1PCIA

Procaricain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
311
structure length
311
Chain Sequence
b'LTSTERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNNSYWLGLNEFADLSNDEFNEKYVGSLIDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDGAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARICAIN
publication title The prosequence of procaricain forms an alpha-helical domain that prevents access to the substrate-binding cleft.
pubmed doi rcsb
source organism Carica papaya
molecule tags Thiol protease
total genus 54
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pciA00
1YT7A 3V6EA 2B1MA 1DF0A 1KHQA 1AU0A 1STFE 1HUCB 3P5UA 1PPPA 4G54A 4XR7A 1XKGA 3GCBA 1MEMA 5JA7A 3USVA 1ATKA 1NB3A 1YVBA 1PADA 2PNSA 4YYWA 2FO5A 2YJ9A 2GHUA 3I3TA 1NLJA 3ERVA 4Q8GA 1TLOA 3WXEA 2HH5A 1U5IA 1U9XA 2AYNA 2R9NA 3IMAA 2IBIA 3H8CA 4FK5A 1MDWA 2E00A 2DZZA 1ME4A 4W4UA 3CH2X 4QRXA 2FTDA 3PW3A 4OEMA 3HD3A 5EF4A 5A24A 4MSXA 3IOQA 4AXLA 1Y08A 1KHPA 1CJLA 2ARYA 3CBKA 2DC9A 3MHHA 1VSNA 3RVXA 3PBHA 1QOLA 1F29A 4CDFB 1MHWA 3KWZA 3KWBX 3P5VA 3F5VA 4BSQA 1AU3A 2E03A 4DMXA 2R9OA 3U8EA 1SNKA 1QMYA 4N79A 1CTEA 4I07A 3WXFA 3RVVA 2AYOA 1VJVA 3TNXA 2DC8A 2XU4A 1DEUA 4I04A 4MZSA 2E02A 1CQDA 4P6EA 1YK8A 1GCBA 4QRVA 1F2BA 4K7CA 1ZIVA 2P0RA 1MS6A 3HHAA 4X6HA 1AU4A 1CPJA 1ME3A 4ZUXU 1U9QX 3IEJA 3H8BA 4RY2A 1AECA 4AXMA 2YJ8A 1YK7A 3LFYA 2WBFX 5PADA 1EWLA 3H6SA 3V6CA 2BDLA 3P5WA 1NQCA 2G7YA 1MEGA 4N8WA 1BGOA 1AYVA 3OVXA 3DF0A 2B1NA 2R9FA 4CDCB 1QDQA 2OZ2A 7PCKA 2AIMA 1BQIA 5J94A 4I05A 1GMYA 4YYRA 3OVZA 1TL9A 2DCCA 1NB5A 2HD5A 3K8UA 1QXPA 1U9VA 2XU1A 1CB5A 4PI3A 2P7UA 3WXGA 1BY8A 1JQPA 2DCDA 3KKUA 2NQDB 1IWDA 1AIMA 3O1GA 4YYUA 3KFQA 4X6JA 3IV2A 3P5XA 4MZOA 1KXRA 3BWKA 4W5BA 3N3KA 1CS8A 2R9CA 2YJCA 1MIRA 4YV8A 5FPWA 2O6XA 3O0UA 4P6GA 3IHPA 5CHVA 2DCBA 4FJCA 3MHSA 4FIPA 6PADA 3E1ZB 3MTNA 3MORA 3OF8A 3KX1A 2DC7A 1EWMA 3HWNA 5CVMA 3KSEA 3H89A 5F02A 3I06A 2YJBA 2OULA 3OISA 2G6DA 3BPMA 2FQ9A 2AVWA 2FUDA 3D6SA 3S3QA 3CH3X 4BPVA 1PCIA 1CV8A 2P86A 3K24A 1EWPA 2FRAA 1THEA 3BC3A 1PIPA 4BQVA 2C0YA 3NHEA 2NQIA 2IPPB 2PREA 3H7DA 1PPDA 1ZCMA 2G8JA 1EF7A 2VHFA 2F7DA 5K16A 1CSBB 3M99A 1ITOA 2DCAA 2FYEA 4N4ZA 4W5CA 8PCHA 1AYUA 2NQAA 2DC6A 3N4CA 1PPOA 2ACTA 4DMYA 2ATOA 1O0EA 2JQFR 4PP1A 2DJFB 4QBBA 1KFUL 4CDEB 2NQGA 2YJ2A 1PBHA 1EWOA 5CVNB 1S4VA 3BPFA 1PXVA 1K3BB 1U9WA 1Y4HA 9PAPA 5CVOB 4PP2E 2H7JA 2CB5A 1Q6KA 4BS6A 3QJ3A 3CBJA 2E01A 3N3GA 1TU6A 2G8EA 2XU5A 3C9EA 3ZUAA 1A6RA 3QT4A 4PADA 3RVWA 2AU1A 4QH6A 3AI8A 3S3RA 1GLOA 3B79A 1ICFA 3BOWA 2JQGR 2XU3A 1KFXL 1F2AA 3PDFA 2AUZA 1POPA 2R6NA 4X6IA 4BS5A 3QSDA 1F2CA 4OELA 1M6DA 4Q8HA 2F1GA 2VHSA 2AS8A 3KW9A 2Y5BA 4YYSA 3LXSA 2HXZA 3BCNA 2GFOA 4WA6A 3F75A 2DJGB 1NPZA 4HWYA 1BP4A 2FT2A 4KLBA 4YYQA 2BDZA 2R9MA 3OF9A 4XUIA 2OP3A 2FRQA 4YVAA 2CIOA 1SP4B 3HHIA 4YYVA 2DZYA 1YALA 1GECE 2PADA 1PE6A 3IUTA 5EGWA 4CDDB 2PBHA 4QRGA 1AYWA 1AU2A 1PPNA 3K9MA 5JH3A 1X9YA 5CHTA 3PNRA 4CZWA 1FH0A 2Y6EA 1CVZA 2AUXA 1NL6A 2HHNA
chains in the Genus database with same CATH superfamily
1DKIA 1YT7A 3V6EA 2B1MA 1DF0A 1KHQA 1AU0A 2HWKA 1STFE 2JTCA 3OQCA 2JRIA 1HUCB 4OVZB 3P5UA 1PPPA 4G54A 4XR7A 1XKGA 5KO3A 3GCBA 1MEMA 5JA7A 3USVA 1ATKA 1NB3A 1YVBA 2Z84A 3PT2A 3IFUA 1PADA 2PNSA 4IP3A 2UZJA 2FO5A 4YYWA 2YJ9A 4D8BA 2GHUA 3I3TA 1NLJA 3ERVA 4Q8GA 1TLOA 4BOPA 5E6JA 3WXEA 2HH5A 3PHXA 4REZA 1U5IA 1U9XA 2AYNA 2R9NA 3IMAA 2IBIA 3H8CA 4FK5A 1MDWA 2E00A 2DZZA 1ME4A 2J7QC 4W4UA 3CH2X 4QRXA 2FTDA 3PW3A 4OEMA 3HD3A 5EF4A 5A24A 4MSXA 3IOQA 4AXLA 1Y08A 3PRPA 1KHPA 1CJLA 2ARYA 3CBKA 2DC9A 3MHHA 1VSNA 3W31A 3RVXA 3PBHA 1QOLA 1F29A 4RF1A 4CDFB 1MHWA 3KWZA 3KWBX 3P5VA 3F5VA 4BSQA 4R3DA 1AU3A 2E03A 4DMXA 2R9OA 3U8EA 1SNKA 1QMYA 4N79A 1CTEA 4I07A 3WXFA 3RVVA 2AYOA 1VJVA 3TNXA 2DC8A 2XU4A 1DEUA 4I04A 4MZSA 2E02A 1CQDA 4P6EA 1YK8A 1GCBA 4QRVA 1F2BA 3MTVA 4K7CA 3RNVA 1ZIVA 2P0RA 1MS6A 3HHAA 4RNAA 4X6HA 1AU4A 1CPJA 1ME3A 4ZUXU 1U9QX 3IEJA 3H8BA 4RY2A 2BTWA 1AECA 4AXMA 2YJ8A 1YK7A 3LFYA 1PVJA 2WBFX 5PADA 1EWLA 3H6SA 3PSEA 3V6CA 2BDLA 3P5WA 1NQCA 4RKXA 2G7YA 1MEGA 4OVZA 4N8WA 1BGOA 1AYVA 3OVXA 3DF0A 2B1NA 2R9FA 2AGAA 4CDCB 1QDQA 2OZ2A 7PCKA 2AIMA 1BQIA 5J94A 4I05A 4WURA 1GMYA 4YYRA 3OVZA 1TL9A 2DCCA 1NB5A 2HD5A 4IUMA 3K8UA 3BBAA 1QXPA 1U9VA 2XU1A 1CB5A 4PI3A 2P7UA 3E9SA 3WXGA 3PRMA 1BY8A 1JQPA 2DCDA 4A5UA 3KKUA 2NQDB 1IWDA 1AIMA 3O1GA 4YYUA 3KFQA 4X6JA 4BOQA 3IV2A 3P5XA 4MZOA 1KXRA 3BWKA 4W5BA 3W30A 3N3KA 1CS8A 3C0RA 2R9CA 2YJCA 3BY4A 1MIRA 4YV8A 5FPWA 2O6XA 3O0UA 4P6GA 3IHPA 5CHVA 2DCBA 4FJCA 3MHSA 4BOSA 4FIPA 6PADA 3E1ZB 3MTNA 3MORA 3OF8A 3B21A 3KX1A 4P16A 2DC7A 1EWMA 3HWNA 5CVMA 3KSEA 3PHUA 3O65A 3H89A 5F02A 3I06A 2YJBA 2OULA 3OISA 2G6DA 3BPMA 2FQ9A 4GUAA 2AVWA 4BOZA 2FUDA 3D6SA 3S3QA 3CH3X 4BPVA 4MM3B 1PCIA 1CV8A 4BOUA 2P86A 3TRKA 3K24A 1EWPA 2FRAA 1THEA 3ZNHA 3BC3A 1PIPA 4BQVA 2C0YA 3NHEA 2NQIA 2IPPB 2PREA 1YZBA 3H7DA 1PPDA 3BB7A 1ZCMA 2G8JA 1EF7A 2VHFA 2F7DA 5K16A 1CSBB 3MJ5A 4HXDB 3M99A 1ITOA 2BTWB 2DCAA 3TMPA 2FYEA 4N4ZA 1UKFA 4W5CA 1AYUA 8PCHA 2NQAA 2DC6A 3N4CA 1PPOA 2ACTA 4PT5A 4DMYA 3MP2A 2ATOA 1O0EA 2JQFR 4PP1A 4D8IA 2DJFB 4QBBA 1KFUL 4CDEB 2NQGA 2YJ2A 1PBHA 1EWOA 5CVNB 1S4VA 3BPFA 1PXVA 1K3BB 5EZSA 1U9WA 1Y4HA 9PAPA 5CVOB 4PP2E 2H7JA 4XZXA 2CB5A 1Q6KA 4BS6A 2DOSA 3QJ3A 3CBJA 5EZQA 2E01A 2BU3A 3N3GA 1TU6A 2G8EA 2XU5A 3C9EA 3ZUAA 1A6RA 3QT4A 4PADA 3RVWA 2AU1A 4QH6A 3AI8A 3S3RA 1GLOA 3B79A 1ICFA 4D8EA 3BOWA 2J7QA 2JQGR 2XU3A 2FE8A 1KFXL 4RF0A 1F2AA 3PDFA 2AUZA 1POPA 2R6NA 4X6IA 4BS5A 3QSDA 1F2CA 4OELA 1M6DA 4MI7A 4Q8HA 2F1GA 2VHSA 2AS8A 3KW9A 5JZEA 2Y5BA 4YYSA 4ZTBA 3LXSA 2HXZA 3BCNA 2GFOA 4WA6A 3F75A 2DJGB 1NPZA 4HWYA 1BP4A 2FT2A 4KLBA 4YYQA 2BDZA 2R9MA 3OF9A 4XUIA 2OP3A 2FRQA 4M0WA 4YVAA 2CIOA 1SP4B 3HHIA 4YYVA 2DZYA 4OW0A 1YALA 1GECE 2PADA 1PE6A 3IUTA 5EGWA 4CDDB 2PBHA 4QRGA 1AYWA 1AU2A 1PPNA 3K9MA 5JH3A 1X9YA 5CHTA 3PNRA 4CZWA 1FH0A 3PHWA 2Y6EA 1CVZA 2AUXA 1NL6A 2HHNA
chains in the Genus database with same CATH topology
1YT7A 3V6EA 2B1MA 1DF0A 1KHQA 1AU0A 1STFE 1HUCB 2VFBA 1E2TA 3P5UA 1PPPA 4G54A 4XR7A 1XKGA 3GCBA 1MEMA 5JA7A 3USVA 1ATKA 1NB3A 1YVBA 1PADA 2PNSA 4YYWA 2FO5A 1W4TA 2YJ9A 2GHUA 3I3TA 1NLJA 3ERVA 4Q8GA 1TLOA 3WXEA 2HH5A 1U5IA 1U9XA 2AYNA 2R9NA 3IMAA 4B55A 2IBIA 3H8CA 4FK5A 1MDWA 2E00A 2DZZA 1ME4A 4W4UA 3CH2X 4QRXA 2FTDA 3PW3A 4OEMA 3HD3A 5EF4A 5A24A 4MSXA 3IOQA 4AXLA 1Y08A 1KHPA 1CJLA 2ARYA 3CBKA 2DC9A 3MHHA 1VSNA 3RVXA 3PBHA 1QOLA 1F29A 4CDFB 1MHWA 3KWZA 3KWBX 3P5VA 3F5VA 4BSQA 1GX3A 1AU3A 2E03A 4DMXA 2R9OA 3U8EA 1SNKA 1QMYA 4N79A 1CTEA 4I07A 3WXFA 3RVVA 3LTWA 2AYOA 1VJVA 3TNXA 2DC8A 2XU4A 1DEUA 4I04A 4MZSA 2E02A 1CQDA 4P6EA 1YK8A 1GCBA 4GUZA 4QRVA 1F2BA 4K7CA 1ZIVA 2P0RA 1MS6A 3HHAA 4X6HA 1AU4A 1CPJA 1ME3A 4ZUXU 1U9QX 3IEJA 3H8BA 4RY2A 1AECA 4AXMA 2YJ8A 1YK7A 3LFYA 2WBFX 5PADA 1EWLA 3H6SA 3V6CA 2BDLA 3P5WA 1NQCA 2G7YA 1MEGA 4N8WA 1BGOA 1AYVA 3OVXA 3DF0A 2B1NA 2R9FA 4CDCB 1QDQA 2OZ2A 7PCKA 2AIMA 1BQIA 5J94A 4I05A 1GMYA 4YYRA 3OVZA 1TL9A 2DCCA 1NB5A 4NV8A 2HD5A 3K8UA 1QXPA 1U9VA 2XU1A 1CB5A 4PI3A 2P7UA 3WXGA 1BY8A 1JQPA 2DCDA 3KKUA 2NQDB 1IWDA 1AIMA 3O1GA 4YYUA 3KFQA 4X6JA 3IV2A 3P5XA 4MZOA 1KXRA 3BWKA 4W5BA 3N3KA 1CS8A 2R9CA 2YJCA 1MIRA 4YV8A 5FPWA 2O6XA 3O0UA 4P6GA 3IHPA 5CHVA 2DCBA 4FJCA 3MHSA 4FIPA 6PADA 3E1ZB 3MTNA 3MORA 3OF8A 3KX1A 2DC7A 1EWMA 3HWNA 5CVMA 3KSEA 3H89A 5F02A 3I06A 2YJBA 2OULA 3OISA 2G6DA 3BPMA 2FQ9A 2AVWA 2FUDA 3D6SA 3S3QA 1W6FA 3CH3X 4BPVA 1PCIA 1CV8A 2P86A 3K24A 1EWPA 2FRAA 1THEA 3BC3A 1PIPA 4BQVA 2C0YA 3NHEA 2NQIA 2IPPB 2PREA 3H7DA 1PPDA 1ZCMA 2G8JA 1EF7A 2VHFA 2F7DA 5K16A 1CSBB 3M99A 1ITOA 1W5RA 2DCAA 2FYEA 4N4ZA 4W5CA 8PCHA 1AYUA 2NQAA 2DC6A 3N4CA 1PPOA 2ACTA 4DMYA 2BSZA 2ATOA 1O0EA 2JQFR 4PP1A 2DJFB 4QBBA 1KFUL 4CDEB 2NQGA 2YJ2A 1PBHA 1EWOA 5CVNB 1S4VA 3BPFA 1PXVA 1K3BB 1U9WA 1Y4HA 9PAPA 5CVOB 4PP2E 2H7JA 2CB5A 1Q6KA 4BS6A 2VFCA 3QJ3A 3CBJA 2E01A 3N3GA 1TU6A 2G8EA 2XU5A 3C9EA 3ZUAA 4C5PA 1A6RA 3QT4A 4PADA 3RVWA 2AU1A 4NV7A 4QH6A 3AI8A 3S3RA 1GLOA 3B79A 1ICFA 3BOWA 2JQGR 2XU3A 1KFXL 1F2AA 3PDFA 2AUZA 1POPA 2R6NA 4X6IA 4BS5A 3QSDA 1F2CA 4OELA 1M6DA 4Q8HA 2F1GA 2VHSA 2AS8A 3KW9A 2Y5BA 4YYSA 3LXSA 2HXZA 3BCNA 2GFOA 4WA6A 3F75A 2DJGB 1NPZA 4HWYA 1BP4A 2FT2A 4KLBA 4YYQA 2BDZA 2R9MA 3OF9A 4XUIA 3D9WA 2OP3A 2FRQA 4YVAA 2CIOA 1SP4B 3HHIA 4YYVA 2DZYA 1YALA 1GECE 2PADA 1PE6A 3IUTA 5EGWA 4CDDB 2PBHA 4QRGA 1AYWA 1AU2A 1PPNA 3K9MA 5JH3A 1X9YA 5CHTA 3PNRA 4CZWA 1FH0A 2Y6EA 4BGFA 1CVZA 2AUXA 1NL6A 2HHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT7 A;  3V6E A;  2B1M A;  1DF0 A;  1KHQ A;  1AU0 A;  1STF E;  1HUC B;  3P5U A;  1PPP A;  4G54 A;  4XR7 A;  1XKG A;  3GCB A;  1MEM A;  5JA7 A;  3USV A;  1ATK A;  1NB3 A;  1YVB A;  1PAD A;  2PNS A;  4YYW A;  2FO5 A;  2YJ9 A;  2GHU A;  3I3T A;  1NLJ A;  3ERV A;  4Q8G A;  1TLO A;  3WXE A;  2HH5 A;  1U5I A;  1U9X A;  2AYN A;  2R9N A;  3IMA A;  2IBI A;  3H8C A;  4FK5 A;  1MDW A;  2E00 A;  2DZZ A;  1ME4 A;  4W4U A;  3CH2 X;  4QRX A;  2FTD A;  3PW3 A;  4OEM A;  3HD3 A;  5EF4 A;  5A24 A;  4MSX A;  3IOQ A;  4AXL A;  1Y08 A;  1KHP A;  1CJL A;  2ARY A;  3CBK A;  2DC9 A;  3MHH A;  1VSN A;  3RVX A;  3PBH A;  1QOL A;  1F29 A;  4CDF B;  1MHW A;  3KWZ A;  3KWB X;  3P5V A;  3F5V A;  4BSQ A;  1AU3 A;  2E03 A;  4DMX A;  2R9O A;  3U8E A;  1SNK A;  1QMY A;  4N79 A;  1CTE A;  4I07 A;  3WXF A;  3RVV A;  2AYO A;  1VJV A;  3TNX A;  2DC8 A;  2XU4 A;  1DEU A;  4I04 A;  4MZS A;  2E02 A;  1CQD A;  4P6E A;  1YK8 A;  1GCB A;  4QRV A;  1F2B A;  4K7C A;  1ZIV A;  2P0R A;  1MS6 A;  3HHA A;  4X6H A;  1AU4 A;  1CPJ A;  1ME3 A;  4ZUX U;  1U9Q X;  3IEJ A;  3H8B A;  4RY2 A;  1AEC A;  4AXM A;  2YJ8 A;  1YK7 A;  3LFY A;  2WBF X;  5PAD A;  1EWL A;  3H6S A;  3V6C A;  2BDL A;  3P5W A;  1NQC A;  2G7Y A;  1MEG A;  4N8W A;  1BGO A;  1AYV A;  3OVX A;  3DF0 A;  2B1N A;  2R9F A;  4CDC B;  1QDQ A;  2OZ2 A;  7PCK A;  2AIM A;  1BQI A;  5J94 A;  4I05 A;  1GMY A;  4YYR A;  3OVZ A;  1TL9 A;  2DCC A;  1NB5 A;  2HD5 A;  3K8U A;  1QXP A;  1U9V A;  2XU1 A;  1CB5 A;  4PI3 A;  2P7U A;  3WXG A;  1BY8 A;  1JQP A;  2DCD A;  3KKU A;  2NQD B;  1IWD A;  1AIM A;  3O1G A;  4YYU A;  3KFQ A;  4X6J A;  3IV2 A;  3P5X A;  4MZO A;  1KXR A;  3BWK A;  4W5B A;  3N3K A;  1CS8 A;  2R9C A;  2YJC A;  1MIR A;  4YV8 A;  5FPW A;  2O6X A;  3O0U A;  4P6G A;  3IHP A;  5CHV A;  2DCB A;  4FJC A;  3MHS A;  4FIP A;  6PAD A;  3E1Z B;  3MTN A;  3MOR A;  3OF8 A;  3KX1 A;  2DC7 A;  1EWM A;  3HWN A;  5CVM A;  3KSE A;  3H89 A;  5F02 A;  3I06 A;  2YJB A;  2OUL A;  3OIS A;  2G6D A;  3BPM A;  2FQ9 A;  2AVW A;  2FUD A;  3D6S A;  3S3Q A;  3CH3 X;  4BPV A;  1PCI A;  1CV8 A;  2P86 A;  3K24 A;  1EWP A;  2FRA A;  1THE A;  3BC3 A;  1PIP A;  4BQV A;  2C0Y A;  3NHE A;  2NQI A;  2IPP B;  2PRE A;  3H7D A;  1PPD A;  1ZCM A;  2G8J A;  1EF7 A;  2VHF A;  2F7D A;  5K16 A;  1CSB B;  3M99 A;  1ITO A;  2DCA A;  2FYE A;  4N4Z A;  4W5C A;  8PCH A;  1AYU A;  2NQA A;  2DC6 A;  3N4C A;  1PPO A;  2ACT A;  4DMY A;  2ATO A;  1O0E A;  2JQF R;  4PP1 A;  2DJF B;  4QBB A;  1KFU L;  4CDE B;  2NQG A;  2YJ2 A;  1PBH A;  1EWO A;  5CVN B;  1S4V A;  3BPF A;  1PXV A;  1K3B B;  1U9W A;  1Y4H A;  9PAP A;  5CVO B;  4PP2 E;  2H7J A;  2CB5 A;  1Q6K A;  4BS6 A;  3QJ3 A;  3CBJ A;  2E01 A;  3N3G A;  1TU6 A;  2G8E A;  2XU5 A;  3C9E A;  3ZUA A;  1A6R A;  3QT4 A;  4PAD A;  3RVW A;  2AU1 A;  4QH6 A;  3AI8 A;  3S3R A;  1GLO A;  3B79 A;  1ICF A;  3BOW A;  2JQG R;  2XU3 A;  1KFX L;  1F2A A;  3PDF A;  2AUZ A;  1POP A;  2R6N A;  4X6I A;  4BS5 A;  3QSD A;  1F2C A;  4OEL A;  1M6D A;  4Q8H A;  2F1G A;  2VHS A;  2AS8 A;  3KW9 A;  2Y5B A;  4YYS A;  3LXS A;  2HXZ A;  3BCN A;  2GFO A;  4WA6 A;  3F75 A;  2DJG B;  1NPZ A;  4HWY A;  1BP4 A;  2FT2 A;  4KLB A;  4YYQ A;  2BDZ A;  2R9M A;  3OF9 A;  4XUI A;  2OP3 A;  2FRQ A;  4YVA A;  2CIO A;  1SP4 B;  3HHI A;  4YYV A;  2DZY A;  1YAL A;  1GEC E;  2PAD A;  1PE6 A;  3IUT A;  5EGW A;  4CDD B;  2PBH A;  4QRG A;  1AYW A;  1AU2 A;  1PPN A;  3K9M A;  5JH3 A;  1X9Y A;  5CHT A;  3PNR A;  4CZW A;  1FH0 A;  2Y6E A;  1CVZ A;  2AUX A;  1NL6 A;  2HHN A; 
#chains in the Genus database with same CATH topology
 1DKI A;  1YT7 A;  3V6E A;  2B1M A;  1DF0 A;  1KHQ A;  1AU0 A;  2HWK A;  1STF E;  2JTC A;  3OQC A;  2JRI A;  1HUC B;  4OVZ B;  3P5U A;  1PPP A;  4G54 A;  4XR7 A;  1XKG A;  5KO3 A;  3GCB A;  1MEM A;  5JA7 A;  3USV A;  1ATK A;  1NB3 A;  1YVB A;  2Z84 A;  3PT2 A;  3IFU A;  1PAD A;  2PNS A;  4IP3 A;  2UZJ A;  2FO5 A;  4YYW A;  2YJ9 A;  4D8B A;  2GHU A;  3I3T A;  1NLJ A;  3ERV A;  4Q8G A;  1TLO A;  4BOP A;  5E6J A;  3WXE A;  2HH5 A;  3PHX A;  4REZ A;  1U5I A;  1U9X A;  2AYN A;  2R9N A;  3IMA A;  2IBI A;  3H8C A;  4FK5 A;  1MDW A;  2E00 A;  2DZZ A;  1ME4 A;  2J7Q C;  4W4U A;  3CH2 X;  4QRX A;  2FTD A;  3PW3 A;  4OEM A;  3HD3 A;  5EF4 A;  5A24 A;  4MSX A;  3IOQ A;  4AXL A;  1Y08 A;  3PRP A;  1KHP A;  1CJL A;  2ARY A;  3CBK A;  2DC9 A;  3MHH A;  1VSN A;  3W31 A;  3RVX A;  3PBH A;  1QOL A;  1F29 A;  4RF1 A;  4CDF B;  1MHW A;  3KWZ A;  3KWB X;  3P5V A;  3F5V A;  4BSQ A;  4R3D A;  1AU3 A;  2E03 A;  4DMX A;  2R9O A;  3U8E A;  1SNK A;  1QMY A;  4N79 A;  1CTE A;  4I07 A;  3WXF A;  3RVV A;  2AYO A;  1VJV A;  3TNX A;  2DC8 A;  2XU4 A;  1DEU A;  4I04 A;  4MZS A;  2E02 A;  1CQD A;  4P6E A;  1YK8 A;  1GCB A;  4QRV A;  1F2B A;  3MTV A;  4K7C A;  3RNV A;  1ZIV A;  2P0R A;  1MS6 A;  3HHA A;  4RNA A;  4X6H A;  1AU4 A;  1CPJ A;  1ME3 A;  4ZUX U;  1U9Q X;  3IEJ A;  3H8B A;  4RY2 A;  2BTW A;  1AEC A;  4AXM A;  2YJ8 A;  1YK7 A;  3LFY A;  1PVJ A;  2WBF X;  5PAD A;  1EWL A;  3H6S A;  3PSE A;  3V6C A;  2BDL A;  3P5W A;  1NQC A;  4RKX A;  2G7Y A;  1MEG A;  4OVZ A;  4N8W A;  1BGO A;  1AYV A;  3OVX A;  3DF0 A;  2B1N A;  2R9F A;  2AGA A;  4CDC B;  1QDQ A;  2OZ2 A;  7PCK A;  2AIM A;  1BQI A;  5J94 A;  4I05 A;  4WUR A;  1GMY A;  4YYR A;  3OVZ A;  1TL9 A;  2DCC A;  1NB5 A;  2HD5 A;  4IUM A;  3K8U A;  3BBA A;  1QXP A;  1U9V A;  2XU1 A;  1CB5 A;  4PI3 A;  2P7U A;  3E9S A;  3WXG A;  3PRM A;  1BY8 A;  1JQP A;  2DCD A;  4A5U A;  3KKU A;  2NQD B;  1IWD A;  1AIM A;  3O1G A;  4YYU A;  3KFQ A;  4X6J A;  4BOQ A;  3IV2 A;  3P5X A;  4MZO A;  1KXR A;  3BWK A;  4W5B A;  3W30 A;  3N3K A;  1CS8 A;  3C0R A;  2R9C A;  2YJC A;  3BY4 A;  1MIR A;  4YV8 A;  5FPW A;  2O6X A;  3O0U A;  4P6G A;  3IHP A;  5CHV A;  2DCB A;  4FJC A;  3MHS A;  4BOS A;  4FIP A;  6PAD A;  3E1Z B;  3MTN A;  3MOR A;  3OF8 A;  3B21 A;  3KX1 A;  4P16 A;  2DC7 A;  1EWM A;  3HWN A;  5CVM A;  3KSE A;  3PHU A;  3O65 A;  3H89 A;  5F02 A;  3I06 A;  2YJB A;  2OUL A;  3OIS A;  2G6D A;  3BPM A;  2FQ9 A;  4GUA A;  2AVW A;  4BOZ A;  2FUD A;  3D6S A;  3S3Q A;  3CH3 X;  4BPV A;  4MM3 B;  1PCI A;  1CV8 A;  4BOU A;  2P86 A;  3TRK A;  3K24 A;  1EWP A;  2FRA A;  1THE A;  3ZNH A;  3BC3 A;  1PIP A;  4BQV A;  2C0Y A;  3NHE A;  2NQI A;  2IPP B;  2PRE A;  1YZB A;  3H7D A;  1PPD A;  3BB7 A;  1ZCM A;  2G8J A;  1EF7 A;  2VHF A;  2F7D A;  5K16 A;  1CSB B;  3MJ5 A;  4HXD B;  3M99 A;  1ITO A;  2BTW B;  2DCA A;  3TMP A;  2FYE A;  4N4Z A;  1UKF A;  4W5C A;  1AYU A;  8PCH A;  2NQA A;  2DC6 A;  3N4C A;  1PPO A;  2ACT A;  4PT5 A;  4DMY A;  3MP2 A;  2ATO A;  1O0E A;  2JQF R;  4PP1 A;  4D8I A;  2DJF B;  4QBB A;  1KFU L;  4CDE B;  2NQG A;  2YJ2 A;  1PBH A;  1EWO A;  5CVN B;  1S4V A;  3BPF A;  1PXV A;  1K3B B;  5EZS A;  1U9W A;  1Y4H A;  9PAP A;  5CVO B;  4PP2 E;  2H7J A;  4XZX A;  2CB5 A;  1Q6K A;  4BS6 A;  2DOS A;  3QJ3 A;  3CBJ A;  5EZQ A;  2E01 A;  2BU3 A;  3N3G A;  1TU6 A;  2G8E A;  2XU5 A;  3C9E A;  3ZUA A;  1A6R A;  3QT4 A;  4PAD A;  3RVW A;  2AU1 A;  4QH6 A;  3AI8 A;  3S3R A;  1GLO A;  3B79 A;  1ICF A;  4D8E A;  3BOW A;  2J7Q A;  2JQG R;  2XU3 A;  2FE8 A;  1KFX L;  4RF0 A;  1F2A A;  3PDF A;  2AUZ A;  1POP A;  2R6N A;  4X6I A;  4BS5 A;  3QSD A;  1F2C A;  4OEL A;  1M6D A;  4MI7 A;  4Q8H A;  2F1G A;  2VHS A;  2AS8 A;  3KW9 A;  5JZE A;  2Y5B A;  4YYS A;  4ZTB A;  3LXS A;  2HXZ A;  3BCN A;  2GFO A;  4WA6 A;  3F75 A;  2DJG B;  1NPZ A;  4HWY A;  1BP4 A;  2FT2 A;  4KLB A;  4YYQ A;  2BDZ A;  2R9M A;  3OF9 A;  4XUI A;  2OP3 A;  2FRQ A;  4M0W A;  4YVA A;  2CIO A;  1SP4 B;  3HHI A;  4YYV A;  2DZY A;  4OW0 A;  1YAL A;  1GEC E;  2PAD A;  1PE6 A;  3IUT A;  5EGW A;  4CDD B;  2PBH A;  4QRG A;  1AYW A;  1AU2 A;  1PPN A;  3K9M A;  5JH3 A;  1X9Y A;  5CHT A;  3PNR A;  4CZW A;  1FH0 A;  3PHW A;  2Y6E A;  1CVZ A;  2AUX A;  1NL6 A;  2HHN A; 
#chains in the Genus database with same CATH homology
 1YT7 A;  3V6E A;  2B1M A;  1DF0 A;  1KHQ A;  1AU0 A;  1STF E;  1HUC B;  2VFB A;  1E2T A;  3P5U A;  1PPP A;  4G54 A;  4XR7 A;  1XKG A;  3GCB A;  1MEM A;  5JA7 A;  3USV A;  1ATK A;  1NB3 A;  1YVB A;  1PAD A;  2PNS A;  4YYW A;  2FO5 A;  1W4T A;  2YJ9 A;  2GHU A;  3I3T A;  1NLJ A;  3ERV A;  4Q8G A;  1TLO A;  3WXE A;  2HH5 A;  1U5I A;  1U9X A;  2AYN A;  2R9N A;  3IMA A;  4B55 A;  2IBI A;  3H8C A;  4FK5 A;  1MDW A;  2E00 A;  2DZZ A;  1ME4 A;  4W4U A;  3CH2 X;  4QRX A;  2FTD A;  3PW3 A;  4OEM A;  3HD3 A;  5EF4 A;  5A24 A;  4MSX A;  3IOQ A;  4AXL A;  1Y08 A;  1KHP A;  1CJL A;  2ARY A;  3CBK A;  2DC9 A;  3MHH A;  1VSN A;  3RVX A;  3PBH A;  1QOL A;  1F29 A;  4CDF B;  1MHW A;  3KWZ A;  3KWB X;  3P5V A;  3F5V A;  4BSQ A;  1GX3 A;  1AU3 A;  2E03 A;  4DMX A;  2R9O A;  3U8E A;  1SNK A;  1QMY A;  4N79 A;  1CTE A;  4I07 A;  3WXF A;  3RVV A;  3LTW A;  2AYO A;  1VJV A;  3TNX A;  2DC8 A;  2XU4 A;  1DEU A;  4I04 A;  4MZS A;  2E02 A;  1CQD A;  4P6E A;  1YK8 A;  1GCB A;  4GUZ A;  4QRV A;  1F2B A;  4K7C A;  1ZIV A;  2P0R A;  1MS6 A;  3HHA A;  4X6H A;  1AU4 A;  1CPJ A;  1ME3 A;  4ZUX U;  1U9Q X;  3IEJ A;  3H8B A;  4RY2 A;  1AEC A;  4AXM A;  2YJ8 A;  1YK7 A;  3LFY A;  2WBF X;  5PAD A;  1EWL A;  3H6S A;  3V6C A;  2BDL A;  3P5W A;  1NQC A;  2G7Y A;  1MEG A;  4N8W A;  1BGO A;  1AYV A;  3OVX A;  3DF0 A;  2B1N A;  2R9F A;  4CDC B;  1QDQ A;  2OZ2 A;  7PCK A;  2AIM A;  1BQI A;  5J94 A;  4I05 A;  1GMY A;  4YYR A;  3OVZ A;  1TL9 A;  2DCC A;  1NB5 A;  4NV8 A;  2HD5 A;  3K8U A;  1QXP A;  1U9V A;  2XU1 A;  1CB5 A;  4PI3 A;  2P7U A;  3WXG A;  1BY8 A;  1JQP A;  2DCD A;  3KKU A;  2NQD B;  1IWD A;  1AIM A;  3O1G A;  4YYU A;  3KFQ A;  4X6J A;  3IV2 A;  3P5X A;  4MZO A;  1KXR A;  3BWK A;  4W5B A;  3N3K A;  1CS8 A;  2R9C A;  2YJC A;  1MIR A;  4YV8 A;  5FPW A;  2O6X A;  3O0U A;  4P6G A;  3IHP A;  5CHV A;  2DCB A;  4FJC A;  3MHS A;  4FIP A;  6PAD A;  3E1Z B;  3MTN A;  3MOR A;  3OF8 A;  3KX1 A;  2DC7 A;  1EWM A;  3HWN A;  5CVM A;  3KSE A;  3H89 A;  5F02 A;  3I06 A;  2YJB A;  2OUL A;  3OIS A;  2G6D A;  3BPM A;  2FQ9 A;  2AVW A;  2FUD A;  3D6S A;  3S3Q A;  1W6F A;  3CH3 X;  4BPV A;  1PCI A;  1CV8 A;  2P86 A;  3K24 A;  1EWP A;  2FRA A;  1THE A;  3BC3 A;  1PIP A;  4BQV A;  2C0Y A;  3NHE A;  2NQI A;  2IPP B;  2PRE A;  3H7D A;  1PPD A;  1ZCM A;  2G8J A;  1EF7 A;  2VHF A;  2F7D A;  5K16 A;  1CSB B;  3M99 A;  1ITO A;  1W5R A;  2DCA A;  2FYE A;  4N4Z A;  4W5C A;  8PCH A;  1AYU A;  2NQA A;  2DC6 A;  3N4C A;  1PPO A;  2ACT A;  4DMY A;  2BSZ A;  2ATO A;  1O0E A;  2JQF R;  4PP1 A;  2DJF B;  4QBB A;  1KFU L;  4CDE B;  2NQG A;  2YJ2 A;  1PBH A;  1EWO A;  5CVN B;  1S4V A;  3BPF A;  1PXV A;  1K3B B;  1U9W A;  1Y4H A;  9PAP A;  5CVO B;  4PP2 E;  2H7J A;  2CB5 A;  1Q6K A;  4BS6 A;  2VFC A;  3QJ3 A;  3CBJ A;  2E01 A;  3N3G A;  1TU6 A;  2G8E A;  2XU5 A;  3C9E A;  3ZUA A;  4C5P A;  1A6R A;  3QT4 A;  4PAD A;  3RVW A;  2AU1 A;  4NV7 A;  4QH6 A;  3AI8 A;  3S3R A;  1GLO A;  3B79 A;  1ICF A;  3BOW A;  2JQG R;  2XU3 A;  1KFX L;  1F2A A;  3PDF A;  2AUZ A;  1POP A;  2R6N A;  4X6I A;  4BS5 A;  3QSD A;  1F2C A;  4OEL A;  1M6D A;  4Q8H A;  2F1G A;  2VHS A;  2AS8 A;  3KW9 A;  2Y5B A;  4YYS A;  3LXS A;  2HXZ A;  3BCN A;  2GFO A;  4WA6 A;  3F75 A;  2DJG B;  1NPZ A;  4HWY A;  1BP4 A;  2FT2 A;  4KLB A;  4YYQ A;  2BDZ A;  2R9M A;  3OF9 A;  4XUI A;  3D9W A;  2OP3 A;  2FRQ A;  4YVA A;  2CIO A;  1SP4 B;  3HHI A;  4YYV A;  2DZY A;  1YAL A;  1GEC E;  2PAD A;  1PE6 A;  3IUT A;  5EGW A;  4CDD B;  2PBH A;  4QRG A;  1AYW A;  1AU2 A;  1PPN A;  3K9M A;  5JH3 A;  1X9Y A;  5CHT A;  3PNR A;  4CZW A;  1FH0 A;  2Y6E A;  4BGF A;  1CVZ A;  2AUX A;  1NL6 A;  2HHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...