O 4M0WA 4OW0A 4RKXA 3TMPA 4DV6O 3ZNHA 3R66A 1N36O 5A2QN 1FJGO 3T1HO 3B21A 4YY3O 1N33O 3F5TA 2VQEO 4X66O 4NXMO 1XNRO 2Z0AA 1DK1A 2BU3A 2BTWA 4XZXA 4B3RO 2N74A 4B3SO 2DJVA 3RNVA 3MTVA 4IP3A 4YHHO 5JZEA 1AILA 3M8AA 4OX9O 4OVZB 4JI1O 4HXDB 4GKJO 2JTCA 4D8IA 4JI4O 4B3MO 4DV1O 1IBMO 4P16A 3IFUA 4OPAA 4DV2O 4BOPA 3SDLA 3OQCA 1AB3A 4BOSA 5E6JA 2UXDO 4RF1A 1R1BA 4DR5O 3BBAA 1UKFA 4DV7O 1HNXO 2UUBO 4JI6O 2E5LO 1PVJA 1HNZO 3MJ5A 4BOUA 4DR7O 2LW7A 1HR0O 1N32O 3RT3C 1D2DA 5IT9N 3E9SA 4JYAO 2UZJA 3PHXA 3PHUA 4JV5O 2FKXA 4AQYO 4DV3O 4WURA 5H5NA 3J81N 4D8BA 5FLXN 4X62O 4DR2O 4OPHA 1XNQO 3PT2A 1G1XB 3T1YO 4LF6O 4KHPO 5LL6Y 3PRMA 5EZQA 4JI7O 4DUYO 4DV5O 4DUZO 1FYJA 4ZTBA 4DR6O 3TRKA 4GUAA 1HNWO 3J80N 5LMUO 4BOZA 2Z84A 2HWKA 4JI0O 2UUCO 2HHHO 1A32A 2UUAO 4LFCO 2ZM6O 4MI7A 3PSEA 4DV4O 4X65O 2J7QC 2UU9O 5KO3A 1NS1A 4REZA 3W30A 4IUMA 4LF8O 1N34O 3PHWA 4MM3B 5LMNO 5BY1A 5EZSA 1IBKO 1XMQO 1J5EO 4K0KO 4RNAA 4A5UA 1YZBA 4LF4O 2F4VO 4DR4O 1FKAO 3O65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 O;  5BXZ A;  4GKK O;  2DOS A;  4NXN O;  2VQF O;  4DR1 O;  3OTO O;  4B3T O;  1IBL O;  4X64 O;  4JI2 O;  1XEQ A;  2UXB O;  4JI5 O;  4LF9 O;  4LF5 O;  1X59 A;  4LFA O;  4LFB O;  4DR3 O;  1I94 O;  2ZKO A;  4JI8 O;  4A5U B;  2UXC O;  3JAM N;  3J7A U;  1KUQ A;  1XMO O;  1R6T A;  4JI3 O;  1F7Y A;  5IWA O;  2JRI A;  2AGA A;  4LF7 O;  5BR8 O;  4DV6 O;  3R66 A;  1N36 O;  5A2Q N;  1FJG O;  3T1H O;  4YY3 O;  1N33 O;  3F5T A;  2VQE O;  4X66 O;  4NXM O;  1XNR O;  2Z0A A;  1DK1 A;  4B3R O;  2N74 A;  4B3S O;  2DJV A;  4YHH O;  1AIL A;  3M8A A;  4OX9 O;  4JI1 O;  4GKJ O;  4JI4 O;  4B3M O;  4DV1 O;  1IBM O;  4OPA A;  4DV2 O;  3SDL A;  1AB3 A;  2UXD O;  1R1B A;  4DR5 O;  4DV7 O;  1HNX O;  2UUB O;  4JI6 O;  2E5L O;  1HNZ O;  4DR7 O;  2LW7 A;  1HR0 O;  1N32 O;  3RT3 C;  1D2D A;  5IT9 N;  4JYA O;  4JV5 O;  2FKX A;  4AQY O;  4DV3 O;  5H5N A;  3J81 N;  5FLX N;  4X62 O;  4DR2 O;  4OPH A;  1XNQ O;  1G1X B;  3T1Y O;  4LF6 O;  4KHP O;  5LL6 Y;  4JI7 O;  4DUY O;  4DV5 O;  4DUZ O;  1FYJ A;  4DR6 O;  1HNW O;  3J80 N;  5LMU O;  4JI0 O;  2UUC O;  2HHH O;  1A32 A;  2UUA O;  4LFC O;  2ZM6 O;  4DV4 O;  4X65 O;  2UU9 O;  1NS1 A;  4LF8 O;  1N34 O;  5LMN O;  5BY1 A;  1IBK O;  1XMQ O;  1J5E O;  4K0K O;  1YZB A;  4LF4 O;  2F4V O;  4DR4 O;  1FKA O;  3O65 A; 
#chains in the Genus database with same CATH topology
 4AXM A;  2DOS A;  1NJI W;  5EGW A;  3DC6 A;  2NR5 A;  3HKE A;  3SPH A;  2JK5 C;  4LWS A;  1URF A;  1HNX B;  1MIR A;  4TV9 B;  3LXS A;  3LSQ A;  2PUS A;  1T5E A;  4RUF A;  4K35 A;  2YEV B;  5J2T B;  1GM9 A;  4RO2 A;  1A6R A;  2XAS A;  3K8U A;  2F23 A;  3T1C A;  4QPK A;  1NLJ A;  2GV9 A;  3ZRW B;  2ZIO A;  3GWK C;  2WA3 A;  5BR8 O;  3O1G A;  3ZNH A;  3AI8 A;  4ZHQ B;  4UCT A;  1SNK A;  3FAV A;  3L72 H;  1NH2 B;  1N33 O;  2DCB A;  4EB6 B;  3IHP A;  1SQF A;  1YF2 A;  4PDM A;  4KHP B;  2N74 A;  2DW4 A;  4I4T B;  1I94 B;  1M56 B;  3RNV A;  4AXL A;  4ZKI A;  1AI6 A;  4HXD B;  1WN7 A;  2O6X A;  3D6S A;  1V54 C;  3SPJ A;  3F75 A;  1IBM O;  1WAZ A;  3CC2 V;  1HDJ A;  4XR7 A;  3CHX A;  4DR5 O;  3CXC U;  2IPP B;  1YJW V;  1AI4 A;  1S76 D;  1DLB A;  1N32 O;  3JD4 A;  5JCO A;  3CRQ A;  1M4U A;  4DV3 B;  2WLN A;  4KL1 A;  3PHU A;  3X2Q C;  4AQY O;  1H2G A;  3N3K A;  1Y74 A;  3AG1 C;  1H2S B;  1GCB A;  3RVY A;  1XNQ O;  1SQV H;  1KHQ A;  2WWW A;  3QVN A;  4G2K A;  2GBO A;  4MVQ A;  2VHS A;  4UCU A;  1V9P A;  3CE2 A;  1XL6 A;  2UUC O;  4X66 B;  3IV2 A;  4YJ3 A;  2ZE7 A;  3ABL B;  4FLX A;  4I04 A;  3W30 A;  2UU9 B;  2FT2 A;  2CK3 G;  1M1K W;  1KQS U;  3PHW A;  4QNH B;  2QJ1 A;  2EZO A;  4RQF A;  4JV5 B;  4IYI A;  3H7D A;  4KLB A;  2D3O W;  4BW5 A;  1EN5 A;  1H8E G;  3B77 A;  3OGI B;  3G4S V;  1K4D C;  3OMI B;  3T4Z A;  3P30 A;  2PYL A;  5H9C A;  3PNR A;  2LP7 A;  4YYV A;  2HLD G;  5DEC A;  3VBB A;  4ABM A;  3U0Z A;  1XEQ A;  4HBN A;  4LF9 O;  1DF0 A;  3ZRV A;  5B1A B;  4AIL C;  2EIM C;  3OUF A;  2UXX A;  4LC1 A;  1CVZ A;  1R6T A;  5LP6 C;  1Z5V A;  1AP6 A;  1B06 A;  2IJI A;  4PEL A;  4BAY A;  1JPX A;  5BZB A;  3AG3 B;  3ABM B;  3CSX A;  5K16 A;  5FPR A;  2E75 B;  1THZ A;  2R9N A;  4RKX A;  2Q73 A;  3FFQ A;  3OD4 A;  2BTQ A;  5J2T A;  1MZE A;  1PM9 A;  3CBK A;  3KX1 A;  2P06 A;  4U3F H;  4YY3 O;  1VQO V;  4HNA B;  4X66 O;  2ATO A;  2BTW A;  3C3T A;  4TWK A;  2JS3 A;  1OCO C;  3WFV A;  1RP3 B;  1AYW A;  2P4V A;  2JJ1 G;  1CXZ B;  2Y5B A;  4GKJ O;  3E8G A;  3FB6 C;  1WJZ A;  4XUI A;  4B3M O;  1XIL A;  3CCJ V;  1UPG A;  3UT5 B;  2ODM A;  1G4Y B;  1TUB B;  2WLM A;  5JJE B;  3V6E A;  2D2C B;  3OQC A;  3CPW U;  2OCC B;  1U9Q X;  3P5V A;  2KG7 A;  4O4J A;  1N8R W;  3KKY A;  1PVJ A;  1J95 A;  3HKB A;  1SRY A;  1ORQ C;  2Y6E A;  2HR3 A;  1OCR C;  3FX7 A;  4UFZ A;  2HG5 C;  2FKX A;  4DV3 O;  3LFY A;  3JAR B;  4LNU A;  1WB8 A;  1LUW A;  2LGW A;  4PDL A;  5IE9 A;  1YK8 A;  4JI7 O;  3SR2 C;  4HZ3 A;  2Q7E A;  5BMV B;  3J80 N;  3MHH A;  3W7W A;  2OTL V;  2Q0A A;  2ZXW C;  3S3W A;  2QM8 A;  4K7C A;  1RM1 C;  1IDS A;  3A2F A;  2UUC B;  1H2L A;  4CDE B;  4MVS A;  2QWN B;  5BY1 A;  3ICX A;  3OVZ A;  1FFT B;  1OCC B;  2HKO A;  1S4V A;  3CME V;  4DYL A;  4LF4 O;  2F4V O;  2YJC A;  5LXT B;  5GON B;  1FKA O;  4DV0 O;  1OHH G;  4R50 A;  4UXN A;  3VQW A;  1M93 A;  2ARH A;  1QOL A;  5L3G A;  1BQI A;  2AYO A;  2WLL B;  3DXR B;  3H8B A;  4X1Y A;  2E5L B;  2KB1 A;  1QHT A;  3RYC B;  3FYI B;  3OE7 G;  5CA0 A;  3JAM N;  2HFE C;  2YDE A;  3G71 V;  1EWM A;  4BS6 A;  3DF0 A;  2JS5 A;  4UB8 Z;  1XMQ B;  4PA6 A;  3UQ8 A;  2JRI A;  1W0K G;  2DC7 A;  2VQE B;  3EVK A;  1PPN A;  2Y4U A;  2GHY A;  4TOI A;  4OW0 A;  3T1Y B;  4PA4 A;  4X1Y B;  3IC9 A;  1YSC A;  3E83 A;  4GZR B;  4YJ2 A;  3B21 A;  3AG2 B;  3ZBH A;  4B3S O;  4F6R B;  5KLV H;  5FL7 G;  3K9S A;  1OCZ B;  1AIL A;  4UCV A;  2NQD B;  1NQC A;  2BTQ B;  3BY6 A;  1KYO F;  4GUN A;  3PDF A;  3JAK A;  1Z5W A;  3CCV V;  3QJ3 A;  3LSU A;  4BOS A;  4FM2 A;  3M7M X;  4RF1 A;  2FML A;  3ASO B;  3GB7 C;  4JI6 O;  3HD3 A;  4Q6G A;  4MS2 A;  4GYC B;  4N79 A;  3A0H Z;  4NTX A;  2IBI A;  3QNE A;  2H8P C;  3JD1 A;  4Z1V A;  5CBF A;  1GKF A;  3HHA A;  4HWY A;  1VIB A;  1N32 B;  3E89 A;  4P9P A;  4X65 B;  1VQ4 V;  5KHJ A;  2Z3Y A;  1N34 B;  2QWR B;  2EIK C;  2Q67 A;  3CX5 F;  4U7O A;  2F93 B;  1S5L Z;  4D7T A;  3OIS A;  1NB5 A;  3MDS A;  2HHH O;  4LFC O;  3UM7 A;  1D5N A;  1GN6 A;  3PSE A;  4MT8 A;  4OX9 B;  3IMA A;  4LFA B;  5KO3 A;  2DZZ A;  4YYW A;  1L0N H;  4DRX B;  2ATK C;  4REZ A;  4U3J B;  2DYS C;  4G28 B;  2WLL A;  5JA7 A;  4JAS A;  4CH4 A;  1AP5 A;  4CDD B;  4E2L A;  4DR4 O;  3NXS A;  3U11 A;  4RAI A;  1MEM A;  3KSE A;  2WLK A;  3KG2 A;  3ZMT A;  3STZ C;  4TV8 B;  1ICF A;  3KKU A;  3JD3 A;  2Q9L A;  3KWB X;  1GTO A;  2CGN A;  1SZX A;  5L3D A;  2JJ2 G;  1XDC A;  2Y69 B;  1JFF A;  2QKC A;  4XDK A;  1Y08 A;  4O4H B;  3K9A A;  3S3X A;  1SF9 A;  1SKV A;  3DXR A;  1M5I A;  2QM7 A;  1Q43 A;  3QSD A;  4CS4 A;  1CTE A;  1NB3 A;  3TNX A;  3K5N A;  3CH2 X;  2DC8 A;  5L3C A;  5CB4 B;  4RQE A;  2V4D A;  3CBJ A;  2XU5 A;  1GO3 F;  4YIO A;  4B3S B;  1JJO A;  2DYR B;  3F7Y C;  3TXS A;  2HHH B;  4XZX A;  2NQA A;  2LO1 A;  3JAL B;  2AZ2 A;  4IHJ B;  2JVD A;  2XAH A;  1MNG A;  4EFB A;  3M99 A;  2LQT A;  4AI8 A;  4D8I A;  3ETG A;  2CGO A;  4LF5 B;  4GX0 A;  3KFQ A;  2IU3 A;  3IJ4 A;  5E6J A;  1R3K C;  1R1B A;  2EX3 A;  4O4L B;  3WU2 Z;  5CHV A;  5C8Y A;  4AHC A;  2IH1 C;  2WLI A;  5IJ0 A;  1KHP A;  2BOB C;  5IYD O;  5IT9 N;  3WB0 A;  3PHX A;  2RQ6 A;  2H94 A;  4ZIB A;  1PCI A;  5KA5 A;  1ZL8 A;  4H37 A;  1BSM A;  3JD2 A;  1HW7 A;  2PI4 A;  3BC3 A;  1G1X B;  4BW9 A;  3ABT A;  2HH5 A;  1NBM G;  2EIN B;  3CH3 X;  3ZED A;  1M90 W;  1FYJ A;  3RVV A;  3UCS C;  2ZNI A;  4GX1 A;  1FS0 G;  1Q6U A;  5IJ0 B;  1Q6K A;  1U5I A;  4JF3 A;  2A7W A;  3N2G A;  1ZLZ A;  4JYB A;  4XBF A;  3ZMZ A;  1U9W A;  2Y0P A;  1SQX H;  2W0F C;  4JI5 B;  1OCC C;  5LGN A;  2WPD G;  1H2N A;  1IBK O;  3FYE B;  4FLU A;  2ZT9 B;  3A0R A;  3SYC A;  3OF8 A;  1Z2G A;  1S77 D;  4PI2 A;  1VQP V;  1AVM A;  1SQQ H;  4BSQ A;  1XI1 A;  4OGQ B;  4LH7 A;  1AEC A;  1VQM V;  3N2G B;  4X20 B;  2AHY A;  1S72 V;  5LA6 B;  1SC5 B;  1D5A A;  1JX9 A;  4NVP A;  4IT5 A;  1QNM A;  1IBM B;  1GM7 A;  1QVF U;  1Q7Y W;  1U9X A;  2NQG A;  2E74 B;  3MOR A;  3T1H B;  3H1I H;  4PV1 B;  1Q6H A;  3RVX A;  4YYQ A;  1TVK B;  1VMG A;  2P4K A;  3EXA A;  3RYI A;  3W7T A;  5KHH A;  1W0J G;  2K1E A;  2VQE O;  3WXF A;  4WFE A;  4WFB V;  2R6N A;  1YAL A;  2NN4 A;  4DR6 B;  4YHH O;  1PNM A;  4JI3 B;  2O57 A;  3VQX A;  2ZNJ A;  3BRC A;  4JI1 O;  2OUL A;  3AG1 B;  1CSB B;  2ZQM A;  4FLT A;  4R8C A;  4DV1 O;  4BOP A;  1PAD A;  2B9Z A;  4EEQ A;  1M9N A;  3BVO A;  2X6A A;  3BBA A;  1UKF A;  5L3F A;  4IHJ A;  3RGB A;  1I5Y A;  1QU7 A;  4J80 A;  2QWP B;  2GTA A;  4B7K A;  3CCL V;  1MEG A;  4FFK A;  1NZ6 A;  2XTA A;  4O2B B;  5H5N A;  3RYF A;  3I3T A;  5CN0 A;  4DR2 O;  1AYV A;  2CTP A;  2QDO A;  3ZN1 A;  1B6Q A;  4LF6 O;  5LL6 Y;  3ZN0 A;  1Y76 B;  4WFG A;  3K03 A;  1JOY A;  2VHF A;  3LNN A;  2FRA A;  1E1Q G;  3H6S A;  3CJH B;  3JCZ A;  2OIE A;  1I0H A;  1RSO B;  3X2Q B;  1H2M A;  3IAY A;  1SS3 A;  2ZE8 A;  1BS3 A;  4BS5 A;  1H38 A;  4X64 B;  3WB2 A;  1XHZ A;  1J5E O;  3S3R A;  1MHW A;  1AI7 A;  4HAM A;  1GN2 A;  1GM8 A;  2KQX A;  4I07 A;  1TA8 A;  1Y67 A;  3AG3 C;  2FUD A;  1MS6 A;  1VF6 C;  1ZX3 A;  5B1B B;  1AJP A;  3ABL C;  4PDR A;  2UXC B;  7PCK A;  2CE4 A;  4UCS A;  1SA0 B;  5EBW C;  1YIJ V;  2BTW B;  2YIB D;  2K9P A;  2ZKO A;  3HHI A;  3KZI Z;  4J9Z B;  4O2A A;  2FTD A;  3CCE V;  2LJ2 A;  1OZ0 A;  5CVM A;  2G6D A;  3O0U A;  3P3N A;  3AK1 A;  1VQ5 V;  2JDI G;  3AEI A;  1N36 O;  4G54 A;  1WPX A;  3W7U A;  4RUE A;  1QQC A;  2XU3 A;  4MVR A;  1NU1 H;  2WLH A;  4MZS A;  3F5W C;  3H9V A;  4FMT A;  1QBZ A;  2AU1 A;  3JSL A;  3G6E V;  2E03 A;  2F1G A;  5EYP B;  3JAR A;  1U9V A;  2N05 A;  3JAT A;  2UUA B;  3IC7 A;  4TT3 G;  3ZHT A;  2Q0O C;  4ZI7 B;  1R73 A;  2CH7 B;  3ZIA G;  3U8E A;  5E1A C;  3MD0 A;  3HWN A;  4DV0 B;  5J2U B;  2YUA A;  3B40 A;  1P84 F;  1F4N A;  4J10 A;  1HNZ B;  4JYA O;  2PGG A;  3ZHR A;  3ZHS A;  4CC6 A;  2R72 A;  1HWY A;  2EIL B;  2A0L A;  2AW9 A;  4FZ1 A;  2FQ9 A;  2IW5 A;  1CPY A;  4X62 O;  4YJ3 B;  5EBM C;  1L0L H;  3L74 H;  5B66 Z;  2AHZ A;  5LXT A;  1K34 A;  3C3S A;  2P0R A;  3ASN C;  2RNB A;  3IEJ A;  4N4Z A;  4DV2 B;  4K0K B;  5LMU O;  1EN6 A;  2YXH A;  2DCA A;  4O2B A;  1F2B A;  2QWQ B;  4PA9 A;  1YK7 A;  4LWS B;  2B1M A;  3ZUA A;  2E76 B;  1OCR B;  3C90 A;  4DV4 O;  1DF5 A;  1K8A W;  3EHB B;  1R3I C;  1CS8 A;  2GFO A;  2AYN A;  2JGD B;  1P49 A;  2YEV A;  4YVA A;  1Y66 A;  1K3E A;  1FXK C;  2Q69 A;  4QH6 A;  5TIS Z;  2DJF B;  1FXV A;  3JAS B;  5D5Q A;  3CCQ V;  1SES A;  3RN4 A;  1NI8 A;  4DR1 O;  2IJJ A;  3CC7 V;  1MMM A;  1P7G A;  3TXQ A;  2HVJ C;  3ZCC A;  2YS8 A;  3JYC A;  2ZIM A;  4NTW A;  1KKC A;  2IBZ H;  1VJV A;  3ZX6 A;  2UXB B;  2ACT A;  4A5U B;  5J9P C;  2Y69 C;  1YTF B;  2ILM A;  3QO8 A;  4JYY A;  4HNA A;  3QO7 A;  4JTC B;  2EIJ B;  1XHX A;  2Q6A A;  2C0Y A;  1YT7 A;  4KFM A;  1GLO A;  4BOQ A;  4WBN B;  3K0G A;  5KUK A;  2IJH A;  5EC2 C;  3JAT B;  4PI0 A;  4IYH A;  4DMY A;  4O2A B;  3UT5 A;  2G8E A;  5GTI Z;  1FAF A;  3E86 A;  2Z0A A;  2XUM A;  1FPO A;  4NTY A;  2E3C A;  2DJV A;  4IP3 A;  1XBL A;  1Y74 B;  4OX9 O;  3HKB B;  4NYK A;  3OMA B;  1V54 B;  1ITO A;  4X89 A;  4JAA A;  1F51 A;  5C93 A;  3PJS K;  1HNZ O;  2RN9 A;  1PL4 A;  3FAV B;  2QTS A;  1P7B A;  3G80 A;  1D2D A;  4DRX A;  4MTX A;  2OP3 A;  3N27 A;  1TGO A;  1MA1 A;  1VQN V;  5FNV A;  4O4I B;  5K1P A;  4OPH A;  1IWD A;  4P9O A;  5JH7 B;  5JVD B;  5CVO B;  5EZQ A;  5J94 A;  4DUY O;  5F02 A;  4DUZ O;  2ZXW B;  2EIN C;  3N3G A;  3D3Q A;  1RM1 B;  4J7K A;  2XAQ A;  3T2M A;  3TK1 A;  5JCO C;  4CBC A;  3RVW A;  1FD9 A;  3F5V A;  3MAQ A;  1K4C C;  1EF7 A;  1AU3 A;  3E8B A;  2P90 A;  2A3Q A;  4LF8 O;  4JI7 B;  5FNV B;  5B3S C;  5EZS A;  5BMV A;  4MW8 A;  4O4H A;  4QJF B;  2E00 A;  4Q8G A;  4DR1 B;  3HPL C;  3L73 H;  4CC5 A;  4CH6 A;  2GSM B;  3OEH G;  4QRX A;  1K5Q A;  2WA4 A;  1F2A A;  4X88 A;  3ZHQ A;  2UXB O;  4Q20 A;  3TJT A;  4BR6 A;  3ZJZ A;  1X59 A;  4F6E A;  4ICG A;  1E1R G;  2UXC O;  4OVZ A;  1YHQ V;  4YJ2 B;  1XNR B;  3J7A U;  4DK0 A;  5PAD A;  4W4K A;  1GRJ A;  4J7Z A;  4FFB B;  2Q7G A;  2CTW A;  4F6R A;  2NQI A;  1EN4 A;  2EJR A;  3RYC A;  1BP4 A;  2DWE C;  2ZE6 A;  4M0W A;  3E22 B;  4GT1 A;  1F2C A;  1DGS A;  1YJN V;  5C8Y B;  5A2Q N;  1FJG O;  1ZWI C;  4W4L A;  1TL9 A;  2PF4 E;  3GWO A;  2BU3 A;  4PDV A;  3SPG A;  3K59 A;  5LMU B;  1BZK A;  3KCX A;  3H1L H;  3MTV A;  3ZMU A;  1OCO B;  4OVZ B;  4OEM A;  3W7S A;  3D36 A;  4OPA A;  4TQD A;  3SDL A;  3ZHU A;  2JQF R;  2B1G A;  2XU4 A;  5H6R A;  4FLY A;  1G6U A;  2OCC C;  5ITZ A;  3JAW B;  3CCR V;  4WUR A;  4UVC A;  4J7J A;  3C9E A;  1W59 A;  4B3M B;  3ASN B;  2OT5 A;  2QTO A;  2YI9 A;  2P67 A;  3B2E E;  1NPZ A;  3MHH C;  4OXS A;  4DK1 A;  4H33 A;  4PA7 A;  3SJA C;  2KG7 B;  3BFR A;  4O4J B;  4DUZ B;  1EWO A;  2YIB A;  3TGU H;  4CS3 A;  4O4I A;  1GMG A;  3CEI A;  1U96 A;  3I06 A;  2W6J G;  2IJK A;  4QIW F;  5EF4 A;  1KBH A;  2RCV A;  4J9Y B;  1N34 O;  4BIZ A;  4FPP A;  3CWB H;  4TSF G;  4WFA V;  2ARY A;  2EIM B;  3SYO A;  1Y4H A;  5CA0 B;  3CXH F;  1W2B U;  5JJJ B;  2CDY A;  2FYU H;  5CBG A;  2ADP A;  5KHG A;  1K7D A;  1EZV H;  5CBH A;  5B1N A;  4FLW A;  1BE3 H;  3H89 A;  1PPO A;  3OF9 A;  1O9H A;  4JI1 B;  1RPR A;  1B04 A;  4J42 A;  1PBH A;  2M7W A;  1KUQ A;  2EIJ C;  2QA4 V;  4KXR A;  4ZOL A;  2A06 H;  4ASU G;  3JAL A;  3LNM B;  2ITC C;  3OAA G;  3AK2 A;  4LF7 O;  4NXM B;  5LGU A;  2FB5 A;  1GEC E;  2PRE A;  2IH3 C;  3HKC B;  3M99 B;  1O0E A;  2CUG A;  3B8N A;  4EFE A;  1ME4 A;  4MVU A;  3BPM A;  1Q81 W;  1OV9 A;  4LF6 B;  1B3Q A;  1QLE B;  2DC6 A;  3BCC H;  5KHK A;  1ZTE A;  4X1I A;  1K5S A;  1GK9 A;  2DQ3 A;  3JAW A;  1ZCM A;  4MSX A;  2X6B A;  2JTC A;  4LFC B;  1OCZ C;  4JYC A;  2B1N A;  4LCU C;  1S0V A;  1VF5 B;  4DV7 O;  3K5M A;  2FYE A;  3ZS8 C;  5KX5 A;  4BOU A;  1AU0 A;  3K04 A;  1Q5O A;  3KCY A;  1VSN A;  5IYZ B;  4IL6 Z;  4U3J A;  4JV5 O;  1R6N A;  4K3A A;  4FVM A;  5ITZ B;  1GN4 A;  4DV5 O;  1DF4 A;  3I5D A;  3FB5 C;  2EIK B;  5K1X A;  5LMN B;  1NVP B;  4FM1 A;  1POP A;  2H3O A;  1YEW A;  4PD4 F;  4U7N A;  4OEL A;  4IUM A;  5KAF Z;  2Y48 A;  1XMQ O;  3USV A;  1YZB A;  3K79 A;  5FPW A;  3AG4 C;  1N36 B;  1US6 A;  4JZ2 A;  4WFH A;  3F7V C;  3G6B A;  1GN3 A;  5CB4 A;  1JQ0 A;  1IBK B;  4JAU A;  3ZMV A;  1DKI A;  1K97 A;  1PNL A;  1R3J C;  2J7Q A;  1AIM A;  1AR5 A;  4LF5 O;  3A0B Z;  4ZBM A;  5IJ9 B;  3WG7 C;  4GKJ B;  1NQT A;  3OM3 B;  4CDC B;  2FTK A;  1XMO O;  3OGC C;  4X20 A;  1HP8 A;  3W31 A;  4GX2 A;  2AGA A;  2FE8 A;  1OJH A;  3B79 A;  5DM6 V;  2YXY A;  2CH7 A;  3FKS G;  4TV8 A;  4D7S A;  3N4C A;  4X62 B;  1EFR G;  4BQV A;  1EWP A;  1DK1 A;  2CTR A;  3RFR A;  1BQ0 A;  2Q68 A;  4N8W A;  3CRR A;  3H1J H;  4MVZ A;  4DV4 B;  2QKS A;  4XDJ A;  2P6J A;  1KFX L;  4MTF A;  2DCD A;  3HKD B;  1PV0 A;  1GH6 A;  1EM1 A;  3CC4 V;  3K58 A;  1K9M W;  1BMF G;  1SER A;  4FJC A;  4B3T B;  2JEX A;  2R70 A;  1FH0 A;  1XUQ A;  1KP3 A;  2QWO B;  4PP1 A;  3D3I A;  4WFF A;  1SET A;  5GW7 A;  2OZ2 A;  4I50 A;  4BWA A;  1AU4 A;  3RYH B;  1VQ8 V;  3L9D A;  4PAD A;  4D6T H;  1AJN A;  2PAD A;  2DYS B;  4LF4 B;  2F4V B;  8PCH A;  2HHN A;  3HKD A;  5A9G A;  1VQL V;  2B1I A;  3CRM A;  5KX5 B;  2Z5U A;  2DJG B;  1FXK B;  3OUS A;  4I0X B;  4I9Q A;  4JGS A;  4H0L B;  2L6L A;  1ENV A;  1YCI A;  1H2K A;  1NTM H;  2YC0 A;  4CH3 A;  2LGQ A;  1BGY H;  4X65 O;  3RWR D;  3AK3 A;  1RFY A;  1KU9 A;  4J11 A;  1ATK A;  3OMN B;  2FO5 A;  4IIJ B;  1AR4 A;  3A8T A;  3SPC A;  1IX9 A;  4F4L A;  2JQG R;  1XOU A;  3VQV A;  2YIA A;  2WAM A;  1SA0 A;  5JH3 A;  3QT4 A;  2JIZ G;  2VQF O;  1SZT A;  3OTO O;  4WBN A;  2P5O A;  5JWP A;  1IBL O;  3MTN A;  1KEC A;  1IZ3 A;  1NR1 A;  4JI5 O;  3NHE A;  3OFN G;  1BHB A;  4DO2 A;  3C0R A;  1I94 O;  4P2Z A;  2NNU A;  2ZM6 B;  2X0L A;  4MVO A;  3I56 V;  1SP4 B;  3MHS A;  2XND G;  4QE7 A;  4QGP A;  4E4E A;  1NH2 D;  5HFL A;  2R9O A;  5IWA O;  2YXL A;  3RVZ A;  1JR9 A;  2BE3 A;  1BQZ A;  4DV6 O;  2DQ0 A;  1L8D A;  3OR7 C;  4DR2 B;  1K92 A;  1Q90 D;  2DZY A;  3K08 A;  3LSS A;  4LF7 B;  2G38 A;  4NXM O;  1QVG U;  4QRV A;  2DC9 A;  3P32 A;  3RYF B;  3OR6 C;  4LF9 B;  1MOF A;  5J2U A;  5JQG A;  4MW3 A;  2Y4T A;  3ETQ A;  5JH7 A;  4I50 B;  4JI2 B;  3ZRW A;  2M6Y A;  4P16 A;  1BHA A;  4DW0 A;  4BIO A;  3FD9 A;  3ZRX A;  3ZHV A;  2B5U A;  1M57 B;  3LDE A;  2N04 A;  4ZHQ A;  3CJH A;  4LFB B;  3ABK B;  3MJ5 A;  2RDC A;  2YIC A;  3RT3 C;  3E9S A;  2XHB A;  3IGA C;  4I0X A;  2P7U A;  2UZJ A;  2E02 A;  4WA6 A;  1MDW A;  2BSK B;  3OEE G;  2PY5 A;  3LUT B;  3K5O A;  1PPP A;  2PI5 A;  5B3S B;  2R9R B;  4B3R B;  3BWK A;  2HXZ A;  3ETE A;  4MVM A;  2IU0 A;  2E01 A;  3B4S A;  5EIB C;  4TUY B;  2LFS A;  5IWA B;  5GTH Z;  2CAZ C;  1HUC B;  2R9F A;  4X1K B;  4JI0 O;  1ME3 A;  1GMY A;  1PPJ H;  4EKW A;  2ZE5 A;  1MZF A;  4HYO A;  2CIO A;  1UFI A;  1NS1 A;  2XAG A;  5LMN O;  1IXM A;  1VQ7 V;  3K57 A;  3ERV A;  1FJG B;  3L71 H;  1PKX A;  4K0K O;  4RNA A;  3RBZ A;  1QCE A;  2VRZ A;  1Y76 A;  4W5B A;  1COW G;  4AQY B;  2ZDI C;  2PBH A;  2F66 C;  3DGE A;  4LR3 A;  2JGD A;  2ETN A;  1YJ9 V;  4PA3 A;  4YIP A;  4UCR A;  3BY4 A;  4CZW A;  4CZZ A;  3K3W A;  5KA6 A;  4DV7 B;  4I5S A;  1R3L C;  3WXG A;  1PXV A;  4W5C A;  2PYJ A;  4PT5 A;  1KMI Z;  2X6C A;  3WG7 B;  2F1M A;  5EZY B;  4JI8 O;  4D8E A;  1NL6 A;  2P86 A;  1PNK A;  2GTS A;  1F7Y A;  1AJQ A;  1X9Y A;  4PJ0 Z;  2QEX V;  4TV9 A;  4DV6 B;  1O9G A;  2AUZ A;  3R66 A;  3E8F A;  3BCN A;  5LYJ A;  2XAF A;  3T1H O;  1JQP A;  1IVS A;  1MG1 A;  1S3J A;  3H01 A;  1MAB G;  4UV8 A;  5JZE A;  4GX5 A;  2R9M A;  3N2K B;  1VF7 A;  1KC8 W;  4NR1 A;  2A9H A;  2EJ7 A;  1CP9 A;  5LP6 A;  2UXN A;  2LW1 A;  3IFU A;  4N21 A;  2ADQ B;  5LHH A;  1VAR A;  2UXD O;  2YJB A;  1MSD A;  3H8C A;  2QM4 A;  3NR7 A;  2UUB O;  2HJD A;  3CCU V;  3BPF A;  5JQG B;  5LYJ B;  3OTF A;  4CDF B;  1QLN A;  5CMU A;  1VQ6 V;  3E2E A;  4D8B A;  4P30 A;  1IBL B;  3VQY A;  5JJN B;  3PW3 A;  3N2K A;  4H13 B;  2EZP A;  5KUM A;  2HJF C;  4FIP C;  1Q8I A;  2AUX A;  2WBF X;  2W6I G;  4X6H A;  4BOZ A;  1M6D A;  1NKD A;  1MSW D;  4MI7 A;  2A79 B;  2J7Q C;  3K9M A;  2YSU B;  1IUR A;  1JMK C;  1XKG A;  6PAD A;  2HEP A;  4QE9 A;  3GVM A;  1YDX A;  4L87 A;  4X9Q A;  3WB1 A;  1KP2 A;  1PL0 A;  4A5U A;  1AI5 A;  2JEU A;  3B09 A;  1YI2 V;  1GAX A;  3JSN A;  5LGT A;  5BXZ A;  4GKK O;  3DC5 A;  5E79 Z;  4YYU A;  4B3T O;  4FK5 A;  2V1D A;  1HR0 B;  1PIP A;  1IXB A;  4X64 O;  2MK3 A;  1BY8 A;  2ZDI A;  4JI2 O;  5LOV B;  1PP9 H;  1Q6I A;  5FPO A;  4X6I A;  3MP2 A;  3PRP A;  1FXH A;  5LHI A;  4YHH B;  4K8Z A;  4UVA A;  4LFA O;  4DR3 O;  2G8J A;  1R6K A;  3CYO A;  5B1A C;  3T4D A;  4JI3 O;  1HNW B;  3JAS A;  1F23 A;  4WCE V;  1BCC H;  4H44 B;  4KUM A;  1EWL A;  1N4C A;  3TMP A;  1EBO A;  2V7Q G;  1DTO A;  4IGG A;  3TCU A;  4DV5 B;  3AG2 C;  1NTZ H;  4R3D A;  3IFX A;  1XNR O;  1Y4M A;  5H2F Z;  4FLZ A;  1VP7 A;  3ZMS A;  2EIL C;  1LUV A;  4DMX A;  3M8A A;  3CRA A;  1QR9 A;  1N0N A;  4JI4 O;  3BPZ A;  5JVD A;  1QXP A;  1V55 C;  2VS0 A;  3UO2 A;  3STL C;  4LNU B;  3ASO C;  2VQF B;  5KMG B;  2R9I A;  1PD3 A;  2AIM A;  4Z2W A;  2NLJ C;  1AYU A;  4P6E A;  2IM9 A;  4EB6 A;  1M56 C;  4I4T A;  3G67 A;  4Q8H A;  1TUB A;  5FLX N;  2YJ9 A;  4LP8 A;  1CQD A;  3W7X A;  2CTQ A;  2XAJ A;  3K06 A;  1BL8 A;  4KHP O;  2VWJ A;  5L3E A;  2YI8 A;  1CV8 A;  1VF6 A;  4L8J A;  1HNW O;  1SQB H;  5KMG A;  2Z84 A;  4PI3 A;  1NR7 A;  4UVB A;  5IY5 C;  2P7T C;  2L35 A;  4UV9 A;  2AVW A;  3GCB A;  1WA8 A;  2ZR3 A;  2WSS G;  3BHP A;  5IJ9 A;  4PHZ A;  2GUZ A;  3BA9 A;  2KSD A;  4DUY B;  3O65 A;  4FFB A;  4W4U A;  2PZS A;  4NXN O;  3B8M A;  1KFU L;  1XNQ B;  3E22 A;  4B7E A;  2RJZ A;  1AR1 B;  3KWZ A;  3ABU A;  2Q4P A;  4I7Z B;  4FZ0 A;  4DR3 B;  5GON A;  4LF8 B;  1Q82 W;  4QBB A;  3BAB A;  3E35 A;  3BB7 A;  5F2V O;  1BT8 A;  4JPR A;  4RWU A;  4UB6 Z;  2G7Y A;  5A24 A;  3K5L A;  4C7U A;  2CB5 A;  5LOV A;  3ETD A;  1WP7 A;  3K0D A;  5IYB O;  4UCO A;  1CPJ A;  4GCZ A;  4I9W A;  3CRC A;  2BCC H;  3L75 H;  1JA8 A;  4DR4 B;  2DYR C;  2DE0 X;  5D5P A;  4CH5 A;  2XOK G;  2Q5Z A;  1BGO A;  3F5T A;  4ZOL B;  1KKD A;  3K24 A;  3KW9 A;  4GLX A;  1XL4 A;  3FB8 C;  1KXR A;  1ZL8 B;  4WF9 V;  4FM0 A;  3CD6 V;  1STF E;  5CA3 A;  3E1Z B;  1CB5 A;  5IYZ A;  5B5E Z;  3D36 C;  1CEZ A;  4JAV A;  3P5W A;  1LR1 A;  4DV2 O;  4FK5 C;  1FXK A;  3CP1 A;  4XDL A;  1Y6X A;  3THO A;  1SQP H;  1HNX O;  1JCH A;  4YV8 A;  2OIG A;  4FJC C;  2Y0I A;  4N23 A;  2LW7 A;  2VWK A;  3PBH A;  1THE A;  4P6G A;  4G27 B;  3TET A;  1L1F A;  3JAK B;  4TQF A;  2AS8 A;  1ZUQ A;  4Z1M G;  4R6Z A;  3OTO B;  3PT2 A;  1V55 B;  1WA8 B;  4CS2 A;  1I08 A;  3PRM A;  2EUL A;  2YJ8 A;  2GHU A;  4ZTB A;  3TRK A;  5EC1 C;  1K3B B;  3RW0 A;  4DV1 B;  1VEW A;  2GUZ B;  2HWK A;  1WPB A;  1WNS A;  4MZO A;  3FB7 C;  1CJL A;  1QDQ A;  2BDZ A;  2AXT Z;  2ZD9 A;  2JGU A;  2Q7H A;  2HD5 A;  1UJW B;  4R7C A;  5LHG A;  3P5U A;  3IOQ A;  4MM3 B;  3QTC A;  1TLO A;  1JJ2 U;  3SJC C;  4JI0 B;  1LNQ A;  2DWD C;  3BA8 A;  3SPI A;  1F4M A;  3LDD A;  1X4T A;  2DCC A;  5HFM A;  3CCS V;  1TVK A;  4DR5 B;  3DSQ A;  3SGI A;  2LFR A;  2FL4 A;  3CCM V;  2HVK C;  2ZCE A;  2DMX A;  2ZIN A;  3HKC A;  1KB9 F;  2QGN A;  2HP8 A;  2UUB B;  5KAI Z;  4B08 A;  4JI4 B;  3OW2 U;  5DN6 G;  5IYC O;  4LFB O;  2ITD C;  4DW1 A;  3ABM C;  3SYA A;  3CB2 A;  1J5E B;  1RPO A;  3H1K H;  4X6J A;  3QF7 A;  4JTD B;  1P4R A;  5H6Q A;  5B1B C;  1Q3E A;  1YIT V;  4JZG A;  2BTO A;  3APO A;  1QMY A;  4I55 A;  2W0X A;  5LA6 A;  1NVP D;  1NT2 B;  1K33 A;  1NTK H;  4B3R O;  3MHS C;  4O4L A;  1TU6 A;  1G8M A;  2BSK A;  1ARO P;  2WLJ A;  4K8X A;  1QLE C;  2BOC C;  1JVM A;  2PTM A;  3LDC A;  4DXW A;  4JYA B;  3CMA V;  2H7J A;  1AB3 A;  3QO5 A;  3V6C A;  3L70 H;  1H8H G;  1PE6 A;  3BOW A;  2GDS A;  5DED A;  2MW2 B;  4DR7 O;  1F29 A;  1HR0 O;  1I5X A;  3JCU Z;  1RSO A;  4NXN B;  4NB5 A;  3SJB C;  2UXD B;  3I55 V;  5CA1 B;  4X1I B;  4JTA B;  4RY2 A;  1TAE A;  2YJ2 A;  3SJQ C;  1ROP A;  5EBL C;  3T1Y O;  2WLI B;  3UKM A;  3HR0 A;  5CVN B;  1YVB A;  1N33 B;  2XU1 A;  3Q4H A;  2F7D A;  1M57 C;  4DR6 O;  4MTG A;  3OVX A;  3P3P A;  1DEU A;  1ZIV A;  4MTO A;  1A32 A;  1TUE B;  4JI8 B;  3BEH A;  4J41 A;  1QR8 A;  2X7R B;  2QSA A;  5CA1 A;  5EZY A;  5L3B A;  3OT7 A;  3EFF K;  1N0J A;  1I7F A;  2OTJ V;  4RF0 A;  2AZ0 A;  2QR4 A;  1SQG A;  3ML0 A;  2ZR2 A;  2XT9 A;  2Q8V A;  2PNS A;  4IIJ A;  1WLE A;  4MSW C;  2OCH A;  1AU2 A;  1WP8 A;  4GKK B;  3AG7 A;  3RYI B;  4QPJ A;  5EYP A;  3DTU B;  4BIU A;  1YVW A;  2FRQ A;  3O9O A;  2YID A;  5KHI A;  1K73 W;  3BAA A;  2BDL A;  4QRG A;  3R65 A;  5LP6 B;  1FFX A;  1ZAU A;  4FIP A;  4YYR A;  1E79 G;  3UO3 A;  5IDJ A;  5CHT A;  3WXE A;  9PAP A;  4BPV A;  4PP2 E;  2F43 G;  1KD1 W;  3RYH A;  5B1O A;  1JFF B;  3QG5 A;  4JI6 B;  4YYS A;  4I55 B;  3U10 A;  1YTF D;  1U97 A;  3SYQ A;  1Q86 W;  3E8H A;  4DR7 B;  1FFX B;  3JD0 A;  4NKG B;  3ABK C;  2E5L O;  2KKW A;  2DN9 A;  4LH6 A;  3VOU A;  3APQ A;  3H1H H;  2R9A A;  2OYQ A;  4YXW G;  2QE7 G;  4TUY A;  2R9C A;  3IUT A;  4LBE C;  1VQK V;  3P5X A;  3J81 N;  5EIB D;  1ZSP A;  2C2A A;  2P22 C;  3CS5 A;  3D8C A;  1XQ8 A;  1S5H C;  1VQ9 V;  1WB7 A;  4X8A A;  5LBQ A;  5BR8 B;  4UUJ C;  4YY3 B;  4ZUX U;  3AG4 B;  2F95 B;  4ZI7 A;  1YXB A;  4GUA A;  1XRE A;  3HKE B;  5EK0 A;  4KP4 A;  3ZRS A;  4I05 A;  2UUA O;  4FLV A;  2ZM6 O;  3SYP A;  5AG2 A;  5IY5 B;  2RMK B;  2UU9 O;  2OWO A;  3PN1 A;  1XMO B;  3Q4H B;  3S3Q A;  1PPD A;  1S5J A;  2QKA A;  3HB3 B;  2EBO A;  4X1K A;  1EZJ A; 
#chains in the Genus database with same CATH homology
 4DV0 O;  4RF0 A;  5BXZ A;  4GKK O;  2DOS A;  4NXN O;  2VQF O;  4DR1 O;  3OTO O;  4B3T O;  3BY4 A;  1IBL O;  4X64 O;  4JI2 O;  1XEQ A;  1DKI A;  2UXB O;  4JI5 O;  2J7Q A;  3MP2 A;  3PRP A;  4PT5 A;  4LF9 O;  3BB7 A;  4LF5 O;  2BTW B;  1X59 A;  4LFA O;  4LFB O;  4DR3 O;  3C0R A;  1I94 O;  2ZKO A;  4JI8 O;  4D8E A;  4A5U B;  2UXC O;  3JAM N;  3J7A U;  1KUQ A;  4OVZ A;  1XMO O;  1R6T A;  4JI3 O;  1F7Y A;  5IWA O;  3W31 A;  4R3D A;  2JRI A;  4BOQ A;  2AGA A;  2FE8 A;  4LF7 O;  5BR8 O;  4M0W A;  4OW0 A;  4RKX A;  3TMP A;  4DV6 O;  3ZNH A;  3R66 A;  1N36 O;  5A2Q N;  1FJG O;  3T1H O;  3B21 A;  4YY3 O;  1N33 O;  3F5T A;  2VQE O;  4X66 O;  4NXM O;  1XNR O;  2Z0A A;  1DK1 A;  2BU3 A;  2BTW A;  4XZX A;  4B3R O;  2N74 A;  4B3S O;  2DJV A;  3RNV A;  3MTV A;  4IP3 A;  4YHH O;  5JZE A;  1AIL A;  3M8A A;  4OX9 O;  4OVZ B;  4JI1 O;  4HXD B;  4GKJ O;  2JTC A;  4D8I A;  4JI4 O;  4B3M O;  4DV1 O;  1IBM O;  4P16 A;  3IFU A;  4OPA A;  4DV2 O;  4BOP A;  3SDL A;  3OQC A;  1AB3 A;  4BOS A;  5E6J A;  2UXD O;  4RF1 A;  1R1B A;  4DR5 O;  3BBA A;  1UKF A;  4DV7 O;  1HNX O;  2UUB O;  4JI6 O;  2E5L O;  1PVJ A;  1HNZ O;  3MJ5 A;  4BOU A;  4DR7 O;  2LW7 A;  1HR0 O;  1N32 O;  3RT3 C;  1D2D A;  5IT9 N;  3E9S A;  4JYA O;  2UZJ A;  3PHX A;  3PHU A;  4JV5 O;  2FKX A;  4AQY O;  4DV3 O;  4WUR A;  5H5N A;  3J81 N;  4D8B A;  5FLX N;  4X62 O;  4DR2 O;  4OPH A;  1XNQ O;  3PT2 A;  1G1X B;  3T1Y O;  4LF6 O;  4KHP O;  5LL6 Y;  3PRM A;  5EZQ A;  4JI7 O;  4DUY O;  4DV5 O;  4DUZ O;  1FYJ A;  4ZTB A;  4DR6 O;  3TRK A;  4GUA A;  1HNW O;  3J80 N;  5LMU O;  4BOZ A;  2Z84 A;  2HWK A;  4JI0 O;  2UUC O;  2HHH O;  1A32 A;  2UUA O;  4LFC O;  2ZM6 O;  4MI7 A;  3PSE A;  4DV4 O;  4X65 O;  2J7Q C;  2UU9 O;  5KO3 A;  1NS1 A;  4REZ A;  3W30 A;  4IUM A;  4LF8 O;  1N34 O;  3PHW A;  4MM3 B;  5LMN O;  5BY1 A;  5EZS A;  1IBK O;  1XMQ O;  1J5E O;  4K0K O;  4RNA A;  4A5U A;  1YZB A;  4LF4 O;  2F4V O;  4DR4 O;  1FKA O;  3O65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...