2DCDA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca078 complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dcdA00
1FH0A 2NQGA 4I05A 4N4ZA 2FUDA 3P5WA 1ATKA 3I3TA 2GFOA 1PE6A 2R9OA 3O1GA 1S4VA 3V6CA 3DF0A 1IWDA 3B79A 1PPOA 2AUXA 2B1NA 2BDLA 5CHTA 3PBHA 2IBIA 2YJ8A 4Q8GA 2DZYA 4CDCB 1CV8A 1CQDA 4BS5A 1TU6A 3OF9A 3E1ZB 1CB5A 1CSBB 2E02A 3S3RA 3V6EA 2NQIA 2XU4A 4CZWA 2AYOA 3CBJA 4YVAA 4QRGA 3BCNA 1ITOA 1AU3A 1U9QX 4I07A 1EWMA 3KWBX 3RVWA 2YJBA 9PAPA 3PNRA 1O0EA 2FO5A 1GECE 4BSQA 4QH6A 1NB5A 3K24A 3PDFA 3CBKA 3LXSA 5PADA 2CB5A 2AS8A 4AXLA 2P86A 2WBFX 5A24A 2OULA 2OZ2A 1VJVA 1KHPA 1AYVA 2Y5BA 3HWNA 3OVXA 4W5BA 2AYNA 1KXRA 1BGOA 4ZUXU 1EWPA 4HWYA 1U9XA 1Q6KA 1U9VA 4YYSA 3HD3A 2H7JA 1AU4A 2G8EA 1CJLA 1SNKA 2ATOA 2DZZA 2JQGR 3QT4A 5EGWA 4P6GA 2Y6EA 2FT2A 1NPZA 2VHSA 2VHFA 1CPJA 1THEA 1Y4HA 3MHHA 2PBHA 2G8JA 2PREA 3GCBA 1NL6A 3F5VA 1ZIVA 4G54A 1PPPA 1SP4B 1CVZA 4WA6A 2HHNA 3MORA 4W5CA 4CDFB 1F2CA 3U8EA 3KWZA 1AYWA 2G7YA 1AIMA 1MDWA 3USVA 2E01A 2XU1A 1STFE 1XKGA 2DC8A 1YT7A 1QXPA 1CS8A 3ERVA 3LFYA 1KHQA 2DCAA 4BQVA 4CDEB 2NQAA 1KFUL 3C9EA 4DMYA 4PI3A 1M6DA 1MHWA 7PCKA 2ARYA 2FRQA 3WXEA 1ME3A 4PP2E 1ME4A 2XU5A 1NQCA 2G6DA 1BP4A 3ZUAA 3IUTA 1PADA 2YJ9A 2CIOA 3P5UA 3RVVA 2JQFR 1ZCMA 4Q8HA 1GLOA 3D6SA 3I06A 1NB3A 1GMYA 2AU1A 3AI8A 2E00A 2HD5A 2OP3A 2FYEA 2R9FA 3K8UA 1VSNA 2F1GA 3HHAA 4QBBA 1POPA 4W4UA 6PADA 2AUZA 2GHUA 4YYWA 3BWKA 1U5IA 3OVZA 4FIPA 1U9WA 3N4CA 5CVNB 5JH3A 1PBHA 3H89A 4X6HA 3MTNA 2P7UA 1QDQA 1DF0A 3S3QA 3NHEA 2HH5A 1EWOA 3BOWA 2R6NA 1AYUA 3PW3A 2AIMA 1HUCB 3KW9A 3P5XA 2BDZA 1GCBA 4K7CA 4KLBA 2YJCA 4I04A 1QMYA 5K16A 3KFQA 1YVBA 4MZSA 3RVXA 2DCDA 1CTEA 3HHIA 2O6XA 1AU2A 2R9MA 4X6JA 4YV8A 5CVOB 5CVMA 1EF7A 3BPMA 1NLJA 1YK7A 3O0UA 4YYUA 2DC7A 1EWLA 4QRVA 1BQIA 3H7DA 2XU3A 1KFXL 4CDDB 3M99A 1Y08A 5F02A 4QRXA 1A6RA 1PIPA 3CH3X 4BPVA 1TLOA 2NQDB 4RY2A 4XUIA 3K9MA 2DJGB 4N8WA 1MIRA 4BS6A 2P0RA 1AU0A 2FRAA 3WXGA 5J94A 4OEMA 2ACTA 1K3BB 4AXMA 1BY8A 3H6SA 2DJFB 4FJCA 4FK5A 1PPDA 1AECA 3OISA 3OF8A 1PCIA 3MHSA 3N3GA 3P5VA 2PNSA 3BPFA 2C0YA 4OELA 3QJ3A 3QSDA 4YYVA 2B1MA 2YJ2A 1MEMA 2DCBA 3H8CA 1TL9A 2IPPB 4P6EA 1PPNA 1F29A 2R9CA 4YYQA 4PADA 4MSXA 4DMXA 3IMAA 3N3KA 1X9YA 5FPWA 2R9NA 3KX1A 2FTDA 1ICFA 2DC9A 2E03A 2HXZA 3IOQA 1MS6A 1YK8A 3TNXA 2F7DA 2AVWA 4N79A 3IV2A 3CH2X 1MEGA 1QOLA 1JQPA 3KSEA 1DEUA 2PADA 2DCCA 3WXFA 5CHVA 3IHPA 3H8BA 4XR7A 1F2AA 3BC3A 8PCHA 2DC6A 3F75A 4MZOA 1PXVA 2FQ9A 1F2BA 5JA7A 5EF4A 1YALA 3IEJA 3KKUA 4PP1A 4X6IA 4YYRA
chains in the Genus database with same CATH superfamily
1FH0A 2NQGA 4I05A 4N4ZA 2FUDA 3P5WA 1ATKA 3I3TA 3TRKA 3PRMA 2GFOA 1PE6A 4BOUA 2R9OA 4OVZB 3O1GA 1S4VA 3V6CA 3DF0A 1IWDA 3MTVA 3B79A 1PPOA 2AUXA 2B1NA 2FE8A 2BDLA 4HXDB 2DOSA 5CHTA 3PBHA 2IBIA 2YJ8A 4Q8GA 2DZYA 4CDCB 1CV8A 1CQDA 4BS5A 1TU6A 3OF9A 4OVZA 3E1ZB 1CB5A 1CSBB 2E02A 3S3RA 3V6EA 2HWKA 2NQIA 2XU4A 4CZWA 2AYOA 3CBJA 4YVAA 4QRGA 4MM3B 3BCNA 4REZA 1ITOA 1AU3A 1U9QX 4I07A 1EWMA 3KWBX 4PT5A 3RVWA 2BTWB 2YJBA 3PSEA 9PAPA 3PNRA 3MP2A 1O0EA 2FO5A 1GECE 4ZTBA 4BSQA 4QH6A 1NB5A 3K24A 3PDFA 3CBKA 4RF0A 1DKIA 3LXSA 1PVJA 5PADA 3TMPA 2CB5A 2AS8A 3W31A 4AXLA 2P86A 2WBFX 5A24A 2OULA 2OZ2A 4OW0A 1VJVA 1KHPA 1AYVA 2Y5BA 3HWNA 3OVXA 4W5BA 2AYNA 1KXRA 1BGOA 4ZUXU 1EWPA 4HWYA 4RF1A 1U9XA 2J7QC 1Q6KA 1U9VA 4YYSA 3HD3A 2H7JA 1AU4A 2G8EA 1CJLA 1SNKA 2ATOA 2DZZA 2JQGR 3QT4A 5EGWA 4P6GA 2Y6EA 2FT2A 1NPZA 2UZJA 2VHSA 2VHFA 1CPJA 1THEA 1Y4HA 3MHHA 2PBHA 4BOSA 2G8JA 3O65A 2PREA 3GCBA 1NL6A 3F5VA 3PRPA 1ZIVA 4G54A 4A5UA 1PPPA 1SP4B 1CVZA 4WA6A 2HHNA 3MORA 3ZNHA 4W5CA 4CDFB 1F2CA 3PHXA 4IUMA 3U8EA 3RNVA 3KWZA 4BOQA 1AYWA 2G7YA 1AIMA 5EZSA 3PT2A 1MDWA 3USVA 2E01A 2XU1A 1STFE 1XKGA 2DC8A 1YT7A 1QXPA 4D8EA 1CS8A 3ERVA 3LFYA 4D8BA 1KHQA 2DCAA 4BQVA 4CDEB 2NQAA 1KFUL 2JTCA 3C9EA 4DMYA 3PHUA 3C0RA 4PI3A 1M6DA 1MHWA 7PCKA 2ARYA 2FRQA 3WXEA 5E6JA 1ME3A 2BU3A 4PP2E 1ME4A 2XU5A 1NQCA 2G6DA 1BP4A 4WURA 3IUTA 3ZUAA 1PADA 2YJ9A 2CIOA 3P5UA 3RVVA 2JQFR 1ZCMA 4Q8HA 1GLOA 3D6SA 3I06A 5KO3A 1NB3A 4RKXA 1GMYA 2AU1A 3AI8A 2E00A 2HD5A 2OP3A 2FYEA 2R9FA 3K8UA 1VSNA 2F1GA 3HHAA 4QBBA 1POPA 4W4UA 6PADA 2AUZA 2GHUA 4YYWA 3BWKA 1U5IA 3OVZA 4FIPA 3BBAA 1U9WA 3PHWA 3N4CA 5CVNB 5JH3A 1PBHA 3H89A 4X6HA 3BB7A 3MTNA 2P7UA 4IP3A 4XZXA 1QDQA 1DF0A 3S3QA 3NHEA 2HH5A 1EWOA 3BOWA 2R6NA 2Z84A 1AYUA 3PW3A 2AIMA 1HUCB 3KW9A 4D8IA 3P5XA 2BDZA 1GCBA 4K7CA 4KLBA 2YJCA 4I04A 1QMYA 5K16A 5EZQA 3KFQA 1YVBA 4MZSA 3RVXA 2DCDA 1CTEA 3HHIA 2O6XA 1AU2A 2R9MA 4X6JA 4YV8A 5CVOB 5CVMA 4MI7A 1EF7A 3BPMA 3B21A 5JZEA 1NLJA 1YK7A 3O0UA 4YYUA 2DC7A 1EWLA 4QRVA 1BQIA 3H7DA 2XU3A 1KFXL 4CDDB 3M99A 1Y08A 3W30A 5F02A 4QRXA 1A6RA 1PIPA 3CH3X 4BPVA 1TLOA 3BY4A 2NQDB 4RY2A 4XUIA 2JRIA 3K9MA 2DJGB 4N8WA 1MIRA 4BS6A 2P0RA 1AU0A 2FRAA 3WXGA 5J94A 4OEMA 2ACTA 1K3BB 4R3DA 1BY8A 3H6SA 4AXMA 2DJFB 4FJCA 4FK5A 1PPDA 4BOZA 1AECA 3OISA 3OF8A 4P16A 1PCIA 3MHSA 3N3GA 3P5VA 2PNSA 3BPFA 2AGAA 2C0YA 4OELA 3QJ3A 3QSDA 4YYVA 2B1MA 1UKFA 2YJ2A 1MEMA 2DCBA 3H8CA 1TL9A 2IPPB 4P6EA 1PPNA 1F29A 4GUAA 1YZBA 2R9CA 2J7QA 4YYQA 4PADA 3E9SA 4MSXA 2BTWA 4DMXA 3IMAA 3N3KA 1X9YA 5FPWA 2R9NA 3KX1A 2FTDA 1ICFA 2DC9A 2E03A 3MJ5A 3OQCA 2HXZA 3IOQA 1MS6A 1YK8A 3TNXA 2F7DA 4BOPA 2AVWA 4N79A 3IV2A 3CH2X 1MEGA 1QOLA 4RNAA 1JQPA 3KSEA 1DEUA 4M0WA 2PADA 2DCCA 3WXFA 5CHVA 3IHPA 3IFUA 3H8BA 4XR7A 1F2AA 3BC3A 8PCHA 2DC6A 3F75A 1PXVA 2FQ9A 1F2BA 4MZOA 5JA7A 5EF4A 1YALA 3IEJA 3KKUA 4PP1A 4X6IA 4YYRA
chains in the Genus database with same CATH topology
1FH0A 2NQGA 4I05A 4N4ZA 2FUDA 3P5WA 1ATKA 3I3TA 2GFOA 1PE6A 2R9OA 3O1GA 1S4VA 3V6CA 3DF0A 1IWDA 3B79A 1PPOA 2AUXA 2B1NA 2BDLA 1E2TA 5CHTA 3PBHA 2IBIA 2YJ8A 4Q8GA 2DZYA 4CDCB 1CV8A 1CQDA 4BS5A 1TU6A 3OF9A 3E1ZB 1CB5A 1CSBB 2E02A 3S3RA 3V6EA 2NQIA 2XU4A 4CZWA 2AYOA 3CBJA 4YVAA 4QRGA 3BCNA 1ITOA 1AU3A 1U9QX 4I07A 1EWMA 3KWBX 3RVWA 2YJBA 9PAPA 3PNRA 1O0EA 2FO5A 1GECE 4BSQA 4QH6A 1NB5A 3D9WA 3K24A 3PDFA 3CBKA 3LXSA 5PADA 2CB5A 2AS8A 4AXLA 2P86A 2WBFX 5A24A 2OULA 2OZ2A 1VJVA 1KHPA 1AYVA 2Y5BA 3HWNA 3OVXA 4W5BA 2AYNA 1KXRA 1BGOA 4ZUXU 1EWPA 4HWYA 1U9XA 1GX3A 1Q6KA 1U9VA 4YYSA 3HD3A 2H7JA 1AU4A 2G8EA 1CJLA 1SNKA 2ATOA 2DZZA 2JQGR 3QT4A 5EGWA 4P6GA 2Y6EA 2FT2A 1NPZA 2VHSA 2VHFA 1CPJA 1THEA 1Y4HA 3MHHA 2PBHA 2G8JA 2PREA 3GCBA 1NL6A 3F5VA 1ZIVA 4G54A 1PPPA 1SP4B 1CVZA 4WA6A 2HHNA 3MORA 4W5CA 4CDFB 1F2CA 3U8EA 3KWZA 1AYWA 2G7YA 1AIMA 1MDWA 3USVA 2E01A 2XU1A 1STFE 1XKGA 2DC8A 1YT7A 1QXPA 1CS8A 3ERVA 3LFYA 2BSZA 1KHQA 2DCAA 4BQVA 4CDEB 2NQAA 1KFUL 3C9EA 4DMYA 4PI3A 1M6DA 1MHWA 7PCKA 2ARYA 2FRQA 3WXEA 1ME3A 4PP2E 1ME4A 2XU5A 1NQCA 2G6DA 1BP4A 3ZUAA 3IUTA 1PADA 2YJ9A 2CIOA 3P5UA 3RVVA 2JQFR 1ZCMA 4Q8HA 1GLOA 3D6SA 3I06A 1NB3A 1GMYA 2AU1A 3AI8A 2E00A 2HD5A 4C5PA 2OP3A 2FYEA 2R9FA 3K8UA 1VSNA 2F1GA 3HHAA 4QBBA 1POPA 4W4UA 6PADA 2AUZA 2GHUA 4YYWA 3BWKA 1U5IA 3OVZA 4FIPA 1U9WA 3N4CA 5CVNB 5JH3A 1PBHA 3H89A 4X6HA 3MTNA 2P7UA 1QDQA 1DF0A 3S3QA 3NHEA 2HH5A 1EWOA 3BOWA 2R6NA 1AYUA 3PW3A 2AIMA 1HUCB 3KW9A 3P5XA 2BDZA 1GCBA 4K7CA 4KLBA 2YJCA 4I04A 1QMYA 5K16A 3KFQA 1YVBA 4MZSA 3RVXA 2DCDA 1CTEA 3HHIA 2O6XA 1AU2A 2R9MA 4X6JA 4YV8A 2VFCA 5CVOB 5CVMA 1EF7A 3BPMA 1NLJA 1YK7A 3O0UA 4YYUA 4B55A 2DC7A 1EWLA 4QRVA 1BQIA 3H7DA 2XU3A 1KFXL 4CDDB 3M99A 1Y08A 5F02A 4QRXA 4GUZA 1A6RA 1PIPA 3CH3X 4BPVA 1TLOA 2NQDB 4RY2A 4XUIA 3K9MA 2DJGB 4N8WA 1MIRA 4BS6A 2P0RA 1AU0A 2FRAA 4NV8A 3WXGA 5J94A 4NV7A 2ACTA 4OEMA 1K3BB 4AXMA 1BY8A 3H6SA 2DJFB 4FJCA 4FK5A 1PPDA 1AECA 3OISA 3OF8A 1PCIA 3MHSA 1W4TA 3N3GA 3P5VA 2PNSA 3BPFA 2C0YA 4OELA 3QJ3A 3QSDA 4YYVA 2B1MA 2YJ2A 1MEMA 2DCBA 3H8CA 1TL9A 2IPPB 3LTWA 4P6EA 1PPNA 1F29A 2R9CA 4YYQA 4PADA 2VFBA 4MSXA 4DMXA 3IMAA 3N3KA 1X9YA 5FPWA 2R9NA 3KX1A 2FTDA 1ICFA 2DC9A 2E03A 2HXZA 3IOQA 1MS6A 1YK8A 3TNXA 2F7DA 2AVWA 4N79A 3IV2A 3CH2X 1MEGA 1QOLA 1JQPA 3KSEA 1DEUA 2PADA 2DCCA 3WXFA 5CHVA 3IHPA 3H8BA 1W6FA 4XR7A 1F2AA 3BC3A 8PCHA 2DC6A 3F75A 1W5RA 4MZOA 1PXVA 2FQ9A 1F2BA 4BGFA 5JA7A 5EF4A 1YALA 3IEJA 3KKUA 4PP1A 4X6IA 4YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FH0 A;  2NQG A;  4I05 A;  4N4Z A;  2FUD A;  3P5W A;  1ATK A;  3I3T A;  2GFO A;  1PE6 A;  2R9O A;  3O1G A;  1S4V A;  3V6C A;  3DF0 A;  1IWD A;  3B79 A;  1PPO A;  2AUX A;  2B1N A;  2BDL A;  5CHT A;  3PBH A;  2IBI A;  2YJ8 A;  4Q8G A;  2DZY A;  4CDC B;  1CV8 A;  1CQD A;  4BS5 A;  1TU6 A;  3OF9 A;  3E1Z B;  1CB5 A;  1CSB B;  2E02 A;  3S3R A;  3V6E A;  2NQI A;  2XU4 A;  4CZW A;  2AYO A;  3CBJ A;  4YVA A;  4QRG A;  3BCN A;  1ITO A;  1AU3 A;  1U9Q X;  4I07 A;  1EWM A;  3KWB X;  3RVW A;  2YJB A;  9PAP A;  3PNR A;  1O0E A;  2FO5 A;  1GEC E;  4BSQ A;  4QH6 A;  1NB5 A;  3K24 A;  3PDF A;  3CBK A;  3LXS A;  5PAD A;  2CB5 A;  2AS8 A;  4AXL A;  2P86 A;  2WBF X;  5A24 A;  2OUL A;  2OZ2 A;  1VJV A;  1KHP A;  1AYV A;  2Y5B A;  3HWN A;  3OVX A;  4W5B A;  2AYN A;  1KXR A;  1BGO A;  4ZUX U;  1EWP A;  4HWY A;  1U9X A;  1Q6K A;  1U9V A;  4YYS A;  3HD3 A;  2H7J A;  1AU4 A;  2G8E A;  1CJL A;  1SNK A;  2ATO A;  2DZZ A;  2JQG R;  3QT4 A;  5EGW A;  4P6G A;  2Y6E A;  2FT2 A;  1NPZ A;  2VHS A;  2VHF A;  1CPJ A;  1THE A;  1Y4H A;  3MHH A;  2PBH A;  2G8J A;  2PRE A;  3GCB A;  1NL6 A;  3F5V A;  1ZIV A;  4G54 A;  1PPP A;  1SP4 B;  1CVZ A;  4WA6 A;  2HHN A;  3MOR A;  4W5C A;  4CDF B;  1F2C A;  3U8E A;  3KWZ A;  1AYW A;  2G7Y A;  1AIM A;  1MDW A;  3USV A;  2E01 A;  2XU1 A;  1STF E;  1XKG A;  2DC8 A;  1YT7 A;  1QXP A;  1CS8 A;  3ERV A;  3LFY A;  1KHQ A;  2DCA A;  4BQV A;  4CDE B;  2NQA A;  1KFU L;  3C9E A;  4DMY A;  4PI3 A;  1M6D A;  1MHW A;  7PCK A;  2ARY A;  2FRQ A;  3WXE A;  1ME3 A;  4PP2 E;  1ME4 A;  2XU5 A;  1NQC A;  2G6D A;  1BP4 A;  3ZUA A;  3IUT A;  1PAD A;  2YJ9 A;  2CIO A;  3P5U A;  3RVV A;  2JQF R;  1ZCM A;  4Q8H A;  1GLO A;  3D6S A;  3I06 A;  1NB3 A;  1GMY A;  2AU1 A;  3AI8 A;  2E00 A;  2HD5 A;  2OP3 A;  2FYE A;  2R9F A;  3K8U A;  1VSN A;  2F1G A;  3HHA A;  4QBB A;  1POP A;  4W4U A;  6PAD A;  2AUZ A;  2GHU A;  4YYW A;  3BWK A;  1U5I A;  3OVZ A;  4FIP A;  1U9W A;  3N4C A;  5CVN B;  5JH3 A;  1PBH A;  3H89 A;  4X6H A;  3MTN A;  2P7U A;  1QDQ A;  1DF0 A;  3S3Q A;  3NHE A;  2HH5 A;  1EWO A;  3BOW A;  2R6N A;  1AYU A;  3PW3 A;  2AIM A;  1HUC B;  3KW9 A;  3P5X A;  2BDZ A;  1GCB A;  4K7C A;  4KLB A;  2YJC A;  4I04 A;  1QMY A;  5K16 A;  3KFQ A;  1YVB A;  4MZS A;  3RVX A;  2DCD A;  1CTE A;  3HHI A;  2O6X A;  1AU2 A;  2R9M A;  4X6J A;  4YV8 A;  5CVO B;  5CVM A;  1EF7 A;  3BPM A;  1NLJ A;  1YK7 A;  3O0U A;  4YYU A;  2DC7 A;  1EWL A;  4QRV A;  1BQI A;  3H7D A;  2XU3 A;  1KFX L;  4CDD B;  3M99 A;  1Y08 A;  5F02 A;  4QRX A;  1A6R A;  1PIP A;  3CH3 X;  4BPV A;  1TLO A;  2NQD B;  4RY2 A;  4XUI A;  3K9M A;  2DJG B;  4N8W A;  1MIR A;  4BS6 A;  2P0R A;  1AU0 A;  2FRA A;  3WXG A;  5J94 A;  4OEM A;  2ACT A;  1K3B B;  4AXM A;  1BY8 A;  3H6S A;  2DJF B;  4FJC A;  4FK5 A;  1PPD A;  1AEC A;  3OIS A;  3OF8 A;  1PCI A;  3MHS A;  3N3G A;  3P5V A;  2PNS A;  3BPF A;  2C0Y A;  4OEL A;  3QJ3 A;  3QSD A;  4YYV A;  2B1M A;  2YJ2 A;  1MEM A;  2DCB A;  3H8C A;  1TL9 A;  2IPP B;  4P6E A;  1PPN A;  1F29 A;  2R9C A;  4YYQ A;  4PAD A;  4MSX A;  4DMX A;  3IMA A;  3N3K A;  1X9Y A;  5FPW A;  2R9N A;  3KX1 A;  2FTD A;  1ICF A;  2DC9 A;  2E03 A;  2HXZ A;  3IOQ A;  1MS6 A;  1YK8 A;  3TNX A;  2F7D A;  2AVW A;  4N79 A;  3IV2 A;  3CH2 X;  1MEG A;  1QOL A;  1JQP A;  3KSE A;  1DEU A;  2PAD A;  2DCC A;  3WXF A;  5CHV A;  3IHP A;  3H8B A;  4XR7 A;  1F2A A;  3BC3 A;  8PCH A;  2DC6 A;  3F75 A;  4MZO A;  1PXV A;  2FQ9 A;  1F2B A;  5JA7 A;  5EF4 A;  1YAL A;  3IEJ A;  3KKU A;  4PP1 A;  4X6I A;  4YYR A; 
#chains in the Genus database with same CATH topology
 1FH0 A;  2NQG A;  4I05 A;  4N4Z A;  2FUD A;  3P5W A;  1ATK A;  3I3T A;  3TRK A;  3PRM A;  2GFO A;  1PE6 A;  4BOU A;  2R9O A;  4OVZ B;  3O1G A;  1S4V A;  3V6C A;  3DF0 A;  1IWD A;  3MTV A;  3B79 A;  1PPO A;  2AUX A;  2B1N A;  2FE8 A;  2BDL A;  4HXD B;  2DOS A;  5CHT A;  3PBH A;  2IBI A;  2YJ8 A;  4Q8G A;  2DZY A;  4CDC B;  1CV8 A;  1CQD A;  4BS5 A;  1TU6 A;  3OF9 A;  4OVZ A;  3E1Z B;  1CB5 A;  1CSB B;  2E02 A;  3S3R A;  3V6E A;  2HWK A;  2NQI A;  2XU4 A;  4CZW A;  2AYO A;  3CBJ A;  4YVA A;  4QRG A;  4MM3 B;  3BCN A;  4REZ A;  1ITO A;  1AU3 A;  1U9Q X;  4I07 A;  1EWM A;  3KWB X;  4PT5 A;  3RVW A;  2BTW B;  2YJB A;  3PSE A;  9PAP A;  3PNR A;  3MP2 A;  1O0E A;  2FO5 A;  1GEC E;  4ZTB A;  4BSQ A;  4QH6 A;  1NB5 A;  3K24 A;  3PDF A;  3CBK A;  4RF0 A;  1DKI A;  3LXS A;  1PVJ A;  5PAD A;  3TMP A;  2CB5 A;  2AS8 A;  3W31 A;  4AXL A;  2P86 A;  2WBF X;  5A24 A;  2OUL A;  2OZ2 A;  4OW0 A;  1VJV A;  1KHP A;  1AYV A;  2Y5B A;  3HWN A;  3OVX A;  4W5B A;  2AYN A;  1KXR A;  1BGO A;  4ZUX U;  1EWP A;  4HWY A;  4RF1 A;  1U9X A;  2J7Q C;  1Q6K A;  1U9V A;  4YYS A;  3HD3 A;  2H7J A;  1AU4 A;  2G8E A;  1CJL A;  1SNK A;  2ATO A;  2DZZ A;  2JQG R;  3QT4 A;  5EGW A;  4P6G A;  2Y6E A;  2FT2 A;  1NPZ A;  2UZJ A;  2VHS A;  2VHF A;  1CPJ A;  1THE A;  1Y4H A;  3MHH A;  2PBH A;  4BOS A;  2G8J A;  3O65 A;  2PRE A;  3GCB A;  1NL6 A;  3F5V A;  3PRP A;  1ZIV A;  4G54 A;  4A5U A;  1PPP A;  1SP4 B;  1CVZ A;  4WA6 A;  2HHN A;  3MOR A;  3ZNH A;  4W5C A;  4CDF B;  1F2C A;  3PHX A;  4IUM A;  3U8E A;  3RNV A;  3KWZ A;  4BOQ A;  1AYW A;  2G7Y A;  1AIM A;  5EZS A;  3PT2 A;  1MDW A;  3USV A;  2E01 A;  2XU1 A;  1STF E;  1XKG A;  2DC8 A;  1YT7 A;  1QXP A;  4D8E A;  1CS8 A;  3ERV A;  3LFY A;  4D8B A;  1KHQ A;  2DCA A;  4BQV A;  4CDE B;  2NQA A;  1KFU L;  2JTC A;  3C9E A;  4DMY A;  3PHU A;  3C0R A;  4PI3 A;  1M6D A;  1MHW A;  7PCK A;  2ARY A;  2FRQ A;  3WXE A;  5E6J A;  1ME3 A;  2BU3 A;  4PP2 E;  1ME4 A;  2XU5 A;  1NQC A;  2G6D A;  1BP4 A;  4WUR A;  3IUT A;  3ZUA A;  1PAD A;  2YJ9 A;  2CIO A;  3P5U A;  3RVV A;  2JQF R;  1ZCM A;  4Q8H A;  1GLO A;  3D6S A;  3I06 A;  5KO3 A;  1NB3 A;  4RKX A;  1GMY A;  2AU1 A;  3AI8 A;  2E00 A;  2HD5 A;  2OP3 A;  2FYE A;  2R9F A;  3K8U A;  1VSN A;  2F1G A;  3HHA A;  4QBB A;  1POP A;  4W4U A;  6PAD A;  2AUZ A;  2GHU A;  4YYW A;  3BWK A;  1U5I A;  3OVZ A;  4FIP A;  3BBA A;  1U9W A;  3PHW A;  3N4C A;  5CVN B;  5JH3 A;  1PBH A;  3H89 A;  4X6H A;  3BB7 A;  3MTN A;  2P7U A;  4IP3 A;  4XZX A;  1QDQ A;  1DF0 A;  3S3Q A;  3NHE A;  2HH5 A;  1EWO A;  3BOW A;  2R6N A;  2Z84 A;  1AYU A;  3PW3 A;  2AIM A;  1HUC B;  3KW9 A;  4D8I A;  3P5X A;  2BDZ A;  1GCB A;  4K7C A;  4KLB A;  2YJC A;  4I04 A;  1QMY A;  5K16 A;  5EZQ A;  3KFQ A;  1YVB A;  4MZS A;  3RVX A;  2DCD A;  1CTE A;  3HHI A;  2O6X A;  1AU2 A;  2R9M A;  4X6J A;  4YV8 A;  5CVO B;  5CVM A;  4MI7 A;  1EF7 A;  3BPM A;  3B21 A;  5JZE A;  1NLJ A;  1YK7 A;  3O0U A;  4YYU A;  2DC7 A;  1EWL A;  4QRV A;  1BQI A;  3H7D A;  2XU3 A;  1KFX L;  4CDD B;  3M99 A;  1Y08 A;  3W30 A;  5F02 A;  4QRX A;  1A6R A;  1PIP A;  3CH3 X;  4BPV A;  1TLO A;  3BY4 A;  2NQD B;  4RY2 A;  4XUI A;  2JRI A;  3K9M A;  2DJG B;  4N8W A;  1MIR A;  4BS6 A;  2P0R A;  1AU0 A;  2FRA A;  3WXG A;  5J94 A;  4OEM A;  2ACT A;  1K3B B;  4R3D A;  1BY8 A;  3H6S A;  4AXM A;  2DJF B;  4FJC A;  4FK5 A;  1PPD A;  4BOZ A;  1AEC A;  3OIS A;  3OF8 A;  4P16 A;  1PCI A;  3MHS A;  3N3G A;  3P5V A;  2PNS A;  3BPF A;  2AGA A;  2C0Y A;  4OEL A;  3QJ3 A;  3QSD A;  4YYV A;  2B1M A;  1UKF A;  2YJ2 A;  1MEM A;  2DCB A;  3H8C A;  1TL9 A;  2IPP B;  4P6E A;  1PPN A;  1F29 A;  4GUA A;  1YZB A;  2R9C A;  2J7Q A;  4YYQ A;  4PAD A;  3E9S A;  4MSX A;  2BTW A;  4DMX A;  3IMA A;  3N3K A;  1X9Y A;  5FPW A;  2R9N A;  3KX1 A;  2FTD A;  1ICF A;  2DC9 A;  2E03 A;  3MJ5 A;  3OQC A;  2HXZ A;  3IOQ A;  1MS6 A;  1YK8 A;  3TNX A;  2F7D A;  4BOP A;  2AVW A;  4N79 A;  3IV2 A;  3CH2 X;  1MEG A;  1QOL A;  4RNA A;  1JQP A;  3KSE A;  1DEU A;  4M0W A;  2PAD A;  2DCC A;  3WXF A;  5CHV A;  3IHP A;  3IFU A;  3H8B A;  4XR7 A;  1F2A A;  3BC3 A;  8PCH A;  2DC6 A;  3F75 A;  1PXV A;  2FQ9 A;  1F2B A;  4MZO A;  5JA7 A;  5EF4 A;  1YAL A;  3IEJ A;  3KKU A;  4PP1 A;  4X6I A;  4YYR A; 
#chains in the Genus database with same CATH homology
 1FH0 A;  2NQG A;  4I05 A;  4N4Z A;  2FUD A;  3P5W A;  1ATK A;  3I3T A;  2GFO A;  1PE6 A;  2R9O A;  3O1G A;  1S4V A;  3V6C A;  3DF0 A;  1IWD A;  3B79 A;  1PPO A;  2AUX A;  2B1N A;  2BDL A;  1E2T A;  5CHT A;  3PBH A;  2IBI A;  2YJ8 A;  4Q8G A;  2DZY A;  4CDC B;  1CV8 A;  1CQD A;  4BS5 A;  1TU6 A;  3OF9 A;  3E1Z B;  1CB5 A;  1CSB B;  2E02 A;  3S3R A;  3V6E A;  2NQI A;  2XU4 A;  4CZW A;  2AYO A;  3CBJ A;  4YVA A;  4QRG A;  3BCN A;  1ITO A;  1AU3 A;  1U9Q X;  4I07 A;  1EWM A;  3KWB X;  3RVW A;  2YJB A;  9PAP A;  3PNR A;  1O0E A;  2FO5 A;  1GEC E;  4BSQ A;  4QH6 A;  1NB5 A;  3D9W A;  3K24 A;  3PDF A;  3CBK A;  3LXS A;  5PAD A;  2CB5 A;  2AS8 A;  4AXL A;  2P86 A;  2WBF X;  5A24 A;  2OUL A;  2OZ2 A;  1VJV A;  1KHP A;  1AYV A;  2Y5B A;  3HWN A;  3OVX A;  4W5B A;  2AYN A;  1KXR A;  1BGO A;  4ZUX U;  1EWP A;  4HWY A;  1U9X A;  1GX3 A;  1Q6K A;  1U9V A;  4YYS A;  3HD3 A;  2H7J A;  1AU4 A;  2G8E A;  1CJL A;  1SNK A;  2ATO A;  2DZZ A;  2JQG R;  3QT4 A;  5EGW A;  4P6G A;  2Y6E A;  2FT2 A;  1NPZ A;  2VHS A;  2VHF A;  1CPJ A;  1THE A;  1Y4H A;  3MHH A;  2PBH A;  2G8J A;  2PRE A;  3GCB A;  1NL6 A;  3F5V A;  1ZIV A;  4G54 A;  1PPP A;  1SP4 B;  1CVZ A;  4WA6 A;  2HHN A;  3MOR A;  4W5C A;  4CDF B;  1F2C A;  3U8E A;  3KWZ A;  1AYW A;  2G7Y A;  1AIM A;  1MDW A;  3USV A;  2E01 A;  2XU1 A;  1STF E;  1XKG A;  2DC8 A;  1YT7 A;  1QXP A;  1CS8 A;  3ERV A;  3LFY A;  2BSZ A;  1KHQ A;  2DCA A;  4BQV A;  4CDE B;  2NQA A;  1KFU L;  3C9E A;  4DMY A;  4PI3 A;  1M6D A;  1MHW A;  7PCK A;  2ARY A;  2FRQ A;  3WXE A;  1ME3 A;  4PP2 E;  1ME4 A;  2XU5 A;  1NQC A;  2G6D A;  1BP4 A;  3ZUA A;  3IUT A;  1PAD A;  2YJ9 A;  2CIO A;  3P5U A;  3RVV A;  2JQF R;  1ZCM A;  4Q8H A;  1GLO A;  3D6S A;  3I06 A;  1NB3 A;  1GMY A;  2AU1 A;  3AI8 A;  2E00 A;  2HD5 A;  4C5P A;  2OP3 A;  2FYE A;  2R9F A;  3K8U A;  1VSN A;  2F1G A;  3HHA A;  4QBB A;  1POP A;  4W4U A;  6PAD A;  2AUZ A;  2GHU A;  4YYW A;  3BWK A;  1U5I A;  3OVZ A;  4FIP A;  1U9W A;  3N4C A;  5CVN B;  5JH3 A;  1PBH A;  3H89 A;  4X6H A;  3MTN A;  2P7U A;  1QDQ A;  1DF0 A;  3S3Q A;  3NHE A;  2HH5 A;  1EWO A;  3BOW A;  2R6N A;  1AYU A;  3PW3 A;  2AIM A;  1HUC B;  3KW9 A;  3P5X A;  2BDZ A;  1GCB A;  4K7C A;  4KLB A;  2YJC A;  4I04 A;  1QMY A;  5K16 A;  3KFQ A;  1YVB A;  4MZS A;  3RVX A;  2DCD A;  1CTE A;  3HHI A;  2O6X A;  1AU2 A;  2R9M A;  4X6J A;  4YV8 A;  2VFC A;  5CVO B;  5CVM A;  1EF7 A;  3BPM A;  1NLJ A;  1YK7 A;  3O0U A;  4YYU A;  4B55 A;  2DC7 A;  1EWL A;  4QRV A;  1BQI A;  3H7D A;  2XU3 A;  1KFX L;  4CDD B;  3M99 A;  1Y08 A;  5F02 A;  4QRX A;  4GUZ A;  1A6R A;  1PIP A;  3CH3 X;  4BPV A;  1TLO A;  2NQD B;  4RY2 A;  4XUI A;  3K9M A;  2DJG B;  4N8W A;  1MIR A;  4BS6 A;  2P0R A;  1AU0 A;  2FRA A;  4NV8 A;  3WXG A;  5J94 A;  4NV7 A;  2ACT A;  4OEM A;  1K3B B;  4AXM A;  1BY8 A;  3H6S A;  2DJF B;  4FJC A;  4FK5 A;  1PPD A;  1AEC A;  3OIS A;  3OF8 A;  1PCI A;  3MHS A;  1W4T A;  3N3G A;  3P5V A;  2PNS A;  3BPF A;  2C0Y A;  4OEL A;  3QJ3 A;  3QSD A;  4YYV A;  2B1M A;  2YJ2 A;  1MEM A;  2DCB A;  3H8C A;  1TL9 A;  2IPP B;  3LTW A;  4P6E A;  1PPN A;  1F29 A;  2R9C A;  4YYQ A;  4PAD A;  2VFB A;  4MSX A;  4DMX A;  3IMA A;  3N3K A;  1X9Y A;  5FPW A;  2R9N A;  3KX1 A;  2FTD A;  1ICF A;  2DC9 A;  2E03 A;  2HXZ A;  3IOQ A;  1MS6 A;  1YK8 A;  3TNX A;  2F7D A;  2AVW A;  4N79 A;  3IV2 A;  3CH2 X;  1MEG A;  1QOL A;  1JQP A;  3KSE A;  1DEU A;  2PAD A;  2DCC A;  3WXF A;  5CHV A;  3IHP A;  3H8B A;  1W6F A;  4XR7 A;  1F2A A;  3BC3 A;  8PCH A;  2DC6 A;  3F75 A;  1W5R A;  4MZO A;  1PXV A;  2FQ9 A;  1F2B A;  4BGF A;  5JA7 A;  5EF4 A;  1YAL A;  3IEJ A;  3KKU A;  4PP1 A;  4X6I A;  4YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...