1F2AA

Crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (ii)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRUZAIN
molecule tags Hydrolase
source organism Trypanosoma cruzi
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2aA00
1BQIA 3P5WA 1VJVA 1F2BA 1DEUA 3WXEA 3RVVA 2DCBA 3F5VA 3BWKA 3H6SA 1TU6A 4P6EA 5EF4A 4YYWA 1NB3A 2NQGA 4QH6A 2ARYA 2R9OA 2IPPB 2HD5A 3U8EA 2NQIA 1EF7A 2OP3A 1HUCB 2DCDA 1ITOA 3WXGA 1AYWA 2HXZA 2AU1A 3IUTA 5JA7A 3OF9A 1PIPA 1NB5A 1MIRA 1FH0A 1QDQA 4PADA 3MHSA 4Q8GA 1MHWA 1U9WA 1TL9A 3MHHA 1SP4B 4BPVA 1YK7A 4I05A 3NHEA 3HD3A 1GMYA 3E1ZB 4Q8HA 2ACTA 1CVZA 3ZUAA 3WXFA 1EWOA 1SNKA 2R6NA 1POPA 2FQ9A 3CBKA 9PAPA 4G54A 2O6XA 1CTEA 2CB5A 2HH5A 3IMAA 2PREA 3PDFA 2R9NA 4MZSA 1AU4A 2PBHA 2HHNA 2AVWA 1PCIA 2XU3A 4RY2A 5K16A 5CHTA 5EGWA 3I06A 3CH3X 1QOLA 4AXLA 1AYVA 4N8WA 2R9MA 3P5XA 1PADA 4CZWA 1CB5A 4X6HA 4I04A 4FIPA 1PBHA 3H7DA 3IHPA 1PXVA 3C9EA 3K8UA 1Y08A 2WBFX 1A6RA 4YYRA 1NQCA 3OF8A 1BY8A 1KFXL 1ME4A 5PADA 1S4VA 3LXSA 2E01A 2YJ2A 4YYSA 4XR7A 2FYEA 1ZCMA 1NPZA 3CH2X 3M99A 4YYQA 1QXPA 3H8CA 2C0YA 1EWPA 2G8EA 1EWLA 3HHIA 2VHFA 2NQDB 1YVBA 2DC7A 4YV8A 1STFE 2AYOA 3USVA 1AECA 3OVZA 3AI8A 1F2AA 3BCNA 2P7UA 1AU3A 1IWDA 3RVXA 1THEA 1YALA 1U9XA 4OEMA 1MDWA 4YYUA 2YJCA 2P0RA 2F7DA 1XKGA 1CJLA 3I3TA 3BPMA 2BDLA 2DC6A 5JH3A 4DMYA 2E03A 2XU4A 1O0EA 4BS6A 5CHVA 4QRXA 1MEMA 3KSEA 2XU1A 3IEJA 1PPDA 2E02A 1JQPA 3DF0A 2FTDA 4CDCB 1Y4HA 3MTNA 4W4UA 2YJ9A 5FPWA 2GHUA 3CBJA 3QJ3A 2IBIA 1PPOA 4MSXA 2FRQA 4YYVA 4X6JA 4DMXA 1U5IA 2G8JA 2OZ2A 3QSDA 2AYNA 1ICFA 2BDZA 5F02A 2B1NA 1YK8A 3KFQA 4HWYA 2DC9A 5CVMA 2B1MA 4P6GA 3N4CA 1QMYA 4ZUXU 1CV8A 4FJCA 1DF0A 1NLJA 3HWNA 1X9YA 3RVWA 3KX1A 4BQVA 3V6CA 1GCBA 4AXMA 1CSBB 2ATOA 3QT4A 1YT7A 3PW3A 4FK5A 4KLBA 1PPNA 2FO5A 4X6IA 2YJ8A 3B79A 2DC8A 2H7JA 3IV2A 2Y5BA 4W5CA 3ERVA 3GCBA 4YVAA 2PADA 3HHAA 4N79A 4QRVA 5J94A 3P5VA 1U9VA 4K7CA 2AUZA 2F1GA 3KWZA 1KHPA 3V6EA 4OELA 3K24A 2G7YA 3O1GA 2G6DA 1CS8A 3H8BA 1ATKA 1F2CA 4QRGA 2DJFB 2DZYA 2DJGB 1AU2A 1M6DA 3O0UA 5CVOB 2AS8A 4WA6A 2NQAA 2AUXA 3BC3A 2E00A 1CPJA 4BSQA 8PCHA 3PBHA 3P5UA 3LFYA 1VSNA 1BP4A 2PNSA 1TLOA 3BOWA 3S3QA 1AYUA 1MS6A 4CDFB 2Y6EA 2R9FA 1MEGA 2GFOA 1K3BB 2FRAA 1NL6A 1ME3A 1KHQA 3BPFA 2DZZA 3K9MA 3MORA 3S3RA 1KXRA 4CDDB 2FUDA 3KWBX 2AIMA 3KW9A 1CQDA 1ZIVA 2CIOA 5CVNB 1F29A 2XU5A 1Q6KA 2R9CA 1BGOA 2FT2A 4I07A 1PE6A 5A24A 2OULA 2JQFR 3IOQA 4BS5A 3D6SA 4W5BA 3OVXA 4PI3A 3N3KA 3H89A 4QBBA 3F75A 3TNXA 2YJBA 4PP2E 2JQGR 2VHSA 3N3GA 3PNRA 2DCCA 1EWMA 1GLOA 1AU0A 1AIMA 2DCAA 1PPPA 4PP1A 2P86A 4XUIA 4MZOA 3KKUA 7PCKA 1KFUL 4N4ZA 6PADA 4CDEB 1U9QX 1GECE 3OISA
chains in the Genus database with same CATH superfamily
1BQIA 4A5UA 3P5WA 1VJVA 1F2BA 1DEUA 4OVZB 3WXEA 3RVVA 2DCBA 3F5VA 3BWKA 3H6SA 1TU6A 4P6EA 5EF4A 4YYWA 1NB3A 2NQGA 4QH6A 2ARYA 2R9OA 2IPPB 2HD5A 3U8EA 2NQIA 1EF7A 1UKFA 2OP3A 1HUCB 2DCDA 4D8BA 1ITOA 3WXGA 1AYWA 2HXZA 4RNAA 4RKXA 2AU1A 3IUTA 3PHWA 5JA7A 3OF9A 1PIPA 1NB5A 1MIRA 1FH0A 2UZJA 1QDQA 4OW0A 4PADA 3MHSA 4Q8GA 1MHWA 3TRKA 1U9WA 1TL9A 3MHHA 1SP4B 4BPVA 1YK7A 4I05A 3NHEA 3HD3A 1GMYA 3TMPA 3E1ZB 4Q8HA 2ACTA 1CVZA 5JZEA 5EZQA 3ZUAA 3WXFA 1EWOA 5E6JA 1SNKA 2R6NA 1POPA 2FQ9A 3CBKA 9PAPA 4G54A 2O6XA 1CTEA 3C0RA 2CB5A 2HH5A 3IMAA 3BB7A 4BOUA 2PREA 3PDFA 2R9NA 4MZSA 2J7QA 1AU4A 2PBHA 2HHNA 2AVWA 1PCIA 2XU3A 4R3DA 4RY2A 5K16A 5CHTA 5EGWA 3I06A 3CH3X 4D8IA 1QOLA 4AXLA 1AYVA 4BOSA 4N8WA 2R9MA 3OQCA 3P5XA 1PADA 3ZNHA 4CZWA 1CB5A 4X6HA 4I04A 4FIPA 1PBHA 3H7DA 3IHPA 1PXVA 2FE8A 3C9EA 3K8UA 1Y08A 2WBFX 1A6RA 4YYRA 1NQCA 3OF8A 1BY8A 1KFXL 1ME4A 5PADA 1S4VA 3LXSA 2E01A 2YJ2A 4YYSA 4REZA 4XR7A 2FYEA 3PRMA 1ZCMA 1NPZA 3W31A 3PHUA 2Z84A 3CH2X 3M99A 3PSEA 4YYQA 1QXPA 3H8CA 2C0YA 1EWPA 2G8EA 1EWLA 3HHIA 2VHFA 2NQDB 1YVBA 2DC7A 3PRPA 4YV8A 1STFE 2AYOA 3USVA 1AECA 3OVZA 3AI8A 4D8EA 1F2AA 3BCNA 2P7UA 1AU3A 1IWDA 3RVXA 1THEA 1YALA 1U9XA 4OEMA 3O65A 1MDWA 4YYUA 2YJCA 4IUMA 2P0RA 2F7DA 4BOQA 1XKGA 4ZTBA 1CJLA 3I3TA 3BPMA 2BDLA 2DC6A 4RF0A 5JH3A 4DMYA 2E03A 2XU4A 1O0EA 4P16A 4XZXA 5CHVA 4WURA 4BS6A 4QRXA 3PT2A 1MEMA 3KSEA 2XU1A 2JTCA 3IEJA 1PPDA 2E02A 1JQPA 3DF0A 2FTDA 4MM3B 4CDCB 3B21A 1Y4HA 3MTNA 4W4UA 2YJ9A 5FPWA 2GHUA 3BBAA 3CBJA 3RNVA 3QJ3A 2IBIA 1PPOA 4MSXA 2FRQA 2JRIA 4YYVA 4X6JA 4DMXA 1U5IA 2G8JA 2OZ2A 3QSDA 3MP2A 2AYNA 1ICFA 2BDZA 5F02A 2B1NA 1YK8A 3KFQA 4HWYA 2DC9A 5CVMA 2B1MA 3BY4A 4P6GA 3N4CA 1QMYA 4ZUXU 1CV8A 4FJCA 2BU3A 1DF0A 1NLJA 3HWNA 1X9YA 3RVWA 3KX1A 4BQVA 3V6CA 1GCBA 2BTWA 3W30A 4AXMA 5EZSA 1CSBB 2ATOA 3QT4A 4MI7A 1YT7A 3PW3A 4FK5A 4PT5A 4BOPA 4KLBA 1YZBA 1PPNA 2FO5A 4X6IA 2YJ8A 3B79A 5KO3A 2DC8A 2H7JA 3IV2A 2Y5BA 1DKIA 4W5CA 3ERVA 3GCBA 4YVAA 2PADA 3HHAA 4N79A 4QRVA 5J94A 3P5VA 4K7CA 1U9VA 2AUZA 2F1GA 3KWZA 1KHPA 3V6EA 4OELA 3K24A 2G7YA 3MJ5A 3O1GA 2G6DA 1CS8A 4M0WA 3H8BA 1ATKA 1F2CA 4QRGA 4RF1A 2DJFB 2DZYA 2DJGB 1AU2A 1M6DA 3MTVA 3O0UA 2AS8A 5CVOB 4WA6A 2NQAA 2AUXA 3BC3A 2E00A 1CPJA 4BSQA 8PCHA 3PBHA 3P5UA 2AGAA 3LFYA 1VSNA 1BP4A 2PNSA 1TLOA 3BOWA 3S3QA 1AYUA 1MS6A 4CDFB 2Y6EA 2R9FA 1MEGA 2GFOA 2HWKA 1K3BB 2FRAA 1NL6A 4BOZA 4IP3A 1ME3A 1KHQA 3BPFA 2DZZA 3K9MA 3MORA 2DOSA 3S3RA 4HXDB 1KXRA 4CDDB 2FUDA 3KWBX 2AIMA 3KW9A 4OVZA 1CQDA 2BTWB 1ZIVA 1PVJA 4GUAA 3IFUA 2CIOA 3PHXA 5CVNB 1F29A 2XU5A 1Q6KA 2R9CA 1BGOA 2FT2A 4I07A 1PE6A 5A24A 2OULA 2JQFR 3IOQA 4BS5A 3D6SA 4W5BA 3OVXA 4PI3A 3N3KA 3H89A 4QBBA 3E9SA 3F75A 3TNXA 2YJBA 4PP2E 2JQGR 2VHSA 3N3GA 3PNRA 2DCCA 1EWMA 1GLOA 1AU0A 1AIMA 2DCAA 1PPPA 4PP1A 2P86A 4XUIA 4MZOA 3KKUA 7PCKA 1KFUL 4N4ZA 6PADA 4CDEB 2J7QC 1U9QX 1GECE 3OISA
chains in the Genus database with same CATH topology
1BQIA 3P5WA 1VJVA 1F2BA 1W5RA 1DEUA 3WXEA 3RVVA 4GUZA 2DCBA 3F5VA 3BWKA 4C5PA 3H6SA 1TU6A 4P6EA 5EF4A 4YYWA 1NB3A 2NQGA 4QH6A 2ARYA 2VFBA 2R9OA 1W4TA 2IPPB 2HD5A 3U8EA 2NQIA 1EF7A 2OP3A 1HUCB 2DCDA 1ITOA 3WXGA 1AYWA 2HXZA 2AU1A 3IUTA 5JA7A 3OF9A 1PIPA 1NB5A 1MIRA 1FH0A 1QDQA 4PADA 3MHSA 4Q8GA 1MHWA 1U9WA 1TL9A 3MHHA 1SP4B 4BPVA 1YK7A 4I05A 3NHEA 3HD3A 1GMYA 3E1ZB 4Q8HA 2ACTA 1CVZA 3ZUAA 3WXFA 1EWOA 1SNKA 2R6NA 1POPA 2FQ9A 3CBKA 9PAPA 4G54A 2O6XA 1CTEA 2CB5A 2HH5A 3IMAA 2PREA 3PDFA 2R9NA 4MZSA 1AU4A 2PBHA 2HHNA 2AVWA 1PCIA 2XU3A 4RY2A 5K16A 5CHTA 5EGWA 3I06A 3CH3X 1QOLA 4AXLA 1AYVA 4N8WA 2VFCA 2R9MA 3P5XA 1PADA 4CZWA 1CB5A 1E2TA 4X6HA 4I04A 4FIPA 1PBHA 3H7DA 3IHPA 1PXVA 3C9EA 3K8UA 1Y08A 2WBFX 1A6RA 4YYRA 1NQCA 3OF8A 4B55A 1BY8A 1KFXL 1ME4A 5PADA 1S4VA 3LXSA 2E01A 2YJ2A 4YYSA 4BGFA 4XR7A 2FYEA 1ZCMA 1NPZA 3CH2X 3M99A 4YYQA 1QXPA 3H8CA 2C0YA 1EWPA 2G8EA 1EWLA 3HHIA 2VHFA 2NQDB 1YVBA 2DC7A 4YV8A 1STFE 2AYOA 3USVA 1AECA 3OVZA 3AI8A 1F2AA 3BCNA 2P7UA 1AU3A 1IWDA 3RVXA 1THEA 1YALA 1U9XA 4OEMA 1MDWA 4YYUA 2YJCA 2P0RA 2F7DA 1XKGA 1CJLA 3I3TA 3BPMA 2BDLA 2DC6A 1GX3A 5JH3A 4DMYA 2E03A 2XU4A 1O0EA 4BS6A 5CHVA 4QRXA 1MEMA 3KSEA 2XU1A 3IEJA 1PPDA 2E02A 1JQPA 3DF0A 2FTDA 4CDCB 1Y4HA 3MTNA 4W4UA 2YJ9A 5FPWA 2GHUA 3CBJA 3QJ3A 2IBIA 1PPOA 4MSXA 2FRQA 4YYVA 4X6JA 4DMXA 1U5IA 2G8JA 2OZ2A 3QSDA 2AYNA 1ICFA 2BDZA 5F02A 2B1NA 1YK8A 3KFQA 4HWYA 2DC9A 5CVMA 2B1MA 4P6GA 3N4CA 1QMYA 4ZUXU 1CV8A 4FJCA 1DF0A 1NLJA 3HWNA 1X9YA 3RVWA 3KX1A 4BQVA 3V6CA 1GCBA 4AXMA 1CSBB 2ATOA 3QT4A 1YT7A 3PW3A 4FK5A 4KLBA 1PPNA 2FO5A 4X6IA 2YJ8A 3B79A 2DC8A 2H7JA 3IV2A 2Y5BA 4W5CA 3D9WA 3ERVA 3GCBA 4YVAA 2PADA 3HHAA 4N79A 4QRVA 5J94A 3P5VA 1U9VA 4K7CA 2AUZA 2F1GA 3KWZA 1KHPA 3V6EA 4OELA 3K24A 2G7YA 3O1GA 2G6DA 1CS8A 3H8BA 1ATKA 1F2CA 4QRGA 3LTWA 2DJFB 2DZYA 2DJGB 1AU2A 1M6DA 3O0UA 5CVOB 2AS8A 4WA6A 2NQAA 2AUXA 2BSZA 3BC3A 2E00A 1CPJA 4BSQA 8PCHA 1W6FA 3PBHA 3P5UA 3LFYA 1VSNA 1BP4A 2PNSA 1TLOA 3BOWA 3S3QA 1AYUA 1MS6A 4CDFB 2Y6EA 2R9FA 1MEGA 2GFOA 1K3BB 2FRAA 1NL6A 1ME3A 1KHQA 3BPFA 2DZZA 3K9MA 3MORA 3S3RA 1KXRA 4CDDB 4NV8A 2FUDA 3KWBX 2AIMA 3KW9A 1CQDA 1ZIVA 2CIOA 5CVNB 1F29A 2XU5A 1Q6KA 2R9CA 1BGOA 2FT2A 4I07A 1PE6A 5A24A 2OULA 2JQFR 3IOQA 4BS5A 3D6SA 4W5BA 3OVXA 4PI3A 3N3KA 3H89A 4QBBA 3F75A 3TNXA 2YJBA 4NV7A 4PP2E 2JQGR 2VHSA 3N3GA 3PNRA 2DCCA 1EWMA 1GLOA 1AU0A 1AIMA 2DCAA 1PPPA 4PP1A 2P86A 4XUIA 4MZOA 3KKUA 7PCKA 1KFUL 4N4ZA 6PADA 4CDEB 1U9QX 1GECE 3OISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQI A;  3P5W A;  1VJV A;  1F2B A;  1DEU A;  3WXE A;  3RVV A;  2DCB A;  3F5V A;  3BWK A;  3H6S A;  1TU6 A;  4P6E A;  5EF4 A;  4YYW A;  1NB3 A;  2NQG A;  4QH6 A;  2ARY A;  2R9O A;  2IPP B;  2HD5 A;  3U8E A;  2NQI A;  1EF7 A;  2OP3 A;  1HUC B;  2DCD A;  1ITO A;  3WXG A;  1AYW A;  2HXZ A;  2AU1 A;  3IUT A;  5JA7 A;  3OF9 A;  1PIP A;  1NB5 A;  1MIR A;  1FH0 A;  1QDQ A;  4PAD A;  3MHS A;  4Q8G A;  1MHW A;  1U9W A;  1TL9 A;  3MHH A;  1SP4 B;  4BPV A;  1YK7 A;  4I05 A;  3NHE A;  3HD3 A;  1GMY A;  3E1Z B;  4Q8H A;  2ACT A;  1CVZ A;  3ZUA A;  3WXF A;  1EWO A;  1SNK A;  2R6N A;  1POP A;  2FQ9 A;  3CBK A;  9PAP A;  4G54 A;  2O6X A;  1CTE A;  2CB5 A;  2HH5 A;  3IMA A;  2PRE A;  3PDF A;  2R9N A;  4MZS A;  1AU4 A;  2PBH A;  2HHN A;  2AVW A;  1PCI A;  2XU3 A;  4RY2 A;  5K16 A;  5CHT A;  5EGW A;  3I06 A;  3CH3 X;  1QOL A;  4AXL A;  1AYV A;  4N8W A;  2R9M A;  3P5X A;  1PAD A;  4CZW A;  1CB5 A;  4X6H A;  4I04 A;  4FIP A;  1PBH A;  3H7D A;  3IHP A;  1PXV A;  3C9E A;  3K8U A;  1Y08 A;  2WBF X;  1A6R A;  4YYR A;  1NQC A;  3OF8 A;  1BY8 A;  1KFX L;  1ME4 A;  5PAD A;  1S4V A;  3LXS A;  2E01 A;  2YJ2 A;  4YYS A;  4XR7 A;  2FYE A;  1ZCM A;  1NPZ A;  3CH2 X;  3M99 A;  4YYQ A;  1QXP A;  3H8C A;  2C0Y A;  1EWP A;  2G8E A;  1EWL A;  3HHI A;  2VHF A;  2NQD B;  1YVB A;  2DC7 A;  4YV8 A;  1STF E;  2AYO A;  3USV A;  1AEC A;  3OVZ A;  3AI8 A;  1F2A A;  3BCN A;  2P7U A;  1AU3 A;  1IWD A;  3RVX A;  1THE A;  1YAL A;  1U9X A;  4OEM A;  1MDW A;  4YYU A;  2YJC A;  2P0R A;  2F7D A;  1XKG A;  1CJL A;  3I3T A;  3BPM A;  2BDL A;  2DC6 A;  5JH3 A;  4DMY A;  2E03 A;  2XU4 A;  1O0E A;  4BS6 A;  5CHV A;  4QRX A;  1MEM A;  3KSE A;  2XU1 A;  3IEJ A;  1PPD A;  2E02 A;  1JQP A;  3DF0 A;  2FTD A;  4CDC B;  1Y4H A;  3MTN A;  4W4U A;  2YJ9 A;  5FPW A;  2GHU A;  3CBJ A;  3QJ3 A;  2IBI A;  1PPO A;  4MSX A;  2FRQ A;  4YYV A;  4X6J A;  4DMX A;  1U5I A;  2G8J A;  2OZ2 A;  3QSD A;  2AYN A;  1ICF A;  2BDZ A;  5F02 A;  2B1N A;  1YK8 A;  3KFQ A;  4HWY A;  2DC9 A;  5CVM A;  2B1M A;  4P6G A;  3N4C A;  1QMY A;  4ZUX U;  1CV8 A;  4FJC A;  1DF0 A;  1NLJ A;  3HWN A;  1X9Y A;  3RVW A;  3KX1 A;  4BQV A;  3V6C A;  1GCB A;  4AXM A;  1CSB B;  2ATO A;  3QT4 A;  1YT7 A;  3PW3 A;  4FK5 A;  4KLB A;  1PPN A;  2FO5 A;  4X6I A;  2YJ8 A;  3B79 A;  2DC8 A;  2H7J A;  3IV2 A;  2Y5B A;  4W5C A;  3ERV A;  3GCB A;  4YVA A;  2PAD A;  3HHA A;  4N79 A;  4QRV A;  5J94 A;  3P5V A;  1U9V A;  4K7C A;  2AUZ A;  2F1G A;  3KWZ A;  1KHP A;  3V6E A;  4OEL A;  3K24 A;  2G7Y A;  3O1G A;  2G6D A;  1CS8 A;  3H8B A;  1ATK A;  1F2C A;  4QRG A;  2DJF B;  2DZY A;  2DJG B;  1AU2 A;  1M6D A;  3O0U A;  5CVO B;  2AS8 A;  4WA6 A;  2NQA A;  2AUX A;  3BC3 A;  2E00 A;  1CPJ A;  4BSQ A;  8PCH A;  3PBH A;  3P5U A;  3LFY A;  1VSN A;  1BP4 A;  2PNS A;  1TLO A;  3BOW A;  3S3Q A;  1AYU A;  1MS6 A;  4CDF B;  2Y6E A;  2R9F A;  1MEG A;  2GFO A;  1K3B B;  2FRA A;  1NL6 A;  1ME3 A;  1KHQ A;  3BPF A;  2DZZ A;  3K9M A;  3MOR A;  3S3R A;  1KXR A;  4CDD B;  2FUD A;  3KWB X;  2AIM A;  3KW9 A;  1CQD A;  1ZIV A;  2CIO A;  5CVN B;  1F29 A;  2XU5 A;  1Q6K A;  2R9C A;  1BGO A;  2FT2 A;  4I07 A;  1PE6 A;  5A24 A;  2OUL A;  2JQF R;  3IOQ A;  4BS5 A;  3D6S A;  4W5B A;  3OVX A;  4PI3 A;  3N3K A;  3H89 A;  4QBB A;  3F75 A;  3TNX A;  2YJB A;  4PP2 E;  2JQG R;  2VHS A;  3N3G A;  3PNR A;  2DCC A;  1EWM A;  1GLO A;  1AU0 A;  1AIM A;  2DCA A;  1PPP A;  4PP1 A;  2P86 A;  4XUI A;  4MZO A;  3KKU A;  7PCK A;  1KFU L;  4N4Z A;  6PAD A;  4CDE B;  1U9Q X;  1GEC E;  3OIS A; 
#chains in the Genus database with same CATH topology
 1BQI A;  4A5U A;  3P5W A;  1VJV A;  1F2B A;  1DEU A;  4OVZ B;  3WXE A;  3RVV A;  2DCB A;  3F5V A;  3BWK A;  3H6S A;  1TU6 A;  4P6E A;  5EF4 A;  4YYW A;  1NB3 A;  2NQG A;  4QH6 A;  2ARY A;  2R9O A;  2IPP B;  2HD5 A;  3U8E A;  2NQI A;  1EF7 A;  1UKF A;  2OP3 A;  1HUC B;  2DCD A;  4D8B A;  1ITO A;  3WXG A;  1AYW A;  2HXZ A;  4RNA A;  4RKX A;  2AU1 A;  3IUT A;  3PHW A;  5JA7 A;  3OF9 A;  1PIP A;  1NB5 A;  1MIR A;  1FH0 A;  2UZJ A;  1QDQ A;  4OW0 A;  4PAD A;  3MHS A;  4Q8G A;  1MHW A;  3TRK A;  1U9W A;  1TL9 A;  3MHH A;  1SP4 B;  4BPV A;  1YK7 A;  4I05 A;  3NHE A;  3HD3 A;  1GMY A;  3TMP A;  3E1Z B;  4Q8H A;  2ACT A;  1CVZ A;  5JZE A;  5EZQ A;  3ZUA A;  3WXF A;  1EWO A;  5E6J A;  1SNK A;  2R6N A;  1POP A;  2FQ9 A;  3CBK A;  9PAP A;  4G54 A;  2O6X A;  1CTE A;  3C0R A;  2CB5 A;  2HH5 A;  3IMA A;  3BB7 A;  4BOU A;  2PRE A;  3PDF A;  2R9N A;  4MZS A;  2J7Q A;  1AU4 A;  2PBH A;  2HHN A;  2AVW A;  1PCI A;  2XU3 A;  4R3D A;  4RY2 A;  5K16 A;  5CHT A;  5EGW A;  3I06 A;  3CH3 X;  4D8I A;  1QOL A;  4AXL A;  1AYV A;  4BOS A;  4N8W A;  2R9M A;  3OQC A;  3P5X A;  1PAD A;  3ZNH A;  4CZW A;  1CB5 A;  4X6H A;  4I04 A;  4FIP A;  1PBH A;  3H7D A;  3IHP A;  1PXV A;  2FE8 A;  3C9E A;  3K8U A;  1Y08 A;  2WBF X;  1A6R A;  4YYR A;  1NQC A;  3OF8 A;  1BY8 A;  1KFX L;  1ME4 A;  5PAD A;  1S4V A;  3LXS A;  2E01 A;  2YJ2 A;  4YYS A;  4REZ A;  4XR7 A;  2FYE A;  3PRM A;  1ZCM A;  1NPZ A;  3W31 A;  3PHU A;  2Z84 A;  3CH2 X;  3M99 A;  3PSE A;  4YYQ A;  1QXP A;  3H8C A;  2C0Y A;  1EWP A;  2G8E A;  1EWL A;  3HHI A;  2VHF A;  2NQD B;  1YVB A;  2DC7 A;  3PRP A;  4YV8 A;  1STF E;  2AYO A;  3USV A;  1AEC A;  3OVZ A;  3AI8 A;  4D8E A;  1F2A A;  3BCN A;  2P7U A;  1AU3 A;  1IWD A;  3RVX A;  1THE A;  1YAL A;  1U9X A;  4OEM A;  3O65 A;  1MDW A;  4YYU A;  2YJC A;  4IUM A;  2P0R A;  2F7D A;  4BOQ A;  1XKG A;  4ZTB A;  1CJL A;  3I3T A;  3BPM A;  2BDL A;  2DC6 A;  4RF0 A;  5JH3 A;  4DMY A;  2E03 A;  2XU4 A;  1O0E A;  4P16 A;  4XZX A;  5CHV A;  4WUR A;  4BS6 A;  4QRX A;  3PT2 A;  1MEM A;  3KSE A;  2XU1 A;  2JTC A;  3IEJ A;  1PPD A;  2E02 A;  1JQP A;  3DF0 A;  2FTD A;  4MM3 B;  4CDC B;  3B21 A;  1Y4H A;  3MTN A;  4W4U A;  2YJ9 A;  5FPW A;  2GHU A;  3BBA A;  3CBJ A;  3RNV A;  3QJ3 A;  2IBI A;  1PPO A;  4MSX A;  2FRQ A;  2JRI A;  4YYV A;  4X6J A;  4DMX A;  1U5I A;  2G8J A;  2OZ2 A;  3QSD A;  3MP2 A;  2AYN A;  1ICF A;  2BDZ A;  5F02 A;  2B1N A;  1YK8 A;  3KFQ A;  4HWY A;  2DC9 A;  5CVM A;  2B1M A;  3BY4 A;  4P6G A;  3N4C A;  1QMY A;  4ZUX U;  1CV8 A;  4FJC A;  2BU3 A;  1DF0 A;  1NLJ A;  3HWN A;  1X9Y A;  3RVW A;  3KX1 A;  4BQV A;  3V6C A;  1GCB A;  2BTW A;  3W30 A;  4AXM A;  5EZS A;  1CSB B;  2ATO A;  3QT4 A;  4MI7 A;  1YT7 A;  3PW3 A;  4FK5 A;  4PT5 A;  4BOP A;  4KLB A;  1YZB A;  1PPN A;  2FO5 A;  4X6I A;  2YJ8 A;  3B79 A;  5KO3 A;  2DC8 A;  2H7J A;  3IV2 A;  2Y5B A;  1DKI A;  4W5C A;  3ERV A;  3GCB A;  4YVA A;  2PAD A;  3HHA A;  4N79 A;  4QRV A;  5J94 A;  3P5V A;  4K7C A;  1U9V A;  2AUZ A;  2F1G A;  3KWZ A;  1KHP A;  3V6E A;  4OEL A;  3K24 A;  2G7Y A;  3MJ5 A;  3O1G A;  2G6D A;  1CS8 A;  4M0W A;  3H8B A;  1ATK A;  1F2C A;  4QRG A;  4RF1 A;  2DJF B;  2DZY A;  2DJG B;  1AU2 A;  1M6D A;  3MTV A;  3O0U A;  2AS8 A;  5CVO B;  4WA6 A;  2NQA A;  2AUX A;  3BC3 A;  2E00 A;  1CPJ A;  4BSQ A;  8PCH A;  3PBH A;  3P5U A;  2AGA A;  3LFY A;  1VSN A;  1BP4 A;  2PNS A;  1TLO A;  3BOW A;  3S3Q A;  1AYU A;  1MS6 A;  4CDF B;  2Y6E A;  2R9F A;  1MEG A;  2GFO A;  2HWK A;  1K3B B;  2FRA A;  1NL6 A;  4BOZ A;  4IP3 A;  1ME3 A;  1KHQ A;  3BPF A;  2DZZ A;  3K9M A;  3MOR A;  2DOS A;  3S3R A;  4HXD B;  1KXR A;  4CDD B;  2FUD A;  3KWB X;  2AIM A;  3KW9 A;  4OVZ A;  1CQD A;  2BTW B;  1ZIV A;  1PVJ A;  4GUA A;  3IFU A;  2CIO A;  3PHX A;  5CVN B;  1F29 A;  2XU5 A;  1Q6K A;  2R9C A;  1BGO A;  2FT2 A;  4I07 A;  1PE6 A;  5A24 A;  2OUL A;  2JQF R;  3IOQ A;  4BS5 A;  3D6S A;  4W5B A;  3OVX A;  4PI3 A;  3N3K A;  3H89 A;  4QBB A;  3E9S A;  3F75 A;  3TNX A;  2YJB A;  4PP2 E;  2JQG R;  2VHS A;  3N3G A;  3PNR A;  2DCC A;  1EWM A;  1GLO A;  1AU0 A;  1AIM A;  2DCA A;  1PPP A;  4PP1 A;  2P86 A;  4XUI A;  4MZO A;  3KKU A;  7PCK A;  1KFU L;  4N4Z A;  6PAD A;  4CDE B;  2J7Q C;  1U9Q X;  1GEC E;  3OIS A; 
#chains in the Genus database with same CATH homology
 1BQI A;  3P5W A;  1VJV A;  1F2B A;  1W5R A;  1DEU A;  3WXE A;  3RVV A;  4GUZ A;  2DCB A;  3F5V A;  3BWK A;  4C5P A;  3H6S A;  1TU6 A;  4P6E A;  5EF4 A;  4YYW A;  1NB3 A;  2NQG A;  4QH6 A;  2ARY A;  2VFB A;  2R9O A;  1W4T A;  2IPP B;  2HD5 A;  3U8E A;  2NQI A;  1EF7 A;  2OP3 A;  1HUC B;  2DCD A;  1ITO A;  3WXG A;  1AYW A;  2HXZ A;  2AU1 A;  3IUT A;  5JA7 A;  3OF9 A;  1PIP A;  1NB5 A;  1MIR A;  1FH0 A;  1QDQ A;  4PAD A;  3MHS A;  4Q8G A;  1MHW A;  1U9W A;  1TL9 A;  3MHH A;  1SP4 B;  4BPV A;  1YK7 A;  4I05 A;  3NHE A;  3HD3 A;  1GMY A;  3E1Z B;  4Q8H A;  2ACT A;  1CVZ A;  3ZUA A;  3WXF A;  1EWO A;  1SNK A;  2R6N A;  1POP A;  2FQ9 A;  3CBK A;  9PAP A;  4G54 A;  2O6X A;  1CTE A;  2CB5 A;  2HH5 A;  3IMA A;  2PRE A;  3PDF A;  2R9N A;  4MZS A;  1AU4 A;  2PBH A;  2HHN A;  2AVW A;  1PCI A;  2XU3 A;  4RY2 A;  5K16 A;  5CHT A;  5EGW A;  3I06 A;  3CH3 X;  1QOL A;  4AXL A;  1AYV A;  4N8W A;  2VFC A;  2R9M A;  3P5X A;  1PAD A;  4CZW A;  1CB5 A;  1E2T A;  4X6H A;  4I04 A;  4FIP A;  1PBH A;  3H7D A;  3IHP A;  1PXV A;  3C9E A;  3K8U A;  1Y08 A;  2WBF X;  1A6R A;  4YYR A;  1NQC A;  3OF8 A;  4B55 A;  1BY8 A;  1KFX L;  1ME4 A;  5PAD A;  1S4V A;  3LXS A;  2E01 A;  2YJ2 A;  4YYS A;  4BGF A;  4XR7 A;  2FYE A;  1ZCM A;  1NPZ A;  3CH2 X;  3M99 A;  4YYQ A;  1QXP A;  3H8C A;  2C0Y A;  1EWP A;  2G8E A;  1EWL A;  3HHI A;  2VHF A;  2NQD B;  1YVB A;  2DC7 A;  4YV8 A;  1STF E;  2AYO A;  3USV A;  1AEC A;  3OVZ A;  3AI8 A;  1F2A A;  3BCN A;  2P7U A;  1AU3 A;  1IWD A;  3RVX A;  1THE A;  1YAL A;  1U9X A;  4OEM A;  1MDW A;  4YYU A;  2YJC A;  2P0R A;  2F7D A;  1XKG A;  1CJL A;  3I3T A;  3BPM A;  2BDL A;  2DC6 A;  1GX3 A;  5JH3 A;  4DMY A;  2E03 A;  2XU4 A;  1O0E A;  4BS6 A;  5CHV A;  4QRX A;  1MEM A;  3KSE A;  2XU1 A;  3IEJ A;  1PPD A;  2E02 A;  1JQP A;  3DF0 A;  2FTD A;  4CDC B;  1Y4H A;  3MTN A;  4W4U A;  2YJ9 A;  5FPW A;  2GHU A;  3CBJ A;  3QJ3 A;  2IBI A;  1PPO A;  4MSX A;  2FRQ A;  4YYV A;  4X6J A;  4DMX A;  1U5I A;  2G8J A;  2OZ2 A;  3QSD A;  2AYN A;  1ICF A;  2BDZ A;  5F02 A;  2B1N A;  1YK8 A;  3KFQ A;  4HWY A;  2DC9 A;  5CVM A;  2B1M A;  4P6G A;  3N4C A;  1QMY A;  4ZUX U;  1CV8 A;  4FJC A;  1DF0 A;  1NLJ A;  3HWN A;  1X9Y A;  3RVW A;  3KX1 A;  4BQV A;  3V6C A;  1GCB A;  4AXM A;  1CSB B;  2ATO A;  3QT4 A;  1YT7 A;  3PW3 A;  4FK5 A;  4KLB A;  1PPN A;  2FO5 A;  4X6I A;  2YJ8 A;  3B79 A;  2DC8 A;  2H7J A;  3IV2 A;  2Y5B A;  4W5C A;  3D9W A;  3ERV A;  3GCB A;  4YVA A;  2PAD A;  3HHA A;  4N79 A;  4QRV A;  5J94 A;  3P5V A;  1U9V A;  4K7C A;  2AUZ A;  2F1G A;  3KWZ A;  1KHP A;  3V6E A;  4OEL A;  3K24 A;  2G7Y A;  3O1G A;  2G6D A;  1CS8 A;  3H8B A;  1ATK A;  1F2C A;  4QRG A;  3LTW A;  2DJF B;  2DZY A;  2DJG B;  1AU2 A;  1M6D A;  3O0U A;  5CVO B;  2AS8 A;  4WA6 A;  2NQA A;  2AUX A;  2BSZ A;  3BC3 A;  2E00 A;  1CPJ A;  4BSQ A;  8PCH A;  1W6F A;  3PBH A;  3P5U A;  3LFY A;  1VSN A;  1BP4 A;  2PNS A;  1TLO A;  3BOW A;  3S3Q A;  1AYU A;  1MS6 A;  4CDF B;  2Y6E A;  2R9F A;  1MEG A;  2GFO A;  1K3B B;  2FRA A;  1NL6 A;  1ME3 A;  1KHQ A;  3BPF A;  2DZZ A;  3K9M A;  3MOR A;  3S3R A;  1KXR A;  4CDD B;  4NV8 A;  2FUD A;  3KWB X;  2AIM A;  3KW9 A;  1CQD A;  1ZIV A;  2CIO A;  5CVN B;  1F29 A;  2XU5 A;  1Q6K A;  2R9C A;  1BGO A;  2FT2 A;  4I07 A;  1PE6 A;  5A24 A;  2OUL A;  2JQF R;  3IOQ A;  4BS5 A;  3D6S A;  4W5B A;  3OVX A;  4PI3 A;  3N3K A;  3H89 A;  4QBB A;  3F75 A;  3TNX A;  2YJB A;  4NV7 A;  4PP2 E;  2JQG R;  2VHS A;  3N3G A;  3PNR A;  2DCC A;  1EWM A;  1GLO A;  1AU0 A;  1AIM A;  2DCA A;  1PPP A;  4PP1 A;  2P86 A;  4XUI A;  4MZO A;  3KKU A;  7PCK A;  1KFU L;  4N4Z A;  6PAD A;  4CDE B;  1U9Q X;  1GEC E;  3OIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...