2DCDA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca078 complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
253
structure length
251
Chain Sequence
b'LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 76
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dcdA00
3IEJA 1VJVA 2DC7A 3CBKA 3WXEA 1FH0A 2DC8A 3K24A 4YYRA 2NQDB 2G6DA 2G8JA 1AYWA 2CIOA 2XU4A 3HD3A 4Q8GA 1YT7A 1ATKA 4CDCB 2YJBA 3MORA 1MS6A 3KKUA 3O0UA 2AU1A 4BS5A 4OEMA 4DMYA 4MSXA 1TLOA 3PW3A 1PPPA 2ATOA 3WXFA 3S3RA 1QXPA 2Y5BA 2R9CA 3P5XA 1MEGA 5CHVA 2FUDA 4CDFB 1BP4A 3K8UA 2PBHA 5A24A 4G54A 5CVMA 1F2BA 2PREA 1YK8A 3MTNA 4MZSA 1AU2A 4P6GA 3KW9A 1AU0A 1CQDA 2OZ2A 4ZUXU 1F2AA 1EWMA 3F75A 1MHWA 2HD5A 3QJ3A 3N4CA 1HUCB 3PNRA 1SP4B 2DJFB 1KHPA 5JH3A 5J94A 4YYVA 4WA6A 2YJ9A 2FQ9A 2E00A 3HWNA 1EWOA 4DMXA 1XKGA 2XU1A 1U9XA 4BPVA 1ZCMA 3PDFA 1ITOA 1ICFA 3OVZA 1PIPA 1U9WA 1EF7A 2AYOA 1AECA 6PADA 3E1ZB 5PADA 3IV2A 2DC6A 3D6SA 4YYUA 3RVWA 2JQGR 1CPJA 3MHSA 3USVA 1KHQA 2F7DA 1AYUA 1PPDA 4X6IA 3OF8A 4X6JA 4XUIA 2FRAA 1DEUA 1CJLA 3ZUAA 1NB3A 2DCCA 3B79A 4FIPA 3NHEA 4AXLA 1AIMA 5F02A 2DCBA 2GFOA 2BDZA 2DJGB 4P6EA 1GLOA 4AXMA 3IUTA 4W4UA 2R6NA 2R9NA 4QH6A 3QSDA 2NQGA 1CV8A 4BS6A 1EWLA 1STFE 1CB5A 2P7UA 1NQCA 4W5BA 1TU6A 2YJCA 4OELA 4PI3A 2VHSA 1CVZA 1BQIA 3CBJA 3AI8A 5CVNB 3N3KA 3PBHA 1NB5A 4N4ZA 4N79A 2OULA 3K9MA 3BOWA 3HHIA 9PAPA 2DC9A 3DF0A 3IOQA 1PXVA 1YALA 1AYVA 3KWZA 1ZIVA 4QRVA 2AYNA 1NPZA 5FPWA 1JQPA 3RVXA 4I05A 8PCHA 4K7CA 2PNSA 4YYWA 3LXSA 1PE6A 1KXRA 1BGOA 3IHPA 2P86A 1THEA 3MHHA 2E01A 2IBIA 2E02A 4QRGA 3V6EA 1BY8A 1PPNA 1Q6KA 1TL9A 1POPA 4MZOA 3H7DA 2R9FA 2PADA 3F5VA 2OP3A 3RVVA 2NQAA 1EWPA 3BCNA 2F1GA 3WXGA 3ERVA 1GCBA 2YJ8A 3O1GA 1IWDA 1Y08A 1O0EA 4N8WA 4CDDB 1S4VA 1MDWA 2HH5A 2FRQA 3KWBX 1PBHA 2VHFA 2FT2A 3S3QA 3QT4A 1GMYA 3BC3A 1CTEA 1PPOA 2ACTA 2O6XA 3N3GA 4YYSA 2GHUA 1K3BB 2DZYA 4HWYA 2BDLA 4BQVA 2DCAA 4KLBA 2NQIA 3H8CA 4QRXA 2AVWA 4W5CA 2P0RA 1GECE 1SNKA 5CHTA 2R9MA 2YJ2A 1AU4A 3LFYA 4RY2A 3C9EA 3H89A 3P5VA 4BSQA 2AS8A 2FTDA 2DZZA 3OVXA 5CVOB 2Y6EA 2B1NA 1F29A 1MEMA 2FO5A 3BPMA 3BWKA 1U5IA 2CB5A 3P5UA 1U9VA 1M6DA 1CS8A 4YYQA 3KX1A 1NL6A 1F2CA 2DCDA 1YVBA 1KFUL 2IPPB 1QDQA 3KSEA 4CZWA 4FJCA 1ME4A 4CDEB 2WBFX 2E03A 3IMAA 1A6RA 2HHNA 4I07A 2R9OA 2H7JA 3CH2X 1PCIA 2ARYA 3GCBA 7PCKA 2HXZA 4FK5A 1PADA 3OISA 4X6HA 2G8EA 3TNXA 3I3TA 5K16A 2XU5A 1VSNA 4YVAA 1QOLA 3CH3X 5EF4A 3I06A 3HHAA 3KFQA 1KFXL 1DF0A 3BPFA 2FYEA 4XR7A 3H8BA 2C0YA 3OF9A 1MIRA 2XU3A 1X9YA 3M99A 1QMYA 3P5WA 1NLJA 2B1MA 1AU3A 4I04A 1CSBB 2AIMA 1YK7A 4YV8A 1ME3A 2AUZA 2G7YA 2AUXA 3U8EA 4Q8HA 4PADA 4PP2E 5JA7A 1U9QX 3H6SA 1Y4HA 4QBBA 4PP1A 3V6CA 2JQFR 5EGWA
chains in the Genus database with same CATH superfamily
3IEJA 1VJVA 4BOUA 2DC7A 4RF0A 3CBKA 3WXEA 1FH0A 2DC8A 3K24A 4YYRA 2NQDB 2G6DA 2G8JA 1AYWA 2CIOA 3BB7A 2XU4A 3HD3A 4D8IA 4Q8GA 1YT7A 1ATKA 4CDCB 2YJBA 3MORA 1MS6A 3KKUA 3O0UA 2AU1A 4BS5A 2J7QA 4OEMA 4DMYA 4MSXA 1TLOA 3PW3A 1PPPA 2ATOA 3WXFA 3S3RA 1QXPA 2Y5BA 4PT5A 2R9CA 3PT2A 3P5XA 1MEGA 4MM3B 5CHVA 2FUDA 4CDFB 1BP4A 3K8UA 2PBHA 4GUAA 5A24A 2HWKA 4G54A 5CVMA 1F2BA 2JRIA 2PREA 3PHUA 1YK8A 3MTNA 4MZSA 4MI7A 1AU2A 4P6GA 3KW9A 3RNVA 1AU0A 1CQDA 2OZ2A 4ZUXU 1F2AA 2BTWB 1EWMA 3F75A 1MHWA 2HD5A 3QJ3A 3N4CA 1HUCB 3PNRA 1SP4B 2DJFB 1KHPA 5JH3A 5J94A 4REZA 4YYVA 4WA6A 2YJ9A 2FQ9A 2E00A 3HWNA 4IP3A 1EWOA 3PSEA 4DMXA 1XKGA 2XU1A 1U9XA 4BPVA 1ZCMA 3PDFA 1ITOA 3W31A 1ICFA 3OVZA 1PIPA 1U9WA 1EF7A 2AYOA 1AECA 6PADA 3E1ZB 5PADA 3IV2A 1PVJA 2DC6A 3D6SA 4YYUA 3RVWA 2JQGR 1CPJA 3MHSA 3USVA 1KHQA 3C0RA 2F7DA 4R3DA 1AYUA 1PPDA 4X6IA 3OF8A 4X6JA 4XUIA 2FRAA 1DEUA 1CJLA 3ZUAA 1NB3A 2DCCA 3B79A 4FIPA 3NHEA 4AXLA 1AIMA 4D8BA 2FE8A 5F02A 2DCBA 2GFOA 2BDZA 2DJGB 4M0WA 4P6EA 4HXDB 1GLOA 3PHWA 4AXMA 3IUTA 4W4UA 2R6NA 2R9NA 4QH6A 3QSDA 2NQGA 1CV8A 4BS6A 1EWLA 1STFE 4RNAA 1CB5A 2P7UA 1NQCA 4W5BA 1TU6A 2YJCA 4OELA 4PI3A 2VHSA 1CVZA 1BQIA 3CBJA 3AI8A 5CVNB 3N3KA 4OVZA 3PBHA 1NB5A 4BOPA 4N4ZA 4N79A 2OULA 3K9MA 3BOWA 3HHIA 4XZXA 9PAPA 2DC9A 3DF0A 5JZEA 3IOQA 1PXVA 2DOSA 1YALA 1AYVA 3KWZA 1ZIVA 4QRVA 2AYNA 1NPZA 5FPWA 1JQPA 3RVXA 4I05A 8PCHA 4K7CA 2PNSA 4YYWA 3W30A 2JTCA 3LXSA 1PE6A 3ZNHA 1KXRA 1BGOA 3IHPA 2P86A 1THEA 3MHHA 3IFUA 2E01A 2IBIA 3OQCA 2E02A 4QRGA 3V6EA 1BY8A 1PPNA 1Q6KA 1TL9A 2BU3A 1POPA 4MZOA 3H7DA 2R9FA 1DKIA 2PADA 3F5VA 4BOQA 2OP3A 3RVVA 2NQAA 1EWPA 4BOSA 3BCNA 2F1GA 4D8EA 4IUMA 3WXGA 3BY4A 3ERVA 1GCBA 2YJ8A 3MTVA 3O1GA 1IWDA 4RKXA 1Y08A 1O0EA 4N8WA 4CDDB 4OW0A 1S4VA 1MDWA 2HH5A 2FRQA 3B21A 3KWBX 5EZSA 1PBHA 2VHFA 2FT2A 3S3QA 3QT4A 1GMYA 3BC3A 1CTEA 1PPOA 2ACTA 2BTWA 2O6XA 3N3GA 4YYSA 2GHUA 1K3BB 2DZYA 4HWYA 2BDLA 4BQVA 2DCAA 4KLBA 2NQIA 3PHXA 3H8CA 4QRXA 2AVWA 4W5CA 2P0RA 3TMPA 1GECE 1SNKA 5CHTA 2R9MA 5E6JA 2YJ2A 1AU4A 3LFYA 4RY2A 3C9EA 3H89A 3P5VA 4BSQA 2AS8A 2FTDA 2DZZA 3OVXA 5CVOB 2Y6EA 2B1NA 1F29A 1MEMA 2FO5A 3BPMA 3BWKA 1U5IA 2CB5A 3P5UA 1U9VA 5EZQA 1M6DA 5KO3A 1CS8A 4P16A 4YYQA 3KX1A 1NL6A 1F2CA 2DCDA 1YVBA 1KFUL 2IPPB 1QDQA 3KSEA 3MP2A 4CZWA 4BOZA 4FJCA 1ME4A 4ZTBA 3PRMA 4CDEB 2WBFX 3E9SA 2E03A 3IMAA 1A6RA 2HHNA 4I07A 2R9OA 2H7JA 3CH2X 1PCIA 2ARYA 3GCBA 7PCKA 2HXZA 4FK5A 1PADA 3TRKA 2J7QC 3OISA 3MJ5A 4X6HA 2G8EA 3TNXA 3I3TA 5K16A 2UZJA 2XU5A 1VSNA 4YVAA 1QOLA 3CH3X 5EF4A 3I06A 3HHAA 3KFQA 1KFXL 4WURA 1DF0A 2AGAA 3BPFA 2FYEA 4XR7A 3H8BA 2C0YA 3OF9A 1MIRA 2XU3A 1X9YA 1YZBA 3M99A 1QMYA 3P5WA 1NLJA 2B1MA 1AU3A 3O65A 4I04A 1CSBB 2AIMA 1YK7A 4YV8A 1UKFA 1ME3A 2AUZA 2G7YA 2AUXA 3U8EA 4Q8HA 2Z84A 4PADA 4PP2E 5JA7A 1U9QX 3H6SA 3BBAA 4RF1A 1Y4HA 4QBBA 4OVZB 3PRPA 4PP1A 3V6CA 2JQFR 4A5UA 5EGWA
chains in the Genus database with same CATH topology
3IEJA 1VJVA 2DC7A 3CBKA 3WXEA 1FH0A 2DC8A 3K24A 4YYRA 2NQDB 2G6DA 2G8JA 1AYWA 2CIOA 2XU4A 3HD3A 4Q8GA 1YT7A 1ATKA 4CDCB 2YJBA 3MORA 1MS6A 3KKUA 3O0UA 2AU1A 4BS5A 4OEMA 4DMYA 4MSXA 1TLOA 3PW3A 1PPPA 2ATOA 3WXFA 3S3RA 1QXPA 2Y5BA 4GUZA 2R9CA 3P5XA 1MEGA 5CHVA 2FUDA 4CDFB 1BP4A 3K8UA 2PBHA 5A24A 1W5RA 4G54A 5CVMA 1F2BA 2PREA 1YK8A 3MTNA 4MZSA 1AU2A 4P6GA 3KW9A 1AU0A 1CQDA 2OZ2A 1GX3A 4ZUXU 1F2AA 1W4TA 1EWMA 3F75A 1MHWA 2HD5A 3QJ3A 3N4CA 1HUCB 3PNRA 1SP4B 2DJFB 1KHPA 5JH3A 5J94A 4YYVA 4WA6A 2YJ9A 2FQ9A 2E00A 3HWNA 1EWOA 4DMXA 1XKGA 2XU1A 1U9XA 4BPVA 1ZCMA 3PDFA 1ITOA 1ICFA 3OVZA 1PIPA 1U9WA 1EF7A 2AYOA 1W6FA 1AECA 6PADA 3E1ZB 5PADA 3IV2A 2DC6A 3D6SA 4YYUA 3RVWA 2JQGR 4B55A 1CPJA 3MHSA 3USVA 1KHQA 2F7DA 1AYUA 4NV7A 1PPDA 4X6IA 3OF8A 4X6JA 4XUIA 2FRAA 1DEUA 1CJLA 3ZUAA 1NB3A 2DCCA 3B79A 4FIPA 3NHEA 4AXLA 1AIMA 5F02A 2DCBA 2GFOA 2BDZA 2DJGB 4P6EA 1GLOA 4AXMA 3IUTA 4W4UA 2R6NA 1E2TA 2R9NA 4QH6A 3QSDA 2NQGA 1CV8A 4BS6A 1EWLA 1STFE 3D9WA 1CB5A 2P7UA 1NQCA 4W5BA 1TU6A 2YJCA 4OELA 4PI3A 2VHSA 4NV8A 1CVZA 1BQIA 3CBJA 3AI8A 5CVNB 3N3KA 3PBHA 1NB5A 4N4ZA 4N79A 2OULA 3K9MA 3BOWA 3HHIA 9PAPA 2DC9A 3DF0A 3IOQA 1PXVA 1YALA 1AYVA 3KWZA 1ZIVA 4QRVA 2AYNA 1NPZA 5FPWA 1JQPA 3RVXA 4I05A 8PCHA 4K7CA 2PNSA 4YYWA 3LXSA 1PE6A 1KXRA 1BGOA 3IHPA 2P86A 1THEA 3MHHA 2E01A 2IBIA 2E02A 4QRGA 3V6EA 1BY8A 1PPNA 1Q6KA 1TL9A 1POPA 4MZOA 3H7DA 2VFBA 2R9FA 2PADA 3F5VA 2OP3A 3RVVA 2NQAA 1EWPA 3BCNA 2F1GA 3WXGA 3ERVA 1GCBA 2YJ8A 3O1GA 1IWDA 1Y08A 1O0EA 4N8WA 4CDDB 1S4VA 1MDWA 2HH5A 2FRQA 3KWBX 1PBHA 2VHFA 2FT2A 3S3QA 3QT4A 1GMYA 3BC3A 4C5PA 1CTEA 1PPOA 2ACTA 2O6XA 3N3GA 4YYSA 2GHUA 1K3BB 2DZYA 4HWYA 2BDLA 4BQVA 2DCAA 4KLBA 2NQIA 2BSZA 3H8CA 4QRXA 2AVWA 4W5CA 2P0RA 1GECE 1SNKA 5CHTA 2R9MA 2YJ2A 1AU4A 3LFYA 4RY2A 3C9EA 3H89A 3P5VA 4BSQA 2AS8A 2FTDA 2DZZA 3OVXA 5CVOB 2Y6EA 2B1NA 1F29A 1MEMA 2FO5A 3BPMA 3BWKA 1U5IA 2CB5A 3P5UA 1U9VA 1M6DA 1CS8A 4YYQA 3KX1A 1NL6A 1F2CA 2DCDA 1YVBA 1KFUL 2IPPB 1QDQA 3KSEA 4CZWA 2VFCA 4FJCA 1ME4A 4CDEB 2WBFX 2E03A 3IMAA 1A6RA 2HHNA 4I07A 2R9OA 2H7JA 3CH2X 1PCIA 2ARYA 3GCBA 7PCKA 2HXZA 4FK5A 1PADA 3OISA 4X6HA 2G8EA 3TNXA 3I3TA 5K16A 2XU5A 1VSNA 4YVAA 1QOLA 3CH3X 5EF4A 3I06A 3HHAA 3KFQA 1KFXL 1DF0A 3BPFA 2FYEA 4XR7A 4BGFA 3H8BA 3LTWA 2C0YA 3OF9A 1MIRA 2XU3A 1X9YA 3M99A 1QMYA 3P5WA 1NLJA 2B1MA 1AU3A 4I04A 1CSBB 2AIMA 1YK7A 4YV8A 1ME3A 2AUZA 2G7YA 2AUXA 3U8EA 4Q8HA 4PADA 4PP2E 5JA7A 1U9QX 3H6SA 1Y4HA 4QBBA 4PP1A 3V6CA 2JQFR 5EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEJ A;  1VJV A;  2DC7 A;  3CBK A;  3WXE A;  1FH0 A;  2DC8 A;  3K24 A;  4YYR A;  2NQD B;  2G6D A;  2G8J A;  1AYW A;  2CIO A;  2XU4 A;  3HD3 A;  4Q8G A;  1YT7 A;  1ATK A;  4CDC B;  2YJB A;  3MOR A;  1MS6 A;  3KKU A;  3O0U A;  2AU1 A;  4BS5 A;  4OEM A;  4DMY A;  4MSX A;  1TLO A;  3PW3 A;  1PPP A;  2ATO A;  3WXF A;  3S3R A;  1QXP A;  2Y5B A;  2R9C A;  3P5X A;  1MEG A;  5CHV A;  2FUD A;  4CDF B;  1BP4 A;  3K8U A;  2PBH A;  5A24 A;  4G54 A;  5CVM A;  1F2B A;  2PRE A;  1YK8 A;  3MTN A;  4MZS A;  1AU2 A;  4P6G A;  3KW9 A;  1AU0 A;  1CQD A;  2OZ2 A;  4ZUX U;  1F2A A;  1EWM A;  3F75 A;  1MHW A;  2HD5 A;  3QJ3 A;  3N4C A;  1HUC B;  3PNR A;  1SP4 B;  2DJF B;  1KHP A;  5JH3 A;  5J94 A;  4YYV A;  4WA6 A;  2YJ9 A;  2FQ9 A;  2E00 A;  3HWN A;  1EWO A;  4DMX A;  1XKG A;  2XU1 A;  1U9X A;  4BPV A;  1ZCM A;  3PDF A;  1ITO A;  1ICF A;  3OVZ A;  1PIP A;  1U9W A;  1EF7 A;  2AYO A;  1AEC A;  6PAD A;  3E1Z B;  5PAD A;  3IV2 A;  2DC6 A;  3D6S A;  4YYU A;  3RVW A;  2JQG R;  1CPJ A;  3MHS A;  3USV A;  1KHQ A;  2F7D A;  1AYU A;  1PPD A;  4X6I A;  3OF8 A;  4X6J A;  4XUI A;  2FRA A;  1DEU A;  1CJL A;  3ZUA A;  1NB3 A;  2DCC A;  3B79 A;  4FIP A;  3NHE A;  4AXL A;  1AIM A;  5F02 A;  2DCB A;  2GFO A;  2BDZ A;  2DJG B;  4P6E A;  1GLO A;  4AXM A;  3IUT A;  4W4U A;  2R6N A;  2R9N A;  4QH6 A;  3QSD A;  2NQG A;  1CV8 A;  4BS6 A;  1EWL A;  1STF E;  1CB5 A;  2P7U A;  1NQC A;  4W5B A;  1TU6 A;  2YJC A;  4OEL A;  4PI3 A;  2VHS A;  1CVZ A;  1BQI A;  3CBJ A;  3AI8 A;  5CVN B;  3N3K A;  3PBH A;  1NB5 A;  4N4Z A;  4N79 A;  2OUL A;  3K9M A;  3BOW A;  3HHI A;  9PAP A;  2DC9 A;  3DF0 A;  3IOQ A;  1PXV A;  1YAL A;  1AYV A;  3KWZ A;  1ZIV A;  4QRV A;  2AYN A;  1NPZ A;  5FPW A;  1JQP A;  3RVX A;  4I05 A;  8PCH A;  4K7C A;  2PNS A;  4YYW A;  3LXS A;  1PE6 A;  1KXR A;  1BGO A;  3IHP A;  2P86 A;  1THE A;  3MHH A;  2E01 A;  2IBI A;  2E02 A;  4QRG A;  3V6E A;  1BY8 A;  1PPN A;  1Q6K A;  1TL9 A;  1POP A;  4MZO A;  3H7D A;  2R9F A;  2PAD A;  3F5V A;  2OP3 A;  3RVV A;  2NQA A;  1EWP A;  3BCN A;  2F1G A;  3WXG A;  3ERV A;  1GCB A;  2YJ8 A;  3O1G A;  1IWD A;  1Y08 A;  1O0E A;  4N8W A;  4CDD B;  1S4V A;  1MDW A;  2HH5 A;  2FRQ A;  3KWB X;  1PBH A;  2VHF A;  2FT2 A;  3S3Q A;  3QT4 A;  1GMY A;  3BC3 A;  1CTE A;  1PPO A;  2ACT A;  2O6X A;  3N3G A;  4YYS A;  2GHU A;  1K3B B;  2DZY A;  4HWY A;  2BDL A;  4BQV A;  2DCA A;  4KLB A;  2NQI A;  3H8C A;  4QRX A;  2AVW A;  4W5C A;  2P0R A;  1GEC E;  1SNK A;  5CHT A;  2R9M A;  2YJ2 A;  1AU4 A;  3LFY A;  4RY2 A;  3C9E A;  3H89 A;  3P5V A;  4BSQ A;  2AS8 A;  2FTD A;  2DZZ A;  3OVX A;  5CVO B;  2Y6E A;  2B1N A;  1F29 A;  1MEM A;  2FO5 A;  3BPM A;  3BWK A;  1U5I A;  2CB5 A;  3P5U A;  1U9V A;  1M6D A;  1CS8 A;  4YYQ A;  3KX1 A;  1NL6 A;  1F2C A;  2DCD A;  1YVB A;  1KFU L;  2IPP B;  1QDQ A;  3KSE A;  4CZW A;  4FJC A;  1ME4 A;  4CDE B;  2WBF X;  2E03 A;  3IMA A;  1A6R A;  2HHN A;  4I07 A;  2R9O A;  2H7J A;  3CH2 X;  1PCI A;  2ARY A;  3GCB A;  7PCK A;  2HXZ A;  4FK5 A;  1PAD A;  3OIS A;  4X6H A;  2G8E A;  3TNX A;  3I3T A;  5K16 A;  2XU5 A;  1VSN A;  4YVA A;  1QOL A;  3CH3 X;  5EF4 A;  3I06 A;  3HHA A;  3KFQ A;  1KFX L;  1DF0 A;  3BPF A;  2FYE A;  4XR7 A;  3H8B A;  2C0Y A;  3OF9 A;  1MIR A;  2XU3 A;  1X9Y A;  3M99 A;  1QMY A;  3P5W A;  1NLJ A;  2B1M A;  1AU3 A;  4I04 A;  1CSB B;  2AIM A;  1YK7 A;  4YV8 A;  1ME3 A;  2AUZ A;  2G7Y A;  2AUX A;  3U8E A;  4Q8H A;  4PAD A;  4PP2 E;  5JA7 A;  1U9Q X;  3H6S A;  1Y4H A;  4QBB A;  4PP1 A;  3V6C A;  2JQF R;  5EGW A; 
#chains in the Genus database with same CATH topology
 3IEJ A;  1VJV A;  4BOU A;  2DC7 A;  4RF0 A;  3CBK A;  3WXE A;  1FH0 A;  2DC8 A;  3K24 A;  4YYR A;  2NQD B;  2G6D A;  2G8J A;  1AYW A;  2CIO A;  3BB7 A;  2XU4 A;  3HD3 A;  4D8I A;  4Q8G A;  1YT7 A;  1ATK A;  4CDC B;  2YJB A;  3MOR A;  1MS6 A;  3KKU A;  3O0U A;  2AU1 A;  4BS5 A;  2J7Q A;  4OEM A;  4DMY A;  4MSX A;  1TLO A;  3PW3 A;  1PPP A;  2ATO A;  3WXF A;  3S3R A;  1QXP A;  2Y5B A;  4PT5 A;  2R9C A;  3PT2 A;  3P5X A;  1MEG A;  4MM3 B;  5CHV A;  2FUD A;  4CDF B;  1BP4 A;  3K8U A;  2PBH A;  4GUA A;  5A24 A;  2HWK A;  4G54 A;  5CVM A;  1F2B A;  2JRI A;  2PRE A;  3PHU A;  1YK8 A;  3MTN A;  4MZS A;  4MI7 A;  1AU2 A;  4P6G A;  3KW9 A;  3RNV A;  1AU0 A;  1CQD A;  2OZ2 A;  4ZUX U;  1F2A A;  2BTW B;  1EWM A;  3F75 A;  1MHW A;  2HD5 A;  3QJ3 A;  3N4C A;  1HUC B;  3PNR A;  1SP4 B;  2DJF B;  1KHP A;  5JH3 A;  5J94 A;  4REZ A;  4YYV A;  4WA6 A;  2YJ9 A;  2FQ9 A;  2E00 A;  3HWN A;  4IP3 A;  1EWO A;  3PSE A;  4DMX A;  1XKG A;  2XU1 A;  1U9X A;  4BPV A;  1ZCM A;  3PDF A;  1ITO A;  3W31 A;  1ICF A;  3OVZ A;  1PIP A;  1U9W A;  1EF7 A;  2AYO A;  1AEC A;  6PAD A;  3E1Z B;  5PAD A;  3IV2 A;  1PVJ A;  2DC6 A;  3D6S A;  4YYU A;  3RVW A;  2JQG R;  1CPJ A;  3MHS A;  3USV A;  1KHQ A;  3C0R A;  2F7D A;  4R3D A;  1AYU A;  1PPD A;  4X6I A;  3OF8 A;  4X6J A;  4XUI A;  2FRA A;  1DEU A;  1CJL A;  3ZUA A;  1NB3 A;  2DCC A;  3B79 A;  4FIP A;  3NHE A;  4AXL A;  1AIM A;  4D8B A;  2FE8 A;  5F02 A;  2DCB A;  2GFO A;  2BDZ A;  2DJG B;  4M0W A;  4P6E A;  4HXD B;  1GLO A;  3PHW A;  4AXM A;  3IUT A;  4W4U A;  2R6N A;  2R9N A;  4QH6 A;  3QSD A;  2NQG A;  1CV8 A;  4BS6 A;  1EWL A;  1STF E;  4RNA A;  1CB5 A;  2P7U A;  1NQC A;  4W5B A;  1TU6 A;  2YJC A;  4OEL A;  4PI3 A;  2VHS A;  1CVZ A;  1BQI A;  3CBJ A;  3AI8 A;  5CVN B;  3N3K A;  4OVZ A;  3PBH A;  1NB5 A;  4BOP A;  4N4Z A;  4N79 A;  2OUL A;  3K9M A;  3BOW A;  3HHI A;  4XZX A;  9PAP A;  2DC9 A;  3DF0 A;  5JZE A;  3IOQ A;  1PXV A;  2DOS A;  1YAL A;  1AYV A;  3KWZ A;  1ZIV A;  4QRV A;  2AYN A;  1NPZ A;  5FPW A;  1JQP A;  3RVX A;  4I05 A;  8PCH A;  4K7C A;  2PNS A;  4YYW A;  3W30 A;  2JTC A;  3LXS A;  1PE6 A;  3ZNH A;  1KXR A;  1BGO A;  3IHP A;  2P86 A;  1THE A;  3MHH A;  3IFU A;  2E01 A;  2IBI A;  3OQC A;  2E02 A;  4QRG A;  3V6E A;  1BY8 A;  1PPN A;  1Q6K A;  1TL9 A;  2BU3 A;  1POP A;  4MZO A;  3H7D A;  2R9F A;  1DKI A;  2PAD A;  3F5V A;  4BOQ A;  2OP3 A;  3RVV A;  2NQA A;  1EWP A;  4BOS A;  3BCN A;  2F1G A;  4D8E A;  4IUM A;  3WXG A;  3BY4 A;  3ERV A;  1GCB A;  2YJ8 A;  3MTV A;  3O1G A;  1IWD A;  4RKX A;  1Y08 A;  1O0E A;  4N8W A;  4CDD B;  4OW0 A;  1S4V A;  1MDW A;  2HH5 A;  2FRQ A;  3B21 A;  3KWB X;  5EZS A;  1PBH A;  2VHF A;  2FT2 A;  3S3Q A;  3QT4 A;  1GMY A;  3BC3 A;  1CTE A;  1PPO A;  2ACT A;  2BTW A;  2O6X A;  3N3G A;  4YYS A;  2GHU A;  1K3B B;  2DZY A;  4HWY A;  2BDL A;  4BQV A;  2DCA A;  4KLB A;  2NQI A;  3PHX A;  3H8C A;  4QRX A;  2AVW A;  4W5C A;  2P0R A;  3TMP A;  1GEC E;  1SNK A;  5CHT A;  2R9M A;  5E6J A;  2YJ2 A;  1AU4 A;  3LFY A;  4RY2 A;  3C9E A;  3H89 A;  3P5V A;  4BSQ A;  2AS8 A;  2FTD A;  2DZZ A;  3OVX A;  5CVO B;  2Y6E A;  2B1N A;  1F29 A;  1MEM A;  2FO5 A;  3BPM A;  3BWK A;  1U5I A;  2CB5 A;  3P5U A;  1U9V A;  5EZQ A;  1M6D A;  5KO3 A;  1CS8 A;  4P16 A;  4YYQ A;  3KX1 A;  1NL6 A;  1F2C A;  2DCD A;  1YVB A;  1KFU L;  2IPP B;  1QDQ A;  3KSE A;  3MP2 A;  4CZW A;  4BOZ A;  4FJC A;  1ME4 A;  4ZTB A;  3PRM A;  4CDE B;  2WBF X;  3E9S A;  2E03 A;  3IMA A;  1A6R A;  2HHN A;  4I07 A;  2R9O A;  2H7J A;  3CH2 X;  1PCI A;  2ARY A;  3GCB A;  7PCK A;  2HXZ A;  4FK5 A;  1PAD A;  3TRK A;  2J7Q C;  3OIS A;  3MJ5 A;  4X6H A;  2G8E A;  3TNX A;  3I3T A;  5K16 A;  2UZJ A;  2XU5 A;  1VSN A;  4YVA A;  1QOL A;  3CH3 X;  5EF4 A;  3I06 A;  3HHA A;  3KFQ A;  1KFX L;  4WUR A;  1DF0 A;  2AGA A;  3BPF A;  2FYE A;  4XR7 A;  3H8B A;  2C0Y A;  3OF9 A;  1MIR A;  2XU3 A;  1X9Y A;  1YZB A;  3M99 A;  1QMY A;  3P5W A;  1NLJ A;  2B1M A;  1AU3 A;  3O65 A;  4I04 A;  1CSB B;  2AIM A;  1YK7 A;  4YV8 A;  1UKF A;  1ME3 A;  2AUZ A;  2G7Y A;  2AUX A;  3U8E A;  4Q8H A;  2Z84 A;  4PAD A;  4PP2 E;  5JA7 A;  1U9Q X;  3H6S A;  3BBA A;  4RF1 A;  1Y4H A;  4QBB A;  4OVZ B;  3PRP A;  4PP1 A;  3V6C A;  2JQF R;  4A5U A;  5EGW A; 
#chains in the Genus database with same CATH homology
 3IEJ A;  1VJV A;  2DC7 A;  3CBK A;  3WXE A;  1FH0 A;  2DC8 A;  3K24 A;  4YYR A;  2NQD B;  2G6D A;  2G8J A;  1AYW A;  2CIO A;  2XU4 A;  3HD3 A;  4Q8G A;  1YT7 A;  1ATK A;  4CDC B;  2YJB A;  3MOR A;  1MS6 A;  3KKU A;  3O0U A;  2AU1 A;  4BS5 A;  4OEM A;  4DMY A;  4MSX A;  1TLO A;  3PW3 A;  1PPP A;  2ATO A;  3WXF A;  3S3R A;  1QXP A;  2Y5B A;  4GUZ A;  2R9C A;  3P5X A;  1MEG A;  5CHV A;  2FUD A;  4CDF B;  1BP4 A;  3K8U A;  2PBH A;  5A24 A;  1W5R A;  4G54 A;  5CVM A;  1F2B A;  2PRE A;  1YK8 A;  3MTN A;  4MZS A;  1AU2 A;  4P6G A;  3KW9 A;  1AU0 A;  1CQD A;  2OZ2 A;  1GX3 A;  4ZUX U;  1F2A A;  1W4T A;  1EWM A;  3F75 A;  1MHW A;  2HD5 A;  3QJ3 A;  3N4C A;  1HUC B;  3PNR A;  1SP4 B;  2DJF B;  1KHP A;  5JH3 A;  5J94 A;  4YYV A;  4WA6 A;  2YJ9 A;  2FQ9 A;  2E00 A;  3HWN A;  1EWO A;  4DMX A;  1XKG A;  2XU1 A;  1U9X A;  4BPV A;  1ZCM A;  3PDF A;  1ITO A;  1ICF A;  3OVZ A;  1PIP A;  1U9W A;  1EF7 A;  2AYO A;  1W6F A;  1AEC A;  6PAD A;  3E1Z B;  5PAD A;  3IV2 A;  2DC6 A;  3D6S A;  4YYU A;  3RVW A;  2JQG R;  4B55 A;  1CPJ A;  3MHS A;  3USV A;  1KHQ A;  2F7D A;  1AYU A;  4NV7 A;  1PPD A;  4X6I A;  3OF8 A;  4X6J A;  4XUI A;  2FRA A;  1DEU A;  1CJL A;  3ZUA A;  1NB3 A;  2DCC A;  3B79 A;  4FIP A;  3NHE A;  4AXL A;  1AIM A;  5F02 A;  2DCB A;  2GFO A;  2BDZ A;  2DJG B;  4P6E A;  1GLO A;  4AXM A;  3IUT A;  4W4U A;  2R6N A;  1E2T A;  2R9N A;  4QH6 A;  3QSD A;  2NQG A;  1CV8 A;  4BS6 A;  1EWL A;  1STF E;  3D9W A;  1CB5 A;  2P7U A;  1NQC A;  4W5B A;  1TU6 A;  2YJC A;  4OEL A;  4PI3 A;  2VHS A;  4NV8 A;  1CVZ A;  1BQI A;  3CBJ A;  3AI8 A;  5CVN B;  3N3K A;  3PBH A;  1NB5 A;  4N4Z A;  4N79 A;  2OUL A;  3K9M A;  3BOW A;  3HHI A;  9PAP A;  2DC9 A;  3DF0 A;  3IOQ A;  1PXV A;  1YAL A;  1AYV A;  3KWZ A;  1ZIV A;  4QRV A;  2AYN A;  1NPZ A;  5FPW A;  1JQP A;  3RVX A;  4I05 A;  8PCH A;  4K7C A;  2PNS A;  4YYW A;  3LXS A;  1PE6 A;  1KXR A;  1BGO A;  3IHP A;  2P86 A;  1THE A;  3MHH A;  2E01 A;  2IBI A;  2E02 A;  4QRG A;  3V6E A;  1BY8 A;  1PPN A;  1Q6K A;  1TL9 A;  1POP A;  4MZO A;  3H7D A;  2VFB A;  2R9F A;  2PAD A;  3F5V A;  2OP3 A;  3RVV A;  2NQA A;  1EWP A;  3BCN A;  2F1G A;  3WXG A;  3ERV A;  1GCB A;  2YJ8 A;  3O1G A;  1IWD A;  1Y08 A;  1O0E A;  4N8W A;  4CDD B;  1S4V A;  1MDW A;  2HH5 A;  2FRQ A;  3KWB X;  1PBH A;  2VHF A;  2FT2 A;  3S3Q A;  3QT4 A;  1GMY A;  3BC3 A;  4C5P A;  1CTE A;  1PPO A;  2ACT A;  2O6X A;  3N3G A;  4YYS A;  2GHU A;  1K3B B;  2DZY A;  4HWY A;  2BDL A;  4BQV A;  2DCA A;  4KLB A;  2NQI A;  2BSZ A;  3H8C A;  4QRX A;  2AVW A;  4W5C A;  2P0R A;  1GEC E;  1SNK A;  5CHT A;  2R9M A;  2YJ2 A;  1AU4 A;  3LFY A;  4RY2 A;  3C9E A;  3H89 A;  3P5V A;  4BSQ A;  2AS8 A;  2FTD A;  2DZZ A;  3OVX A;  5CVO B;  2Y6E A;  2B1N A;  1F29 A;  1MEM A;  2FO5 A;  3BPM A;  3BWK A;  1U5I A;  2CB5 A;  3P5U A;  1U9V A;  1M6D A;  1CS8 A;  4YYQ A;  3KX1 A;  1NL6 A;  1F2C A;  2DCD A;  1YVB A;  1KFU L;  2IPP B;  1QDQ A;  3KSE A;  4CZW A;  2VFC A;  4FJC A;  1ME4 A;  4CDE B;  2WBF X;  2E03 A;  3IMA A;  1A6R A;  2HHN A;  4I07 A;  2R9O A;  2H7J A;  3CH2 X;  1PCI A;  2ARY A;  3GCB A;  7PCK A;  2HXZ A;  4FK5 A;  1PAD A;  3OIS A;  4X6H A;  2G8E A;  3TNX A;  3I3T A;  5K16 A;  2XU5 A;  1VSN A;  4YVA A;  1QOL A;  3CH3 X;  5EF4 A;  3I06 A;  3HHA A;  3KFQ A;  1KFX L;  1DF0 A;  3BPF A;  2FYE A;  4XR7 A;  4BGF A;  3H8B A;  3LTW A;  2C0Y A;  3OF9 A;  1MIR A;  2XU3 A;  1X9Y A;  3M99 A;  1QMY A;  3P5W A;  1NLJ A;  2B1M A;  1AU3 A;  4I04 A;  1CSB B;  2AIM A;  1YK7 A;  4YV8 A;  1ME3 A;  2AUZ A;  2G7Y A;  2AUX A;  3U8E A;  4Q8H A;  4PAD A;  4PP2 E;  5JA7 A;  1U9Q X;  3H6S A;  1Y4H A;  4QBB A;  4PP1 A;  3V6C A;  2JQF R;  5EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...