2JRIA

Solution structure of the josephin domain of ataxin-3 in complex with ubiquitin molecule.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ataxin-3
publication title Understanding the plasticity of the ubiquitin-protein recognition code: the josephin domain of ataxin-3 is a diubiquitin binding motif
rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 44
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2jriA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2jriA01
4JI1O 1YZBA 2F4VO 4AQYO 4B3SO 2VQFO 2AGAA 5LL6Y 4KHPO 4DR7O 4DR3O 4LF7O 4NXMO 4JYAO 1X59A 2DJVA 1XMQO 2UUAO 3T1YO 5BXZA 4LFCO 2UUCO 1A32A 1IBMO 1HNZO 1N33O 4B3MO 4DV6O 4JV5O 5FLXN 1J5EO 1FJGO 1N34O 1NS1A 4JI3O 4DR1O 1G1XB 2ZKOA 4JI5O 4X64O 5BR8O 4OPAA 4A5UB 2LW7A 4X66O 2FKXA 4DR2O 1R1BA 3T1HO 4LFBO 4GKKO 4JI4O 3J81N 4X62O 4JI0O 1DK1A 3OTOO 2JRIA 1HNXO 1HNWO 2HHHO 1I94O 4NXNO 2N74A 2UUBO 1N36O 4DV7O 4B3RO 5H5NA 3JAMN 3J80N 1FYJA 1IBLO 3SDLA 4OPHA 4DR5O 4LF5O 3O65A 3F5TA 1AILA 4DV1O 4LF9O 4DR4O 5BY1A 4DV0O 4DUYO 3J7AU 4GKJO 4B3TO 4DV4O 1FKAO 2UXBO 4LFAO 4LF8O 1XEQA 4LF6O 2ZM6O 4JI6O 2UXCO 1F7YA 4JI8O 4LF4O 5A2QN 1IBKO 4DUZO 5IWAO 2VQEO 3RT3C 2UXDO 2UU9O 2Z0AA 2E5LO 4JI2O 5IT9N 1D2DA 4K0KO 1XNRO 1XMOO 3M8AA 4X65O 5LMUO 4YY3O 4DR6O 2DOSA 1KUQA 1AB3A 1XNQO 4JI7O 1N32O 1R6TA 3R66A 4OX9O 4YHHO 5LMNO 1HR0O 4DV2O 4DV3O 4DV5O
chains in the Genus database with same CATH superfamily
3ZIAG 2F4VO 4AQYO 5IDJA 5KMGB 2PF4E 1ZLZA 2HFEC 3ZJZA 1U5IA 2CDYA 3CBKA 2ZE5A 3OQCA 1MZFA 3ETEA 1QDQA 4IIJB 4UCSA 1AYUA 3S3RA 1XHXA 1A32A 1WJZA 1LUWA 3N2GB 4RKXA 2J7QC 3BEHA 4JTDB 3L75H 3NXSA 1J5EO 3A0BZ 4TQFA 5B3SC 2DYSB 3Q4HB 2FTDA 4MTGA 1G1XB 4BOQA 4JV5B 5A9GA 4JI5O 1CVZA 3H9VA 3ZMUA 2FL4A 1GLOA 2DMXA 4UFZA 1QNMA 4CH6A 1KECA 4DR5B 4TV9A 3LXSA 4LF5B 4JI0O 4W4UA 2HR3A 5GTHZ 1NKDA 3RYHB 4EKWA 1EN6A 1OCCB 3FD9A 2UUBO 1PPOA 3TGUH 5IYDO 3EFFK 3K04A 4DV7O 1Q90D 4J10A 1MHWA 1AR4A 4LCUC 3G4SV 2QM7A 2GBOA 2Y4TA 5IJ9A 3CCEV 4P6GA 4J7KA 3JARB 4QGPA 3F5TA 4TWKA 3RNVA 2YI9A 2E5LB 2XU1A 4B3TO 3JYCA 3KW9A 4UV8A 4WURA 4X88A 4I55A 2FO5A 4BIZA 1VEWA 3LDEA 1K3BB 1WA8A 1N4CA 1VARA 4JI6O 2F7DA 4JI8O 4BR6A 2B1NA 5LGUA 1S3JA 3UQ8A 2VQEO 3RT3C 1AVMA 2R9CA 2UU9O 1I5XA 3SYAA 1G4YB 1EN5A 1L0NH 4PDLA 1JJ2U 3FFQA 2QTOA 3PN1A 3CHXA 3KG2A 3K57A 3JSNA 1FFTB 5B1BC 4Q20A 1QQCA 3JD1A 3K58A 3ZS8C 1PNMA 4D7SA 5F2VO 1Q82W 3OVXA 2FUDA 2HVJC 5J94A 4OX9O 4RF1A 1H2LA 3E89A 2K1EA 2XUMA 4EB6B 4WF9V 5CVOB 1IVSA 3PT2A 2AGAA 4MVZA 1YIJV 3HKBB 2PADA 4LF7O 1KXRA 4LBEC 3OF9A 1CEZA 4XDLA 2P6JA 5CHTA 3CXHF 2C0YA 1N33O 1RM1C 2FYUH 1POPA 1YSCA 4LH6A 4TOIA 5IE9A 4OEMA 4YYVA 3TK1A 2XNDG 2DJGB 4R3DA 5ITZB 3ABMC 3ZHTA 2HWKA 1FXKB 3L73H 6PADA 4DO2A 5JH7B 3K5NA 2QE7G 5H6RA 5IJ0A 2N74A 4BW5A 3AK3A 2JQFR 4LFAB 2ZINA 4PELA 3ETGA 5IYZA 3OUFA 1IBLO 3ZN1A 4RAIA 3CCSV 4FFKA 4D8IA 1AP6A 2PNSA 1VF5B 2OULA 4OELA 3MTVA 4DUYO 2YJ9A 2ZNIA 1MSDA 4YV8A 3BPZA 3N2KB 3SYPA 1A6RA 1WPBA 2WAMA 3FB5C 4DK1A 3X2QC 2PZSA 2KSDA 1K5SA 1ICFA 4JZGA 4JAVA 1R6KA 4X65O 3IOQA 2DCDA 1DGSA 2E03A 4KHPB 2EIJC 1PPJH 2AYNA 3ABKC 5IYBO 2ARYA 2EULA 1XMQB 2BTWA 3BBAA 3KZIZ 1P4RA 1IBMB 5LGNA 3K9MA 2CAZC 1F4NA 2QJ1A 2YIBD 1Y66A 4IYIA 3QF7A 1PV0A 3PHXA 3F7YC 1TUBA 5EZSA 4MVQA 1FJGB 2P4VA 4PP1A 4O2BA 4R6ZA 4LH7A 3ZHVA 4DV3B 3LFYA 4X64B 4WBNB 5BR8B 3IAYA 1GKFA 4CZWA 3DC6A 3JALA 4X66B 2G8EA 3CS5A 2CTPA 5KHGA 4GKKB 2PUSA 2BTOA 4UUJC 3RGBA 5FLXN 2P5OA 1EWPA 4K35A 3OD4A 2V7QG 4B7KA 3CRRA 1NS1A 3CCVV 3IV2A 4CDDB 3K06A 3K0GA 5LBQA 1RFYA 1NT2B 2XOKG 1MIRA 1R73A 2QR4A 2QKCA 2NNUA 3IC7A 3D6SA 2IBZH 2R9OA 4FVMA 5KHJA 1KFXL 3AK2A 5CVMA 3CRCA 4G28B 4I9QA 4D8BA 2JQGR 2UXBB 3H7DA 1LNQA 1R3IC 4KXRA 1K3EA 3SDLA 4DR5O 1JFFA 3AI8A 1LUVA 2RJZA 4LF5O 4BS5A 3ML0A 1JQ0A 1AILA 4N21A 2P7UA 4U3JA 3BCCH 3ABMB 3RVWA 4TQDA 2Z5UA 4X1KA 4DR6B 2W6IG 2JEXA 1GCBA 3GWKC 1UJWB 4PP2E 1THEA 1K33A 1AI7A 2GHUA 4MVUA 2E5LO 5IT9N 1OHHG 4CH4A 3BABA 4F6EA 3BAAA 2LGWA 5JJJB 4JAAA 1BS3A 1WB7A 1P84F 2EBOA 1BCCH 3C0RA 3C9EA 4GUNA 4ZBMA 4MZSA 1IURA 4XDJA 1EZVH 2YEVB 1SZXA 3K24A 3BA8A 2FTKA 1XBLA 1HR0B 3H1LH 1KC8W 5KA6A 2R6NA 4ZOLB 2CH7A 3I06A 4H13B 5LA6A 4HWYA 1QVFU 2YI8A 1HNXB 3WB0A 4QE9A 5L3BA 4NTYA 2XAQA 2AUZA 1P49A 5EIBD 3KX1A 5J9PC 2WA4A 5LXTB 1J5EB 3ETDA 3CWBH 5CMUA 4ZHQA 3IMAA 2HD5A 1BQ0A 5CVNB 1MNGA 3SPIA 1CPYA 3HPLC 2B1MA 3IFUA 3W7SA 1XHZA 3OF8A 1XUQA 2XASA 3ICXA 4DR4B 4H37A 1DEUA 1EWLA 5EC1C 2BCCH 2P86A 3J80N 4PDMA 2ZM6B 4CS2A 4DW1A 1AI5A 4PT5A 4FM2A 2JGUA 1OV9A 4O4JA 2G38A 5LP6A 1SA0B 4P6EA 1AR1B 3WXGA 1BZKA 5LMUB 4WCEV 1FAFA 4PADA 4LFAO 4FFBB 1XL6A 3AG2C 3SYCA 4Q8HA 1DF0A 3MORA 4O4HA 1OCOB 3T4ZA 3QG5A 3OUSA 2GFOA 4G54A 2Q9LA 1JCHA 3KCYA 1D2DA 5KHHA 1WAZA 4RO2A 3OGCC 4B3SB 4UCOA 1G6UA 1G8MA 3P5XA 2NN4A 4QH6A 4I9WA 1QXPA 5JVDA 2JDIG 2UUCB 2KQXA 4EFEA 1KHPA 3AG3C 3D36C 4DV6B 4FPPA 1R6NA 5FPRA 4OVZB 1U97A 4K8XA 4KHPO 4JI3B 2HEPA 4DR3O 5J2UB 3RWRD 2R9AA 2QKAA 4J80A 4MTOA 4BOPA 1XMQO 2UXNA 3RVXA 2B1IA 1IBMO 5EC2C 1XI1A 3VQXA 1F29A 2WA3A 3F5VA 1VQ8V 1V55C 2F93B 1HNWB 1QU7A 1FJGO 1N33B 2ZDIA 3SYQA 4PA4A 4BSQA 1SS3A 2YSUB 1SP4B 4X64O 5BR8O 4Q8GA 4X66O 4I7ZB 4KL1A 1KKDA 4GKKO 3DXRA 1Y4HA 1DK1A 1Y76A 2XAHA 2OWOA 4X1YA 4DK0A 2HHHO 2QEXV 4GKJB 1WNSA 4R8CA 3UT5B 4RF0A 3HKCA 4UCVA 2D2CB 4DW0A 5E6JA 4N4ZA 3TXQA 3I55V 3OVZA 2PYJA 4IT5A 2QDOA 1QR8A 2AW9A 2P7TC 2EZPA 1F2AA 2D3OW 3H8BA 3GVMA 4Z1MG 4TUYB 4DXWA 1I0HA 1OCZB 1SQBH 4YIOA 2ADPA 1BHBA 3KFQA 1MEMA 3PHWA 3E86A 2BU3A 1GM9A 4YXWG 3WU2Z 2UXBO 5FNVB 3VQVA 1W0JG 3CXCU 1E79G 2IW5A 1AU0A 2UXCO 2ZXWC 1B3QA 1K7DA 2RQ6A 4UVBA 1H8HG 3CCUV 2WSSG 2A79B 3F5WC 1UKFA 4UVAA 3N2GA 1XNRO 2ZE7A 2JJ2G 2IM9A 1CS8A 3NR7A 1H38A 3RYFA 4YJ3A 4DR6O 3F75A 1ME4A 2ZCEA 4O4IB 5B66Z 2DZZA 3B79A 2QGNA 1S0VA 1AR5A 2AIMA 3ABLC 4QE7A 4LFCB 1H2MA 1V9PA 1TVKA 5KUKA 1Q6UA 4MTXA 2WLMA 2Q67A 2P22C 5KX5B 1JJOA 3MHHA 1N34B 1WLEA 4MT8A 1M9NA 2Q7EA 1M57C 2F43G 4BWAA 1U9VA 1K97A 1KHQA 3ZHSA 2Q4PA 3PRMA 4H0LB 3H89A 2CTRA 4RWUA 4CZZA 4IUMA 3OT7A 4ZI7A 5CA1B 1AU4A 1Q5OA 1S72V 1MMMA 1SKVA 4J11A 1PP9H 2Y0IA 1VQ6V 4HXDB 3AG3B 3ZMTA 3BVOA 2BE3A 2F95B 2X6BA 2QWNB 4KP4A 4PJ0Z 2CE4A 1Q3EA 1SERA 4DV1B 2Q7HA 2L35A 4MVRA 1HNXO 1K8AW 3CH2X 5LHIA 2NQAA 1M93A 1X9YA 2BOCC 1DF4A 3MTNA 3A8TA 1Q8IA 3JD2A 1V55B 1AP5A 2PI5A 3L9DA 2YC0A 1COWG 3MD0A 3OMNB 3O65A 1ITOA 2RN9A 4DR4O 4YYQA 1NR1A 4X1IB 3OEEG 3MAQA 5EBWC 4UVCA 2Q69A 3CCRV 1EFRG 2A3QA 2ZM6O 4K3AA 5H6QA 2JS5A 5EZQA 4LNUA 2NR5A 2Y6EA 5BMVB 3P5WA 2Z3YA 3K5LA 2QM4A 5LMUO 2LO1A 4QPJA 4X6IA 4WFGA 4CDCB 3ZBHA 1SC5B 2M7WA 3HKDA 2BTQB 1MZEA 3AG7A 2XTAA 1DTOA 4ASUG 1H2NA 4I4TA 1I08A 5B5EZ 1HDJA 3R66A 1FXKA 4MW3A 4MI7A 2HKOA 4B3SO 1YVBA 1QR9A 2WLKA 2YJCA 1PCIA 1X59A 2BSKB 1F23A 2A06H 3OM3B 2HJFC 4P2ZA 3T1YO 1CTEA 2UUCO 3N4CA 8PCHA 3T1HB 3V6EA 4DV6O 1L1FA 4A5UA 4TV8A 2AZ0A 4JI3O 3ERVA 3ABLB 1ZIVA 1W2BU 2GUZA 2YXYA 3HKEA 3CYOA 3CRQA 3N2KA 1NLJA 4DR2O 3QO7A 1PPNA 3OR7C 3TCUA 3AG4B 2ZIMA 4RUFA 2HLDG 2EX3A 2XAJA 2YDEA 3NHEA 1M57B 4O4LA 1P7BA 1HNWO 3O1GA 4DV0B 4TV9B 4RQFA 4BW9A 5L3GA 2EINC 4ICGA 2ARHA 5H5NA 2YXHA 2BSKA 3OW2U 1OCRB 1R3JC 3SJBC 1QCEA 5KUMA 3T2MA 3CD6V 1S5JA 3BRCA 3FYIB 5J2TA 5L3DA 2LFRA 2HJDA 1BT8A 4RY2A 5CBHA 3N27A 4QRVA 5IJ9B 2G6DA 2FRQA 1KFUL 4GKJO 4J42A 5JA7A 2CB5A 4WFEA 3BB7A 2JGDA 3P5UA 4AHCA 3RVVA 2E74B 1WP8A 3ZMSA 1XILA 5A2QN 2EILC 3WG7C 4I55B 3H1JH 1WA8B 4YHHB 2HHNA 2R9NA 3E35A 1AECA 5B3SB 3M8AA 3E83A 1AJPA 1EN4A 2V1DA 4N79A 1VQLV 4QIWF 3FAVA 1DF5A 1TGOA 5KAFZ 1F2BA 3PBHA 2HG5C 1Q43A 1U9XA 3DF0A 1EM1A 3CMAV 2VS0A 4CS3A 4B3MB 1AU2A 4FZ1A 4O2AA 4UV9A 2PY5A 3BCNA 4GYCB 3SPJA 4E2LA 1W0KG 2ETNA 5HFMA 3OR6C 3B8MA 3QO8A 1URFA 2OIGA 2E01A 2Q6AA 1KP3A 4U7NA 1ZL8A 4DR3B 5BXZA 4LFCO 4NVPA 1WB8A 2AUXA 5LOVA 3RBZA 3OTOB 2CGNA 3PW3A 2R9MA 1N34O 4UCRA 1VQPV 1PVJA 9PAPA 4M0WA 5JQGB 1XDCA 1D5NA 1VP7A 2EJRA 1GH6A 3GCBA 4G27B 4IHJA 3V6CA 3P32A 1XREA 3CC7V 4JTAB 4LF9B 1PPDA 3T1CA 1Y74A 1NBMG 5B1BB 2HXZA 1IXBA 4J9YB 4DV4B 1YJNV 3JAMN 1YHQV 4OW0A 1U9QX 2HHHB 4LF6B 3W7UA 5IJ0B 3I5DA 1NJIW 1VQ7V 4U3FH 2W0FC 1RSOA 2A7WA 3TXSA 5KLVH 1QVGU 5IYZB 1S76D 3WB2A 4DV1O 1GN6A 4PA3A 1B06A 2OCCC 1GK9A 4X6JA 2ZQMA 3VBBA 3ZEDA 5GONA 3K3WA 2Q5ZA 4MS2A 1PXVA 2YEVA 1NQCA 2G7YA 5EBLC 4GLXA 4MSWC 5JJNB 5D5PA 5DN6G 2IJIA 2HH5A 1WP7A 3ZMZA 1RM1B 1W59A 2Z0AA 2UXCB 1NB3A 1FH0A 4JI1B 4PV1B 1NPZA 4ZUXU 3LNNA 1FD9A 1Y08A 5PADA 1AIMA 1XNRB 2DQ3A 2LQTA 3LSUA 4CS4A 2KG7A 1FPOA 4FIPA 4EFBA 4FK5A 1DKIA 3I56V 3CCQV 3KKUA 2BTWB 1P7GA 3GB7C 1BGOA 2PREA 2EILB 3WG7B 4JYCA 3JASA 5KA5A 2WLLB 4MVOA 2DC6A 2K9PA 3P30A 3UCSC 3K5MA 1V54C 4XZXA 1OJHA 5CA3A 1SRYA 3RVZA 4O2BB 4PDVA 3HHIA 1HWYA 2ZR3A 4PI3A 3JALB 1JX9A 4BIOA 1KQSU 4NXNB 3W31A 3JATA 1SA0A 1KB9F 1AJNA 1S77D 4P16A 2OT5A 3E22A 5JJEB 1K9MW 2E3CA 1X4TA 5EZYA 3X2QB 3KWBX 4HNAB 3T1HO 3JSLA 3ZX6A 5LP6C 3MJ5A 4UCTA 3TNXA 3P5VA 3C90A 2EIJB 5EYPB 3BFRA 2DE0X 4MTFA 1QLNA 3ABKB 1CPJA 1Q6KA 1ZSPA 2CTQA 3CRAA 3BPMA 4D6TH 4UB6Z 3APQA 4LF4B 3T4DA 3QTCA 2AHZA 1E1RG 1IBKB 1B6QA 3B2EE 5GW7A 4HZ3A 3JAKA 3ZHQA 5LYJB 4DV0O 4I50A 1JFFB 4QPKA 3UO2A 1YJ9V 3PJSK 3RYCA 2Q73A 1NH2B 2CK3G 4U3JB 4X6HA 5J2UA 1XNQB 3MHSA 1AU3A 2N05A 4X1KB 3M99A 2EIMC 3ASOC 1NU1H 3SR2C 3STZC 1SESA 4UXNA 5C8YA 4MM3B 5B1AC 3KWZA 4DR7B 5CA0A 3CPWU 4NXMB 2LP7A 4JYAB 1QOLA 4ZTBA 2QM8A 1YALA 2OCCB 5AG2A 2DCCA 3ZRWB 1VQ9V 2WLJA 1Y4MA 1CB5A 4YHHO 5DECA 2NLJC 4DV2O 3FB6C 4X20A 1AROP 3OE7G 1XL4A 2ZDIC 4W4KA 3C3TA 4K8ZA 4I5SA 3RYIA 1GN4A 3K9SA 4WFFA 2DJVA 3APOA 3CC4V 1S4VA 1Z5WA 3H01A 4LC1A 5C93A 3ZNHA 1ENVA 4LFBB 4QRGA 1BL8A 2P67A 4B3MO 1GN3A 3T1YB 2CH7B 2RNBA 3IC9A 4TSFG 2XAGA 3QO5A 5LA6B 4LWSA 1YK8A 3A2FA 3BA9A 4PHZA 1YK7A 2JEUA 1H2GA 2ZIOA 1FFXA 4OPAA 3CCMV 4F6RA 4FMTA 4RNAA 2LW7A 1MOFA 1PPPA 4DRXA 2CUGA 1U96A 4YIPA 4ZHQB 1NVPD 3OTOO 2PI4A 2MK3A 2F1MA 3E8BA 2P0RA 1EF7A 1O9HA 4DR2B 2ODMA 2WBFX 4Q6GA 1V54B 2WLIA 1I94O 4TT3G 1PL0A 4W5CA 2NQIA 4HAMA 3PRPA 3M7MX 2W6JG 5EBMC 2H94A 1YF2A 1ZUQA 3K8UA 2YJ8A 1YCIA 4I07A 4I0XA 4YJ2A 2UXDB 5CBGA 2YIDA 1NZ6A 4LF9O 5KHIA 4DV4O 2YUAA 3RFRA 4FJCA 1Q7YW 1AJQA 4O4JB 2DYSC 4LF8O 5LP6B 3K79A 4R50A 4LF6O 3CJHA 5CB4B 3PDFA 4CC5A 2YXLA 4FM0A 4BAYA 4CDFB 3IHPA 4CH5A 1TAEA 1YDXA 2B9ZA 3L71H 1MA1A 1HW7A 3MHHC 4O4HB 4DV5B 3CX5F 2F1GA 1N0NA 3B09A 1OCCC 2DOSA 4YYUA 5LHGA 2JIZG 1KYOF 2PYLA 1N32O 2LGQA 1VF7A 1XOUA 4B08A 5KMGA 1JMKC 3U10A 3STLC 1HNZB 4XUIA 4WFHA 3P3PA 2DWEC 1ZCMA 5JVDB 2IJKA 4JI1O 2DC8A 3OAAG 1K73W 4IIJA 1DLBA 4W5BA 1JR9A 4YYWA 2EIMB 3LUTB 4DR1B 1US6A 4ZKIA 3ASOB 3VQYA 1QBZA 1GTOA 2DJFB 2QTSA 5H9CA 3WXEA 1MDWA 3Q4HA 2Y48A 5B1AB 1MABG 1SQGA 1SZTA 3FB7C 5K1PA 4KLBA 3AG2B 2MW2B 3C3SA 3OEHG 3B4SA 1MSWD 2M6YA 2NQDB 4BOSA 1EBOA 5DEDA 3RYHA 3CB2A 1Y6XA 3JD4A 4JI4O 3USVA 1PIPA 2XAFA 4BOUA 4AI8A 2H3OA 2QWOB 2IJJA 2QWQB 2V4DA 1BMFG 4N23A 4XDKA 1MG1A 3G6EV 4NXNO 4F4LA 1NTMH 1PKXA 3DXRB 2DYRC 5JZEA 4DMXA 3A0RA 3SPHA 4MZOA 1Y76B 4KFMA 3JARA 4GX0A 3W7XA 4X1YB 4CH3A 1BP4A 1NQTA 2F66C 3H1HH 5JCOA 4PA9A 3HKCB 1NVPB 2P4KA 1NTZH 3HHAA 1Y67A 1I7FA 1T5EA 3SPGA 3FYEB 3TETA 1S5LZ 2Y69C 3K03A 1BQZA 4LF4O 4JI7B 5CHVA 1F51A 3QJ3A 3CE2A 1WPXA 1IBKO 3ZRVA 1FXKC 3SJQC 2ATKC 4FLYA 1CXZB 1GECE 4CDEB 3KSEA 4GUAA 4RUEA 4YVAA 3K0DA 3THOA 2YS8A 3S3WA 5KHKA 1BHAA 5KO3A 3H1IH 4NTXA 2LW1A 5CBFA 3WFVA 3ZMVA 4KUMA 1Z2GA 3ASNC 2X7RB 1XNQO 3DC5A 3RYFB 2UUAB 4YJ3B 4EB6A 4FLUA 3HKBA 1YT7A 4GX1A 1PE6A 4NKGB 4PA7A 2W0XA 1KKCA 3RW0A 1VF6A 1TVKB 4DR7O 1J95A 4NXMO 3R65A 4JYAO 1U9WA 2FMLA 1VMGA 1SF9A 1JA8A 4Z2WA 3BC3A 5L3CA 3FKSG 1SETA 3JAWB 3U0ZA 1M4UA 5ITZA 2QSAA 4D8EA 1NL6A 1AYVA 3W7WA 3MDSA 2CTWA 1JOYA 4N8WA 4ZI7B 2XT9A 2ZXWB 3L72H 5JH7A 3OMIB 4LFBO 1R1BA 3ZRSA 3K59A 1RPRA 1Z5VA 3HR0A 4BS6A 2G8JA 3D3IA 1K92A 2JRIA 2ZT9B 1VQOV 2J7QA 2PBHA 1PM9A 2YIAA 1SQFA 5L3EA 2GTSA 2O57A 1LR1A 4UCUA 1AI6A 3E8HA 1GRJA 2AHYA 4AILC 2H8PC 3QT4A 2QWPB 2YJ2A 4OGQB 3ETQA 3ZHRA 2QWRB 4Z1VA 2Q8VA 4YY3B 5DM6V 2ZR2A 4PDRA 3E1ZB 1QMYA 1IDSA 5IY5C 3N3KA 5FL7G 1BE3H 4OXSA 3G67A 2XU4A 3K9AA 3E9SA 2A9HA 2Y5BA 5IWAO 1F2CA 2DYRB 3OTFA 3GWOA 2UXDO 2ACTA 4FZ0A 2JK5C 1YEWA 1QLEC 2WPDG 4LNUB 2VQFB 3CCJV 2ZNJA 1QHTA 2ITCC 3LDCA 3G71V 2OIEA 4GCZA 2IJHA 3KKYA 3BY4A 1ZWIC 4GX5A 5JQGA 3CCLV 2LFSA 3E2EA 1MEGA 1K5QA 3K5OA 1O0EA 3HKDB 1Q81W 3PHUA 4HYOA 3U11A 1L8DA 2IH1C 2Y69B 2A0LA 1YI2V 4DV5O 4I4TB 1PD3A 4WBNA 1YZBA 4JAUA 3A0HZ 4DV2B 2C2AA 1VQ5V 3B21A 3IFXA 3KCXA 1HNZO 4X62B 3W7TA 5A24A 4MVSA 1VSNA 3ASNB 2OYQA 3VOUA 4GT1A 4JPRA 3D3QA 1O9GA 3RN4A 4DR1O 4B3RB 2ZKOA 4W4LA 4A5UB 2XU3A 4TV8B 4U7OA 3AG1C 2GUZB 2YJBA 3IUTA 3CEIA 2OTLV 1GN2A 3HKEB 3FB8C 3S3QA 5KAIZ 1JVMA 2ADQB 2E75B 4X8AA 1N36O 5H2FZ 3HB3B 2P90A 5BZBA 1FXVA 3HD3A 3TJTA 4O4LB 1I94B 4BQVA 4G2KA 3LDDA 1SQVH 2OCHA 3ABTA 1FXHA 4CBCA 3L70H 2JVDA 2B1GA 2O6XA 1XMOB 3UO3A 4QJFB 5J2TB 1SQQH 4IYHA 4BOZA 2Q68A 1XEQA 3DGEA 3QSDA 5EK0A 1CP9A 2HVKC 1TUEB 2WLLA 4FIPC 4FK5C 1NH2D 4LF8B 3U8EA 2Q0AA 5B1OA 2JGDB 4P9PA 1F4MA 4J7JA 4JF3A 4P30A 3G80A 3BHPA 5LMNB 4K0KO 3N3GA 3OGIB 4FLWA 1YITV 4DMYA 4AXMA 1GM8A 1BGYH 4GZRB 3SJCC 3CH3X 1STFE 3JCUZ 4JI7O 4FLZA 4XR7A 4GX2A 1R6TA 1HP8A 3FAVB 4X9QA 3LSQA 2Q0OC 2FB5A 2GTAA 1R3LC 4HNAA 5IY5B 1N32B 1NB5A 2BDZA 3W30A 2EINB 4ZOLA 1ROPA 2Y0PA 1N8RW 2AYOA 3E8GA 2X0LA 2YIBA 2FYEA 4O2AB 5EYPA 3CC2V 2DW4A 1QLEB 2E02A 2UUAO 2JJ1G 1AYWA 4NYKA 5JH3A 4YYRA 4LR3A 4NR1A 1OCOC 3SPCA 5K1XA 2Y4UA 2YICA 1IZ3A 5LXTA 4JV5O 1RP3B 1ZL8B 3ABUA 2IU0A 2X6AA 3VQWA 2R9IA 3WXFA 3O9OA 5K16A 5LYJA 2QKSA 2DN9A 2X6CA 5E79Z 5LOVB 2UZJA 4AXLA 1ME3A 1PBHA 4JYYA 3ZRXA 2H7JA 2EIKC 1B04A 1TUBB 3LSSA 4X89A 1YTFD 1ZTEA 3EVKA 2ZE6A 4IHJB 4JI4B 2IU3A 3PSEA 2GV9A 2VHFA 3WB1A 3IJ4A 1Y74B 3MHSC 2R9FA 4OPHA 3O0UA 2PTMA 4DUZB 2KKWA 4EEQA 1WN7A 1VJVA 4FFBA 5HFLA 4D7TA 3ZRWA 2NQGA 4QRXA 4JI2B 2BOBC 3J7AU 3LNMB 1KBHA 1RSOB 3AG1B 1Q86W 4IP3A 5JWPA 4XBFA 1M56C 2WWWA 4WFBV 2R9RB 5GTIZ 2PGGA 5GONB 4UB8Z 3JCZA 4MSXA 2VWKA 2R70A 1EWMA 1OZ0A 2UXXA 4ZIBA 5B1NA 2DCBA 2F4VB 4AQYB 3TRKA 4PI0A 4YY3O 1RPOA 4H44B 3BPFA 5EIBC 3ZCCA 1ZX3A 1AB3A 2DCAA 5TISZ 1KP2A 2R72A 4J7ZA 2ATOA 2E00A 4C7UA 4IL6Z 4OVZA 1YJWV 2F23A 3ZHUA 2QA4V 1JPXA 1OCZC 3ZUAA 2KG7B 4J9ZB 3CBJA 1R3KC 2VQFO 5LL6Y 3G6BA 1K34A 2EJ7A 5CN0A 2OTJV 1I5YA 1GAXA 2FT2A 4JGSA 4JI5B 4R7CA 3UKMA 1N0JA 3H8CA 3JASB 2WLNA 1IXMA 4DYLA 4FLVA 2IBIA 1THZA 1XKGA 4JI0B 3CRMA 5E1AC 4JZ2A 4IGGA 2ZE8A 2UUBB 4DV7B 2LJ2A 2XU5A 3PNRA 3F7VC 3UM7A 1VIBA 2Q7GA 3JATB 4MVMA 4K7CA 2FKXA 2OP3A 3UT5A 1M1KW 5CB4A 4X62O 3J81N 1M5IA 2EZOA 3E22B 2AU1A 4FJCC 5EZYB 1CJLA 3H6SA 1JQPA 4B3TB 3EXAA 4B3RO 1GM7A 5EF4A 3B77A 4TUYA 4B7EA 2E76B 1FYJA 2GDSA 4JI6B 1CQDA 2CGOA 1SNKA 4REZA 4JI8B 1TA8A 2ILMA 2VQEB 4P9OA 5FNVA 1YTFB 2UU9B 2ITDC 5BY1A 2RMKB 1TU6A 2FQ9A 2N04A 4J41A 1FKAO 4CC6A 2EIKB 5L3FA 4RQEA 1GO3F 4PA6A 3JAKB 4PD4F 1BY8A 2L6LA 4I50B 4JTCB 1F7YA 3TMPA 3BOWA 3RYCB 1KU9A 3H1KH 2JS3A 3DTUB 4OX9B 1MS6A 4O4IA 2KB1A 1NI8A 2JTCA 1ZAUA 1YXBA 1XMOO 1SQPH 3E8FA 5IWAB 1VQMV 1KD1W 3M99B 1TL9A 4YYSA 3L74H 1IWDA 3OISA 3OMAB 4LF7B 4E4EA 3AEIA 1Q6IA 1KMIZ 3P3NA 5C8YB 2BDLA 5KX5A 2Z84A 4I05A 5CA0B 4QBBA 3QNEA 1L0LH 5LMNO 4DV3O 1M56B 3IEJA 5LHHA 1IX9A 1UFIA 1BSMA 4FM1A 3AK1A 4L8JA 4X20B 4ABMA 5LGTA 3MP2A 5CA1A 2AZ2A 1M90W 3RYIB 2FE8A 4PI2A 1EZJA 1H8EG 3B8NA 2CIOA 3ZN0A 2FRAA 1H2KA 3D36A 3BWKA 2IH3C 2WLHA 2VWJA 3OFNG 3FX7A 2DZYA 5FPWA 4BPVA 2DC7A 4JASA 4I04A 5JCOC 1IBLB 4LWSB 2AS8A 2ZD9A 2IPPB 2DWDC 1K4CC 2B5UA 4NB5A 4BIUA 1GMYA 1FFXB 4F6RB 3CMEV 1FS0G 4DUYB 2HP8A 5IYCO 1E1QG 1GMGA 3JD0A 4DRXB 3D8CA 3JD3A 1N36B 2WLIB 3B40A 4X1IA 2VHSA 1ORQC 1XQ8A 3CP1A 3QVNA 2OZ2A 3IGAC 1H2SB 4WA6A 1VQ4V 1TLOA 4JYBA 2RCVA 3EHBB 3RVYA 4FLTA 5FPOA 3SGIA 1CSBB 2AVWA 1HUCB 4X65B 5EGWA 4NTWA 4I0XB 1CV8A 4YJ2B 3CSXA 1VQKV 1PNKA 3SYOA 5BMVA 1S5HC 3BY6A 3DSQA 3HWNA 1Q6HA 4FLXA 1PNLA 3K08A 3SJAC 4QNHB 4DUZO 2P06A 1NR7A 2GHYA 1YVWA 1AI4A 4L87A 3S3XA 4WFAV 1NTKH 5F02A 3CJHB 3AG4C 2BTQA 4JI2O 2XHBA 1EWOA 1UPGA 1VF6C 2DQ0A 2RDCA 5D5QA 2DC9A 2GSMB 1PADA 3JAWA 7PCKA 2AXTZ 2VRZA 4K0KB 1KUQA 1K4DC 4HBNA 1OCRC 1PL4A 3I3TA 1SQXH 4MW8A 1D5AA 1VQNV 1ATKA 1HR0O 1M6DA 1BQIA 4H33A 4LP8A
chains in the Genus database with same CATH topology
4JI1O 1YZBA 2BTWB 2F4VO 4AQYO 4B3SO 3PHXA 2VQFO 5EZSA 3W30A 3PT2A 2AGAA 5LL6Y 4OVZB 4KHPO 4DR7O 4DR3O 4LF7O 4NXMO 4JYAO 3OQCA 1X59A 3B21A 3MP2A 4BOPA 2DJVA 1XMQO 2UUAO 3T1YO 4XZXA 2FE8A 5BXZA 4LFCO 2UUCO 3ZNHA 1A32A 1IBMO 3PRMA 1HNZO 4RKXA 1N33O 4IUMA 4B3MO 4DV6O 2J7QC 4JV5O 5FLXN 1J5EO 4A5UA 1FJGO 1N34O 3W31A 4D8EA 1NS1A 4JI3O 4DR1O 1G1XB 4BOQA 1PVJA 2ZKOA 4M0WA 4R3DA 4JI5O 2UZJA 4X64O 4P16A 4BOSA 5BR8O 4RNAA 4OPAA 4A5UB 4HXDB 2LW7A 2HWKA 4X66O 2FKXA 4DR2O 1R1BA 3T1HO 4LFBO 4GKKO 4JI4O 3IFUA 3J81N 4X62O 4BOUA 3MJ5A 4JI0O 1DK1A 3OTOO 2JRIA 1HNXO 1HNWO 2J7QA 2HHHO 1I94O 4NXNO 2N74A 2UUBO 5JZEA 1N36O 4D8BA 4DV7O 3PSEA 4B3RO 5H5NA 3JAMN 4RF0A 4OW0A 5E6JA 3J80N 3PRPA 1FYJA 1IBLO 4REZA 3SDLA 4OPHA 4PT5A 4DR5O 4D8IA 4LF5O 3O65A 3F5TA 1AILA 4DV1O 4LF9O 3RNVA 4DR4O 5BY1A 3MTVA 4DV0O 4DUYO 3J7AU 4GKJO 3PHWA 2BU3A 4B3TO 4DV4O 1FKAO 2UXBO 4LFAO 4WURA 4LF8O 4IP3A 4BOZA 1XEQA 3BB7A 4LF6O 2ZM6O 4JI6O 2UXCO 1F7YA 3E9SA 3TMPA 4JI8O 4LF4O 5A2QN 5EZQA 1IBKO 4DUZO 5IWAO 2VQEO 3RT3C 2UXDO 2UU9O 2Z0AA 4GUAA 1UKFA 2E5LO 4JI2O 5IT9N 1D2DA 2JTCA 4K0KO 1XNRO 5KO3A 1XMOO 3M8AA 4X65O 5LMUO 3TRKA 4MM3B 4YY3O 4DR6O 2DOSA 1KUQA 4ZTBA 1AB3A 3BY4A 1XNQO 3C0RA 4JI7O 2BTWA 1N32O 1R6TA 3BBAA 2Z84A 3R66A 4OVZA 1DKIA 3PHUA 4OX9O 4RF1A 4YHHO 5LMNO 1HR0O 4MI7A 4DV2O 4DV3O 4DV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 O;  1YZB A;  2F4V O;  4AQY O;  4B3S O;  2VQF O;  2AGA A;  5LL6 Y;  4KHP O;  4DR7 O;  4DR3 O;  4LF7 O;  4NXM O;  4JYA O;  1X59 A;  2DJV A;  1XMQ O;  2UUA O;  3T1Y O;  5BXZ A;  4LFC O;  2UUC O;  1A32 A;  1IBM O;  1HNZ O;  1N33 O;  4B3M O;  4DV6 O;  4JV5 O;  5FLX N;  1J5E O;  1FJG O;  1N34 O;  1NS1 A;  4JI3 O;  4DR1 O;  1G1X B;  2ZKO A;  4JI5 O;  4X64 O;  5BR8 O;  4OPA A;  4A5U B;  2LW7 A;  4X66 O;  2FKX A;  4DR2 O;  1R1B A;  3T1H O;  4LFB O;  4GKK O;  4JI4 O;  3J81 N;  4X62 O;  4JI0 O;  1DK1 A;  3OTO O;  2JRI A;  1HNX O;  1HNW O;  2HHH O;  1I94 O;  4NXN O;  2N74 A;  2UUB O;  1N36 O;  4DV7 O;  4B3R O;  5H5N A;  3JAM N;  3J80 N;  1FYJ A;  1IBL O;  3SDL A;  4OPH A;  4DR5 O;  4LF5 O;  3O65 A;  3F5T A;  1AIL A;  4DV1 O;  4LF9 O;  4DR4 O;  5BY1 A;  4DV0 O;  4DUY O;  3J7A U;  4GKJ O;  4B3T O;  4DV4 O;  1FKA O;  2UXB O;  4LFA O;  4LF8 O;  1XEQ A;  4LF6 O;  2ZM6 O;  4JI6 O;  2UXC O;  1F7Y A;  4JI8 O;  4LF4 O;  5A2Q N;  1IBK O;  4DUZ O;  5IWA O;  2VQE O;  3RT3 C;  2UXD O;  2UU9 O;  2Z0A A;  2E5L O;  4JI2 O;  5IT9 N;  1D2D A;  4K0K O;  1XNR O;  1XMO O;  3M8A A;  4X65 O;  5LMU O;  4YY3 O;  4DR6 O;  2DOS A;  1KUQ A;  1AB3 A;  1XNQ O;  4JI7 O;  1N32 O;  1R6T A;  3R66 A;  4OX9 O;  4YHH O;  5LMN O;  1HR0 O;  4DV2 O;  4DV3 O;  4DV5 O; 
#chains in the Genus database with same CATH topology
 3ZIA G;  2F4V O;  4AQY O;  5IDJ A;  5KMG B;  2PF4 E;  1ZLZ A;  2HFE C;  3ZJZ A;  1U5I A;  2CDY A;  3CBK A;  2ZE5 A;  3OQC A;  1MZF A;  3ETE A;  1QDQ A;  4IIJ B;  4UCS A;  1AYU A;  3S3R A;  1XHX A;  1A32 A;  1WJZ A;  1LUW A;  3N2G B;  4RKX A;  2J7Q C;  3BEH A;  4JTD B;  3L75 H;  3NXS A;  1J5E O;  3A0B Z;  4TQF A;  5B3S C;  2DYS B;  3Q4H B;  2FTD A;  4MTG A;  1G1X B;  4BOQ A;  4JV5 B;  5A9G A;  4JI5 O;  1CVZ A;  3H9V A;  3ZMU A;  2FL4 A;  1GLO A;  2DMX A;  4UFZ A;  1QNM A;  4CH6 A;  1KEC A;  4DR5 B;  4TV9 A;  3LXS A;  4LF5 B;  4JI0 O;  4W4U A;  2HR3 A;  5GTH Z;  1NKD A;  3RYH B;  4EKW A;  1EN6 A;  1OCC B;  3FD9 A;  2UUB O;  1PPO A;  3TGU H;  5IYD O;  3EFF K;  3K04 A;  4DV7 O;  1Q90 D;  4J10 A;  1MHW A;  1AR4 A;  4LCU C;  3G4S V;  2QM7 A;  2GBO A;  2Y4T A;  5IJ9 A;  3CCE V;  4P6G A;  4J7K A;  3JAR B;  4QGP A;  3F5T A;  4TWK A;  3RNV A;  2YI9 A;  2E5L B;  2XU1 A;  4B3T O;  3JYC A;  3KW9 A;  4UV8 A;  4WUR A;  4X88 A;  4I55 A;  2FO5 A;  4BIZ A;  1VEW A;  3LDE A;  1K3B B;  1WA8 A;  1N4C A;  1VAR A;  4JI6 O;  2F7D A;  4JI8 O;  4BR6 A;  2B1N A;  5LGU A;  1S3J A;  3UQ8 A;  2VQE O;  3RT3 C;  1AVM A;  2R9C A;  2UU9 O;  1I5X A;  3SYA A;  1G4Y B;  1EN5 A;  1L0N H;  4PDL A;  1JJ2 U;  3FFQ A;  2QTO A;  3PN1 A;  3CHX A;  3KG2 A;  3K57 A;  3JSN A;  1FFT B;  5B1B C;  4Q20 A;  1QQC A;  3JD1 A;  3K58 A;  3ZS8 C;  1PNM A;  4D7S A;  5F2V O;  1Q82 W;  3OVX A;  2FUD A;  2HVJ C;  5J94 A;  4OX9 O;  4RF1 A;  1H2L A;  3E89 A;  2K1E A;  2XUM A;  4EB6 B;  4WF9 V;  5CVO B;  1IVS A;  3PT2 A;  2AGA A;  4MVZ A;  1YIJ V;  3HKB B;  2PAD A;  4LF7 O;  1KXR A;  4LBE C;  3OF9 A;  1CEZ A;  4XDL A;  2P6J A;  5CHT A;  3CXH F;  2C0Y A;  1N33 O;  1RM1 C;  2FYU H;  1POP A;  1YSC A;  4LH6 A;  4TOI A;  5IE9 A;  4OEM A;  4YYV A;  3TK1 A;  2XND G;  2DJG B;  4R3D A;  5ITZ B;  3ABM C;  3ZHT A;  2HWK A;  1FXK B;  3L73 H;  6PAD A;  4DO2 A;  5JH7 B;  3K5N A;  2QE7 G;  5H6R A;  5IJ0 A;  2N74 A;  4BW5 A;  3AK3 A;  2JQF R;  4LFA B;  2ZIN A;  4PEL A;  3ETG A;  5IYZ A;  3OUF A;  1IBL O;  3ZN1 A;  4RAI A;  3CCS V;  4FFK A;  4D8I A;  1AP6 A;  2PNS A;  1VF5 B;  2OUL A;  4OEL A;  3MTV A;  4DUY O;  2YJ9 A;  2ZNI A;  1MSD A;  4YV8 A;  3BPZ A;  3N2K B;  3SYP A;  1A6R A;  1WPB A;  2WAM A;  3FB5 C;  4DK1 A;  3X2Q C;  2PZS A;  2KSD A;  1K5S A;  1ICF A;  4JZG A;  4JAV A;  1R6K A;  4X65 O;  3IOQ A;  2DCD A;  1DGS A;  2E03 A;  4KHP B;  2EIJ C;  1PPJ H;  2AYN A;  3ABK C;  5IYB O;  2ARY A;  2EUL A;  1XMQ B;  2BTW A;  3BBA A;  3KZI Z;  1P4R A;  1IBM B;  5LGN A;  3K9M A;  2CAZ C;  1F4N A;  2QJ1 A;  2YIB D;  1Y66 A;  4IYI A;  3QF7 A;  1PV0 A;  3PHX A;  3F7Y C;  1TUB A;  5EZS A;  4MVQ A;  1FJG B;  2P4V A;  4PP1 A;  4O2B A;  4R6Z A;  4LH7 A;  3ZHV A;  4DV3 B;  3LFY A;  4X64 B;  4WBN B;  5BR8 B;  3IAY A;  1GKF A;  4CZW A;  3DC6 A;  3JAL A;  4X66 B;  2G8E A;  3CS5 A;  2CTP A;  5KHG A;  4GKK B;  2PUS A;  2BTO A;  4UUJ C;  3RGB A;  5FLX N;  2P5O A;  1EWP A;  4K35 A;  3OD4 A;  2V7Q G;  4B7K A;  3CRR A;  1NS1 A;  3CCV V;  3IV2 A;  4CDD B;  3K06 A;  3K0G A;  5LBQ A;  1RFY A;  1NT2 B;  2XOK G;  1MIR A;  1R73 A;  2QR4 A;  2QKC A;  2NNU A;  3IC7 A;  3D6S A;  2IBZ H;  2R9O A;  4FVM A;  5KHJ A;  1KFX L;  3AK2 A;  5CVM A;  3CRC A;  4G28 B;  4I9Q A;  4D8B A;  2JQG R;  2UXB B;  3H7D A;  1LNQ A;  1R3I C;  4KXR A;  1K3E A;  3SDL A;  4DR5 O;  1JFF A;  3AI8 A;  1LUV A;  2RJZ A;  4LF5 O;  4BS5 A;  3ML0 A;  1JQ0 A;  1AIL A;  4N21 A;  2P7U A;  4U3J A;  3BCC H;  3ABM B;  3RVW A;  4TQD A;  2Z5U A;  4X1K A;  4DR6 B;  2W6I G;  2JEX A;  1GCB A;  3GWK C;  1UJW B;  4PP2 E;  1THE A;  1K33 A;  1AI7 A;  2GHU A;  4MVU A;  2E5L O;  5IT9 N;  1OHH G;  4CH4 A;  3BAB A;  4F6E A;  3BAA A;  2LGW A;  5JJJ B;  4JAA A;  1BS3 A;  1WB7 A;  1P84 F;  2EBO A;  1BCC H;  3C0R A;  3C9E A;  4GUN A;  4ZBM A;  4MZS A;  1IUR A;  4XDJ A;  1EZV H;  2YEV B;  1SZX A;  3K24 A;  3BA8 A;  2FTK A;  1XBL A;  1HR0 B;  3H1L H;  1KC8 W;  5KA6 A;  2R6N A;  4ZOL B;  2CH7 A;  3I06 A;  4H13 B;  5LA6 A;  4HWY A;  1QVF U;  2YI8 A;  1HNX B;  3WB0 A;  4QE9 A;  5L3B A;  4NTY A;  2XAQ A;  2AUZ A;  1P49 A;  5EIB D;  3KX1 A;  5J9P C;  2WA4 A;  5LXT B;  1J5E B;  3ETD A;  3CWB H;  5CMU A;  4ZHQ A;  3IMA A;  2HD5 A;  1BQ0 A;  5CVN B;  1MNG A;  3SPI A;  1CPY A;  3HPL C;  2B1M A;  3IFU A;  3W7S A;  1XHZ A;  3OF8 A;  1XUQ A;  2XAS A;  3ICX A;  4DR4 B;  4H37 A;  1DEU A;  1EWL A;  5EC1 C;  2BCC H;  2P86 A;  3J80 N;  4PDM A;  2ZM6 B;  4CS2 A;  4DW1 A;  1AI5 A;  4PT5 A;  4FM2 A;  2JGU A;  1OV9 A;  4O4J A;  2G38 A;  5LP6 A;  1SA0 B;  4P6E A;  1AR1 B;  3WXG A;  1BZK A;  5LMU B;  4WCE V;  1FAF A;  4PAD A;  4LFA O;  4FFB B;  1XL6 A;  3AG2 C;  3SYC A;  4Q8H A;  1DF0 A;  3MOR A;  4O4H A;  1OCO B;  3T4Z A;  3QG5 A;  3OUS A;  2GFO A;  4G54 A;  2Q9L A;  1JCH A;  3KCY A;  1D2D A;  5KHH A;  1WAZ A;  4RO2 A;  3OGC C;  4B3S B;  4UCO A;  1G6U A;  1G8M A;  3P5X A;  2NN4 A;  4QH6 A;  4I9W A;  1QXP A;  5JVD A;  2JDI G;  2UUC B;  2KQX A;  4EFE A;  1KHP A;  3AG3 C;  3D36 C;  4DV6 B;  4FPP A;  1R6N A;  5FPR A;  4OVZ B;  1U97 A;  4K8X A;  4KHP O;  4JI3 B;  2HEP A;  4DR3 O;  5J2U B;  3RWR D;  2R9A A;  2QKA A;  4J80 A;  4MTO A;  4BOP A;  1XMQ O;  2UXN A;  3RVX A;  2B1I A;  1IBM O;  5EC2 C;  1XI1 A;  3VQX A;  1F29 A;  2WA3 A;  3F5V A;  1VQ8 V;  1V55 C;  2F93 B;  1HNW B;  1QU7 A;  1FJG O;  1N33 B;  2ZDI A;  3SYQ A;  4PA4 A;  4BSQ A;  1SS3 A;  2YSU B;  1SP4 B;  4X64 O;  5BR8 O;  4Q8G A;  4X66 O;  4I7Z B;  4KL1 A;  1KKD A;  4GKK O;  3DXR A;  1Y4H A;  1DK1 A;  1Y76 A;  2XAH A;  2OWO A;  4X1Y A;  4DK0 A;  2HHH O;  2QEX V;  4GKJ B;  1WNS A;  4R8C A;  3UT5 B;  4RF0 A;  3HKC A;  4UCV A;  2D2C B;  4DW0 A;  5E6J A;  4N4Z A;  3TXQ A;  3I55 V;  3OVZ A;  2PYJ A;  4IT5 A;  2QDO A;  1QR8 A;  2AW9 A;  2P7T C;  2EZP A;  1F2A A;  2D3O W;  3H8B A;  3GVM A;  4Z1M G;  4TUY B;  4DXW A;  1I0H A;  1OCZ B;  1SQB H;  4YIO A;  2ADP A;  1BHB A;  3KFQ A;  1MEM A;  3PHW A;  3E86 A;  2BU3 A;  1GM9 A;  4YXW G;  3WU2 Z;  2UXB O;  5FNV B;  3VQV A;  1W0J G;  3CXC U;  1E79 G;  2IW5 A;  1AU0 A;  2UXC O;  2ZXW C;  1B3Q A;  1K7D A;  2RQ6 A;  4UVB A;  1H8H G;  3CCU V;  2WSS G;  2A79 B;  3F5W C;  1UKF A;  4UVA A;  3N2G A;  1XNR O;  2ZE7 A;  2JJ2 G;  2IM9 A;  1CS8 A;  3NR7 A;  1H38 A;  3RYF A;  4YJ3 A;  4DR6 O;  3F75 A;  1ME4 A;  2ZCE A;  4O4I B;  5B66 Z;  2DZZ A;  3B79 A;  2QGN A;  1S0V A;  1AR5 A;  2AIM A;  3ABL C;  4QE7 A;  4LFC B;  1H2M A;  1V9P A;  1TVK A;  5KUK A;  1Q6U A;  4MTX A;  2WLM A;  2Q67 A;  2P22 C;  5KX5 B;  1JJO A;  3MHH A;  1N34 B;  1WLE A;  4MT8 A;  1M9N A;  2Q7E A;  1M57 C;  2F43 G;  4BWA A;  1U9V A;  1K97 A;  1KHQ A;  3ZHS A;  2Q4P A;  3PRM A;  4H0L B;  3H89 A;  2CTR A;  4RWU A;  4CZZ A;  4IUM A;  3OT7 A;  4ZI7 A;  5CA1 B;  1AU4 A;  1Q5O A;  1S72 V;  1MMM A;  1SKV A;  4J11 A;  1PP9 H;  2Y0I A;  1VQ6 V;  4HXD B;  3AG3 B;  3ZMT A;  3BVO A;  2BE3 A;  2F95 B;  2X6B A;  2QWN B;  4KP4 A;  4PJ0 Z;  2CE4 A;  1Q3E A;  1SER A;  4DV1 B;  2Q7H A;  2L35 A;  4MVR A;  1HNX O;  1K8A W;  3CH2 X;  5LHI A;  2NQA A;  1M93 A;  1X9Y A;  2BOC C;  1DF4 A;  3MTN A;  3A8T A;  1Q8I A;  3JD2 A;  1V55 B;  1AP5 A;  2PI5 A;  3L9D A;  2YC0 A;  1COW G;  3MD0 A;  3OMN B;  3O65 A;  1ITO A;  2RN9 A;  4DR4 O;  4YYQ A;  1NR1 A;  4X1I B;  3OEE G;  3MAQ A;  5EBW C;  4UVC A;  2Q69 A;  3CCR V;  1EFR G;  2A3Q A;  2ZM6 O;  4K3A A;  5H6Q A;  2JS5 A;  5EZQ A;  4LNU A;  2NR5 A;  2Y6E A;  5BMV B;  3P5W A;  2Z3Y A;  3K5L A;  2QM4 A;  5LMU O;  2LO1 A;  4QPJ A;  4X6I A;  4WFG A;  4CDC B;  3ZBH A;  1SC5 B;  2M7W A;  3HKD A;  2BTQ B;  1MZE A;  3AG7 A;  2XTA A;  1DTO A;  4ASU G;  1H2N A;  4I4T A;  1I08 A;  5B5E Z;  1HDJ A;  3R66 A;  1FXK A;  4MW3 A;  4MI7 A;  2HKO A;  4B3S O;  1YVB A;  1QR9 A;  2WLK A;  2YJC A;  1PCI A;  1X59 A;  2BSK B;  1F23 A;  2A06 H;  3OM3 B;  2HJF C;  4P2Z A;  3T1Y O;  1CTE A;  2UUC O;  3N4C A;  8PCH A;  3T1H B;  3V6E A;  4DV6 O;  1L1F A;  4A5U A;  4TV8 A;  2AZ0 A;  4JI3 O;  3ERV A;  3ABL B;  1ZIV A;  1W2B U;  2GUZ A;  2YXY A;  3HKE A;  3CYO A;  3CRQ A;  3N2K A;  1NLJ A;  4DR2 O;  3QO7 A;  1PPN A;  3OR7 C;  3TCU A;  3AG4 B;  2ZIM A;  4RUF A;  2HLD G;  2EX3 A;  2XAJ A;  2YDE A;  3NHE A;  1M57 B;  4O4L A;  1P7B A;  1HNW O;  3O1G A;  4DV0 B;  4TV9 B;  4RQF A;  4BW9 A;  5L3G A;  2EIN C;  4ICG A;  2ARH A;  5H5N A;  2YXH A;  2BSK A;  3OW2 U;  1OCR B;  1R3J C;  3SJB C;  1QCE A;  5KUM A;  3T2M A;  3CD6 V;  1S5J A;  3BRC A;  3FYI B;  5J2T A;  5L3D A;  2LFR A;  2HJD A;  1BT8 A;  4RY2 A;  5CBH A;  3N27 A;  4QRV A;  5IJ9 B;  2G6D A;  2FRQ A;  1KFU L;  4GKJ O;  4J42 A;  5JA7 A;  2CB5 A;  4WFE A;  3BB7 A;  2JGD A;  3P5U A;  4AHC A;  3RVV A;  2E74 B;  1WP8 A;  3ZMS A;  1XIL A;  5A2Q N;  2EIL C;  3WG7 C;  4I55 B;  3H1J H;  1WA8 B;  4YHH B;  2HHN A;  2R9N A;  3E35 A;  1AEC A;  5B3S B;  3M8A A;  3E83 A;  1AJP A;  1EN4 A;  2V1D A;  4N79 A;  1VQL V;  4QIW F;  3FAV A;  1DF5 A;  1TGO A;  5KAF Z;  1F2B A;  3PBH A;  2HG5 C;  1Q43 A;  1U9X A;  3DF0 A;  1EM1 A;  3CMA V;  2VS0 A;  4CS3 A;  4B3M B;  1AU2 A;  4FZ1 A;  4O2A A;  4UV9 A;  2PY5 A;  3BCN A;  4GYC B;  3SPJ A;  4E2L A;  1W0K G;  2ETN A;  5HFM A;  3OR6 C;  3B8M A;  3QO8 A;  1URF A;  2OIG A;  2E01 A;  2Q6A A;  1KP3 A;  4U7N A;  1ZL8 A;  4DR3 B;  5BXZ A;  4LFC O;  4NVP A;  1WB8 A;  2AUX A;  5LOV A;  3RBZ A;  3OTO B;  2CGN A;  3PW3 A;  2R9M A;  1N34 O;  4UCR A;  1VQP V;  1PVJ A;  9PAP A;  4M0W A;  5JQG B;  1XDC A;  1D5N A;  1VP7 A;  2EJR A;  1GH6 A;  3GCB A;  4G27 B;  4IHJ A;  3V6C A;  3P32 A;  1XRE A;  3CC7 V;  4JTA B;  4LF9 B;  1PPD A;  3T1C A;  1Y74 A;  1NBM G;  5B1B B;  2HXZ A;  1IXB A;  4J9Y B;  4DV4 B;  1YJN V;  3JAM N;  1YHQ V;  4OW0 A;  1U9Q X;  2HHH B;  4LF6 B;  3W7U A;  5IJ0 B;  3I5D A;  1NJI W;  1VQ7 V;  4U3F H;  2W0F C;  1RSO A;  2A7W A;  3TXS A;  5KLV H;  1QVG U;  5IYZ B;  1S76 D;  3WB2 A;  4DV1 O;  1GN6 A;  4PA3 A;  1B06 A;  2OCC C;  1GK9 A;  4X6J A;  2ZQM A;  3VBB A;  3ZED A;  5GON A;  3K3W A;  2Q5Z A;  4MS2 A;  1PXV A;  2YEV A;  1NQC A;  2G7Y A;  5EBL C;  4GLX A;  4MSW C;  5JJN B;  5D5P A;  5DN6 G;  2IJI A;  2HH5 A;  1WP7 A;  3ZMZ A;  1RM1 B;  1W59 A;  2Z0A A;  2UXC B;  1NB3 A;  1FH0 A;  4JI1 B;  4PV1 B;  1NPZ A;  4ZUX U;  3LNN A;  1FD9 A;  1Y08 A;  5PAD A;  1AIM A;  1XNR B;  2DQ3 A;  2LQT A;  3LSU A;  4CS4 A;  2KG7 A;  1FPO A;  4FIP A;  4EFB A;  4FK5 A;  1DKI A;  3I56 V;  3CCQ V;  3KKU A;  2BTW B;  1P7G A;  3GB7 C;  1BGO A;  2PRE A;  2EIL B;  3WG7 B;  4JYC A;  3JAS A;  5KA5 A;  2WLL B;  4MVO A;  2DC6 A;  2K9P A;  3P30 A;  3UCS C;  3K5M A;  1V54 C;  4XZX A;  1OJH A;  5CA3 A;  1SRY A;  3RVZ A;  4O2B B;  4PDV A;  3HHI A;  1HWY A;  2ZR3 A;  4PI3 A;  3JAL B;  1JX9 A;  4BIO A;  1KQS U;  4NXN B;  3W31 A;  3JAT A;  1SA0 A;  1KB9 F;  1AJN A;  1S77 D;  4P16 A;  2OT5 A;  3E22 A;  5JJE B;  1K9M W;  2E3C A;  1X4T A;  5EZY A;  3X2Q B;  3KWB X;  4HNA B;  3T1H O;  3JSL A;  3ZX6 A;  5LP6 C;  3MJ5 A;  4UCT A;  3TNX A;  3P5V A;  3C90 A;  2EIJ B;  5EYP B;  3BFR A;  2DE0 X;  4MTF A;  1QLN A;  3ABK B;  1CPJ A;  1Q6K A;  1ZSP A;  2CTQ A;  3CRA A;  3BPM A;  4D6T H;  4UB6 Z;  3APQ A;  4LF4 B;  3T4D A;  3QTC A;  2AHZ A;  1E1R G;  1IBK B;  1B6Q A;  3B2E E;  5GW7 A;  4HZ3 A;  3JAK A;  3ZHQ A;  5LYJ B;  4DV0 O;  4I50 A;  1JFF B;  4QPK A;  3UO2 A;  1YJ9 V;  3PJS K;  3RYC A;  2Q73 A;  1NH2 B;  2CK3 G;  4U3J B;  4X6H A;  5J2U A;  1XNQ B;  3MHS A;  1AU3 A;  2N05 A;  4X1K B;  3M99 A;  2EIM C;  3ASO C;  1NU1 H;  3SR2 C;  3STZ C;  1SES A;  4UXN A;  5C8Y A;  4MM3 B;  5B1A C;  3KWZ A;  4DR7 B;  5CA0 A;  3CPW U;  4NXM B;  2LP7 A;  4JYA B;  1QOL A;  4ZTB A;  2QM8 A;  1YAL A;  2OCC B;  5AG2 A;  2DCC A;  3ZRW B;  1VQ9 V;  2WLJ A;  1Y4M A;  1CB5 A;  4YHH O;  5DEC A;  2NLJ C;  4DV2 O;  3FB6 C;  4X20 A;  1ARO P;  3OE7 G;  1XL4 A;  2ZDI C;  4W4K A;  3C3T A;  4K8Z A;  4I5S A;  3RYI A;  1GN4 A;  3K9S A;  4WFF A;  2DJV A;  3APO A;  3CC4 V;  1S4V A;  1Z5W A;  3H01 A;  4LC1 A;  5C93 A;  3ZNH A;  1ENV A;  4LFB B;  4QRG A;  1BL8 A;  2P67 A;  4B3M O;  1GN3 A;  3T1Y B;  2CH7 B;  2RNB A;  3IC9 A;  4TSF G;  2XAG A;  3QO5 A;  5LA6 B;  4LWS A;  1YK8 A;  3A2F A;  3BA9 A;  4PHZ A;  1YK7 A;  2JEU A;  1H2G A;  2ZIO A;  1FFX A;  4OPA A;  3CCM V;  4F6R A;  4FMT A;  4RNA A;  2LW7 A;  1MOF A;  1PPP A;  4DRX A;  2CUG A;  1U96 A;  4YIP A;  4ZHQ B;  1NVP D;  3OTO O;  2PI4 A;  2MK3 A;  2F1M A;  3E8B A;  2P0R A;  1EF7 A;  1O9H A;  4DR2 B;  2ODM A;  2WBF X;  4Q6G A;  1V54 B;  2WLI A;  1I94 O;  4TT3 G;  1PL0 A;  4W5C A;  2NQI A;  4HAM A;  3PRP A;  3M7M X;  2W6J G;  5EBM C;  2H94 A;  1YF2 A;  1ZUQ A;  3K8U A;  2YJ8 A;  1YCI A;  4I07 A;  4I0X A;  4YJ2 A;  2UXD B;  5CBG A;  2YID A;  1NZ6 A;  4LF9 O;  5KHI A;  4DV4 O;  2YUA A;  3RFR A;  4FJC A;  1Q7Y W;  1AJQ A;  4O4J B;  2DYS C;  4LF8 O;  5LP6 B;  3K79 A;  4R50 A;  4LF6 O;  3CJH A;  5CB4 B;  3PDF A;  4CC5 A;  2YXL A;  4FM0 A;  4BAY A;  4CDF B;  3IHP A;  4CH5 A;  1TAE A;  1YDX A;  2B9Z A;  3L71 H;  1MA1 A;  1HW7 A;  3MHH C;  4O4H B;  4DV5 B;  3CX5 F;  2F1G A;  1N0N A;  3B09 A;  1OCC C;  2DOS A;  4YYU A;  5LHG A;  2JIZ G;  1KYO F;  2PYL A;  1N32 O;  2LGQ A;  1VF7 A;  1XOU A;  4B08 A;  5KMG A;  1JMK C;  3U10 A;  3STL C;  1HNZ B;  4XUI A;  4WFH A;  3P3P A;  2DWE C;  1ZCM A;  5JVD B;  2IJK A;  4JI1 O;  2DC8 A;  3OAA G;  1K73 W;  4IIJ A;  1DLB A;  4W5B A;  1JR9 A;  4YYW A;  2EIM B;  3LUT B;  4DR1 B;  1US6 A;  4ZKI A;  3ASO B;  3VQY A;  1QBZ A;  1GTO A;  2DJF B;  2QTS A;  5H9C A;  3WXE A;  1MDW A;  3Q4H A;  2Y48 A;  5B1A B;  1MAB G;  1SQG A;  1SZT A;  3FB7 C;  5K1P A;  4KLB A;  3AG2 B;  2MW2 B;  3C3S A;  3OEH G;  3B4S A;  1MSW D;  2M6Y A;  2NQD B;  4BOS A;  1EBO A;  5DED A;  3RYH A;  3CB2 A;  1Y6X A;  3JD4 A;  4JI4 O;  3USV A;  1PIP A;  2XAF A;  4BOU A;  4AI8 A;  2H3O A;  2QWO B;  2IJJ A;  2QWQ B;  2V4D A;  1BMF G;  4N23 A;  4XDK A;  1MG1 A;  3G6E V;  4NXN O;  4F4L A;  1NTM H;  1PKX A;  3DXR B;  2DYR C;  5JZE A;  4DMX A;  3A0R A;  3SPH A;  4MZO A;  1Y76 B;  4KFM A;  3JAR A;  4GX0 A;  3W7X A;  4X1Y B;  4CH3 A;  1BP4 A;  1NQT A;  2F66 C;  3H1H H;  5JCO A;  4PA9 A;  3HKC B;  1NVP B;  2P4K A;  1NTZ H;  3HHA A;  1Y67 A;  1I7F A;  1T5E A;  3SPG A;  3FYE B;  3TET A;  1S5L Z;  2Y69 C;  3K03 A;  1BQZ A;  4LF4 O;  4JI7 B;  5CHV A;  1F51 A;  3QJ3 A;  3CE2 A;  1WPX A;  1IBK O;  3ZRV A;  1FXK C;  3SJQ C;  2ATK C;  4FLY A;  1CXZ B;  1GEC E;  4CDE B;  3KSE A;  4GUA A;  4RUE A;  4YVA A;  3K0D A;  3THO A;  2YS8 A;  3S3W A;  5KHK A;  1BHA A;  5KO3 A;  3H1I H;  4NTX A;  2LW1 A;  5CBF A;  3WFV A;  3ZMV A;  4KUM A;  1Z2G A;  3ASN C;  2X7R B;  1XNQ O;  3DC5 A;  3RYF B;  2UUA B;  4YJ3 B;  4EB6 A;  4FLU A;  3HKB A;  1YT7 A;  4GX1 A;  1PE6 A;  4NKG B;  4PA7 A;  2W0X A;  1KKC A;  3RW0 A;  1VF6 A;  1TVK B;  4DR7 O;  1J95 A;  4NXM O;  3R65 A;  4JYA O;  1U9W A;  2FML A;  1VMG A;  1SF9 A;  1JA8 A;  4Z2W A;  3BC3 A;  5L3C A;  3FKS G;  1SET A;  3JAW B;  3U0Z A;  1M4U A;  5ITZ A;  2QSA A;  4D8E A;  1NL6 A;  1AYV A;  3W7W A;  3MDS A;  2CTW A;  1JOY A;  4N8W A;  4ZI7 B;  2XT9 A;  2ZXW B;  3L72 H;  5JH7 A;  3OMI B;  4LFB O;  1R1B A;  3ZRS A;  3K59 A;  1RPR A;  1Z5V A;  3HR0 A;  4BS6 A;  2G8J A;  3D3I A;  1K92 A;  2JRI A;  2ZT9 B;  1VQO V;  2J7Q A;  2PBH A;  1PM9 A;  2YIA A;  1SQF A;  5L3E A;  2GTS A;  2O57 A;  1LR1 A;  4UCU A;  1AI6 A;  3E8H A;  1GRJ A;  2AHY A;  4AIL C;  2H8P C;  3QT4 A;  2QWP B;  2YJ2 A;  4OGQ B;  3ETQ A;  3ZHR A;  2QWR B;  4Z1V A;  2Q8V A;  4YY3 B;  5DM6 V;  2ZR2 A;  4PDR A;  3E1Z B;  1QMY A;  1IDS A;  5IY5 C;  3N3K A;  5FL7 G;  1BE3 H;  4OXS A;  3G67 A;  2XU4 A;  3K9A A;  3E9S A;  2A9H A;  2Y5B A;  5IWA O;  1F2C A;  2DYR B;  3OTF A;  3GWO A;  2UXD O;  2ACT A;  4FZ0 A;  2JK5 C;  1YEW A;  1QLE C;  2WPD G;  4LNU B;  2VQF B;  3CCJ V;  2ZNJ A;  1QHT A;  2ITC C;  3LDC A;  3G71 V;  2OIE A;  4GCZ A;  2IJH A;  3KKY A;  3BY4 A;  1ZWI C;  4GX5 A;  5JQG A;  3CCL V;  2LFS A;  3E2E A;  1MEG A;  1K5Q A;  3K5O A;  1O0E A;  3HKD B;  1Q81 W;  3PHU A;  4HYO A;  3U11 A;  1L8D A;  2IH1 C;  2Y69 B;  2A0L A;  1YI2 V;  4DV5 O;  4I4T B;  1PD3 A;  4WBN A;  1YZB A;  4JAU A;  3A0H Z;  4DV2 B;  2C2A A;  1VQ5 V;  3B21 A;  3IFX A;  3KCX A;  1HNZ O;  4X62 B;  3W7T A;  5A24 A;  4MVS A;  1VSN A;  3ASN B;  2OYQ A;  3VOU A;  4GT1 A;  4JPR A;  3D3Q A;  1O9G A;  3RN4 A;  4DR1 O;  4B3R B;  2ZKO A;  4W4L A;  4A5U B;  2XU3 A;  4TV8 B;  4U7O A;  3AG1 C;  2GUZ B;  2YJB A;  3IUT A;  3CEI A;  2OTL V;  1GN2 A;  3HKE B;  3FB8 C;  3S3Q A;  5KAI Z;  1JVM A;  2ADQ B;  2E75 B;  4X8A A;  1N36 O;  5H2F Z;  3HB3 B;  2P90 A;  5BZB A;  1FXV A;  3HD3 A;  3TJT A;  4O4L B;  1I94 B;  4BQV A;  4G2K A;  3LDD A;  1SQV H;  2OCH A;  3ABT A;  1FXH A;  4CBC A;  3L70 H;  2JVD A;  2B1G A;  2O6X A;  1XMO B;  3UO3 A;  4QJF B;  5J2T B;  1SQQ H;  4IYH A;  4BOZ A;  2Q68 A;  1XEQ A;  3DGE A;  3QSD A;  5EK0 A;  1CP9 A;  2HVK C;  1TUE B;  2WLL A;  4FIP C;  4FK5 C;  1NH2 D;  4LF8 B;  3U8E A;  2Q0A A;  5B1O A;  2JGD B;  4P9P A;  1F4M A;  4J7J A;  4JF3 A;  4P30 A;  3G80 A;  3BHP A;  5LMN B;  4K0K O;  3N3G A;  3OGI B;  4FLW A;  1YIT V;  4DMY A;  4AXM A;  1GM8 A;  1BGY H;  4GZR B;  3SJC C;  3CH3 X;  1STF E;  3JCU Z;  4JI7 O;  4FLZ A;  4XR7 A;  4GX2 A;  1R6T A;  1HP8 A;  3FAV B;  4X9Q A;  3LSQ A;  2Q0O C;  2FB5 A;  2GTA A;  1R3L C;  4HNA A;  5IY5 B;  1N32 B;  1NB5 A;  2BDZ A;  3W30 A;  2EIN B;  4ZOL A;  1ROP A;  2Y0P A;  1N8R W;  2AYO A;  3E8G A;  2X0L A;  2YIB A;  2FYE A;  4O2A B;  5EYP A;  3CC2 V;  2DW4 A;  1QLE B;  2E02 A;  2UUA O;  2JJ1 G;  1AYW A;  4NYK A;  5JH3 A;  4YYR A;  4LR3 A;  4NR1 A;  1OCO C;  3SPC A;  5K1X A;  2Y4U A;  2YIC A;  1IZ3 A;  5LXT A;  4JV5 O;  1RP3 B;  1ZL8 B;  3ABU A;  2IU0 A;  2X6A A;  3VQW A;  2R9I A;  3WXF A;  3O9O A;  5K16 A;  5LYJ A;  2QKS A;  2DN9 A;  2X6C A;  5E79 Z;  5LOV B;  2UZJ A;  4AXL A;  1ME3 A;  1PBH A;  4JYY A;  3ZRX A;  2H7J A;  2EIK C;  1B04 A;  1TUB B;  3LSS A;  4X89 A;  1YTF D;  1ZTE A;  3EVK A;  2ZE6 A;  4IHJ B;  4JI4 B;  2IU3 A;  3PSE A;  2GV9 A;  2VHF A;  3WB1 A;  3IJ4 A;  1Y74 B;  3MHS C;  2R9F A;  4OPH A;  3O0U A;  2PTM A;  4DUZ B;  2KKW A;  4EEQ A;  1WN7 A;  1VJV A;  4FFB A;  5HFL A;  4D7T A;  3ZRW A;  2NQG A;  4QRX A;  4JI2 B;  2BOB C;  3J7A U;  3LNM B;  1KBH A;  1RSO B;  3AG1 B;  1Q86 W;  4IP3 A;  5JWP A;  4XBF A;  1M56 C;  2WWW A;  4WFB V;  2R9R B;  5GTI Z;  2PGG A;  5GON B;  4UB8 Z;  3JCZ A;  4MSX A;  2VWK A;  2R70 A;  1EWM A;  1OZ0 A;  2UXX A;  4ZIB A;  5B1N A;  2DCB A;  2F4V B;  4AQY B;  3TRK A;  4PI0 A;  4YY3 O;  1RPO A;  4H44 B;  3BPF A;  5EIB C;  3ZCC A;  1ZX3 A;  1AB3 A;  2DCA A;  5TIS Z;  1KP2 A;  2R72 A;  4J7Z A;  2ATO A;  2E00 A;  4C7U A;  4IL6 Z;  4OVZ A;  1YJW V;  2F23 A;  3ZHU A;  2QA4 V;  1JPX A;  1OCZ C;  3ZUA A;  2KG7 B;  4J9Z B;  3CBJ A;  1R3K C;  2VQF O;  5LL6 Y;  3G6B A;  1K34 A;  2EJ7 A;  5CN0 A;  2OTJ V;  1I5Y A;  1GAX A;  2FT2 A;  4JGS A;  4JI5 B;  4R7C A;  3UKM A;  1N0J A;  3H8C A;  3JAS B;  2WLN A;  1IXM A;  4DYL A;  4FLV A;  2IBI A;  1THZ A;  1XKG A;  4JI0 B;  3CRM A;  5E1A C;  4JZ2 A;  4IGG A;  2ZE8 A;  2UUB B;  4DV7 B;  2LJ2 A;  2XU5 A;  3PNR A;  3F7V C;  3UM7 A;  1VIB A;  2Q7G A;  3JAT B;  4MVM A;  4K7C A;  2FKX A;  2OP3 A;  3UT5 A;  1M1K W;  5CB4 A;  4X62 O;  3J81 N;  1M5I A;  2EZO A;  3E22 B;  2AU1 A;  4FJC C;  5EZY B;  1CJL A;  3H6S A;  1JQP A;  4B3T B;  3EXA A;  4B3R O;  1GM7 A;  5EF4 A;  3B77 A;  4TUY A;  4B7E A;  2E76 B;  1FYJ A;  2GDS A;  4JI6 B;  1CQD A;  2CGO A;  1SNK A;  4REZ A;  4JI8 B;  1TA8 A;  2ILM A;  2VQE B;  4P9O A;  5FNV A;  1YTF B;  2UU9 B;  2ITD C;  5BY1 A;  2RMK B;  1TU6 A;  2FQ9 A;  2N04 A;  4J41 A;  1FKA O;  4CC6 A;  2EIK B;  5L3F A;  4RQE A;  1GO3 F;  4PA6 A;  3JAK B;  4PD4 F;  1BY8 A;  2L6L A;  4I50 B;  4JTC B;  1F7Y A;  3TMP A;  3BOW A;  3RYC B;  1KU9 A;  3H1K H;  2JS3 A;  3DTU B;  4OX9 B;  1MS6 A;  4O4I A;  2KB1 A;  1NI8 A;  2JTC A;  1ZAU A;  1YXB A;  1XMO O;  1SQP H;  3E8F A;  5IWA B;  1VQM V;  1KD1 W;  3M99 B;  1TL9 A;  4YYS A;  3L74 H;  1IWD A;  3OIS A;  3OMA B;  4LF7 B;  4E4E A;  3AEI A;  1Q6I A;  1KMI Z;  3P3N A;  5C8Y B;  2BDL A;  5KX5 A;  2Z84 A;  4I05 A;  5CA0 B;  4QBB A;  3QNE A;  1L0L H;  5LMN O;  4DV3 O;  1M56 B;  3IEJ A;  5LHH A;  1IX9 A;  1UFI A;  1BSM A;  4FM1 A;  3AK1 A;  4L8J A;  4X20 B;  4ABM A;  5LGT A;  3MP2 A;  5CA1 A;  2AZ2 A;  1M90 W;  3RYI B;  2FE8 A;  4PI2 A;  1EZJ A;  1H8E G;  3B8N A;  2CIO A;  3ZN0 A;  2FRA A;  1H2K A;  3D36 A;  3BWK A;  2IH3 C;  2WLH A;  2VWJ A;  3OFN G;  3FX7 A;  2DZY A;  5FPW A;  4BPV A;  2DC7 A;  4JAS A;  4I04 A;  5JCO C;  1IBL B;  4LWS B;  2AS8 A;  2ZD9 A;  2IPP B;  2DWD C;  1K4C C;  2B5U A;  4NB5 A;  4BIU A;  1GMY A;  1FFX B;  4F6R B;  3CME V;  1FS0 G;  4DUY B;  2HP8 A;  5IYC O;  1E1Q G;  1GMG A;  3JD0 A;  4DRX B;  3D8C A;  3JD3 A;  1N36 B;  2WLI B;  3B40 A;  4X1I A;  2VHS A;  1ORQ C;  1XQ8 A;  3CP1 A;  3QVN A;  2OZ2 A;  3IGA C;  1H2S B;  4WA6 A;  1VQ4 V;  1TLO A;  4JYB A;  2RCV A;  3EHB B;  3RVY A;  4FLT A;  5FPO A;  3SGI A;  1CSB B;  2AVW A;  1HUC B;  4X65 B;  5EGW A;  4NTW A;  4I0X B;  1CV8 A;  4YJ2 B;  3CSX A;  1VQK V;  1PNK A;  3SYO A;  5BMV A;  1S5H C;  3BY6 A;  3DSQ A;  3HWN A;  1Q6H A;  4FLX A;  1PNL A;  3K08 A;  3SJA C;  4QNH B;  4DUZ O;  2P06 A;  1NR7 A;  2GHY A;  1YVW A;  1AI4 A;  4L87 A;  3S3X A;  4WFA V;  1NTK H;  5F02 A;  3CJH B;  3AG4 C;  2BTQ A;  4JI2 O;  2XHB A;  1EWO A;  1UPG A;  1VF6 C;  2DQ0 A;  2RDC A;  5D5Q A;  2DC9 A;  2GSM B;  1PAD A;  3JAW A;  7PCK A;  2AXT Z;  2VRZ A;  4K0K B;  1KUQ A;  1K4D C;  4HBN A;  1OCR C;  1PL4 A;  3I3T A;  1SQX H;  4MW8 A;  1D5A A;  1VQN V;  1ATK A;  1HR0 O;  1M6D A;  1BQI A;  4H33 A;  4LP8 A; 
#chains in the Genus database with same CATH homology
 4JI1 O;  1YZB A;  2BTW B;  2F4V O;  4AQY O;  4B3S O;  3PHX A;  2VQF O;  5EZS A;  3W30 A;  3PT2 A;  2AGA A;  5LL6 Y;  4OVZ B;  4KHP O;  4DR7 O;  4DR3 O;  4LF7 O;  4NXM O;  4JYA O;  3OQC A;  1X59 A;  3B21 A;  3MP2 A;  4BOP A;  2DJV A;  1XMQ O;  2UUA O;  3T1Y O;  4XZX A;  2FE8 A;  5BXZ A;  4LFC O;  2UUC O;  3ZNH A;  1A32 A;  1IBM O;  3PRM A;  1HNZ O;  4RKX A;  1N33 O;  4IUM A;  4B3M O;  4DV6 O;  2J7Q C;  4JV5 O;  5FLX N;  1J5E O;  4A5U A;  1FJG O;  1N34 O;  3W31 A;  4D8E A;  1NS1 A;  4JI3 O;  4DR1 O;  1G1X B;  4BOQ A;  1PVJ A;  2ZKO A;  4M0W A;  4R3D A;  4JI5 O;  2UZJ A;  4X64 O;  4P16 A;  4BOS A;  5BR8 O;  4RNA A;  4OPA A;  4A5U B;  4HXD B;  2LW7 A;  2HWK A;  4X66 O;  2FKX A;  4DR2 O;  1R1B A;  3T1H O;  4LFB O;  4GKK O;  4JI4 O;  3IFU A;  3J81 N;  4X62 O;  4BOU A;  3MJ5 A;  4JI0 O;  1DK1 A;  3OTO O;  2JRI A;  1HNX O;  1HNW O;  2J7Q A;  2HHH O;  1I94 O;  4NXN O;  2N74 A;  2UUB O;  5JZE A;  1N36 O;  4D8B A;  4DV7 O;  3PSE A;  4B3R O;  5H5N A;  3JAM N;  4RF0 A;  4OW0 A;  5E6J A;  3J80 N;  3PRP A;  1FYJ A;  1IBL O;  4REZ A;  3SDL A;  4OPH A;  4PT5 A;  4DR5 O;  4D8I A;  4LF5 O;  3O65 A;  3F5T A;  1AIL A;  4DV1 O;  4LF9 O;  3RNV A;  4DR4 O;  5BY1 A;  3MTV A;  4DV0 O;  4DUY O;  3J7A U;  4GKJ O;  3PHW A;  2BU3 A;  4B3T O;  4DV4 O;  1FKA O;  2UXB O;  4LFA O;  4WUR A;  4LF8 O;  4IP3 A;  4BOZ A;  1XEQ A;  3BB7 A;  4LF6 O;  2ZM6 O;  4JI6 O;  2UXC O;  1F7Y A;  3E9S A;  3TMP A;  4JI8 O;  4LF4 O;  5A2Q N;  5EZQ A;  1IBK O;  4DUZ O;  5IWA O;  2VQE O;  3RT3 C;  2UXD O;  2UU9 O;  2Z0A A;  4GUA A;  1UKF A;  2E5L O;  4JI2 O;  5IT9 N;  1D2D A;  2JTC A;  4K0K O;  1XNR O;  5KO3 A;  1XMO O;  3M8A A;  4X65 O;  5LMU O;  3TRK A;  4MM3 B;  4YY3 O;  4DR6 O;  2DOS A;  1KUQ A;  4ZTB A;  1AB3 A;  3BY4 A;  1XNQ O;  3C0R A;  4JI7 O;  2BTW A;  1N32 O;  1R6T A;  3BBA A;  2Z84 A;  3R66 A;  4OVZ A;  1DKI A;  3PHU A;  4OX9 O;  4RF1 A;  4YHH O;  5LMN O;  1HR0 O;  4MI7 A;  4DV2 O;  4DV3 O;  4DV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...