2JRIA

Solution structure of the josephin domain of ataxin-3 in complex with ubiquitin molecule.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ataxin-3
publication title Understanding the plasticity of the ubiquitin-protein recognition code: the josephin domain of ataxin-3 is a diubiquitin binding motif
rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 44
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2jriA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2jriA01
4DR2O 4JI4O 1AB3A 4DR7O 2Z0AA 4DV4O 4DR5O 2ZKOA 2UXBO 3T1HO 4OPHA 3RT3C 1N34O 2F4VO 4JV5O 2DJVA 1HNZO 1KUQA 4AQYO 1XEQA 1IBKO 1R1BA 1G1XB 5IT9N 1DK1A 5BR8O 4JI3O 4LFBO 1YZBA 2DOSA 2UXCO 4X66O 2UU9O 2FKXA 2UUCO 1NS1A 4JI1O 4LFCO 1IBLO 4LF6O 4LF5O 1XMOO 1N33O 4DR3O 2UUAO 1N36O 3JAMN 4DR4O 3J81N 1F7YA 4B3TO 5BXZA 4NXMO 2ZM6O 1FYJA 4NXNO 4DV3O 1A32A 1XMQO 3T1YO 1HNXO 4DV7O 3R66A 5LMNO 4X64O 4LFAO 4LF9O 3J80N 5FLXN 1D2DA 5LL6Y 5A2QN 4JI8O 2UXDO 1FKAO 4JI7O 4OX9O 2AGAA 1HR0O 4YHHO 4B3MO 2VQEO 5LMUO 1XNRO 1FJGO 4X62O 4DV5O 4DV1O 4A5UB 1J5EO 1I94O 4GKKO 4DR6O 1HNWO 1R6TA 1AILA 1IBMO 4DR1O 4OPAA 4DUYO 4GKJO 4K0KO 3OTOO 4KHPO 4JI6O 2E5LO 4LF8O 1XNQO 2JRIA 4B3SO 4LF4O 4DUZO 1X59A 4DV2O 2HHHO 5H5NA 1N32O 3F5TA 2LW7A 4X65O 3J7AU 2VQFO 4JI5O 4JI0O 3M8AA 4B3RO 4YY3O 3O65A 4JI2O 4LF7O 3SDLA 5IWAO 4JYAO 2N74A 4DV0O 2UUBO 5BY1A 4DV6O
chains in the Genus database with same CATH superfamily
3ZJZA 1M90W 1PNKA 1AYWA 3JALB 2ZE8A 3RNVA 2LQTA 1HW7A 1GN4A 4DV1B 1RPRA 4X65B 2JGUA 2WA4A 4J7JA 1N8RW 2F4VO 4J41A 1U96A 2IJIA 1ZIVA 2RJZA 3ABKC 4ZBMA 1N4CA 3SPHA 4GKJB 4GZRB 3WU2Z 5L3DA 4FM0A 2ZNIA 3HHIA 1OZ0A 3DXRB 3BB7A 4JI6B 3DC6A 2NQGA 4D7SA 1H38A 1U9WA 3HKDA 3CRMA 1XL6A 4N8WA 4DR4O 2LFRA 1FXKB 4X1YA 4NXNO 2EILB 1A32A 2ZE7A 4YIOA 1SQPH 4O2AB 4AHCA 3W30A 5CB4A 3G6EV 1GKFA 1BE3H 2UUBB 3E83A 3OQCA 3W7SA 4HYOA 1SERA 1NR1A 3IC7A 4KL1A 1BSMA 4MVMA 4JI8O 3DF0A 1M6DA 4MZSA 3APQA 2FL4A 3K08A 4CH3A 2UXDO 3CRRA 5F2VO 1FXKC 2R9AA 1SZTA 2Q7HA 4FFBB 2EILC 4ZOLA 1VF6A 5LMUO 4I04A 1W2BU 1P49A 4CS3A 2OZ2A 1VQ4V 4FM2A 1XHXA 4JI3B 2E75B 2XNDG 2P90A 5EC1C 3ZMTA 2CH7B 5L3GA 2UUCB 4D8BA 1JCHA 4KXRA 3OMIB 3MJ5A 4JYBA 3HKDB 4KHPO 2UUAB 4P16A 3I56V 3ZRVA 2JRIA 3CC4V 4NXMB 3VOUA 1SS3A 3CYOA 1A6RA 5CB4B 2HP8A 1F2AA 1NT2B 4OGQB 4XBFA 4MVRA 2FRQA 1GH6A 2UXXA 4H33A 3QJ3A 2YIDA 3OAAG 2JIZG 4RO2A 2P86A 4OX9B 1S5HC 2Z3YA 4QPJA 1QVFU 4LF4B 1AB3A 2HHHB 4PHZA 4DV5B 1K97A 3CRCA 2YJ9A 1G8MA 4D8EA 4WFFA 1H8EG 1WB8A 1HUCB 3H1JH 1XEQA 3AG7A 3NXSA 1ME4A 3OISA 3ZRSA 4BWAA 1K4DC 5BR8O 2JDIG 1M1KW 1CQDA 1VF6C 4BQVA 3FYIB 4K0KB 1EN6A 2IBZH 5FPRA 2UXCO 3OD4A 4JI4B 2ETNA 1EN4A 1F4NA 1Y4HA 3H6SA 4H13B 4LFCO 1XHZA 3O0UA 3BC3A 4F6RB 1XNQB 1AU3A 1VMGA 3QF7A 3TRKA 1HWYA 1Q7YW 1VQ6V 3LUTB 2NQAA 4UV9A 2OULA 4JTDB 3I3TA 5B3SB 3T4ZA 1ZCMA 1NLJA 1YF2A 4B3RB 2HFEC 1IDSA 1UPGA 3E35A 4CDDB 3CCVV 4DV7O 3MHHA 1FFTB 1GN6A 5LMNO 3ZHVA 1MZEA 3RW0A 1R3JC 3GB7C 4NTYA 3D6SA 5B3SC 3O9OA 4HWYA 2A3QA 3PW3A 5EYPA 3I06A 1ZL8A 5J2TA 1I08A 3JD0A 1YK7A 5IYCO 3BWKA 2ZNJA 4DV1O 4JYCA 1WJZA 1EZVH 4PI2A 2XU5A 3H1KH 4RF0A 1ATKA 5CA3A 4YVAA 1GM9A 4QGPA 4WURA 4JI1B 4GKJO 3OEEG 1F23A 1W59A 4M0WA 4JI6O 5LHIA 2RN9A 4EEQA 1Y6XA 5EF4A 3G6BA 2P6JA 1K3BB 1XMQB 4CH5A 1J95A 1S72V 1US6A 2UUBO 5KLVH 5EYPB 3ABLC 4CS2A 5J2TB 2EIMB 1Q81W 2F66C 5IJ9A 1F4MA 3CPWU 3MHHC 4YYWA 1SA0B 1M56B 3M99B 4X1IA 1WP8A 1VQLV 4ZUXU 1NTMH 4BIUA 2EIMC 4JI3O 5IJ0B 2ARHA 5JQGA 5BMVB 4UCVA 2UUCO 1M56C 3LNMB 1NKDA 1MS6A 4FLYA 3CMAV 1AU0A 2UZJA 3H8BA 4O2BA 2UUAO 5KA6A 1Q6HA 3CCQV 1NI8A 2FYEA 4NXMO 2A06H 1XDCA 4CH6A 3MORA 3F5WC 1VQKV 4JYAB 2L35A 4DK0A 4CC5A 2OP3A 2ITDC 3CXHF 4TV9B 3J80N 4IT5A 5IJ9B 4DYLA 4P2ZA 4QNHB 3JD4A 4YJ3A 1BZKA 3UCSC 1Z5WA 4PA7A 1B6QA 3QNEA 3BA9A 4DR7B 4OX9O 3DGEA 2WPDG 1EN5A 4X1IB 2WA3A 3PJSK 1R6KA 1TA8A 4MTXA 4DV5O 3OUFA 2DCAA 3L75H 5JQGB 3FB6C 1BGYH 2ZD9A 1NTKH 2X0LA 3B8MA 1DF0A 4K0KO 4O2BB 1P84F 3VQVA 4N79A 1FAFA 3BPFA 2E3CA 2FO5A 1XNQO 3TGUH 4Z1MG 2P4KA 4XDLA 3KFQA 3ICXA 2DCBA 5B1NA 4N23A 1KFXL 3KG2A 3TNXA 1RPOA 4F4LA 4B3RO 4QJFB 1THZA 4KP4A 4LBEC 2XHBA 2QWOB 3H1LH 4LF9B 3BCNA 1NVPD 4YJ3B 4KUMA 1GM8A 4LWSA 5JJJB 5LGNA 4PP1A 4WF9V 2B1GA 3E2EA 2HWKA 2Q4PA 4CDCB 1B06A 1EZJA 1ZX3A 2IH1C 4FPPA 4Q20A 3STZC 3ZCCA 1IWDA 1XKGA 2W6JG 3RT3C 4HAMA 1M9NA 3USVA 2ZT9B 3ZMUA 9PAPA 4L8JA 1YALA 1T5EA 4UCSA 4JI1O 4QBBA 2A9HA 4FZ0A 4YIPA 2D2CB 4B3SB 3I5DA 1SETA 4MZOA 5EK0A 1XQ8A 3CXCU 2J7QA 3JSNA 5JH7A 1RSOA 4IYIA 1SESA 2PGGA 1YSCA 1XMQO 4FIPA 2PYLA 3OR6C 2D3OW 4LWSB 2QWRB 4CDFB 2OT5A 5FNVB 1ENVA 3IV2A 4PELA 1PP9H 4TUYA 1XREA 2JS3A 4FLZA 4W4UA 4JYYA 2R9IA 5JCOC 1HNZB 2FQ9A 5KUKA 1CPYA 4GLXA 1GRJA 2CDYA 4DW1A 1PPPA 2B9ZA 1JA8A 1K73W 2Y0IA 4BS5A 4PADA 4DR3B 4I9QA 1KP2A 3JD2A 5TISZ 1KYOF 1Y74A 3JCZA 5JH7B 4IIJA 1RSOB 3OVZA 3QT4A 2YXYA 2WLIA 2ADQB 4G27B 2X6AA 1WPBA 3T1YB 1CB5A 2CGOA 3K5MA 3K8UA 4PT5A 4TV8A 3RVWA 4JI0O 1VQMV 4X64B 3T1CA 4JYAO 3P5VA 3HKBA 2BOBC 4QE9A 2Y6EA 3N2GA 5CBGA 2J7QC 4G28B 3PN1A 3BOWA 4DR2O 4GX0A 1COWG 4FIPC 4IP3A 3QO7A 2BSKA 1S77D 3HKEA 4DR7O 3WXFA 1U9VA 2DJVA 2QM4A 3TCUA 2V1DA 1U97A 4A5UA 1G1XB 5IT9N 4DUYB 3C9EA 1KHQA 1QU7A 2JEXA 4YYSA 3OTOB 2H7JA 1FD9A 2HJDA 1PKXA 2E03A 3R65A 1Y74B 4IIJB 1N0JA 2WLIB 4RWUA 1KMIZ 1Q90D 3CP1A 5KAIZ 3E8BA 4ZHQB 1E1QG 4TV8B 3IJ4A 2R9CA 4WFHA 4O4LA 4MW3A 3N2GB 4YYVA 1KP3A 5BZBA 2AHYA 4D6TH 1EWMA 4LF9O 1WAZA 2CUGA 4BOUA 1JJOA 2Y4TA 2BSKB 3TK1A 3CRAA 1FKAO 4IUMA 3ZHUA 1NH2D 4P6GA 4R3DA 2AGAA 2DWEC 3ZX6A 4YYUA 1YITV 3PHWA 3RYFA 2N04A 2NN4A 1QHTA 3SGIA 5EIBD 4TQFA 2AS8A 4A5UB 4AQYB 2Z5UA 3UT5B 1AJNA 3TETA 1JQPA 1THEA 1ICFA 2WWWA 3P32A 2F95B 4I9WA 2EX3A 3AG3B 5EZSA 5B5EZ 1AVMA 1JR9A 1KD1W 3KX1A 3ZMSA 3G67A 3IMAA 1KXRA 5CA1A 2C2AA 3BABA 3ZHTA 4B3SO 3ZRWB 3H01A 4O4LB 3AG3C 1IZ3A 2VHSA 3H9VA 5KUMA 2EJRA 2YJCA 1DEUA 2N74A 3ERVA 2QR4A 3OM3B 3UQ8A 3DXRA 3RYFB 1GTOA 2W0FC 3L70H 1CJLA 4NKGB 4OXSA 3OMNB 4UCRA 1PVJA 4R8CA 4UCTA 2HKOA 5DN6G 1XOUA 1HNZO 1IXMA 2P22C 4MTOA 2ZE5A 3ASNB 1AP6A 1FFXB 3B09A 1FXKA 4QPKA 2YI8A 2QSAA 5EGWA 4AILC 4O2AA 2UU9O 4IGGA 3IFUA 3PHUA 1YTFD 5CA1B 2CTWA 1TVKA 3STLC 2H8PC 4DR3O 1SZXA 3ASNC 2QA4V 1OCOB 2YICA 1K4CC 4K8ZA 4EFEA 4X8AA 2ZDIC 4FFBA 1Y76B 3JATA 1MEGA 3SYPA 2GV9A 3T1YO 3LDCA 2Z84A 2ITCC 1OCCB 4DV6B 1QOLA 3FYEB 4X64O 2YJBA 3CB2A 1NB3A 3U8EA 1OCOC 4FK5C 2GUZA 3KZIZ 5A2QN 1H2LA 2Q73A 2CH7A 3QO5A 1L0LH 4R6ZA 5LYJB 2CB5A 4PI3A 1YI2V 2VWKA 2JJ2G 4RUFA 1KKDA 4EKWA 1OCCC 2ZIMA 4X6JA 1R3IC 3RYCB 3S3RA 3ZN1A 2LP7A 1SQBH 5KHIA 2DE0X 1QLNA 2WLNA 2QDOA 1TU6A 3E1ZB 4DUYO 1TVKB 5IYBO 1IBLB 1VQ8V 4FLVA 2JS5A 3OTOO 2XOKG 1LUWA 3K57A 4GT1A 4R7CA 5LBQA 3FAVA 1NQCA 1YVWA 4JASA 2BDLA 3JATB 4J10A 1NB5A 1GK9A 3JAWA 3F75A 1IX9A 4HNAA 3B21A 5CVMA 2ZE6A 2Q5ZA 2GUZB 3AK1A 2F1MA 4PDVA 4X62O 4B7KA 4WFBV 5LXTB 4JAUA 3DTUB 1YJWV 5F02A 3SPJA 3BY6A 2XAFA 2JQFR 4BOPA 4J42A 5K1XA 1D5AA 4B3MB 1YDXA 1S76D 1N32B 4TT3G 4F6RA 1VQNV 4IL6Z 1PPNA 4OPHA 2B1MA 3O1GA 1VIBA 1R3KC 1K5QA 2DJGB 3ABMB 4AQYO 1SQGA 3JASB 4R50A 1YZBA 1EF7A 5E6JA 5D5QA 1H2GA 3FAVB 2G6DA 3D36A 3B79A 4DR5B 2AUXA 3ABMC 3CH2X 2DZZA 2NNUA 3JAWB 2KG7A 5L3BA 1BQ0A 4XDJA 3L72H 3MAQA 5EZQA 4HNAB 3RVXA 1VF7A 2BTQA 4LF7B 1MZFA 2L6LA 3RFRA 4E4EA 5CN0A 1XILA 5LOVB 5LGTA 3UKMA 3OF8A 3WXEA 3AK2A 1GM7A 3WB1A 3CBJA 2AU1A 4PDMA 2P5OA 1N34B 2QKCA 1U9XA 3K0DA 3KSEA 3IC9A 3IAYA 5A24A 1AECA 5LP6C 3E8FA 5LHGA 3B40A 5HFMA 1KB9F 3ZEDA 1QDQA 2AUZA 4PV1B 1ORQC 1MSDA 1YHQV 2KG7B 1PBHA 4BIOA 4L87A 4TOIA 1WNSA 4ZKIA 4OW0A 2LGWA 4W5BA 2P67A 2ZM6B 2BTQB 3EHBB 1B3QA 3L73H 2NQDB 3VBBA 1SA0A 4X65O 2FTKA 1PXVA 3D36C 2OTLV 1SP4B 3M99A 4D8IA 4HXDB 2Q7EA 3U0ZA 5PADA 2E74B 3DC5A 5KHHA 5GONA 4O4HB 4GCZA 3KKUA 3AK3A 2WLHA 4DV6O 4W5CA 1R73A 5KX5A 1BS3A 5IJ0A 1Q82W 4JAVA 1MG1A 4MTFA 1M93A 5BMVA 2E76B 1PE6A 2ZCEA 2VQEB 1FJGB 1WLEA 2G7YA 5IYDO 1HDJA 4J80A 3H8CA 1I5XA 3ABLB 4RQEA 1I94B 2FUDA 1HNWB 1KUQA 1R6NA 2V7QG 5H6RA 2QKSA 1NS1A 2HVJC 1IBLO 3V6CA 2DN9A 4UVAA 1K33A 2E5LB 4TV9A 1QNMA 1WA8A 5LA6A 2DC7A 3JAMN 1Y67A 3APOA 2DQ0A 5GONB 5IY5B 3G71V 5D5PA 2ZQMA 5KX5B 1VQ7V 1ZLZA 2DC9A 3BAAA 3MD0A 1HP8A 4CC6A 3HHAA 2LGQA 4PA9A 4UVBA 2M6YA 1D2DA 1XL4A 2G8EA 4YV8A 1TUBA 1ME3A 1R3LC 1BP4A 1QCEA 2UXBB 3ETEA 5IY5C 3SYQA 4B3MO 5JVDA 4BSQA 3KWBX 2P4VA 2EJ7A 3W7XA 2DCCA 4LFBB 1DF5A 2BTWA 2VWJA 2Q8VA 4LNUA 4GUAA 3H7DA 4MSWC 1QQCA 4Z2WA 4LF5B 1QR8A 1S3JA 1WA8B 2XAGA 5LA6B 1BHAA 1JX9A 2X7RB 1MABG 4LH7A 3UO3A 3FKSG 3F5VA 4K7CA 3K5NA 3LFYA 4B3TB 1G4YB 4LF4O 4MSXA 3JD1A 2HHHO 4I5SA 2VRZA 2NLJC 3HB3B 3C3SA 3JCUZ 1NU1H 1PD3A 3F7YC 1VSNA 2AIMA 3I55V 1AI5A 4DRXB 4LF7O 2CTQA 1I0HA 3MHSC 4P9OA 4UXNA 1CP9A 4JPRA 1E79G 4YXWG 1PV0A 1MDWA 3ZHQA 1TUBB 2X6BA 4JI4O 2QKAA 1RM1B 1TLOA 4JZ2A 3A0HZ 5JVDB 3K59A 1NR7A 2PZSA 3MTNA 3FB7C 5CA0A 1ROPA 3TXSA 1QR9A 3CJHA 1QLEC 2GBOA 1N34O 2B1NA 1J5EB 1U5IA 4CDEB 1IXBA 2BTWB 2PYJA 1DGSA 4LNUB 5H2FZ 1SRYA 2RMKB 3E22B 4DR1B 1DK1A 2R6NA 4WBNA 2A79B 1RM1C 5GW7A 1OCZB 3JD3A 3ZHRA 5JCOA 1TL9A 4YYQA 1W0JG 1LR1A 1GO3F 1FPOA 3MDSA 2EIKB 3CCSV 3SR2C 4LC1A 5FNVA 2QWNB 2KKWA 2PUSA 4XZXA 2RQ6A 1BHBA 4LR3A 5ITZB 2ZM6O 2G8JA 1OCZC 1QMYA 2YUAA 1H2KA 3FB5C 3OR7C 3OMAB 3N3KA 1Q3EA 4X66B 1JPXA 2EIKC 3K06A 2FMLA 3OFNG 3LSQA 4Q8HA 3K03A 3IHPA 3ABTA 2PI4A 3VQWA 3BFRA 2XAHA 1ZWIC 3RN4A 5CA0B 4FM1A 3CJHB 3Q4HA 2O6XA 4F6EA 2VQEO 1FJGO 1B04A 1YVBA 4U7NA 4XR7A 2FE8A 2W6IG 4TSFG 4MTGA 4WBNB 1I94O 1HNWO 1NTZH 3CCJV 5GTHZ 2PREA 1ZSPA 1AU2A 3N3GA 4X1KA 4K35A 1NJIW 3CX5F 2F23A 2XTAA 5KHKA 4X9QA 4PDLA 1AYUA 2JEUA 3E89A 2E5LO 3RVZA 5JA7A 2OIEA 1UFIA 2CAZC 2N05A 4DK1A 5B66Z 3QO8A 4Z1VA 3C3TA 2VS0A 5H5NA 1H2MA 5FPWA 3F5TA 3K9AA 2WBFX 2MW2B 1N0NA 4H37A 2DC8A 3IGAC 3A0RA 2JJ1G 3CH3X 3NHEA 4UUJC 2IPPB 3BBAA 2XUMA 4JGSA 4CZZA 3PT2A 1PPJH 3Q4HB 3ETGA 2AYOA 2NQIA 4FZ1A 1XBLA 4YYRA 2JVDA 2UXBO 2Q0OC 1EWPA 1DKIA 1AP5A 3P5UA 1IBMB 2HVKC 4ZHQA 1EM1A 4X1KB 4LFBO 1FH0A 2FKXA 1K7DA 3ZMZA 1GMYA 2F1GA 4PP2E 1PL4A 4LF5O 4FFKA 3BPMA 2ARYA 4X6HA 4UB8Z 5K1PA 2ZR3A 4MT8A 1WN7A 2CGNA 1JOYA 4B3TO 1KHPA 4JI5B 1P4RA 4MW8A 2VQFB 1VQOV 1XI1A 3B77A 2IW5A 1NQTA 1Z5VA 3K9SA 1GCBA 1Q5OA 1NPZA 2EINB 3UT5A 5JWPA 4J7KA 4JTCB 2DC6A 3NR7A 2R9NA 3UM7A 2YIBA 2JK5C 5B1BB 3QSDA 2LJ2A 4DV4B 3V6EA 3K5OA 2EINC 4GYCB 3K3WA 5EBLC 5IDJA 3E8HA 3D8CA 1IBKB 2RCVA 1Q43A 3ZRWA 1J5EO 5H6QA 1MSWD 5B1BC 4JI8B 4DR1O 4X6IA 3B2EE 1F2BA 3RVYA 4QE7A 5IYZA 3E8GA 1V55B 1XMOB 4GX1A 2DJFB 1K8AW 1QBZA 3CRQA 2O57A 2GTAA 4TQDA 1YT7A 1P7BA 5DM6V 2Q9LA 4X89A 4FLTA 4NTWA 3TJTA 1PADA 1W0KG 3HKCB 1OHHG 1HNXB 2KB1A 2YSUB 1MNGA 1AI6A 2AZ2A 1CEZA 1V55C 4LFAB 3E9SA 2HEPA 2WLJA 1L0NH 5BY1A 1FFXA 4I07A 3LDDA 4LH6A 2ZDIA 1EBOA 2IH3C 3JSLA 2PTMA 3EXAA 3KKYA 2QJ1A 2Y69C 3ZS8C 2IBIA 3THOA 4WFEA 5JJEB 2PY5A 4WFAV 2WSSG 2M7WA 4GKKB 4DR6B 4FK5A 3JAKB 3E86A 4UFZA 4GX5A 1Y76A 5IYZB 1CV8A 1KFUL 4LCUC 3SPIA 1PIPA 1OJHA 2QEXV 3LNNA 2DW4A 4LF8B 2GDSA 2V4DA 1GAXA 3ETDA 4XUIA 2EIJC 3U10A 4RF1A 1NZ6A 2GHUA 1F7YA 1YK8A 5LYJA 1QVGU 3N4CA 3ZBHA 3FD9A 3HR0A 3CHXA 4FJCA 4EFBA 2XAJA 4K3AA 3RYCA 1JVMA 1NVPB 1AJQA 1P7GA 1XUQA 4J11A 2R9FA 2CIOA 5LGUA 4QRVA 1Z2GA 1AI4A 2Q67A 1MHWA 3B8NA 3CC7V 1X4TA 1TGOA 4ICGA 3QG5A 1AYVA 2R9MA 2YXLA 4ZTBA 1V54B 4WFGA 1AR4A 3FFQA 4J9ZB 3QVNA 3N2KB 4DV7B 1D5NA 4BR6A 5C8YB 1IBMO 1GECE 1YJNV 4U3JA 1VF5B 4LF6B 4W4KA 2WLLA 1BGOA 1K34A 4O4IA 5J2UA 1V54C 5LXTA 5CMUA 1YIJV 1IVSA 2BDZA 2JTCA 4REZA 2Y0PA 3ABUA 4FLWA 3K04A 3SYOA 2K1EA 4DMYA 1S5JA 4J9YB 3CWBH 3WXGA 2VQFO 3JARA 4JI5O 2NR5A 4NVPA 4EB6A 2OYQA 1YEWA 5KO3A 1AI7A 1AR5A 3JASA 1AJPA 1H8HG 1I5YA 4FJCC 3PRMA 4MS2A 3A0BZ 3L74H 1XNRB 1K5SA 4BOQA 1JJ2U 4DV4O 3OVXA 1H2NA 3VQXA 2E02A 3FB8C 2DQ3A 2X6CA 4YJ2A 1IURA 2YDEA 5CBHA 5GTIZ 3S3XA 1IBKO 2OCCB 3WB0A 4U3JB 4D7TA 5CHTA 4PA4A 1CVZA 3T2MA 1ITOA 2IJHA 2DOSA 3D3QA 2WLLB 5JJNB 4O4IB 3CE2A 1DTOA 5J2UB 4AXMA 2G38A 1PPOA 1FXHA 3SJBC 1GN2A 3BY4A 5LOVA 4QIWF 1F2CA 4CH4A 1XMOO 5L3EA 2HH5A 4BOZA 2BCCH 2PADA 3U11A 2IM9A 2DCDA 2OCCC 3W7WA 5LP6A 1JQ0A 3OE7G 3JARB 2EBOA 4EB6B 2XU1A 3SJQC 4ZIBA 5CHVA 4IHJA 5EBMC 1HNXO 2WLKA 4OEMA 3R66A 4LFAO 3A8TA 2AYNA 4BW5A 1RFYA 2YJ8A 3SPCA 1BQZA 3K5LA 2R9RB 3AG4B 3W7UA 4I4TA 1PL0A 1Q6UA 4QH6A 2BTOA 1KC8W 4X1YB 2LW1A 4YJ2B 1Y4MA 2WLMA 2QWQB 3CMEV 3AG2B 3GWOA 1CTEA 4FVMA 3ZIAG 4PD4F 4GKKO 4DR6O 2PNSA 2Q69A 1AILA 2H94A 1VQPV 3AG4C 2XT9A 1RP3B 4RNAA 1TAEA 4X88A 2BOCC 2FRAA 4IYHA 4ZOLB 4O4HA 1N33B 3AG2C 5LP6B 1F29A 4LF8O 4P9PA 2DYRB 3OT7A 4IHJB 2LO1A 2YEVA 3CEIA 4NYKA 4JAAA 4PI0A 1L1FA 2XU3A 1EFRG 3IOQA 3CCUV 4I4TB 3BRCA 4CS4A 1QXPA 2FT2A 2RNBA 3IEJA 4BS6A 5LHHA 4JI7B 4RAIA 2DYRC 4P30A 1HR0B 1NH2B 2AZ0A 4Q6GA 3WB2A 2QM8A 2QGNA 2ZKOA 2QWPB 2ACTA 2MK3A 2VHFA 5A9GA 4U7OA 1R1BA 7PCKA 3BEHA 2F43G 4HBNA 3PDFA 2ATOA 4WCEV 2CTRA 2AHZA 1U9QX 3RYHA 3X2QB 4LF6O 5EIBC 2PI5A 2A7WA 4RY2A 3EFFK 3ASOB 1CXZB 4NR1A 4DV2B 3RVVA 3J81N 2YEVB 4DXWA 2HXZA 3AG1B 3AEIA 4YY3B 1LUVA 5KHJA 3X2QC 1KBHA 2AVWA 4DV0B 1PM9A 1BMFG 3ASOC 3K79A 1FS0G 3ZUAA 3C90A 3TXQA 3AG1C 4I7ZB 4C7UA 4QRXA 3T1HB 4JV5B 1S4VA 1XNRO 3MHSA 8PCHA 2YC0A 2FTDA 4OVZA 1R6TA 3RWRD 2EULA 4UVCA 1SQVH 3OEHG 3K58A 2JGDA 2R70A 3RYHB 3KCYA 4PA3A 4CBCA 4DRXA 4I50A 2BE3A 1ZL8B 1YTFB 2XU4A 4G2KA 4AI8A 1BT8A 1KECA 4MVZA 3SYAA 3B4SA 3ZN0A 1KQSU 3ETQA 4DO2A 1N32O 4H44B 4I0XA 3J7AU 1NL6A 2P7TC 3O65A 4ASUG 5H9CA 3CCRV 1WPXA 3D3IA 4MI7A 1SC5B 2GFOA 3E22A 1SQQH 1WB7A 5EZYA 3PRPA 1URFA 4RUEA 4JF3A 1GLOA 4YHHB 2HHNA 2ILMA 5L3FA 3P5WA 3OW2U 3HWNA 2E00A 2Y5BA 2ATKC 4O4JA 3K24A 1M57B 4DR5O 1ZUQA 4OVZB 3SJCC 2WAMA 4JI0B 2HR3A 4MVQA 2JGDB 4MM3B 3CS5A 5ITZA 3DSQA 4W4LA 3GCBA 3WG7B 2PF4E 2GSMB 4I50B 3WFVA 1QLEB 2CK3G 2HJFC 3ZMVA 2UXNA 2YIBD 4DR2B 3ZRXA 3H1IH 1SNKA 1YJ9V 1M57C 1YXBA 5HFLA 3CCEV 2QTSA 1I7FA 3P3PA 1N33O 4TWKA 4DUZB 4MVOA 2ZXWB 4I0XB 1DLBA 3KW9A 3WG7C 3N27A 1E1RG 4BIZA 1FYJA 3MTVA 2FB5A 1M4UA 5KMGA 3QTCA 4JI2B 2YXHA 5KAFZ 2OIGA 1BQIA 4PA6A 5JH3A 3W31A 5EZYB 3BVOA 3CCLV 2IU0A 2IJKA 1YCIA 3L71H 2ZXWC 2YS8A 4OELA 4O4JB 3VQYA 4JI7O 1HR0O 2R72A 5AG2A 5DECA 1X9YA 1POPA 4K8XA 4CZWA 2ZR2A 2F93B 4FLXA 2HG5C 1K3EA 3RBZA 3EVKA 3P5XA 3IUTA 1NBMG 1O9HA 4QRGA 2LFSA 4BPVA 4XDKA 3RYIA 2RDCA 3K9MA 5E1AC 2B5UA 3M7MX 1UJWB 3A2FA 1N36B 4DW0A 4DV2O 5KMGB 4I55A 4DV3B 1O0EA 2HD5A 1GN3A 3OGIB 4G54A 4YY3O 5KHGA 3SDLA 3BHPA 1OV9A 3K0GA 5FL7G 4DV0O 3AI8A 1PNMA 4DMXA 1KKCA 4Q8GA 2A0LA 4B7EA 3H1HH 4BW9A 2JQGR 5CBFA 3GVMA 5L3CA 5K16A 3F7VC 4N4ZA 3G80A 2Z0AA 2Q0AA 3T1HO 2IJJA 2C0YA 5C93A 3H89A 4JV5O 2AXTZ 4NB5A 1MA1A 4PDRA 2Y48A 3CBKA 1DF4A 3OUSA 3S3QA 1EWLA 3G4SV 3RYIB 1PPDA 3KWZA 4KLBA 3JYCA 4FLUA 4RKXA 2H3OA 4I55B 2Q6AA 1F51A 2F7DA 2XASA 3FX7A 2ZIOA 1VP7A 3RGBA 2Y4UA 2B1IA 4E2LA 5IWAB 1O9GA 1VEWA 5E79Z 4GX2A 2UU9B 2P0RA 1STFE 3LSSA 4ABMA 2DYSB 3OTFA 1VJVA 1Q8IA 2HLDG 4JZGA 5LL6Y 3PHXA 3CC2V 1CS8A 2K9PA 3SPGA 3SJAC 3BA8A 4MVSA 5B1AB 2P06A 2Q7GA 3IFXA 4YHHO 1MMMA 5DEDA 2F4VB 1L8DA 2DYSC 3LSUA 1SKVA 4UCOA 1AR1B 1S0VA 2ODMA 4KFMA 5CVNB 2E01A 1SQXH 2EZOA 2IU3A 1FXVA 3BCCH 3HKCA 4BOSA 2DMXA 4TUYB 1GMGA 1WP7A 2W0XA 5B1AC 1Q86W 3CCMV 2PBHA 2QM7A 1KU9A 4B08A 1M5IA 5JZEA 3PSEA 4WA6A 4X20A 5EC2C 3GWKC 4DR4B 5CVOB 2GTSA 5J94A 3T4DA 2AW9A 4DUZO 4NXNB 3MP2A 2FYUH 3M8AA 2OCHA 4JI2O 2GHYA 3JAKA 2YIAA 3LDEA 1JMKC 1Y66A 1BCCH 2ZINA 2KQXA 2UXDB 2P7UA 1VQ9V 2QE7G 4BAYA 3ZHSA 6PADA 1EWOA 1TUEB 3W7TA 1PNLA 1SF9A 3S3WA 1CSBB 1CPJA 1VARA 2DZYA 5LMUB 1OCRB 4UB6Z 2XAQA 2OTJV 3HKBB 1JFFA 4LP8A 2BU3A 1Q6KA 1V9PA 2Y69B 5KA5A 3OGCC 3SYCA 3CD6V 4X62B 4X66O 5J9PC 1Y08A 5FPOA 4KHPB 3L9DA 2KSDA 4X20B 3HKEB 3KCXA 4RQFA 1OCRC 2R9OA 2DWDC 3UO2A 4ZI7A 2QTOA 1AU4A 4N21A 1N36O 4JTAB 5BXZA 1AROP 3LXSA 3CSXA 4DV3O 1PCIA 1S5LZ 3C0RA 1BL8A 2EIJB 4H0LB 3TMPA 3OF9A 4I05A 3N2KA 3P3NA 5C8YA 4MVUA 5FLXN 3PBHA 4FMTA 5EBWC 5IE9A 1VQ5V 1Q6IA 1MIRA 3JALA 1BY8A 1K92A 1G6UA 1SQFA 4PJ0Z 1JFFB 1ZTEA 4UCUA 4AXLA 5BR8B 1MOFA 2UXCB 2ADPA 3PNRA 4U3FH 4GUNA 4OPAA 1ZAUA 4LFCB 1K9MW 1LNQA 2CE4A 3BPZA 4ZI7B 2OWOA 4HZ3A 3ZNHA 3P30A 3ML0A 2YJ2A 2Q68A 4UV8A 2EZPA 4J7ZA 1MEMA 1X59A 1H2SB 2YI9A 4NTXA 5B1OA 1AIMA 2LW7A 3HD3A 5LMNB 2CTPA 5IWAO 1UKFA 4P6EA 3HPLC 3ABKB
chains in the Genus database with same CATH topology
2J7QC 4DR2O 4JI4O 3BBAA 3PRMA 3PT2A 3PRPA 4BOPA 2HWKA 3RNVA 4IP3A 1AB3A 4BOQA 4DR7O 2Z0AA 4DV4O 4DR5O 2ZKOA 2UXBO 1PVJA 3T1HO 4OPHA 3RT3C 4D8EA 1N34O 4OVZB 2F4VO 4JV5O 2DJVA 1HNZO 1DKIA 1KUQA 2BTWB 4AQYO 2BU3A 1XEQA 1IBKO 4A5UA 1R1BA 4MM3B 1G1XB 5IT9N 1DK1A 5BR8O 4JI3O 4LFBO 1YZBA 2DOSA 2UXCO 4X66O 2UU9O 3BB7A 2FKXA 3IFUA 5E6JA 2UUCO 3PHUA 1NS1A 4JI1O 4LFCO 1IBLO 4LF6O 3BY4A 4RKXA 2UZJA 4LF5O 1XMOO 4BOZA 1N33O 4DR3O 4MI7A 2UUAO 3TRKA 4XZXA 4RF1A 1N36O 3JAMN 4DR4O 5EZQA 3J81N 1F7YA 4B3TO 5BXZA 4NXMO 2ZM6O 2J7QA 1FYJA 4NXNO 3MTVA 4DV3O 1A32A 1XMQO 3T1YO 2Z84A 3W30A 3C0RA 1HNXO 4DV7O 3TMPA 3R66A 3OQCA 5LMNO 4X64O 4LFAO 3W31A 4LF9O 3J80N 5FLXN 1D2DA 5LL6Y 5A2QN 4JI8O 3PHXA 4BOUA 2UXDO 1FKAO 4IUMA 4R3DA 4JI7O 4OX9O 2AGAA 1HR0O 4YHHO 3PHWA 4B3MO 2VQEO 5LMUO 1XNRO 1FJGO 4X62O 4ZTBA 4DV5O 4DV1O 4A5UB 2FE8A 4RF0A 1J5EO 1I94O 4OVZA 4GKKO 4DR6O 1HNWO 1R6TA 1AILA 2BTWA 1IBMO 4RNAA 4BOSA 4DR1O 4OPAA 4WURA 4DUYO 4D8BA 4GKJO 4GUAA 4K0KO 5EZSA 4M0WA 3MJ5A 5JZEA 3OTOO 4KHPO 4JI6O 3PSEA 4P16A 3ZNHA 2E5LO 4LF8O 1XNQO 2JTCA 2JRIA 4OW0A 4B3SO 4REZA 4LF4O 4DUZO 1X59A 4DV2O 2HHHO 5H5NA 3MP2A 1N32O 3F5TA 2LW7A 4X65O 4PT5A 3J7AU 2VQFO 4JI5O 3B21A 4JI0O 4D8IA 3M8AA 4B3RO 4HXDB 4YY3O 3E9SA 3O65A 4JI2O 4LF7O 3SDLA 5IWAO 4JYAO 2N74A 1UKFA 5KO3A 4DV0O 2UUBO 5BY1A 4DV6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 O;  4JI4 O;  1AB3 A;  4DR7 O;  2Z0A A;  4DV4 O;  4DR5 O;  2ZKO A;  2UXB O;  3T1H O;  4OPH A;  3RT3 C;  1N34 O;  2F4V O;  4JV5 O;  2DJV A;  1HNZ O;  1KUQ A;  4AQY O;  1XEQ A;  1IBK O;  1R1B A;  1G1X B;  5IT9 N;  1DK1 A;  5BR8 O;  4JI3 O;  4LFB O;  1YZB A;  2DOS A;  2UXC O;  4X66 O;  2UU9 O;  2FKX A;  2UUC O;  1NS1 A;  4JI1 O;  4LFC O;  1IBL O;  4LF6 O;  4LF5 O;  1XMO O;  1N33 O;  4DR3 O;  2UUA O;  1N36 O;  3JAM N;  4DR4 O;  3J81 N;  1F7Y A;  4B3T O;  5BXZ A;  4NXM O;  2ZM6 O;  1FYJ A;  4NXN O;  4DV3 O;  1A32 A;  1XMQ O;  3T1Y O;  1HNX O;  4DV7 O;  3R66 A;  5LMN O;  4X64 O;  4LFA O;  4LF9 O;  3J80 N;  5FLX N;  1D2D A;  5LL6 Y;  5A2Q N;  4JI8 O;  2UXD O;  1FKA O;  4JI7 O;  4OX9 O;  2AGA A;  1HR0 O;  4YHH O;  4B3M O;  2VQE O;  5LMU O;  1XNR O;  1FJG O;  4X62 O;  4DV5 O;  4DV1 O;  4A5U B;  1J5E O;  1I94 O;  4GKK O;  4DR6 O;  1HNW O;  1R6T A;  1AIL A;  1IBM O;  4DR1 O;  4OPA A;  4DUY O;  4GKJ O;  4K0K O;  3OTO O;  4KHP O;  4JI6 O;  2E5L O;  4LF8 O;  1XNQ O;  2JRI A;  4B3S O;  4LF4 O;  4DUZ O;  1X59 A;  4DV2 O;  2HHH O;  5H5N A;  1N32 O;  3F5T A;  2LW7 A;  4X65 O;  3J7A U;  2VQF O;  4JI5 O;  4JI0 O;  3M8A A;  4B3R O;  4YY3 O;  3O65 A;  4JI2 O;  4LF7 O;  3SDL A;  5IWA O;  4JYA O;  2N74 A;  4DV0 O;  2UUB O;  5BY1 A;  4DV6 O; 
#chains in the Genus database with same CATH topology
 3ZJZ A;  1M90 W;  1PNK A;  1AYW A;  3JAL B;  2ZE8 A;  3RNV A;  2LQT A;  1HW7 A;  1GN4 A;  4DV1 B;  1RPR A;  4X65 B;  2JGU A;  2WA4 A;  4J7J A;  1N8R W;  2F4V O;  4J41 A;  1U96 A;  2IJI A;  1ZIV A;  2RJZ A;  3ABK C;  4ZBM A;  1N4C A;  3SPH A;  4GKJ B;  4GZR B;  3WU2 Z;  5L3D A;  4FM0 A;  2ZNI A;  3HHI A;  1OZ0 A;  3DXR B;  3BB7 A;  4JI6 B;  3DC6 A;  2NQG A;  4D7S A;  1H38 A;  1U9W A;  3HKD A;  3CRM A;  1XL6 A;  4N8W A;  4DR4 O;  2LFR A;  1FXK B;  4X1Y A;  4NXN O;  2EIL B;  1A32 A;  2ZE7 A;  4YIO A;  1SQP H;  4O2A B;  4AHC A;  3W30 A;  5CB4 A;  3G6E V;  1GKF A;  1BE3 H;  2UUB B;  3E83 A;  3OQC A;  3W7S A;  4HYO A;  1SER A;  1NR1 A;  3IC7 A;  4KL1 A;  1BSM A;  4MVM A;  4JI8 O;  3DF0 A;  1M6D A;  4MZS A;  3APQ A;  2FL4 A;  3K08 A;  4CH3 A;  2UXD O;  3CRR A;  5F2V O;  1FXK C;  2R9A A;  1SZT A;  2Q7H A;  4FFB B;  2EIL C;  4ZOL A;  1VF6 A;  5LMU O;  4I04 A;  1W2B U;  1P49 A;  4CS3 A;  2OZ2 A;  1VQ4 V;  4FM2 A;  1XHX A;  4JI3 B;  2E75 B;  2XND G;  2P90 A;  5EC1 C;  3ZMT A;  2CH7 B;  5L3G A;  2UUC B;  4D8B A;  1JCH A;  4KXR A;  3OMI B;  3MJ5 A;  4JYB A;  3HKD B;  4KHP O;  2UUA B;  4P16 A;  3I56 V;  3ZRV A;  2JRI A;  3CC4 V;  4NXM B;  3VOU A;  1SS3 A;  3CYO A;  1A6R A;  5CB4 B;  2HP8 A;  1F2A A;  1NT2 B;  4OGQ B;  4XBF A;  4MVR A;  2FRQ A;  1GH6 A;  2UXX A;  4H33 A;  3QJ3 A;  2YID A;  3OAA G;  2JIZ G;  4RO2 A;  2P86 A;  4OX9 B;  1S5H C;  2Z3Y A;  4QPJ A;  1QVF U;  4LF4 B;  1AB3 A;  2HHH B;  4PHZ A;  4DV5 B;  1K97 A;  3CRC A;  2YJ9 A;  1G8M A;  4D8E A;  4WFF A;  1H8E G;  1WB8 A;  1HUC B;  3H1J H;  1XEQ A;  3AG7 A;  3NXS A;  1ME4 A;  3OIS A;  3ZRS A;  4BWA A;  1K4D C;  5BR8 O;  2JDI G;  1M1K W;  1CQD A;  1VF6 C;  4BQV A;  3FYI B;  4K0K B;  1EN6 A;  2IBZ H;  5FPR A;  2UXC O;  3OD4 A;  4JI4 B;  2ETN A;  1EN4 A;  1F4N A;  1Y4H A;  3H6S A;  4H13 B;  4LFC O;  1XHZ A;  3O0U A;  3BC3 A;  4F6R B;  1XNQ B;  1AU3 A;  1VMG A;  3QF7 A;  3TRK A;  1HWY A;  1Q7Y W;  1VQ6 V;  3LUT B;  2NQA A;  4UV9 A;  2OUL A;  4JTD B;  3I3T A;  5B3S B;  3T4Z A;  1ZCM A;  1NLJ A;  1YF2 A;  4B3R B;  2HFE C;  1IDS A;  1UPG A;  3E35 A;  4CDD B;  3CCV V;  4DV7 O;  3MHH A;  1FFT B;  1GN6 A;  5LMN O;  3ZHV A;  1MZE A;  3RW0 A;  1R3J C;  3GB7 C;  4NTY A;  3D6S A;  5B3S C;  3O9O A;  4HWY A;  2A3Q A;  3PW3 A;  5EYP A;  3I06 A;  1ZL8 A;  5J2T A;  1I08 A;  3JD0 A;  1YK7 A;  5IYC O;  3BWK A;  2ZNJ A;  4DV1 O;  4JYC A;  1WJZ A;  1EZV H;  4PI2 A;  2XU5 A;  3H1K H;  4RF0 A;  1ATK A;  5CA3 A;  4YVA A;  1GM9 A;  4QGP A;  4WUR A;  4JI1 B;  4GKJ O;  3OEE G;  1F23 A;  1W59 A;  4M0W A;  4JI6 O;  5LHI A;  2RN9 A;  4EEQ A;  1Y6X A;  5EF4 A;  3G6B A;  2P6J A;  1K3B B;  1XMQ B;  4CH5 A;  1J95 A;  1S72 V;  1US6 A;  2UUB O;  5KLV H;  5EYP B;  3ABL C;  4CS2 A;  5J2T B;  2EIM B;  1Q81 W;  2F66 C;  5IJ9 A;  1F4M A;  3CPW U;  3MHH C;  4YYW A;  1SA0 B;  1M56 B;  3M99 B;  4X1I A;  1WP8 A;  1VQL V;  4ZUX U;  1NTM H;  4BIU A;  2EIM C;  4JI3 O;  5IJ0 B;  2ARH A;  5JQG A;  5BMV B;  4UCV A;  2UUC O;  1M56 C;  3LNM B;  1NKD A;  1MS6 A;  4FLY A;  3CMA V;  1AU0 A;  2UZJ A;  3H8B A;  4O2B A;  2UUA O;  5KA6 A;  1Q6H A;  3CCQ V;  1NI8 A;  2FYE A;  4NXM O;  2A06 H;  1XDC A;  4CH6 A;  3MOR A;  3F5W C;  1VQK V;  4JYA B;  2L35 A;  4DK0 A;  4CC5 A;  2OP3 A;  2ITD C;  3CXH F;  4TV9 B;  3J80 N;  4IT5 A;  5IJ9 B;  4DYL A;  4P2Z A;  4QNH B;  3JD4 A;  4YJ3 A;  1BZK A;  3UCS C;  1Z5W A;  4PA7 A;  1B6Q A;  3QNE A;  3BA9 A;  4DR7 B;  4OX9 O;  3DGE A;  2WPD G;  1EN5 A;  4X1I B;  2WA3 A;  3PJS K;  1R6K A;  1TA8 A;  4MTX A;  4DV5 O;  3OUF A;  2DCA A;  3L75 H;  5JQG B;  3FB6 C;  1BGY H;  2ZD9 A;  1NTK H;  2X0L A;  3B8M A;  1DF0 A;  4K0K O;  4O2B B;  1P84 F;  3VQV A;  4N79 A;  1FAF A;  3BPF A;  2E3C A;  2FO5 A;  1XNQ O;  3TGU H;  4Z1M G;  2P4K A;  4XDL A;  3KFQ A;  3ICX A;  2DCB A;  5B1N A;  4N23 A;  1KFX L;  3KG2 A;  3TNX A;  1RPO A;  4F4L A;  4B3R O;  4QJF B;  1THZ A;  4KP4 A;  4LBE C;  2XHB A;  2QWO B;  3H1L H;  4LF9 B;  3BCN A;  1NVP D;  4YJ3 B;  4KUM A;  1GM8 A;  4LWS A;  5JJJ B;  5LGN A;  4PP1 A;  4WF9 V;  2B1G A;  3E2E A;  2HWK A;  2Q4P A;  4CDC B;  1B06 A;  1EZJ A;  1ZX3 A;  2IH1 C;  4FPP A;  4Q20 A;  3STZ C;  3ZCC A;  1IWD A;  1XKG A;  2W6J G;  3RT3 C;  4HAM A;  1M9N A;  3USV A;  2ZT9 B;  3ZMU A;  9PAP A;  4L8J A;  1YAL A;  1T5E A;  4UCS A;  4JI1 O;  4QBB A;  2A9H A;  4FZ0 A;  4YIP A;  2D2C B;  4B3S B;  3I5D A;  1SET A;  4MZO A;  5EK0 A;  1XQ8 A;  3CXC U;  2J7Q A;  3JSN A;  5JH7 A;  1RSO A;  4IYI A;  1SES A;  2PGG A;  1YSC A;  1XMQ O;  4FIP A;  2PYL A;  3OR6 C;  2D3O W;  4LWS B;  2QWR B;  4CDF B;  2OT5 A;  5FNV B;  1ENV A;  3IV2 A;  4PEL A;  1PP9 H;  4TUY A;  1XRE A;  2JS3 A;  4FLZ A;  4W4U A;  4JYY A;  2R9I A;  5JCO C;  1HNZ B;  2FQ9 A;  5KUK A;  1CPY A;  4GLX A;  1GRJ A;  2CDY A;  4DW1 A;  1PPP A;  2B9Z A;  1JA8 A;  1K73 W;  2Y0I A;  4BS5 A;  4PAD A;  4DR3 B;  4I9Q A;  1KP2 A;  3JD2 A;  5TIS Z;  1KYO F;  1Y74 A;  3JCZ A;  5JH7 B;  4IIJ A;  1RSO B;  3OVZ A;  3QT4 A;  2YXY A;  2WLI A;  2ADQ B;  4G27 B;  2X6A A;  1WPB A;  3T1Y B;  1CB5 A;  2CGO A;  3K5M A;  3K8U A;  4PT5 A;  4TV8 A;  3RVW A;  4JI0 O;  1VQM V;  4X64 B;  3T1C A;  4JYA O;  3P5V A;  3HKB A;  2BOB C;  4QE9 A;  2Y6E A;  3N2G A;  5CBG A;  2J7Q C;  4G28 B;  3PN1 A;  3BOW A;  4DR2 O;  4GX0 A;  1COW G;  4FIP C;  4IP3 A;  3QO7 A;  2BSK A;  1S77 D;  3HKE A;  4DR7 O;  3WXF A;  1U9V A;  2DJV A;  2QM4 A;  3TCU A;  2V1D A;  1U97 A;  4A5U A;  1G1X B;  5IT9 N;  4DUY B;  3C9E A;  1KHQ A;  1QU7 A;  2JEX A;  4YYS A;  3OTO B;  2H7J A;  1FD9 A;  2HJD A;  1PKX A;  2E03 A;  3R65 A;  1Y74 B;  4IIJ B;  1N0J A;  2WLI B;  4RWU A;  1KMI Z;  1Q90 D;  3CP1 A;  5KAI Z;  3E8B A;  4ZHQ B;  1E1Q G;  4TV8 B;  3IJ4 A;  2R9C A;  4WFH A;  4O4L A;  4MW3 A;  3N2G B;  4YYV A;  1KP3 A;  5BZB A;  2AHY A;  4D6T H;  1EWM A;  4LF9 O;  1WAZ A;  2CUG A;  4BOU A;  1JJO A;  2Y4T A;  2BSK B;  3TK1 A;  3CRA A;  1FKA O;  4IUM A;  3ZHU A;  1NH2 D;  4P6G A;  4R3D A;  2AGA A;  2DWE C;  3ZX6 A;  4YYU A;  1YIT V;  3PHW A;  3RYF A;  2N04 A;  2NN4 A;  1QHT A;  3SGI A;  5EIB D;  4TQF A;  2AS8 A;  4A5U B;  4AQY B;  2Z5U A;  3UT5 B;  1AJN A;  3TET A;  1JQP A;  1THE A;  1ICF A;  2WWW A;  3P32 A;  2F95 B;  4I9W A;  2EX3 A;  3AG3 B;  5EZS A;  5B5E Z;  1AVM A;  1JR9 A;  1KD1 W;  3KX1 A;  3ZMS A;  3G67 A;  3IMA A;  1KXR A;  5CA1 A;  2C2A A;  3BAB A;  3ZHT A;  4B3S O;  3ZRW B;  3H01 A;  4O4L B;  3AG3 C;  1IZ3 A;  2VHS A;  3H9V A;  5KUM A;  2EJR A;  2YJC A;  1DEU A;  2N74 A;  3ERV A;  2QR4 A;  3OM3 B;  3UQ8 A;  3DXR A;  3RYF B;  1GTO A;  2W0F C;  3L70 H;  1CJL A;  4NKG B;  4OXS A;  3OMN B;  4UCR A;  1PVJ A;  4R8C A;  4UCT A;  2HKO A;  5DN6 G;  1XOU A;  1HNZ O;  1IXM A;  2P22 C;  4MTO A;  2ZE5 A;  3ASN B;  1AP6 A;  1FFX B;  3B09 A;  1FXK A;  4QPK A;  2YI8 A;  2QSA A;  5EGW A;  4AIL C;  4O2A A;  2UU9 O;  4IGG A;  3IFU A;  3PHU A;  1YTF D;  5CA1 B;  2CTW A;  1TVK A;  3STL C;  2H8P C;  4DR3 O;  1SZX A;  3ASN C;  2QA4 V;  1OCO B;  2YIC A;  1K4C C;  4K8Z A;  4EFE A;  4X8A A;  2ZDI C;  4FFB A;  1Y76 B;  3JAT A;  1MEG A;  3SYP A;  2GV9 A;  3T1Y O;  3LDC A;  2Z84 A;  2ITC C;  1OCC B;  4DV6 B;  1QOL A;  3FYE B;  4X64 O;  2YJB A;  3CB2 A;  1NB3 A;  3U8E A;  1OCO C;  4FK5 C;  2GUZ A;  3KZI Z;  5A2Q N;  1H2L A;  2Q73 A;  2CH7 A;  3QO5 A;  1L0L H;  4R6Z A;  5LYJ B;  2CB5 A;  4PI3 A;  1YI2 V;  2VWK A;  2JJ2 G;  4RUF A;  1KKD A;  4EKW A;  1OCC C;  2ZIM A;  4X6J A;  1R3I C;  3RYC B;  3S3R A;  3ZN1 A;  2LP7 A;  1SQB H;  5KHI A;  2DE0 X;  1QLN A;  2WLN A;  2QDO A;  1TU6 A;  3E1Z B;  4DUY O;  1TVK B;  5IYB O;  1IBL B;  1VQ8 V;  4FLV A;  2JS5 A;  3OTO O;  2XOK G;  1LUW A;  3K57 A;  4GT1 A;  4R7C A;  5LBQ A;  3FAV A;  1NQC A;  1YVW A;  4JAS A;  2BDL A;  3JAT B;  4J10 A;  1NB5 A;  1GK9 A;  3JAW A;  3F75 A;  1IX9 A;  4HNA A;  3B21 A;  5CVM A;  2ZE6 A;  2Q5Z A;  2GUZ B;  3AK1 A;  2F1M A;  4PDV A;  4X62 O;  4B7K A;  4WFB V;  5LXT B;  4JAU A;  3DTU B;  1YJW V;  5F02 A;  3SPJ A;  3BY6 A;  2XAF A;  2JQF R;  4BOP A;  4J42 A;  5K1X A;  1D5A A;  4B3M B;  1YDX A;  1S76 D;  1N32 B;  4TT3 G;  4F6R A;  1VQN V;  4IL6 Z;  1PPN A;  4OPH A;  2B1M A;  3O1G A;  1VIB A;  1R3K C;  1K5Q A;  2DJG B;  3ABM B;  4AQY O;  1SQG A;  3JAS B;  4R50 A;  1YZB A;  1EF7 A;  5E6J A;  5D5Q A;  1H2G A;  3FAV B;  2G6D A;  3D36 A;  3B79 A;  4DR5 B;  2AUX A;  3ABM C;  3CH2 X;  2DZZ A;  2NNU A;  3JAW B;  2KG7 A;  5L3B A;  1BQ0 A;  4XDJ A;  3L72 H;  3MAQ A;  5EZQ A;  4HNA B;  3RVX A;  1VF7 A;  2BTQ A;  4LF7 B;  1MZF A;  2L6L A;  3RFR A;  4E4E A;  5CN0 A;  1XIL A;  5LOV B;  5LGT A;  3UKM A;  3OF8 A;  3WXE A;  3AK2 A;  1GM7 A;  3WB1 A;  3CBJ A;  2AU1 A;  4PDM A;  2P5O A;  1N34 B;  2QKC A;  1U9X A;  3K0D A;  3KSE A;  3IC9 A;  3IAY A;  5A24 A;  1AEC A;  5LP6 C;  3E8F A;  5LHG A;  3B40 A;  5HFM A;  1KB9 F;  3ZED A;  1QDQ A;  2AUZ A;  4PV1 B;  1ORQ C;  1MSD A;  1YHQ V;  2KG7 B;  1PBH A;  4BIO A;  4L87 A;  4TOI A;  1WNS A;  4ZKI A;  4OW0 A;  2LGW A;  4W5B A;  2P67 A;  2ZM6 B;  2BTQ B;  3EHB B;  1B3Q A;  3L73 H;  2NQD B;  3VBB A;  1SA0 A;  4X65 O;  2FTK A;  1PXV A;  3D36 C;  2OTL V;  1SP4 B;  3M99 A;  4D8I A;  4HXD B;  2Q7E A;  3U0Z A;  5PAD A;  2E74 B;  3DC5 A;  5KHH A;  5GON A;  4O4H B;  4GCZ A;  3KKU A;  3AK3 A;  2WLH A;  4DV6 O;  4W5C A;  1R73 A;  5KX5 A;  1BS3 A;  5IJ0 A;  1Q82 W;  4JAV A;  1MG1 A;  4MTF A;  1M93 A;  5BMV A;  2E76 B;  1PE6 A;  2ZCE A;  2VQE B;  1FJG B;  1WLE A;  2G7Y A;  5IYD O;  1HDJ A;  4J80 A;  3H8C A;  1I5X A;  3ABL B;  4RQE A;  1I94 B;  2FUD A;  1HNW B;  1KUQ A;  1R6N A;  2V7Q G;  5H6R A;  2QKS A;  1NS1 A;  2HVJ C;  1IBL O;  3V6C A;  2DN9 A;  4UVA A;  1K33 A;  2E5L B;  4TV9 A;  1QNM A;  1WA8 A;  5LA6 A;  2DC7 A;  3JAM N;  1Y67 A;  3APO A;  2DQ0 A;  5GON B;  5IY5 B;  3G71 V;  5D5P A;  2ZQM A;  5KX5 B;  1VQ7 V;  1ZLZ A;  2DC9 A;  3BAA A;  3MD0 A;  1HP8 A;  4CC6 A;  3HHA A;  2LGQ A;  4PA9 A;  4UVB A;  2M6Y A;  1D2D A;  1XL4 A;  2G8E A;  4YV8 A;  1TUB A;  1ME3 A;  1R3L C;  1BP4 A;  1QCE A;  2UXB B;  3ETE A;  5IY5 C;  3SYQ A;  4B3M O;  5JVD A;  4BSQ A;  3KWB X;  2P4V A;  2EJ7 A;  3W7X A;  2DCC A;  4LFB B;  1DF5 A;  2BTW A;  2VWJ A;  2Q8V A;  4LNU A;  4GUA A;  3H7D A;  4MSW C;  1QQC A;  4Z2W A;  4LF5 B;  1QR8 A;  1S3J A;  1WA8 B;  2XAG A;  5LA6 B;  1BHA A;  1JX9 A;  2X7R B;  1MAB G;  4LH7 A;  3UO3 A;  3FKS G;  3F5V A;  4K7C A;  3K5N A;  3LFY A;  4B3T B;  1G4Y B;  4LF4 O;  4MSX A;  3JD1 A;  2HHH O;  4I5S A;  2VRZ A;  2NLJ C;  3HB3 B;  3C3S A;  3JCU Z;  1NU1 H;  1PD3 A;  3F7Y C;  1VSN A;  2AIM A;  3I55 V;  1AI5 A;  4DRX B;  4LF7 O;  2CTQ A;  1I0H A;  3MHS C;  4P9O A;  4UXN A;  1CP9 A;  4JPR A;  1E79 G;  4YXW G;  1PV0 A;  1MDW A;  3ZHQ A;  1TUB B;  2X6B A;  4JI4 O;  2QKA A;  1RM1 B;  1TLO A;  4JZ2 A;  3A0H Z;  5JVD B;  3K59 A;  1NR7 A;  2PZS A;  3MTN A;  3FB7 C;  5CA0 A;  1ROP A;  3TXS A;  1QR9 A;  3CJH A;  1QLE C;  2GBO A;  1N34 O;  2B1N A;  1J5E B;  1U5I A;  4CDE B;  1IXB A;  2BTW B;  2PYJ A;  1DGS A;  4LNU B;  5H2F Z;  1SRY A;  2RMK B;  3E22 B;  4DR1 B;  1DK1 A;  2R6N A;  4WBN A;  2A79 B;  1RM1 C;  5GW7 A;  1OCZ B;  3JD3 A;  3ZHR A;  5JCO A;  1TL9 A;  4YYQ A;  1W0J G;  1LR1 A;  1GO3 F;  1FPO A;  3MDS A;  2EIK B;  3CCS V;  3SR2 C;  4LC1 A;  5FNV A;  2QWN B;  2KKW A;  2PUS A;  4XZX A;  2RQ6 A;  1BHB A;  4LR3 A;  5ITZ B;  2ZM6 O;  2G8J A;  1OCZ C;  1QMY A;  2YUA A;  1H2K A;  3FB5 C;  3OR7 C;  3OMA B;  3N3K A;  1Q3E A;  4X66 B;  1JPX A;  2EIK C;  3K06 A;  2FML A;  3OFN G;  3LSQ A;  4Q8H A;  3K03 A;  3IHP A;  3ABT A;  2PI4 A;  3VQW A;  3BFR A;  2XAH A;  1ZWI C;  3RN4 A;  5CA0 B;  4FM1 A;  3CJH B;  3Q4H A;  2O6X A;  4F6E A;  2VQE O;  1FJG O;  1B04 A;  1YVB A;  4U7N A;  4XR7 A;  2FE8 A;  2W6I G;  4TSF G;  4MTG A;  4WBN B;  1I94 O;  1HNW O;  1NTZ H;  3CCJ V;  5GTH Z;  2PRE A;  1ZSP A;  1AU2 A;  3N3G A;  4X1K A;  4K35 A;  1NJI W;  3CX5 F;  2F23 A;  2XTA A;  5KHK A;  4X9Q A;  4PDL A;  1AYU A;  2JEU A;  3E89 A;  2E5L O;  3RVZ A;  5JA7 A;  2OIE A;  1UFI A;  2CAZ C;  2N05 A;  4DK1 A;  5B66 Z;  3QO8 A;  4Z1V A;  3C3T A;  2VS0 A;  5H5N A;  1H2M A;  5FPW A;  3F5T A;  3K9A A;  2WBF X;  2MW2 B;  1N0N A;  4H37 A;  2DC8 A;  3IGA C;  3A0R A;  2JJ1 G;  3CH3 X;  3NHE A;  4UUJ C;  2IPP B;  3BBA A;  2XUM A;  4JGS A;  4CZZ A;  3PT2 A;  1PPJ H;  3Q4H B;  3ETG A;  2AYO A;  2NQI A;  4FZ1 A;  1XBL A;  4YYR A;  2JVD A;  2UXB O;  2Q0O C;  1EWP A;  1DKI A;  1AP5 A;  3P5U A;  1IBM B;  2HVK C;  4ZHQ A;  1EM1 A;  4X1K B;  4LFB O;  1FH0 A;  2FKX A;  1K7D A;  3ZMZ A;  1GMY A;  2F1G A;  4PP2 E;  1PL4 A;  4LF5 O;  4FFK A;  3BPM A;  2ARY A;  4X6H A;  4UB8 Z;  5K1P A;  2ZR3 A;  4MT8 A;  1WN7 A;  2CGN A;  1JOY A;  4B3T O;  1KHP A;  4JI5 B;  1P4R A;  4MW8 A;  2VQF B;  1VQO V;  1XI1 A;  3B77 A;  2IW5 A;  1NQT A;  1Z5V A;  3K9S A;  1GCB A;  1Q5O A;  1NPZ A;  2EIN B;  3UT5 A;  5JWP A;  4J7K A;  4JTC B;  2DC6 A;  3NR7 A;  2R9N A;  3UM7 A;  2YIB A;  2JK5 C;  5B1B B;  3QSD A;  2LJ2 A;  4DV4 B;  3V6E A;  3K5O A;  2EIN C;  4GYC B;  3K3W A;  5EBL C;  5IDJ A;  3E8H A;  3D8C A;  1IBK B;  2RCV A;  1Q43 A;  3ZRW A;  1J5E O;  5H6Q A;  1MSW D;  5B1B C;  4JI8 B;  4DR1 O;  4X6I A;  3B2E E;  1F2B A;  3RVY A;  4QE7 A;  5IYZ A;  3E8G A;  1V55 B;  1XMO B;  4GX1 A;  2DJF B;  1K8A W;  1QBZ A;  3CRQ A;  2O57 A;  2GTA A;  4TQD A;  1YT7 A;  1P7B A;  5DM6 V;  2Q9L A;  4X89 A;  4FLT A;  4NTW A;  3TJT A;  1PAD A;  1W0K G;  3HKC B;  1OHH G;  1HNX B;  2KB1 A;  2YSU B;  1MNG A;  1AI6 A;  2AZ2 A;  1CEZ A;  1V55 C;  4LFA B;  3E9S A;  2HEP A;  2WLJ A;  1L0N H;  5BY1 A;  1FFX A;  4I07 A;  3LDD A;  4LH6 A;  2ZDI A;  1EBO A;  2IH3 C;  3JSL A;  2PTM A;  3EXA A;  3KKY A;  2QJ1 A;  2Y69 C;  3ZS8 C;  2IBI A;  3THO A;  4WFE A;  5JJE B;  2PY5 A;  4WFA V;  2WSS G;  2M7W A;  4GKK B;  4DR6 B;  4FK5 A;  3JAK B;  3E86 A;  4UFZ A;  4GX5 A;  1Y76 A;  5IYZ B;  1CV8 A;  1KFU L;  4LCU C;  3SPI A;  1PIP A;  1OJH A;  2QEX V;  3LNN A;  2DW4 A;  4LF8 B;  2GDS A;  2V4D A;  1GAX A;  3ETD A;  4XUI A;  2EIJ C;  3U10 A;  4RF1 A;  1NZ6 A;  2GHU A;  1F7Y A;  1YK8 A;  5LYJ A;  1QVG U;  3N4C A;  3ZBH A;  3FD9 A;  3HR0 A;  3CHX A;  4FJC A;  4EFB A;  2XAJ A;  4K3A A;  3RYC A;  1JVM A;  1NVP B;  1AJQ A;  1P7G A;  1XUQ A;  4J11 A;  2R9F A;  2CIO A;  5LGU A;  4QRV A;  1Z2G A;  1AI4 A;  2Q67 A;  1MHW A;  3B8N A;  3CC7 V;  1X4T A;  1TGO A;  4ICG A;  3QG5 A;  1AYV A;  2R9M A;  2YXL A;  4ZTB A;  1V54 B;  4WFG A;  1AR4 A;  3FFQ A;  4J9Z B;  3QVN A;  3N2K B;  4DV7 B;  1D5N A;  4BR6 A;  5C8Y B;  1IBM O;  1GEC E;  1YJN V;  4U3J A;  1VF5 B;  4LF6 B;  4W4K A;  2WLL A;  1BGO A;  1K34 A;  4O4I A;  5J2U A;  1V54 C;  5LXT A;  5CMU A;  1YIJ V;  1IVS A;  2BDZ A;  2JTC A;  4REZ A;  2Y0P A;  3ABU A;  4FLW A;  3K04 A;  3SYO A;  2K1E A;  4DMY A;  1S5J A;  4J9Y B;  3CWB H;  3WXG A;  2VQF O;  3JAR A;  4JI5 O;  2NR5 A;  4NVP A;  4EB6 A;  2OYQ A;  1YEW A;  5KO3 A;  1AI7 A;  1AR5 A;  3JAS A;  1AJP A;  1H8H G;  1I5Y A;  4FJC C;  3PRM A;  4MS2 A;  3A0B Z;  3L74 H;  1XNR B;  1K5S A;  4BOQ A;  1JJ2 U;  4DV4 O;  3OVX A;  1H2N A;  3VQX A;  2E02 A;  3FB8 C;  2DQ3 A;  2X6C A;  4YJ2 A;  1IUR A;  2YDE A;  5CBH A;  5GTI Z;  3S3X A;  1IBK O;  2OCC B;  3WB0 A;  4U3J B;  4D7T A;  5CHT A;  4PA4 A;  1CVZ A;  3T2M A;  1ITO A;  2IJH A;  2DOS A;  3D3Q A;  2WLL B;  5JJN B;  4O4I B;  3CE2 A;  1DTO A;  5J2U B;  4AXM A;  2G38 A;  1PPO A;  1FXH A;  3SJB C;  1GN2 A;  3BY4 A;  5LOV A;  4QIW F;  1F2C A;  4CH4 A;  1XMO O;  5L3E A;  2HH5 A;  4BOZ A;  2BCC H;  2PAD A;  3U11 A;  2IM9 A;  2DCD A;  2OCC C;  3W7W A;  5LP6 A;  1JQ0 A;  3OE7 G;  3JAR B;  2EBO A;  4EB6 B;  2XU1 A;  3SJQ C;  4ZIB A;  5CHV A;  4IHJ A;  5EBM C;  1HNX O;  2WLK A;  4OEM A;  3R66 A;  4LFA O;  3A8T A;  2AYN A;  4BW5 A;  1RFY A;  2YJ8 A;  3SPC A;  1BQZ A;  3K5L A;  2R9R B;  3AG4 B;  3W7U A;  4I4T A;  1PL0 A;  1Q6U A;  4QH6 A;  2BTO A;  1KC8 W;  4X1Y B;  2LW1 A;  4YJ2 B;  1Y4M A;  2WLM A;  2QWQ B;  3CME V;  3AG2 B;  3GWO A;  1CTE A;  4FVM A;  3ZIA G;  4PD4 F;  4GKK O;  4DR6 O;  2PNS A;  2Q69 A;  1AIL A;  2H94 A;  1VQP V;  3AG4 C;  2XT9 A;  1RP3 B;  4RNA A;  1TAE A;  4X88 A;  2BOC C;  2FRA A;  4IYH A;  4ZOL B;  4O4H A;  1N33 B;  3AG2 C;  5LP6 B;  1F29 A;  4LF8 O;  4P9P A;  2DYR B;  3OT7 A;  4IHJ B;  2LO1 A;  2YEV A;  3CEI A;  4NYK A;  4JAA A;  4PI0 A;  1L1F A;  2XU3 A;  1EFR G;  3IOQ A;  3CCU V;  4I4T B;  3BRC A;  4CS4 A;  1QXP A;  2FT2 A;  2RNB A;  3IEJ A;  4BS6 A;  5LHH A;  4JI7 B;  4RAI A;  2DYR C;  4P30 A;  1HR0 B;  1NH2 B;  2AZ0 A;  4Q6G A;  3WB2 A;  2QM8 A;  2QGN A;  2ZKO A;  2QWP B;  2ACT A;  2MK3 A;  2VHF A;  5A9G A;  4U7O A;  1R1B A;  7PCK A;  3BEH A;  2F43 G;  4HBN A;  3PDF A;  2ATO A;  4WCE V;  2CTR A;  2AHZ A;  1U9Q X;  3RYH A;  3X2Q B;  4LF6 O;  5EIB C;  2PI5 A;  2A7W A;  4RY2 A;  3EFF K;  3ASO B;  1CXZ B;  4NR1 A;  4DV2 B;  3RVV A;  3J81 N;  2YEV B;  4DXW A;  2HXZ A;  3AG1 B;  3AEI A;  4YY3 B;  1LUV A;  5KHJ A;  3X2Q C;  1KBH A;  2AVW A;  4DV0 B;  1PM9 A;  1BMF G;  3ASO C;  3K79 A;  1FS0 G;  3ZUA A;  3C90 A;  3TXQ A;  3AG1 C;  4I7Z B;  4C7U A;  4QRX A;  3T1H B;  4JV5 B;  1S4V A;  1XNR O;  3MHS A;  8PCH A;  2YC0 A;  2FTD A;  4OVZ A;  1R6T A;  3RWR D;  2EUL A;  4UVC A;  1SQV H;  3OEH G;  3K58 A;  2JGD A;  2R70 A;  3RYH B;  3KCY A;  4PA3 A;  4CBC A;  4DRX A;  4I50 A;  2BE3 A;  1ZL8 B;  1YTF B;  2XU4 A;  4G2K A;  4AI8 A;  1BT8 A;  1KEC A;  4MVZ A;  3SYA A;  3B4S A;  3ZN0 A;  1KQS U;  3ETQ A;  4DO2 A;  1N32 O;  4H44 B;  4I0X A;  3J7A U;  1NL6 A;  2P7T C;  3O65 A;  4ASU G;  5H9C A;  3CCR V;  1WPX A;  3D3I A;  4MI7 A;  1SC5 B;  2GFO A;  3E22 A;  1SQQ H;  1WB7 A;  5EZY A;  3PRP A;  1URF A;  4RUE A;  4JF3 A;  1GLO A;  4YHH B;  2HHN A;  2ILM A;  5L3F A;  3P5W A;  3OW2 U;  3HWN A;  2E00 A;  2Y5B A;  2ATK C;  4O4J A;  3K24 A;  1M57 B;  4DR5 O;  1ZUQ A;  4OVZ B;  3SJC C;  2WAM A;  4JI0 B;  2HR3 A;  4MVQ A;  2JGD B;  4MM3 B;  3CS5 A;  5ITZ A;  3DSQ A;  4W4L A;  3GCB A;  3WG7 B;  2PF4 E;  2GSM B;  4I50 B;  3WFV A;  1QLE B;  2CK3 G;  2HJF C;  3ZMV A;  2UXN A;  2YIB D;  4DR2 B;  3ZRX A;  3H1I H;  1SNK A;  1YJ9 V;  1M57 C;  1YXB A;  5HFL A;  3CCE V;  2QTS A;  1I7F A;  3P3P A;  1N33 O;  4TWK A;  4DUZ B;  4MVO A;  2ZXW B;  4I0X B;  1DLB A;  3KW9 A;  3WG7 C;  3N27 A;  1E1R G;  4BIZ A;  1FYJ A;  3MTV A;  2FB5 A;  1M4U A;  5KMG A;  3QTC A;  4JI2 B;  2YXH A;  5KAF Z;  2OIG A;  1BQI A;  4PA6 A;  5JH3 A;  3W31 A;  5EZY B;  3BVO A;  3CCL V;  2IU0 A;  2IJK A;  1YCI A;  3L71 H;  2ZXW C;  2YS8 A;  4OEL A;  4O4J B;  3VQY A;  4JI7 O;  1HR0 O;  2R72 A;  5AG2 A;  5DEC A;  1X9Y A;  1POP A;  4K8X A;  4CZW A;  2ZR2 A;  2F93 B;  4FLX A;  2HG5 C;  1K3E A;  3RBZ A;  3EVK A;  3P5X A;  3IUT A;  1NBM G;  1O9H A;  4QRG A;  2LFS A;  4BPV A;  4XDK A;  3RYI A;  2RDC A;  3K9M A;  5E1A C;  2B5U A;  3M7M X;  1UJW B;  3A2F A;  1N36 B;  4DW0 A;  4DV2 O;  5KMG B;  4I55 A;  4DV3 B;  1O0E A;  2HD5 A;  1GN3 A;  3OGI B;  4G54 A;  4YY3 O;  5KHG A;  3SDL A;  3BHP A;  1OV9 A;  3K0G A;  5FL7 G;  4DV0 O;  3AI8 A;  1PNM A;  4DMX A;  1KKC A;  4Q8G A;  2A0L A;  4B7E A;  3H1H H;  4BW9 A;  2JQG R;  5CBF A;  3GVM A;  5L3C A;  5K16 A;  3F7V C;  4N4Z A;  3G80 A;  2Z0A A;  2Q0A A;  3T1H O;  2IJJ A;  2C0Y A;  5C93 A;  3H89 A;  4JV5 O;  2AXT Z;  4NB5 A;  1MA1 A;  4PDR A;  2Y48 A;  3CBK A;  1DF4 A;  3OUS A;  3S3Q A;  1EWL A;  3G4S V;  3RYI B;  1PPD A;  3KWZ A;  4KLB A;  3JYC A;  4FLU A;  4RKX A;  2H3O A;  4I55 B;  2Q6A A;  1F51 A;  2F7D A;  2XAS A;  3FX7 A;  2ZIO A;  1VP7 A;  3RGB A;  2Y4U A;  2B1I A;  4E2L A;  5IWA B;  1O9G A;  1VEW A;  5E79 Z;  4GX2 A;  2UU9 B;  2P0R A;  1STF E;  3LSS A;  4ABM A;  2DYS B;  3OTF A;  1VJV A;  1Q8I A;  2HLD G;  4JZG A;  5LL6 Y;  3PHX A;  3CC2 V;  1CS8 A;  2K9P A;  3SPG A;  3SJA C;  3BA8 A;  4MVS A;  5B1A B;  2P06 A;  2Q7G A;  3IFX A;  4YHH O;  1MMM A;  5DED A;  2F4V B;  1L8D A;  2DYS C;  3LSU A;  1SKV A;  4UCO A;  1AR1 B;  1S0V A;  2ODM A;  4KFM A;  5CVN B;  2E01 A;  1SQX H;  2EZO A;  2IU3 A;  1FXV A;  3BCC H;  3HKC A;  4BOS A;  2DMX A;  4TUY B;  1GMG A;  1WP7 A;  2W0X A;  5B1A C;  1Q86 W;  3CCM V;  2PBH A;  2QM7 A;  1KU9 A;  4B08 A;  1M5I A;  5JZE A;  3PSE A;  4WA6 A;  4X20 A;  5EC2 C;  3GWK C;  4DR4 B;  5CVO B;  2GTS A;  5J94 A;  3T4D A;  2AW9 A;  4DUZ O;  4NXN B;  3MP2 A;  2FYU H;  3M8A A;  2OCH A;  4JI2 O;  2GHY A;  3JAK A;  2YIA A;  3LDE A;  1JMK C;  1Y66 A;  1BCC H;  2ZIN A;  2KQX A;  2UXD B;  2P7U A;  1VQ9 V;  2QE7 G;  4BAY A;  3ZHS A;  6PAD A;  1EWO A;  1TUE B;  3W7T A;  1PNL A;  1SF9 A;  3S3W A;  1CSB B;  1CPJ A;  1VAR A;  2DZY A;  5LMU B;  1OCR B;  4UB6 Z;  2XAQ A;  2OTJ V;  3HKB B;  1JFF A;  4LP8 A;  2BU3 A;  1Q6K A;  1V9P A;  2Y69 B;  5KA5 A;  3OGC C;  3SYC A;  3CD6 V;  4X62 B;  4X66 O;  5J9P C;  1Y08 A;  5FPO A;  4KHP B;  3L9D A;  2KSD A;  4X20 B;  3HKE B;  3KCX A;  4RQF A;  1OCR C;  2R9O A;  2DWD C;  3UO2 A;  4ZI7 A;  2QTO A;  1AU4 A;  4N21 A;  1N36 O;  4JTA B;  5BXZ A;  1ARO P;  3LXS A;  3CSX A;  4DV3 O;  1PCI A;  1S5L Z;  3C0R A;  1BL8 A;  2EIJ B;  4H0L B;  3TMP A;  3OF9 A;  4I05 A;  3N2K A;  3P3N A;  5C8Y A;  4MVU A;  5FLX N;  3PBH A;  4FMT A;  5EBW C;  5IE9 A;  1VQ5 V;  1Q6I A;  1MIR A;  3JAL A;  1BY8 A;  1K92 A;  1G6U A;  1SQF A;  4PJ0 Z;  1JFF B;  1ZTE A;  4UCU A;  4AXL A;  5BR8 B;  1MOF A;  2UXC B;  2ADP A;  3PNR A;  4U3F H;  4GUN A;  4OPA A;  1ZAU A;  4LFC B;  1K9M W;  1LNQ A;  2CE4 A;  3BPZ A;  4ZI7 B;  2OWO A;  4HZ3 A;  3ZNH A;  3P30 A;  3ML0 A;  2YJ2 A;  2Q68 A;  4UV8 A;  2EZP A;  4J7Z A;  1MEM A;  1X59 A;  1H2S B;  2YI9 A;  4NTX A;  5B1O A;  1AIM A;  2LW7 A;  3HD3 A;  5LMN B;  2CTP A;  5IWA O;  1UKF A;  4P6E A;  3HPL C;  3ABK B; 
#chains in the Genus database with same CATH homology
 2J7Q C;  4DR2 O;  4JI4 O;  3BBA A;  3PRM A;  3PT2 A;  3PRP A;  4BOP A;  2HWK A;  3RNV A;  4IP3 A;  1AB3 A;  4BOQ A;  4DR7 O;  2Z0A A;  4DV4 O;  4DR5 O;  2ZKO A;  2UXB O;  1PVJ A;  3T1H O;  4OPH A;  3RT3 C;  4D8E A;  1N34 O;  4OVZ B;  2F4V O;  4JV5 O;  2DJV A;  1HNZ O;  1DKI A;  1KUQ A;  2BTW B;  4AQY O;  2BU3 A;  1XEQ A;  1IBK O;  4A5U A;  1R1B A;  4MM3 B;  1G1X B;  5IT9 N;  1DK1 A;  5BR8 O;  4JI3 O;  4LFB O;  1YZB A;  2DOS A;  2UXC O;  4X66 O;  2UU9 O;  3BB7 A;  2FKX A;  3IFU A;  5E6J A;  2UUC O;  3PHU A;  1NS1 A;  4JI1 O;  4LFC O;  1IBL O;  4LF6 O;  3BY4 A;  4RKX A;  2UZJ A;  4LF5 O;  1XMO O;  4BOZ A;  1N33 O;  4DR3 O;  4MI7 A;  2UUA O;  3TRK A;  4XZX A;  4RF1 A;  1N36 O;  3JAM N;  4DR4 O;  5EZQ A;  3J81 N;  1F7Y A;  4B3T O;  5BXZ A;  4NXM O;  2ZM6 O;  2J7Q A;  1FYJ A;  4NXN O;  3MTV A;  4DV3 O;  1A32 A;  1XMQ O;  3T1Y O;  2Z84 A;  3W30 A;  3C0R A;  1HNX O;  4DV7 O;  3TMP A;  3R66 A;  3OQC A;  5LMN O;  4X64 O;  4LFA O;  3W31 A;  4LF9 O;  3J80 N;  5FLX N;  1D2D A;  5LL6 Y;  5A2Q N;  4JI8 O;  3PHX A;  4BOU A;  2UXD O;  1FKA O;  4IUM A;  4R3D A;  4JI7 O;  4OX9 O;  2AGA A;  1HR0 O;  4YHH O;  3PHW A;  4B3M O;  2VQE O;  5LMU O;  1XNR O;  1FJG O;  4X62 O;  4ZTB A;  4DV5 O;  4DV1 O;  4A5U B;  2FE8 A;  4RF0 A;  1J5E O;  1I94 O;  4OVZ A;  4GKK O;  4DR6 O;  1HNW O;  1R6T A;  1AIL A;  2BTW A;  1IBM O;  4RNA A;  4BOS A;  4DR1 O;  4OPA A;  4WUR A;  4DUY O;  4D8B A;  4GKJ O;  4GUA A;  4K0K O;  5EZS A;  4M0W A;  3MJ5 A;  5JZE A;  3OTO O;  4KHP O;  4JI6 O;  3PSE A;  4P16 A;  3ZNH A;  2E5L O;  4LF8 O;  1XNQ O;  2JTC A;  2JRI A;  4OW0 A;  4B3S O;  4REZ A;  4LF4 O;  4DUZ O;  1X59 A;  4DV2 O;  2HHH O;  5H5N A;  3MP2 A;  1N32 O;  3F5T A;  2LW7 A;  4X65 O;  4PT5 A;  3J7A U;  2VQF O;  4JI5 O;  3B21 A;  4JI0 O;  4D8I A;  3M8A A;  4B3R O;  4HXD B;  4YY3 O;  3E9S A;  3O65 A;  4JI2 O;  4LF7 O;  3SDL A;  5IWA O;  4JYA O;  2N74 A;  1UKF A;  5KO3 A;  4DV0 O;  2UUB O;  5BY1 A;  4DV6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...