1F2AA

Crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (ii)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CRUZAIN
publication title A target within the target: probing cruzain's P1' site to define structural determinants for the Chagas' disease protease.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1f2aA00
1GMYA 3HHAA 4DMXA 4QRGA 3WXFA 3N3KA 4YYWA 2DZZA 4N4ZA 1MEGA 2AYNA 3P5XA 4RY2A 3K9MA 2FRAA 3BPFA 2BDZA 3V6CA 1K3BB 1KFUL 1QMYA 4YYUA 1MEMA 3KW9A 1CPJA 1U5IA 4QH6A 1NB5A 4QBBA 2F7DA 2FUDA 2R9MA 1XKGA 2AUZA 2IBIA 2HD5A 2OULA 2DJGB 2YJCA 1AYVA 3NHEA 1ZCMA 3IMAA 2NQGA 1STFE 1MHWA 2XU1A 3F5VA 3IHPA 1YK8A 2DCBA 5CVMA 1THEA 3H8BA 3BOWA 1U9WA 1JQPA 3D6SA 1F2CA 5CHTA 3HWNA 1CQDA 3I3TA 4ZUXU 2C0YA 2DC9A 4QRXA 5F02A 2YJ8A 2GHUA 1SNKA 2E02A 1PBHA 3MORA 1ME3A 1PXVA 3CH2X 2DCDA 4CDDB 1EWOA 2H7JA 3ZUAA 9PAPA 1EWPA 1QXPA 4YYRA 1YT7A 1U9VA 3O1GA 4N8WA 3P5WA 2VHFA 4CDCB 1PPPA 2Y6EA 2HHNA 4PADA 1PPOA 1IWDA 1X9YA 3OF9A 4I04A 1A6RA 1BP4A 2G8JA 3RVVA 2DZYA 1MDWA 2PADA 2ARYA 3IEJA 4PP1A 3H89A 1PADA 3RVWA 1SP4B 1ME4A 3S3RA 4CDFB 2G8EA 3KKUA 1YK7A 2XU3A 5JH3A 1NQCA 4XR7A 3O0UA 2AYOA 3BWKA 4P6EA 4KLBA 5EF4A 1TLOA 1CVZA 2JQGR 1TU6A 2PBHA 5J94A 5JA7A 3BCNA 4G54A 1PE6A 3OVZA 3F75A 4BSQA 4FJCA 1F2BA 2JQFR 3USVA 2NQAA 4MSXA 1CV8A 4K7CA 4OEMA 1ICFA 1CTEA 2B1NA 7PCKA 3KSEA 4OELA 1GCBA 5CVOB 2E03A 4W5CA 2DCCA 4FK5A 1BY8A 4I07A 2YJ9A 3CBJA 1AIMA 1MS6A 4W5BA 3OVXA 2Y5BA 1GLOA 2NQIA 3KX1A 2R9OA 3PDFA 1CJLA 3M99A 3HHIA 4AXLA 3IOQA 2YJBA 4PP2E 3LXSA 1FH0A 3HD3A 4WA6A 4X6HA 4I05A 3TNXA 5CHVA 1ATKA 2OP3A 2FT2A 1ITOA 4N79A 1M6DA 3MTNA 1O0EA 2P86A 2CB5A 2G6DA 4PI3A 2AU1A 3KWZA 3GCBA 2HXZA 5EGWA 2XU4A 3V6EA 2DCAA 2IPPB 3ERVA 4MZOA 2DJFB 1AU4A 4BS6A 1ZIVA 5CVNB 1Q6KA 5PADA 1QDQA 2ACTA 4BPVA 4HWYA 3QJ3A 3KWBX 2PREA 3H8CA 2BDLA 2FYEA 1U9XA 3U8EA 3S3QA 4Q8GA 2R6NA 2R9NA 2R9FA 1BGOA 1PCIA 1AU0A 2NQDB 1POPA 3OISA 3MHHA 1F2AA 4X6IA 1F29A 3H6SA 1PIPA 3N4CA 2HH5A 1BQIA 1MIRA 1PPDA 3IUTA 1Y4HA 3WXEA 2P0RA 2FQ9A 2WBFX 1Y08A 2FO5A 3CBKA 4YVAA 2E00A 1NLJA 1YVBA 3I06A 1TL9A 4YYSA 3QSDA 6PADA 2YJ2A 2OZ2A 2VHSA 4P6GA 3MHSA 5K16A 1U9QX 8PCHA 2DC8A 3P5UA 4BS5A 2GFOA 4QRVA 2AUXA 4DMYA 2R9CA 1KFXL 2FTDA 5FPWA 4MZSA 3PNRA 3OF8A 1S4VA 2G7YA 3K24A 3K8UA 2PNSA 5A24A 4XUIA 3BC3A 3PW3A 3PBHA 2E01A 3IV2A 1CB5A 1QOLA 3QT4A 3RVXA 1VJVA 3P5VA 1CS8A 4BQVA 3CH3X 2AVWA 3DF0A 4AXMA 3WXGA 4YYVA 1CSBB 1GECE 2O6XA 2DC6A 1AU3A 4FIPA 2DC7A 1PPNA 2AIMA 1YALA 3KFQA 1AECA 2F1GA 3B79A 1NPZA 1AYWA 3H7DA 1DF0A 1AYUA 1EWLA 4YYQA 3C9EA 1EWMA 2ATOA 4YV8A 1KXRA 2B1MA 3AI8A 4Q8HA 4CZWA 1DEUA 1NL6A 1AU2A 2FRQA 2AS8A 4CDEB 1HUCB 2XU5A 3E1ZB 3LFYA 4X6JA 1VSNA 1KHPA 3BPMA 1NB3A 2P7UA 1EF7A 1KHQA 2CIOA 4W4UA 3N3GA
chains in the Genus database with same CATH superfamily
1GMYA 3HHAA 4DMXA 4QRGA 3WXFA 3N3KA 4BOPA 4OW0A 4YYWA 2DZZA 4BOZA 3BB7A 4N4ZA 1MEGA 2AYNA 3P5XA 4RY2A 3K9MA 2FRAA 1YZBA 3BPFA 2BDZA 3V6CA 4IUMA 1K3BB 1KFUL 1QMYA 4YYUA 1MEMA 3KW9A 1CPJA 1DKIA 4A5UA 1U5IA 4QH6A 1NB5A 4QBBA 2F7DA 2FUDA 2R9MA 1XKGA 2AUZA 2IBIA 2HD5A 2OULA 2DJGB 2YJCA 4R3DA 3BBAA 3ZNHA 1AYVA 3NHEA 1ZCMA 3IMAA 2NQGA 1STFE 1MHWA 2XU1A 3F5VA 3IHPA 1YK8A 2DCBA 5CVMA 1THEA 3H8BA 3BOWA 1U9WA 1JQPA 4ZTBA 3BY4A 3D6SA 1F2CA 5CHTA 4GUAA 4BOQA 3HWNA 2UZJA 1CQDA 4D8IA 4IP3A 3I3TA 4ZUXU 2C0YA 2DC9A 4QRXA 4OVZA 5F02A 2YJ8A 2GHUA 1SNKA 2E02A 1PBHA 4REZA 3MORA 1ME3A 1PXVA 3CH2X 2DCDA 2AGAA 4CDDB 1EWOA 2H7JA 3ZUAA 9PAPA 1EWPA 1QXPA 4YYRA 1YT7A 1U9VA 3O1GA 4N8WA 3P5WA 2VHFA 4CDCB 1PPPA 2Y6EA 2HHNA 4PADA 1PPOA 1IWDA 1X9YA 3OF9A 4I04A 1A6RA 1BP4A 2G8JA 3RVVA 3PHWA 2DZYA 3MP2A 1MDWA 2PADA 5EZQA 2ARYA 3IEJA 4PP1A 3H89A 1PADA 3RVWA 1SP4B 4D8EA 3TMPA 1ME4A 3S3RA 4WURA 4CDFB 2G8EA 3KKUA 1YK7A 2XU3A 5JH3A 1NQCA 4XR7A 3O0UA 2AYOA 4BOSA 3BWKA 4P6EA 4KLBA 5EF4A 1TLOA 4RNAA 1CVZA 2JQGR 1TU6A 2BTWA 2PBHA 5J94A 5JA7A 5E6JA 3BCNA 4G54A 1PE6A 3OVZA 3F75A 4BSQA 4FJCA 1F2BA 4OVZB 2JQFR 3USVA 3PHXA 3W30A 2NQAA 4MSXA 1CV8A 4K7CA 4OEMA 1ICFA 1CTEA 2B1NA 7PCKA 3KSEA 4OELA 1GCBA 5CVOB 2E03A 4W5CA 2DCCA 4FK5A 1BY8A 4I07A 2YJ9A 3CBJA 1AIMA 1MS6A 4W5BA 3OVXA 2Y5BA 1GLOA 2J7QC 2NQIA 4XZXA 3KX1A 2R9OA 2DOSA 3PDFA 1CJLA 3M99A 3HHIA 4AXLA 3IOQA 3MJ5A 2YJBA 4PP2E 3LXSA 1FH0A 3HD3A 4WA6A 4X6HA 4I05A 3TNXA 5CHVA 1ATKA 2OP3A 2FT2A 1ITOA 4N79A 1M6DA 3MTNA 1O0EA 2P86A 2CB5A 2G6DA 2JTCA 4PI3A 2AU1A 3KWZA 3GCBA 2HXZA 5EGWA 2XU4A 3V6EA 3PRMA 2DCAA 2IPPB 3ERVA 3PSEA 4MZOA 3PRPA 2DJFB 1AU4A 4BS6A 1ZIVA 5CVNB 1Q6KA 5PADA 2Z84A 2J7QA 1QDQA 2ACTA 2BTWB 4BPVA 3B21A 4HWYA 1UKFA 3QJ3A 3KWBX 2PREA 3H8CA 2BDLA 4MM3B 2FYEA 4M0WA 1U9XA 4PT5A 3U8EA 3S3QA 4Q8GA 2R6NA 2R9NA 2R9FA 1BGOA 5KO3A 5JZEA 3E9SA 1PCIA 4BOUA 1AU0A 2NQDB 1POPA 3OISA 3MHHA 1F2AA 2BU3A 4X6IA 1F29A 3H6SA 3W31A 1PIPA 3N4CA 2HH5A 1BQIA 1MIRA 1PPDA 3IFUA 3IUTA 1Y4HA 3TRKA 3WXEA 2P0RA 2FQ9A 4MI7A 2WBFX 1Y08A 2FO5A 3CBKA 4D8BA 2JRIA 4YVAA 2E00A 4RF0A 2FE8A 1NLJA 3PHUA 1YVBA 3I06A 1TL9A 4YYSA 3QSDA 6PADA 4HXDB 2YJ2A 2OZ2A 2VHSA 4P6GA 3MHSA 5K16A 1U9QX 8PCHA 2DC8A 2HWKA 3P5UA 4BS5A 2GFOA 4QRVA 2AUXA 4DMYA 2R9CA 1KFXL 2FTDA 5FPWA 4MZSA 3PNRA 3OF8A 1S4VA 2G7YA 3K24A 3K8UA 1PVJA 4RKXA 2PNSA 5A24A 4XUIA 3BC3A 3PW3A 3PBHA 2E01A 3MTVA 3IV2A 1CB5A 1QOLA 3QT4A 3RVXA 1VJVA 3P5VA 1CS8A 4BQVA 3CH3X 2AVWA 3DF0A 4AXMA 3PT2A 3WXGA 4P16A 4YYVA 1CSBB 1GECE 2O6XA 2DC6A 1AU3A 4FIPA 2DC7A 1PPNA 2AIMA 1YALA 3KFQA 1AECA 2F1GA 3B79A 1NPZA 1AYWA 4RF1A 5EZSA 3H7DA 1DF0A 1AYUA 1EWLA 4YYQA 3C9EA 1EWMA 2ATOA 4YV8A 1KXRA 2B1MA 3AI8A 4Q8HA 4CZWA 1DEUA 1NL6A 1AU2A 2FRQA 2AS8A 4CDEB 1HUCB 2XU5A 3E1ZB 3OQCA 3RNVA 3C0RA 3LFYA 4X6JA 3O65A 1VSNA 1KHPA 3BPMA 1NB3A 2P7UA 1EF7A 1KHQA 2CIOA 4W4UA 3N3GA
chains in the Genus database with same CATH topology
1GMYA 3HHAA 4DMXA 4QRGA 3WXFA 3N3KA 4YYWA 2DZZA 4N4ZA 1MEGA 2AYNA 3P5XA 4RY2A 3K9MA 2FRAA 3BPFA 2BDZA 3V6CA 1K3BB 2VFBA 1KFUL 4BGFA 1QMYA 4YYUA 1MEMA 3KW9A 1CPJA 1U5IA 4QH6A 1NB5A 4QBBA 2F7DA 2FUDA 2R9MA 1XKGA 2AUZA 2IBIA 2HD5A 2OULA 2DJGB 2YJCA 1AYVA 3NHEA 1ZCMA 3IMAA 2NQGA 1STFE 1MHWA 2XU1A 3F5VA 3IHPA 1YK8A 2DCBA 5CVMA 1THEA 3H8BA 3BOWA 1U9WA 1JQPA 3D6SA 1F2CA 5CHTA 3HWNA 1CQDA 3I3TA 4ZUXU 2C0YA 2DC9A 4QRXA 5F02A 2YJ8A 2GHUA 1SNKA 2E02A 1PBHA 3MORA 1ME3A 1PXVA 3CH2X 2DCDA 4CDDB 1EWOA 2H7JA 3ZUAA 9PAPA 3D9WA 1EWPA 1QXPA 4YYRA 1YT7A 1U9VA 3O1GA 4N8WA 3P5WA 2VHFA 4CDCB 1PPPA 2Y6EA 2HHNA 4PADA 1PPOA 1IWDA 1X9YA 3OF9A 4I04A 2BSZA 1A6RA 1BP4A 2G8JA 3RVVA 2DZYA 1MDWA 2PADA 4C5PA 2ARYA 3IEJA 4PP1A 3H89A 1PADA 3RVWA 1SP4B 1ME4A 3S3RA 4CDFB 2G8EA 3KKUA 1YK7A 2XU3A 5JH3A 1NQCA 4XR7A 3O0UA 2AYOA 3BWKA 4P6EA 4KLBA 5EF4A 1TLOA 1CVZA 2JQGR 1TU6A 2PBHA 5J94A 5JA7A 3BCNA 4G54A 1PE6A 3OVZA 3F75A 4BSQA 4FJCA 1F2BA 2JQFR 3USVA 4NV7A 2NQAA 4MSXA 4NV8A 1CV8A 4K7CA 4OEMA 1ICFA 1CTEA 2B1NA 7PCKA 3KSEA 4OELA 1GCBA 5CVOB 1W4TA 2E03A 4W5CA 2DCCA 4FK5A 1BY8A 4I07A 2YJ9A 3CBJA 1AIMA 1MS6A 4W5BA 3OVXA 2Y5BA 1GLOA 2NQIA 3KX1A 2R9OA 4B55A 3PDFA 1CJLA 3M99A 3HHIA 4AXLA 3IOQA 2YJBA 4PP2E 3LXSA 1FH0A 3HD3A 4WA6A 4X6HA 4I05A 3TNXA 5CHVA 1ATKA 2OP3A 2FT2A 1ITOA 4N79A 1M6DA 3MTNA 1O0EA 2P86A 2CB5A 2G6DA 4PI3A 2AU1A 3KWZA 3GCBA 2HXZA 5EGWA 2XU4A 3V6EA 2DCAA 2IPPB 3ERVA 4MZOA 2DJFB 1AU4A 4BS6A 1ZIVA 5CVNB 1Q6KA 5PADA 1QDQA 2ACTA 4BPVA 4HWYA 2VFCA 3QJ3A 3KWBX 2PREA 3H8CA 2BDLA 2FYEA 1U9XA 3U8EA 3S3QA 4Q8GA 2R6NA 2R9NA 2R9FA 1BGOA 1PCIA 1AU0A 3LTWA 2NQDB 1POPA 3OISA 3MHHA 1F2AA 4X6IA 1F29A 3H6SA 1PIPA 3N4CA 2HH5A 1BQIA 1MIRA 1PPDA 3IUTA 1Y4HA 3WXEA 2P0RA 2FQ9A 2WBFX 1Y08A 2FO5A 4GUZA 3CBKA 4YVAA 2E00A 1NLJA 1YVBA 3I06A 1TL9A 1W5RA 4YYSA 3QSDA 6PADA 2YJ2A 2OZ2A 2VHSA 4P6GA 3MHSA 5K16A 1U9QX 8PCHA 2DC8A 3P5UA 4BS5A 2GFOA 4QRVA 2AUXA 4DMYA 2R9CA 1KFXL 2FTDA 5FPWA 4MZSA 3PNRA 3OF8A 1S4VA 2G7YA 1W6FA 3K24A 3K8UA 2PNSA 5A24A 4XUIA 3BC3A 3PW3A 3PBHA 2E01A 3IV2A 1CB5A 1QOLA 3QT4A 3RVXA 1VJVA 3P5VA 1CS8A 4BQVA 3CH3X 2AVWA 3DF0A 4AXMA 3WXGA 4YYVA 1CSBB 1GECE 1E2TA 2O6XA 2DC6A 1AU3A 1GX3A 4FIPA 2DC7A 1PPNA 2AIMA 1YALA 3KFQA 1AECA 2F1GA 3B79A 1NPZA 1AYWA 3H7DA 1DF0A 1AYUA 1EWLA 4YYQA 3C9EA 1EWMA 2ATOA 4YV8A 1KXRA 2B1MA 3AI8A 4Q8HA 4CZWA 1DEUA 1NL6A 1AU2A 2FRQA 2AS8A 4CDEB 1HUCB 2XU5A 3E1ZB 3LFYA 4X6JA 1VSNA 1KHPA 3BPMA 1NB3A 2P7UA 1EF7A 1KHQA 2CIOA 4W4UA 3N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMY A;  3HHA A;  4DMX A;  4QRG A;  3WXF A;  3N3K A;  4YYW A;  2DZZ A;  4N4Z A;  1MEG A;  2AYN A;  3P5X A;  4RY2 A;  3K9M A;  2FRA A;  3BPF A;  2BDZ A;  3V6C A;  1K3B B;  1KFU L;  1QMY A;  4YYU A;  1MEM A;  3KW9 A;  1CPJ A;  1U5I A;  4QH6 A;  1NB5 A;  4QBB A;  2F7D A;  2FUD A;  2R9M A;  1XKG A;  2AUZ A;  2IBI A;  2HD5 A;  2OUL A;  2DJG B;  2YJC A;  1AYV A;  3NHE A;  1ZCM A;  3IMA A;  2NQG A;  1STF E;  1MHW A;  2XU1 A;  3F5V A;  3IHP A;  1YK8 A;  2DCB A;  5CVM A;  1THE A;  3H8B A;  3BOW A;  1U9W A;  1JQP A;  3D6S A;  1F2C A;  5CHT A;  3HWN A;  1CQD A;  3I3T A;  4ZUX U;  2C0Y A;  2DC9 A;  4QRX A;  5F02 A;  2YJ8 A;  2GHU A;  1SNK A;  2E02 A;  1PBH A;  3MOR A;  1ME3 A;  1PXV A;  3CH2 X;  2DCD A;  4CDD B;  1EWO A;  2H7J A;  3ZUA A;  9PAP A;  1EWP A;  1QXP A;  4YYR A;  1YT7 A;  1U9V A;  3O1G A;  4N8W A;  3P5W A;  2VHF A;  4CDC B;  1PPP A;  2Y6E A;  2HHN A;  4PAD A;  1PPO A;  1IWD A;  1X9Y A;  3OF9 A;  4I04 A;  1A6R A;  1BP4 A;  2G8J A;  3RVV A;  2DZY A;  1MDW A;  2PAD A;  2ARY A;  3IEJ A;  4PP1 A;  3H89 A;  1PAD A;  3RVW A;  1SP4 B;  1ME4 A;  3S3R A;  4CDF B;  2G8E A;  3KKU A;  1YK7 A;  2XU3 A;  5JH3 A;  1NQC A;  4XR7 A;  3O0U A;  2AYO A;  3BWK A;  4P6E A;  4KLB A;  5EF4 A;  1TLO A;  1CVZ A;  2JQG R;  1TU6 A;  2PBH A;  5J94 A;  5JA7 A;  3BCN A;  4G54 A;  1PE6 A;  3OVZ A;  3F75 A;  4BSQ A;  4FJC A;  1F2B A;  2JQF R;  3USV A;  2NQA A;  4MSX A;  1CV8 A;  4K7C A;  4OEM A;  1ICF A;  1CTE A;  2B1N A;  7PCK A;  3KSE A;  4OEL A;  1GCB A;  5CVO B;  2E03 A;  4W5C A;  2DCC A;  4FK5 A;  1BY8 A;  4I07 A;  2YJ9 A;  3CBJ A;  1AIM A;  1MS6 A;  4W5B A;  3OVX A;  2Y5B A;  1GLO A;  2NQI A;  3KX1 A;  2R9O A;  3PDF A;  1CJL A;  3M99 A;  3HHI A;  4AXL A;  3IOQ A;  2YJB A;  4PP2 E;  3LXS A;  1FH0 A;  3HD3 A;  4WA6 A;  4X6H A;  4I05 A;  3TNX A;  5CHV A;  1ATK A;  2OP3 A;  2FT2 A;  1ITO A;  4N79 A;  1M6D A;  3MTN A;  1O0E A;  2P86 A;  2CB5 A;  2G6D A;  4PI3 A;  2AU1 A;  3KWZ A;  3GCB A;  2HXZ A;  5EGW A;  2XU4 A;  3V6E A;  2DCA A;  2IPP B;  3ERV A;  4MZO A;  2DJF B;  1AU4 A;  4BS6 A;  1ZIV A;  5CVN B;  1Q6K A;  5PAD A;  1QDQ A;  2ACT A;  4BPV A;  4HWY A;  3QJ3 A;  3KWB X;  2PRE A;  3H8C A;  2BDL A;  2FYE A;  1U9X A;  3U8E A;  3S3Q A;  4Q8G A;  2R6N A;  2R9N A;  2R9F A;  1BGO A;  1PCI A;  1AU0 A;  2NQD B;  1POP A;  3OIS A;  3MHH A;  1F2A A;  4X6I A;  1F29 A;  3H6S A;  1PIP A;  3N4C A;  2HH5 A;  1BQI A;  1MIR A;  1PPD A;  3IUT A;  1Y4H A;  3WXE A;  2P0R A;  2FQ9 A;  2WBF X;  1Y08 A;  2FO5 A;  3CBK A;  4YVA A;  2E00 A;  1NLJ A;  1YVB A;  3I06 A;  1TL9 A;  4YYS A;  3QSD A;  6PAD A;  2YJ2 A;  2OZ2 A;  2VHS A;  4P6G A;  3MHS A;  5K16 A;  1U9Q X;  8PCH A;  2DC8 A;  3P5U A;  4BS5 A;  2GFO A;  4QRV A;  2AUX A;  4DMY A;  2R9C A;  1KFX L;  2FTD A;  5FPW A;  4MZS A;  3PNR A;  3OF8 A;  1S4V A;  2G7Y A;  3K24 A;  3K8U A;  2PNS A;  5A24 A;  4XUI A;  3BC3 A;  3PW3 A;  3PBH A;  2E01 A;  3IV2 A;  1CB5 A;  1QOL A;  3QT4 A;  3RVX A;  1VJV A;  3P5V A;  1CS8 A;  4BQV A;  3CH3 X;  2AVW A;  3DF0 A;  4AXM A;  3WXG A;  4YYV A;  1CSB B;  1GEC E;  2O6X A;  2DC6 A;  1AU3 A;  4FIP A;  2DC7 A;  1PPN A;  2AIM A;  1YAL A;  3KFQ A;  1AEC A;  2F1G A;  3B79 A;  1NPZ A;  1AYW A;  3H7D A;  1DF0 A;  1AYU A;  1EWL A;  4YYQ A;  3C9E A;  1EWM A;  2ATO A;  4YV8 A;  1KXR A;  2B1M A;  3AI8 A;  4Q8H A;  4CZW A;  1DEU A;  1NL6 A;  1AU2 A;  2FRQ A;  2AS8 A;  4CDE B;  1HUC B;  2XU5 A;  3E1Z B;  3LFY A;  4X6J A;  1VSN A;  1KHP A;  3BPM A;  1NB3 A;  2P7U A;  1EF7 A;  1KHQ A;  2CIO A;  4W4U A;  3N3G A; 
#chains in the Genus database with same CATH topology
 1GMY A;  3HHA A;  4DMX A;  4QRG A;  3WXF A;  3N3K A;  4BOP A;  4OW0 A;  4YYW A;  2DZZ A;  4BOZ A;  3BB7 A;  4N4Z A;  1MEG A;  2AYN A;  3P5X A;  4RY2 A;  3K9M A;  2FRA A;  1YZB A;  3BPF A;  2BDZ A;  3V6C A;  4IUM A;  1K3B B;  1KFU L;  1QMY A;  4YYU A;  1MEM A;  3KW9 A;  1CPJ A;  1DKI A;  4A5U A;  1U5I A;  4QH6 A;  1NB5 A;  4QBB A;  2F7D A;  2FUD A;  2R9M A;  1XKG A;  2AUZ A;  2IBI A;  2HD5 A;  2OUL A;  2DJG B;  2YJC A;  4R3D A;  3BBA A;  3ZNH A;  1AYV A;  3NHE A;  1ZCM A;  3IMA A;  2NQG A;  1STF E;  1MHW A;  2XU1 A;  3F5V A;  3IHP A;  1YK8 A;  2DCB A;  5CVM A;  1THE A;  3H8B A;  3BOW A;  1U9W A;  1JQP A;  4ZTB A;  3BY4 A;  3D6S A;  1F2C A;  5CHT A;  4GUA A;  4BOQ A;  3HWN A;  2UZJ A;  1CQD A;  4D8I A;  4IP3 A;  3I3T A;  4ZUX U;  2C0Y A;  2DC9 A;  4QRX A;  4OVZ A;  5F02 A;  2YJ8 A;  2GHU A;  1SNK A;  2E02 A;  1PBH A;  4REZ A;  3MOR A;  1ME3 A;  1PXV A;  3CH2 X;  2DCD A;  2AGA A;  4CDD B;  1EWO A;  2H7J A;  3ZUA A;  9PAP A;  1EWP A;  1QXP A;  4YYR A;  1YT7 A;  1U9V A;  3O1G A;  4N8W A;  3P5W A;  2VHF A;  4CDC B;  1PPP A;  2Y6E A;  2HHN A;  4PAD A;  1PPO A;  1IWD A;  1X9Y A;  3OF9 A;  4I04 A;  1A6R A;  1BP4 A;  2G8J A;  3RVV A;  3PHW A;  2DZY A;  3MP2 A;  1MDW A;  2PAD A;  5EZQ A;  2ARY A;  3IEJ A;  4PP1 A;  3H89 A;  1PAD A;  3RVW A;  1SP4 B;  4D8E A;  3TMP A;  1ME4 A;  3S3R A;  4WUR A;  4CDF B;  2G8E A;  3KKU A;  1YK7 A;  2XU3 A;  5JH3 A;  1NQC A;  4XR7 A;  3O0U A;  2AYO A;  4BOS A;  3BWK A;  4P6E A;  4KLB A;  5EF4 A;  1TLO A;  4RNA A;  1CVZ A;  2JQG R;  1TU6 A;  2BTW A;  2PBH A;  5J94 A;  5JA7 A;  5E6J A;  3BCN A;  4G54 A;  1PE6 A;  3OVZ A;  3F75 A;  4BSQ A;  4FJC A;  1F2B A;  4OVZ B;  2JQF R;  3USV A;  3PHX A;  3W30 A;  2NQA A;  4MSX A;  1CV8 A;  4K7C A;  4OEM A;  1ICF A;  1CTE A;  2B1N A;  7PCK A;  3KSE A;  4OEL A;  1GCB A;  5CVO B;  2E03 A;  4W5C A;  2DCC A;  4FK5 A;  1BY8 A;  4I07 A;  2YJ9 A;  3CBJ A;  1AIM A;  1MS6 A;  4W5B A;  3OVX A;  2Y5B A;  1GLO A;  2J7Q C;  2NQI A;  4XZX A;  3KX1 A;  2R9O A;  2DOS A;  3PDF A;  1CJL A;  3M99 A;  3HHI A;  4AXL A;  3IOQ A;  3MJ5 A;  2YJB A;  4PP2 E;  3LXS A;  1FH0 A;  3HD3 A;  4WA6 A;  4X6H A;  4I05 A;  3TNX A;  5CHV A;  1ATK A;  2OP3 A;  2FT2 A;  1ITO A;  4N79 A;  1M6D A;  3MTN A;  1O0E A;  2P86 A;  2CB5 A;  2G6D A;  2JTC A;  4PI3 A;  2AU1 A;  3KWZ A;  3GCB A;  2HXZ A;  5EGW A;  2XU4 A;  3V6E A;  3PRM A;  2DCA A;  2IPP B;  3ERV A;  3PSE A;  4MZO A;  3PRP A;  2DJF B;  1AU4 A;  4BS6 A;  1ZIV A;  5CVN B;  1Q6K A;  5PAD A;  2Z84 A;  2J7Q A;  1QDQ A;  2ACT A;  2BTW B;  4BPV A;  3B21 A;  4HWY A;  1UKF A;  3QJ3 A;  3KWB X;  2PRE A;  3H8C A;  2BDL A;  4MM3 B;  2FYE A;  4M0W A;  1U9X A;  4PT5 A;  3U8E A;  3S3Q A;  4Q8G A;  2R6N A;  2R9N A;  2R9F A;  1BGO A;  5KO3 A;  5JZE A;  3E9S A;  1PCI A;  4BOU A;  1AU0 A;  2NQD B;  1POP A;  3OIS A;  3MHH A;  1F2A A;  2BU3 A;  4X6I A;  1F29 A;  3H6S A;  3W31 A;  1PIP A;  3N4C A;  2HH5 A;  1BQI A;  1MIR A;  1PPD A;  3IFU A;  3IUT A;  1Y4H A;  3TRK A;  3WXE A;  2P0R A;  2FQ9 A;  4MI7 A;  2WBF X;  1Y08 A;  2FO5 A;  3CBK A;  4D8B A;  2JRI A;  4YVA A;  2E00 A;  4RF0 A;  2FE8 A;  1NLJ A;  3PHU A;  1YVB A;  3I06 A;  1TL9 A;  4YYS A;  3QSD A;  6PAD A;  4HXD B;  2YJ2 A;  2OZ2 A;  2VHS A;  4P6G A;  3MHS A;  5K16 A;  1U9Q X;  8PCH A;  2DC8 A;  2HWK A;  3P5U A;  4BS5 A;  2GFO A;  4QRV A;  2AUX A;  4DMY A;  2R9C A;  1KFX L;  2FTD A;  5FPW A;  4MZS A;  3PNR A;  3OF8 A;  1S4V A;  2G7Y A;  3K24 A;  3K8U A;  1PVJ A;  4RKX A;  2PNS A;  5A24 A;  4XUI A;  3BC3 A;  3PW3 A;  3PBH A;  2E01 A;  3MTV A;  3IV2 A;  1CB5 A;  1QOL A;  3QT4 A;  3RVX A;  1VJV A;  3P5V A;  1CS8 A;  4BQV A;  3CH3 X;  2AVW A;  3DF0 A;  4AXM A;  3PT2 A;  3WXG A;  4P16 A;  4YYV A;  1CSB B;  1GEC E;  2O6X A;  2DC6 A;  1AU3 A;  4FIP A;  2DC7 A;  1PPN A;  2AIM A;  1YAL A;  3KFQ A;  1AEC A;  2F1G A;  3B79 A;  1NPZ A;  1AYW A;  4RF1 A;  5EZS A;  3H7D A;  1DF0 A;  1AYU A;  1EWL A;  4YYQ A;  3C9E A;  1EWM A;  2ATO A;  4YV8 A;  1KXR A;  2B1M A;  3AI8 A;  4Q8H A;  4CZW A;  1DEU A;  1NL6 A;  1AU2 A;  2FRQ A;  2AS8 A;  4CDE B;  1HUC B;  2XU5 A;  3E1Z B;  3OQC A;  3RNV A;  3C0R A;  3LFY A;  4X6J A;  3O65 A;  1VSN A;  1KHP A;  3BPM A;  1NB3 A;  2P7U A;  1EF7 A;  1KHQ A;  2CIO A;  4W4U A;  3N3G A; 
#chains in the Genus database with same CATH homology
 1GMY A;  3HHA A;  4DMX A;  4QRG A;  3WXF A;  3N3K A;  4YYW A;  2DZZ A;  4N4Z A;  1MEG A;  2AYN A;  3P5X A;  4RY2 A;  3K9M A;  2FRA A;  3BPF A;  2BDZ A;  3V6C A;  1K3B B;  2VFB A;  1KFU L;  4BGF A;  1QMY A;  4YYU A;  1MEM A;  3KW9 A;  1CPJ A;  1U5I A;  4QH6 A;  1NB5 A;  4QBB A;  2F7D A;  2FUD A;  2R9M A;  1XKG A;  2AUZ A;  2IBI A;  2HD5 A;  2OUL A;  2DJG B;  2YJC A;  1AYV A;  3NHE A;  1ZCM A;  3IMA A;  2NQG A;  1STF E;  1MHW A;  2XU1 A;  3F5V A;  3IHP A;  1YK8 A;  2DCB A;  5CVM A;  1THE A;  3H8B A;  3BOW A;  1U9W A;  1JQP A;  3D6S A;  1F2C A;  5CHT A;  3HWN A;  1CQD A;  3I3T A;  4ZUX U;  2C0Y A;  2DC9 A;  4QRX A;  5F02 A;  2YJ8 A;  2GHU A;  1SNK A;  2E02 A;  1PBH A;  3MOR A;  1ME3 A;  1PXV A;  3CH2 X;  2DCD A;  4CDD B;  1EWO A;  2H7J A;  3ZUA A;  9PAP A;  3D9W A;  1EWP A;  1QXP A;  4YYR A;  1YT7 A;  1U9V A;  3O1G A;  4N8W A;  3P5W A;  2VHF A;  4CDC B;  1PPP A;  2Y6E A;  2HHN A;  4PAD A;  1PPO A;  1IWD A;  1X9Y A;  3OF9 A;  4I04 A;  2BSZ A;  1A6R A;  1BP4 A;  2G8J A;  3RVV A;  2DZY A;  1MDW A;  2PAD A;  4C5P A;  2ARY A;  3IEJ A;  4PP1 A;  3H89 A;  1PAD A;  3RVW A;  1SP4 B;  1ME4 A;  3S3R A;  4CDF B;  2G8E A;  3KKU A;  1YK7 A;  2XU3 A;  5JH3 A;  1NQC A;  4XR7 A;  3O0U A;  2AYO A;  3BWK A;  4P6E A;  4KLB A;  5EF4 A;  1TLO A;  1CVZ A;  2JQG R;  1TU6 A;  2PBH A;  5J94 A;  5JA7 A;  3BCN A;  4G54 A;  1PE6 A;  3OVZ A;  3F75 A;  4BSQ A;  4FJC A;  1F2B A;  2JQF R;  3USV A;  4NV7 A;  2NQA A;  4MSX A;  4NV8 A;  1CV8 A;  4K7C A;  4OEM A;  1ICF A;  1CTE A;  2B1N A;  7PCK A;  3KSE A;  4OEL A;  1GCB A;  5CVO B;  1W4T A;  2E03 A;  4W5C A;  2DCC A;  4FK5 A;  1BY8 A;  4I07 A;  2YJ9 A;  3CBJ A;  1AIM A;  1MS6 A;  4W5B A;  3OVX A;  2Y5B A;  1GLO A;  2NQI A;  3KX1 A;  2R9O A;  4B55 A;  3PDF A;  1CJL A;  3M99 A;  3HHI A;  4AXL A;  3IOQ A;  2YJB A;  4PP2 E;  3LXS A;  1FH0 A;  3HD3 A;  4WA6 A;  4X6H A;  4I05 A;  3TNX A;  5CHV A;  1ATK A;  2OP3 A;  2FT2 A;  1ITO A;  4N79 A;  1M6D A;  3MTN A;  1O0E A;  2P86 A;  2CB5 A;  2G6D A;  4PI3 A;  2AU1 A;  3KWZ A;  3GCB A;  2HXZ A;  5EGW A;  2XU4 A;  3V6E A;  2DCA A;  2IPP B;  3ERV A;  4MZO A;  2DJF B;  1AU4 A;  4BS6 A;  1ZIV A;  5CVN B;  1Q6K A;  5PAD A;  1QDQ A;  2ACT A;  4BPV A;  4HWY A;  2VFC A;  3QJ3 A;  3KWB X;  2PRE A;  3H8C A;  2BDL A;  2FYE A;  1U9X A;  3U8E A;  3S3Q A;  4Q8G A;  2R6N A;  2R9N A;  2R9F A;  1BGO A;  1PCI A;  1AU0 A;  3LTW A;  2NQD B;  1POP A;  3OIS A;  3MHH A;  1F2A A;  4X6I A;  1F29 A;  3H6S A;  1PIP A;  3N4C A;  2HH5 A;  1BQI A;  1MIR A;  1PPD A;  3IUT A;  1Y4H A;  3WXE A;  2P0R A;  2FQ9 A;  2WBF X;  1Y08 A;  2FO5 A;  4GUZ A;  3CBK A;  4YVA A;  2E00 A;  1NLJ A;  1YVB A;  3I06 A;  1TL9 A;  1W5R A;  4YYS A;  3QSD A;  6PAD A;  2YJ2 A;  2OZ2 A;  2VHS A;  4P6G A;  3MHS A;  5K16 A;  1U9Q X;  8PCH A;  2DC8 A;  3P5U A;  4BS5 A;  2GFO A;  4QRV A;  2AUX A;  4DMY A;  2R9C A;  1KFX L;  2FTD A;  5FPW A;  4MZS A;  3PNR A;  3OF8 A;  1S4V A;  2G7Y A;  1W6F A;  3K24 A;  3K8U A;  2PNS A;  5A24 A;  4XUI A;  3BC3 A;  3PW3 A;  3PBH A;  2E01 A;  3IV2 A;  1CB5 A;  1QOL A;  3QT4 A;  3RVX A;  1VJV A;  3P5V A;  1CS8 A;  4BQV A;  3CH3 X;  2AVW A;  3DF0 A;  4AXM A;  3WXG A;  4YYV A;  1CSB B;  1GEC E;  1E2T A;  2O6X A;  2DC6 A;  1AU3 A;  1GX3 A;  4FIP A;  2DC7 A;  1PPN A;  2AIM A;  1YAL A;  3KFQ A;  1AEC A;  2F1G A;  3B79 A;  1NPZ A;  1AYW A;  3H7D A;  1DF0 A;  1AYU A;  1EWL A;  4YYQ A;  3C9E A;  1EWM A;  2ATO A;  4YV8 A;  1KXR A;  2B1M A;  3AI8 A;  4Q8H A;  4CZW A;  1DEU A;  1NL6 A;  1AU2 A;  2FRQ A;  2AS8 A;  4CDE B;  1HUC B;  2XU5 A;  3E1Z B;  3LFY A;  4X6J A;  1VSN A;  1KHP A;  3BPM A;  1NB3 A;  2P7U A;  1EF7 A;  1KHQ A;  2CIO A;  4W4U A;  3N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...