1PCIA

Procaricain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
311
structure length
311
Chain Sequence
LTSTERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNNSYWLGLNEFADLSNDEFNEKYVGSLIDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDGAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The prosequence of procaricain forms an alpha-helical domain that prevents access to the substrate-binding cleft.
pubmed doi rcsb
source organism Carica papaya
molecule tags Thiol protease
molecule keywords PROCARICAIN
total genus 54
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pciA00
1POPA 1NLJA 1IWDA 3KW9A 1BP4A 4X6HA 4Q8HA 2AVWA 1MEGA 2C0YA 1Y4HA 4X6JA 1U9XA 2DCDA 3KWBX 3RVVA 2R9CA 1CV8A 2YJBA 2R9OA 2H7JA 5PADA 4FK5A 2AU1A 2WBFX 2ACTA 1PADA 4PADA 1YK8A 2FTDA 2GHUA 5CVMA 1ICFA 2HH5A 1EWOA 3IOQA 1MS6A 4AXLA 1NQCA 4MZOA 4N8WA 2P86A 1U9QX 4Q8GA 2G8EA 1ME4A 1PPDA 3QSDA 1Q6KA 3P5VA 1EWLA 3F5VA 3IMAA 2OP3A 1GECE 5CVOB 2FYEA 4KLBA 2XU5A 3MHSA 3RVWA 1AYUA 1PPOA 1NB5A 1U9VA 1QDQA 1BGOA 8PCHA 3H8CA 2G6DA 3S3QA 3F75A 3N3KA 3OF8A 4PP2E 1EWMA 1Y08A 1CS8A 1STFE 4QBBA 3I3TA 9PAPA 1YK7A 1BQIA 5FPWA 3DF0A 2E00A 2AYNA 2PNSA 1F2BA 5J94A 1AIMA 4RY2A 1PPPA 2FT2A 2YJ8A 1AYVA 3P5UA 2DJFB 1GMYA 1AECA 2PADA 5CHVA 3MHHA 2ATOA 1YT7A 3KKUA 1ZCMA 1AU0A 1GLOA 3H89A 2BDLA 4N79A 2IBIA 2CIOA 4PI3A 4W4UA 2JQFR 1DEUA 2XU4A 2XU3A 3P5XA 3V6EA 3PDFA 4BS6A 1CJLA 2R6NA 5JH3A 3NHEA 4G54A 2PREA 1DF0A 3V6CA 3N3GA 4DMYA 1YVBA 1AU3A 3PBHA 1TL9A 3IHPA 4FIPA 3BOWA 2DCAA 2OZ2A 1NPZA 1QXPA 3ERVA 3IUTA 2P7UA 3D6SA 3O1GA 4I07A 2ARYA 4I05A 4YYSA 3WXEA 3WXGA 3H6SA 3IV2A 4MZSA 2B1NA 1CB5A 2Y5BA 1CSBB 1KHQA 7PCKA 1K3BB 4BS5A 2AUZA 1U5IA 1X9YA 1AYWA 3MORA 1U9WA 3PNRA 1KHPA 2DC6A 4DMXA 3H7DA 2AS8A 1MHWA 1THEA 4OELA 4YYWA 3RVXA 3TNXA 3GCBA 3LFYA 1YALA 1PPNA 1GCBA 2R9MA 2GFOA 5JA7A 1ATKA 2E02A 2NQDB 3BC3A 3K24A 1SP4B 4BQVA 4QRGA 4OEMA 3KWZA 1S4VA 2AYOA 4CDCB 2G8JA 2FRAA 4ZUXU 1CVZA 4YYVA 2NQIA 3U8EA 5CHTA 3BCNA 2YJ9A 3CBJA 6PADA 2OULA 4N4ZA 1KFUL 4QRXA 4YYQA 1F29A 4I04A 4YV8A 2DCCA 1ZIVA 2F1GA 2DC9A 1CTEA 4CDDB 1PBHA 1PXVA 2DC7A 2DCBA 4QRVA 3M99A 1O0EA 3HWNA 5EF4A 4CZWA 3QJ3A 4P6EA 2BDZA 1SNKA 4QH6A 3AI8A 1VSNA 2Y6EA 3QT4A 1AU2A 2AUXA 1ITOA 2VHSA 2R9FA 2NQAA 3LXSA 2NQGA 2DZYA 3OISA 2F7DA 1F2CA 4W5BA 3HHAA 5EGWA 3S3RA 3O0UA 4YYRA 4BSQA 2JQGR 2E01A 4CDFB 3KSEA 1XKGA 1KFXL 2B1MA 1PCIA 1TLOA 2VHFA 1VJVA 2P0RA 2HHNA 4WA6A 3OF9A 3OVXA 2HD5A 1NL6A 1M6DA 4P6GA 2HXZA 3PW3A 4W5CA 3E1ZB 1QMYA 3CH2X 4YYUA 4HWYA 2AIMA 1EF7A 3BPFA 1TU6A 3HHIA 1FH0A 2G7YA 2E03A 2DZZA 3C9EA 1HUCB 2O6XA 1MIRA 4X6IA 1PE6A 3BPMA 2FQ9A 5A24A 2DJGB 3IEJA 4CDEB 4XUIA 3CBKA 3BWKA 1ME3A 1EWPA 1CQDA 4PP1A 3H8BA 4AXMA 4FJCA 4XR7A 3I06A 3USVA 5F02A 4YVAA 3KFQA 1MEMA 1NB3A 2PBHA 2FRQA 4K7CA 4MSXA 3HD3A 2XU1A 1JQPA 1PIPA 3CH3X 3B79A 5CVNB 1F2AA 1BY8A 2FUDA 2R9NA 2IPPB 1KXRA 2FO5A 2DC8A 1CPJA 3K8UA 4BPVA 3ZUAA 1QOLA 2YJCA 1AU4A 1MDWA 3N4CA 5K16A 3OVZA 3K9MA 1A6RA 2YJ2A 3WXFA 3MTNA 3P5WA 3KX1A 2CB5A
chains in the Genus database with same CATH superfamily
1POPA 1NLJA 1IWDA 3KW9A 1BP4A 4X6HA 1UKFA 4Q8HA 4R3DA 2AVWA 1MEGA 4RNAA 2C0YA 1Y4HA 3PRMA 4X6JA 1U9XA 3BB7A 2DCDA 3KWBX 4BOUA 3RVVA 2R9CA 1CV8A 2YJBA 2R9OA 2H7JA 5PADA 4FK5A 2AU1A 4BOPA 2WBFX 2ACTA 2AGAA 1PADA 4PADA 1YK8A 2FTDA 2GHUA 5CVMA 2Z84A 1ICFA 2HWKA 2HH5A 1EWOA 3IOQA 2JTCA 1MS6A 4AXLA 4D8BA 1NQCA 5E6JA 4MZOA 4N8WA 2P86A 1U9QX 4Q8GA 2G8EA 1ME4A 1PPDA 3QSDA 1Q6KA 1PVJA 3PRPA 3P5VA 1EWLA 3F5VA 3IMAA 2OP3A 2J7QA 1GECE 5CVOB 2FYEA 4KLBA 2XU5A 3MHSA 3RVWA 1AYUA 1PPOA 1NB5A 1U9VA 3BY4A 3OQCA 1QDQA 1BGOA 8PCHA 5EZSA 3H8CA 2G6DA 4MM3B 3S3QA 3F75A 3N3KA 3OF8A 4RF0A 4PP2E 1EWMA 1DKIA 1Y08A 1CS8A 1STFE 4QBBA 3I3TA 2BU3A 9PAPA 1YK7A 1BQIA 4IP3A 4OVZA 5FPWA 3DF0A 2E00A 2AYNA 2PNSA 1F2BA 5J94A 1AIMA 4RY2A 1PPPA 2FT2A 2YJ8A 1AYVA 3P5UA 2DJFB 1GMYA 1AECA 2PADA 5CHVA 3MHHA 2ATOA 1YT7A 3KKUA 4ZTBA 3O65A 1ZCMA 1AU0A 1GLOA 3H89A 2BDLA 4N79A 2IBIA 3MTVA 2CIOA 3RNVA 3MJ5A 4PI3A 3PHXA 4W4UA 2JQFR 4REZA 1DEUA 2XU4A 2XU3A 3P5XA 3V6EA 3PHUA 3PDFA 4BS6A 1CJLA 2R6NA 5JH3A 3NHEA 4G54A 2PREA 2FE8A 1DF0A 3C0RA 3V6CA 3N3GA 4DMYA 1YVBA 1AU3A 3PBHA 1TL9A 3IHPA 4FIPA 3BOWA 2DCAA 2OZ2A 1NPZA 1QXPA 3ERVA 3IUTA 2P7UA 3D6SA 3O1GA 4I07A 2ARYA 4I05A 4YYSA 3WXEA 3WXGA 3H6SA 3IV2A 4MZSA 2B1NA 1CB5A 2Y5BA 1CSBB 1KHQA 7PCKA 1K3BB 4BS5A 4D8IA 2AUZA 1U5IA 1X9YA 4HXDB 3PSEA 4PT5A 1AYWA 3MORA 1U9WA 3PNRA 1KHPA 2DC6A 4DMXA 4RF1A 3W30A 3H7DA 2AS8A 1MHWA 1THEA 4OELA 4A5UA 3E9SA 4YYWA 3RVXA 3TNXA 3GCBA 3LFYA 1YALA 1PPNA 1GCBA 2R9MA 2GFOA 5JA7A 1ATKA 3TMPA 4OW0A 3B21A 2E02A 2NQDB 4D8EA 3BC3A 3K24A 2DOSA 3MP2A 1SP4B 4BQVA 4QRGA 4OEMA 3KWZA 1S4VA 2AYOA 4CDCB 2G8JA 2FRAA 3W31A 4ZUXU 1CVZA 4YYVA 2NQIA 3U8EA 5CHTA 3BCNA 2YJ9A 3CBJA 6PADA 2OULA 4N4ZA 1KFUL 4QRXA 4YYQA 1F29A 4I04A 4YV8A 2DCCA 1ZIVA 2F1GA 2DC9A 1CTEA 5KO3A 4CDDB 1PBHA 1PXVA 4MI7A 2DC7A 2DCBA 4QRVA 4BOZA 3M99A 1O0EA 3HWNA 4WURA 5EF4A 4CZWA 3QJ3A 4P6EA 2BDZA 1SNKA 4QH6A 1YZBA 3AI8A 1VSNA 2Y6EA 4IUMA 3QT4A 1AU2A 2AUXA 1ITOA 2VHSA 2R9FA 2NQAA 3LXSA 2NQGA 2DZYA 3OISA 2F7DA 2BTWA 4BOSA 2JRIA 1F2CA 4W5BA 3HHAA 5EGWA 3S3RA 3O0UA 4YYRA 4BSQA 2JQGR 2BTWB 3TRKA 2E01A 4CDFB 3KSEA 1XKGA 1KFXL 2B1MA 1PCIA 1TLOA 2VHFA 1VJVA 2P0RA 2HHNA 3PT2A 3OF9A 4WA6A 3OVXA 4RKXA 2HD5A 1NL6A 1M6DA 4P6GA 2HXZA 3PW3A 4W5CA 5JZEA 3E1ZB 1QMYA 3CH2X 4YYUA 4HWYA 2AIMA 1EF7A 3BPFA 1TU6A 3HHIA 1FH0A 2G7YA 2E03A 4BOQA 2DZZA 3C9EA 1HUCB 2O6XA 1MIRA 4X6IA 1PE6A 3BPMA 2FQ9A 4GUAA 4XZXA 5A24A 2DJGB 3IEJA 4CDEB 4XUIA 3CBKA 3BWKA 1ME3A 1EWPA 1CQDA 3H8BA 4PP1A 4AXMA 4FJCA 3ZNHA 4XR7A 3I06A 3USVA 5F02A 4YVAA 4OVZB 3KFQA 1MEMA 1NB3A 4P16A 2PBHA 2FRQA 4K7CA 4MSXA 3HD3A 2XU1A 1JQPA 1PIPA 3CH3X 3B79A 5CVNB 1F2AA 1BY8A 2FUDA 2R9NA 3PHWA 2IPPB 1KXRA 2FO5A 5EZQA 2DC8A 1CPJA 3K8UA 4M0WA 4BPVA 3ZUAA 1QOLA 2YJCA 1AU4A 1MDWA 3N4CA 5K16A 3OVZA 3BBAA 3K9MA 1A6RA 2YJ2A 3WXFA 3IFUA 3MTNA 3P5WA 3KX1A 2UZJA 2CB5A 2J7QC
chains in the Genus database with same CATH topology
1POPA 1NLJA 1IWDA 3KW9A 1BP4A 4X6HA 4Q8HA 2AVWA 1MEGA 2C0YA 1Y4HA 4X6JA 1U9XA 2DCDA 3KWBX 3RVVA 2R9CA 1CV8A 2YJBA 2R9OA 2H7JA 5PADA 4FK5A 2AU1A 2WBFX 2ACTA 1PADA 4PADA 1YK8A 2FTDA 2GHUA 5CVMA 1ICFA 2HH5A 1EWOA 1GX3A 3IOQA 1MS6A 4AXLA 1NQCA 4MZOA 4N8WA 2P86A 1U9QX 4Q8GA 2G8EA 1ME4A 1PPDA 3QSDA 1Q6KA 3P5VA 1EWLA 3F5VA 3IMAA 2OP3A 1GECE 5CVOB 2FYEA 4KLBA 2XU5A 3MHSA 3RVWA 1AYUA 1PPOA 1NB5A 1U9VA 1QDQA 1BGOA 2VFCA 8PCHA 3H8CA 2G6DA 3S3QA 3F75A 3N3KA 3OF8A 4PP2E 1EWMA 1Y08A 1CS8A 1STFE 4QBBA 3I3TA 4GUZA 9PAPA 1YK7A 1BQIA 5FPWA 3DF0A 2E00A 2AYNA 2PNSA 1F2BA 5J94A 1AIMA 4RY2A 1PPPA 2FT2A 2YJ8A 1AYVA 3P5UA 2DJFB 1GMYA 1AECA 2PADA 5CHVA 3MHHA 2ATOA 1YT7A 3KKUA 1ZCMA 1AU0A 1GLOA 3H89A 2BDLA 4N79A 2IBIA 2CIOA 4PI3A 4W4UA 2JQFR 1DEUA 2XU4A 2XU3A 3P5XA 3V6EA 3PDFA 4BS6A 1CJLA 2R6NA 5JH3A 3NHEA 4G54A 4BGFA 2PREA 1DF0A 3V6CA 3N3GA 4DMYA 1YVBA 4NV7A 1AU3A 3PBHA 1TL9A 3IHPA 4FIPA 3BOWA 2DCAA 2OZ2A 1NPZA 1QXPA 3ERVA 3IUTA 2P7UA 3D6SA 3O1GA 4I07A 2ARYA 4I05A 4YYSA 3WXEA 3WXGA 3H6SA 3IV2A 4MZSA 2B1NA 1CB5A 2Y5BA 1CSBB 1KHQA 7PCKA 1K3BB 4BS5A 2AUZA 1U5IA 1W4TA 1X9YA 1AYWA 3MORA 1U9WA 3PNRA 1KHPA 2DC6A 4DMXA 4C5PA 3H7DA 2AS8A 1MHWA 1THEA 4OELA 1W5RA 4YYWA 3RVXA 3TNXA 3GCBA 3LFYA 1YALA 1PPNA 1GCBA 2R9MA 2GFOA 5JA7A 1ATKA 2E02A 2NQDB 3BC3A 3K24A 1SP4B 4BQVA 4QRGA 4OEMA 3KWZA 1S4VA 2AYOA 4CDCB 2G8JA 2FRAA 4ZUXU 1CVZA 4YYVA 2NQIA 3U8EA 2VFBA 5CHTA 3BCNA 2YJ9A 3CBJA 6PADA 2OULA 4N4ZA 1KFUL 4QRXA 4YYQA 1F29A 4I04A 4YV8A 2DCCA 1ZIVA 2F1GA 2DC9A 1CTEA 4CDDB 1PBHA 1PXVA 2DC7A 2DCBA 4QRVA 3M99A 1O0EA 3HWNA 5EF4A 4CZWA 3QJ3A 4P6EA 2BDZA 1SNKA 4QH6A 3AI8A 1VSNA 2Y6EA 3QT4A 1AU2A 2AUXA 3LTWA 1ITOA 2VHSA 2R9FA 2NQAA 3LXSA 2NQGA 2DZYA 3OISA 2F7DA 1F2CA 4W5BA 3HHAA 5EGWA 3S3RA 3O0UA 4YYRA 4BSQA 2JQGR 2E01A 4CDFB 3KSEA 1XKGA 1KFXL 2B1MA 1PCIA 1TLOA 2VHFA 1VJVA 2P0RA 2HHNA 4WA6A 3OF9A 3OVXA 2HD5A 1NL6A 1M6DA 4P6GA 2HXZA 3PW3A 4W5CA 3E1ZB 1QMYA 3CH2X 4YYUA 4HWYA 2AIMA 1EF7A 3BPFA 1TU6A 3HHIA 1FH0A 2G7YA 2E03A 2DZZA 3C9EA 1HUCB 2O6XA 1MIRA 4X6IA 1PE6A 3BPMA 2FQ9A 5A24A 2DJGB 3IEJA 4CDEB 4XUIA 3CBKA 3BWKA 1ME3A 1EWPA 1CQDA 4PP1A 3H8BA 4AXMA 4FJCA 4XR7A 1W6FA 3I06A 3USVA 2BSZA 5F02A 4YVAA 3KFQA 1MEMA 1NB3A 2PBHA 2FRQA 4K7CA 4MSXA 3HD3A 2XU1A 1JQPA 1PIPA 3CH3X 3B79A 4B55A 5CVNB 1F2AA 1BY8A 2FUDA 2R9NA 2IPPB 1KXRA 2FO5A 2DC8A 4NV8A 1E2TA 1CPJA 3K8UA 4BPVA 3ZUAA 1QOLA 2YJCA 1AU4A 1MDWA 3N4CA 5K16A 3OVZA 3K9MA 1A6RA 2YJ2A 3WXFA 3MTNA 3P5WA 3KX1A 2CB5A 3D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POP A;  1NLJ A;  1IWD A;  3KW9 A;  1BP4 A;  4X6H A;  4Q8H A;  2AVW A;  1MEG A;  2C0Y A;  1Y4H A;  4X6J A;  1U9X A;  2DCD A;  3KWB X;  3RVV A;  2R9C A;  1CV8 A;  2YJB A;  2R9O A;  2H7J A;  5PAD A;  4FK5 A;  2AU1 A;  2WBF X;  2ACT A;  1PAD A;  4PAD A;  1YK8 A;  2FTD A;  2GHU A;  5CVM A;  1ICF A;  2HH5 A;  1EWO A;  3IOQ A;  1MS6 A;  4AXL A;  1NQC A;  4MZO A;  4N8W A;  2P86 A;  1U9Q X;  4Q8G A;  2G8E A;  1ME4 A;  1PPD A;  3QSD A;  1Q6K A;  3P5V A;  1EWL A;  3F5V A;  3IMA A;  2OP3 A;  1GEC E;  5CVO B;  2FYE A;  4KLB A;  2XU5 A;  3MHS A;  3RVW A;  1AYU A;  1PPO A;  1NB5 A;  1U9V A;  1QDQ A;  1BGO A;  8PCH A;  3H8C A;  2G6D A;  3S3Q A;  3F75 A;  3N3K A;  3OF8 A;  4PP2 E;  1EWM A;  1Y08 A;  1CS8 A;  1STF E;  4QBB A;  3I3T A;  9PAP A;  1YK7 A;  1BQI A;  5FPW A;  3DF0 A;  2E00 A;  2AYN A;  2PNS A;  1F2B A;  5J94 A;  1AIM A;  4RY2 A;  1PPP A;  2FT2 A;  2YJ8 A;  1AYV A;  3P5U A;  2DJF B;  1GMY A;  1AEC A;  2PAD A;  5CHV A;  3MHH A;  2ATO A;  1YT7 A;  3KKU A;  1ZCM A;  1AU0 A;  1GLO A;  3H89 A;  2BDL A;  4N79 A;  2IBI A;  2CIO A;  4PI3 A;  4W4U A;  2JQF R;  1DEU A;  2XU4 A;  2XU3 A;  3P5X A;  3V6E A;  3PDF A;  4BS6 A;  1CJL A;  2R6N A;  5JH3 A;  3NHE A;  4G54 A;  2PRE A;  1DF0 A;  3V6C A;  3N3G A;  4DMY A;  1YVB A;  1AU3 A;  3PBH A;  1TL9 A;  3IHP A;  4FIP A;  3BOW A;  2DCA A;  2OZ2 A;  1NPZ A;  1QXP A;  3ERV A;  3IUT A;  2P7U A;  3D6S A;  3O1G A;  4I07 A;  2ARY A;  4I05 A;  4YYS A;  3WXE A;  3WXG A;  3H6S A;  3IV2 A;  4MZS A;  2B1N A;  1CB5 A;  2Y5B A;  1CSB B;  1KHQ A;  7PCK A;  1K3B B;  4BS5 A;  2AUZ A;  1U5I A;  1X9Y A;  1AYW A;  3MOR A;  1U9W A;  3PNR A;  1KHP A;  2DC6 A;  4DMX A;  3H7D A;  2AS8 A;  1MHW A;  1THE A;  4OEL A;  4YYW A;  3RVX A;  3TNX A;  3GCB A;  3LFY A;  1YAL A;  1PPN A;  1GCB A;  2R9M A;  2GFO A;  5JA7 A;  1ATK A;  2E02 A;  2NQD B;  3BC3 A;  3K24 A;  1SP4 B;  4BQV A;  4QRG A;  4OEM A;  3KWZ A;  1S4V A;  2AYO A;  4CDC B;  2G8J A;  2FRA A;  4ZUX U;  1CVZ A;  4YYV A;  2NQI A;  3U8E A;  5CHT A;  3BCN A;  2YJ9 A;  3CBJ A;  6PAD A;  2OUL A;  4N4Z A;  1KFU L;  4QRX A;  4YYQ A;  1F29 A;  4I04 A;  4YV8 A;  2DCC A;  1ZIV A;  2F1G A;  2DC9 A;  1CTE A;  4CDD B;  1PBH A;  1PXV A;  2DC7 A;  2DCB A;  4QRV A;  3M99 A;  1O0E A;  3HWN A;  5EF4 A;  4CZW A;  3QJ3 A;  4P6E A;  2BDZ A;  1SNK A;  4QH6 A;  3AI8 A;  1VSN A;  2Y6E A;  3QT4 A;  1AU2 A;  2AUX A;  1ITO A;  2VHS A;  2R9F A;  2NQA A;  3LXS A;  2NQG A;  2DZY A;  3OIS A;  2F7D A;  1F2C A;  4W5B A;  3HHA A;  5EGW A;  3S3R A;  3O0U A;  4YYR A;  4BSQ A;  2JQG R;  2E01 A;  4CDF B;  3KSE A;  1XKG A;  1KFX L;  2B1M A;  1PCI A;  1TLO A;  2VHF A;  1VJV A;  2P0R A;  2HHN A;  4WA6 A;  3OF9 A;  3OVX A;  2HD5 A;  1NL6 A;  1M6D A;  4P6G A;  2HXZ A;  3PW3 A;  4W5C A;  3E1Z B;  1QMY A;  3CH2 X;  4YYU A;  4HWY A;  2AIM A;  1EF7 A;  3BPF A;  1TU6 A;  3HHI A;  1FH0 A;  2G7Y A;  2E03 A;  2DZZ A;  3C9E A;  1HUC B;  2O6X A;  1MIR A;  4X6I A;  1PE6 A;  3BPM A;  2FQ9 A;  5A24 A;  2DJG B;  3IEJ A;  4CDE B;  4XUI A;  3CBK A;  3BWK A;  1ME3 A;  1EWP A;  1CQD A;  4PP1 A;  3H8B A;  4AXM A;  4FJC A;  4XR7 A;  3I06 A;  3USV A;  5F02 A;  4YVA A;  3KFQ A;  1MEM A;  1NB3 A;  2PBH A;  2FRQ A;  4K7C A;  4MSX A;  3HD3 A;  2XU1 A;  1JQP A;  1PIP A;  3CH3 X;  3B79 A;  5CVN B;  1F2A A;  1BY8 A;  2FUD A;  2R9N A;  2IPP B;  1KXR A;  2FO5 A;  2DC8 A;  1CPJ A;  3K8U A;  4BPV A;  3ZUA A;  1QOL A;  2YJC A;  1AU4 A;  1MDW A;  3N4C A;  5K16 A;  3OVZ A;  3K9M A;  1A6R A;  2YJ2 A;  3WXF A;  3MTN A;  3P5W A;  3KX1 A;  2CB5 A; 
#chains in the Genus database with same CATH topology
 1POP A;  1NLJ A;  1IWD A;  3KW9 A;  1BP4 A;  4X6H A;  1UKF A;  4Q8H A;  4R3D A;  2AVW A;  1MEG A;  4RNA A;  2C0Y A;  1Y4H A;  3PRM A;  4X6J A;  1U9X A;  3BB7 A;  2DCD A;  3KWB X;  4BOU A;  3RVV A;  2R9C A;  1CV8 A;  2YJB A;  2R9O A;  2H7J A;  5PAD A;  4FK5 A;  2AU1 A;  4BOP A;  2WBF X;  2ACT A;  2AGA A;  1PAD A;  4PAD A;  1YK8 A;  2FTD A;  2GHU A;  5CVM A;  2Z84 A;  1ICF A;  2HWK A;  2HH5 A;  1EWO A;  3IOQ A;  2JTC A;  1MS6 A;  4AXL A;  4D8B A;  1NQC A;  5E6J A;  4MZO A;  4N8W A;  2P86 A;  1U9Q X;  4Q8G A;  2G8E A;  1ME4 A;  1PPD A;  3QSD A;  1Q6K A;  1PVJ A;  3PRP A;  3P5V A;  1EWL A;  3F5V A;  3IMA A;  2OP3 A;  2J7Q A;  1GEC E;  5CVO B;  2FYE A;  4KLB A;  2XU5 A;  3MHS A;  3RVW A;  1AYU A;  1PPO A;  1NB5 A;  1U9V A;  3BY4 A;  3OQC A;  1QDQ A;  1BGO A;  8PCH A;  5EZS A;  3H8C A;  2G6D A;  4MM3 B;  3S3Q A;  3F75 A;  3N3K A;  3OF8 A;  4RF0 A;  4PP2 E;  1EWM A;  1DKI A;  1Y08 A;  1CS8 A;  1STF E;  4QBB A;  3I3T A;  2BU3 A;  9PAP A;  1YK7 A;  1BQI A;  4IP3 A;  4OVZ A;  5FPW A;  3DF0 A;  2E00 A;  2AYN A;  2PNS A;  1F2B A;  5J94 A;  1AIM A;  4RY2 A;  1PPP A;  2FT2 A;  2YJ8 A;  1AYV A;  3P5U A;  2DJF B;  1GMY A;  1AEC A;  2PAD A;  5CHV A;  3MHH A;  2ATO A;  1YT7 A;  3KKU A;  4ZTB A;  3O65 A;  1ZCM A;  1AU0 A;  1GLO A;  3H89 A;  2BDL A;  4N79 A;  2IBI A;  3MTV A;  2CIO A;  3RNV A;  3MJ5 A;  4PI3 A;  3PHX A;  4W4U A;  2JQF R;  4REZ A;  1DEU A;  2XU4 A;  2XU3 A;  3P5X A;  3V6E A;  3PHU A;  3PDF A;  4BS6 A;  1CJL A;  2R6N A;  5JH3 A;  3NHE A;  4G54 A;  2PRE A;  2FE8 A;  1DF0 A;  3C0R A;  3V6C A;  3N3G A;  4DMY A;  1YVB A;  1AU3 A;  3PBH A;  1TL9 A;  3IHP A;  4FIP A;  3BOW A;  2DCA A;  2OZ2 A;  1NPZ A;  1QXP A;  3ERV A;  3IUT A;  2P7U A;  3D6S A;  3O1G A;  4I07 A;  2ARY A;  4I05 A;  4YYS A;  3WXE A;  3WXG A;  3H6S A;  3IV2 A;  4MZS A;  2B1N A;  1CB5 A;  2Y5B A;  1CSB B;  1KHQ A;  7PCK A;  1K3B B;  4BS5 A;  4D8I A;  2AUZ A;  1U5I A;  1X9Y A;  4HXD B;  3PSE A;  4PT5 A;  1AYW A;  3MOR A;  1U9W A;  3PNR A;  1KHP A;  2DC6 A;  4DMX A;  4RF1 A;  3W30 A;  3H7D A;  2AS8 A;  1MHW A;  1THE A;  4OEL A;  4A5U A;  3E9S A;  4YYW A;  3RVX A;  3TNX A;  3GCB A;  3LFY A;  1YAL A;  1PPN A;  1GCB A;  2R9M A;  2GFO A;  5JA7 A;  1ATK A;  3TMP A;  4OW0 A;  3B21 A;  2E02 A;  2NQD B;  4D8E A;  3BC3 A;  3K24 A;  2DOS A;  3MP2 A;  1SP4 B;  4BQV A;  4QRG A;  4OEM A;  3KWZ A;  1S4V A;  2AYO A;  4CDC B;  2G8J A;  2FRA A;  3W31 A;  4ZUX U;  1CVZ A;  4YYV A;  2NQI A;  3U8E A;  5CHT A;  3BCN A;  2YJ9 A;  3CBJ A;  6PAD A;  2OUL A;  4N4Z A;  1KFU L;  4QRX A;  4YYQ A;  1F29 A;  4I04 A;  4YV8 A;  2DCC A;  1ZIV A;  2F1G A;  2DC9 A;  1CTE A;  5KO3 A;  4CDD B;  1PBH A;  1PXV A;  4MI7 A;  2DC7 A;  2DCB A;  4QRV A;  4BOZ A;  3M99 A;  1O0E A;  3HWN A;  4WUR A;  5EF4 A;  4CZW A;  3QJ3 A;  4P6E A;  2BDZ A;  1SNK A;  4QH6 A;  1YZB A;  3AI8 A;  1VSN A;  2Y6E A;  4IUM A;  3QT4 A;  1AU2 A;  2AUX A;  1ITO A;  2VHS A;  2R9F A;  2NQA A;  3LXS A;  2NQG A;  2DZY A;  3OIS A;  2F7D A;  2BTW A;  4BOS A;  2JRI A;  1F2C A;  4W5B A;  3HHA A;  5EGW A;  3S3R A;  3O0U A;  4YYR A;  4BSQ A;  2JQG R;  2BTW B;  3TRK A;  2E01 A;  4CDF B;  3KSE A;  1XKG A;  1KFX L;  2B1M A;  1PCI A;  1TLO A;  2VHF A;  1VJV A;  2P0R A;  2HHN A;  3PT2 A;  3OF9 A;  4WA6 A;  3OVX A;  4RKX A;  2HD5 A;  1NL6 A;  1M6D A;  4P6G A;  2HXZ A;  3PW3 A;  4W5C A;  5JZE A;  3E1Z B;  1QMY A;  3CH2 X;  4YYU A;  4HWY A;  2AIM A;  1EF7 A;  3BPF A;  1TU6 A;  3HHI A;  1FH0 A;  2G7Y A;  2E03 A;  4BOQ A;  2DZZ A;  3C9E A;  1HUC B;  2O6X A;  1MIR A;  4X6I A;  1PE6 A;  3BPM A;  2FQ9 A;  4GUA A;  4XZX A;  5A24 A;  2DJG B;  3IEJ A;  4CDE B;  4XUI A;  3CBK A;  3BWK A;  1ME3 A;  1EWP A;  1CQD A;  3H8B A;  4PP1 A;  4AXM A;  4FJC A;  3ZNH A;  4XR7 A;  3I06 A;  3USV A;  5F02 A;  4YVA A;  4OVZ B;  3KFQ A;  1MEM A;  1NB3 A;  4P16 A;  2PBH A;  2FRQ A;  4K7C A;  4MSX A;  3HD3 A;  2XU1 A;  1JQP A;  1PIP A;  3CH3 X;  3B79 A;  5CVN B;  1F2A A;  1BY8 A;  2FUD A;  2R9N A;  3PHW A;  2IPP B;  1KXR A;  2FO5 A;  5EZQ A;  2DC8 A;  1CPJ A;  3K8U A;  4M0W A;  4BPV A;  3ZUA A;  1QOL A;  2YJC A;  1AU4 A;  1MDW A;  3N4C A;  5K16 A;  3OVZ A;  3BBA A;  3K9M A;  1A6R A;  2YJ2 A;  3WXF A;  3IFU A;  3MTN A;  3P5W A;  3KX1 A;  2UZJ A;  2CB5 A;  2J7Q C; 
#chains in the Genus database with same CATH homology
 1POP A;  1NLJ A;  1IWD A;  3KW9 A;  1BP4 A;  4X6H A;  4Q8H A;  2AVW A;  1MEG A;  2C0Y A;  1Y4H A;  4X6J A;  1U9X A;  2DCD A;  3KWB X;  3RVV A;  2R9C A;  1CV8 A;  2YJB A;  2R9O A;  2H7J A;  5PAD A;  4FK5 A;  2AU1 A;  2WBF X;  2ACT A;  1PAD A;  4PAD A;  1YK8 A;  2FTD A;  2GHU A;  5CVM A;  1ICF A;  2HH5 A;  1EWO A;  1GX3 A;  3IOQ A;  1MS6 A;  4AXL A;  1NQC A;  4MZO A;  4N8W A;  2P86 A;  1U9Q X;  4Q8G A;  2G8E A;  1ME4 A;  1PPD A;  3QSD A;  1Q6K A;  3P5V A;  1EWL A;  3F5V A;  3IMA A;  2OP3 A;  1GEC E;  5CVO B;  2FYE A;  4KLB A;  2XU5 A;  3MHS A;  3RVW A;  1AYU A;  1PPO A;  1NB5 A;  1U9V A;  1QDQ A;  1BGO A;  2VFC A;  8PCH A;  3H8C A;  2G6D A;  3S3Q A;  3F75 A;  3N3K A;  3OF8 A;  4PP2 E;  1EWM A;  1Y08 A;  1CS8 A;  1STF E;  4QBB A;  3I3T A;  4GUZ A;  9PAP A;  1YK7 A;  1BQI A;  5FPW A;  3DF0 A;  2E00 A;  2AYN A;  2PNS A;  1F2B A;  5J94 A;  1AIM A;  4RY2 A;  1PPP A;  2FT2 A;  2YJ8 A;  1AYV A;  3P5U A;  2DJF B;  1GMY A;  1AEC A;  2PAD A;  5CHV A;  3MHH A;  2ATO A;  1YT7 A;  3KKU A;  1ZCM A;  1AU0 A;  1GLO A;  3H89 A;  2BDL A;  4N79 A;  2IBI A;  2CIO A;  4PI3 A;  4W4U A;  2JQF R;  1DEU A;  2XU4 A;  2XU3 A;  3P5X A;  3V6E A;  3PDF A;  4BS6 A;  1CJL A;  2R6N A;  5JH3 A;  3NHE A;  4G54 A;  4BGF A;  2PRE A;  1DF0 A;  3V6C A;  3N3G A;  4DMY A;  1YVB A;  4NV7 A;  1AU3 A;  3PBH A;  1TL9 A;  3IHP A;  4FIP A;  3BOW A;  2DCA A;  2OZ2 A;  1NPZ A;  1QXP A;  3ERV A;  3IUT A;  2P7U A;  3D6S A;  3O1G A;  4I07 A;  2ARY A;  4I05 A;  4YYS A;  3WXE A;  3WXG A;  3H6S A;  3IV2 A;  4MZS A;  2B1N A;  1CB5 A;  2Y5B A;  1CSB B;  1KHQ A;  7PCK A;  1K3B B;  4BS5 A;  2AUZ A;  1U5I A;  1W4T A;  1X9Y A;  1AYW A;  3MOR A;  1U9W A;  3PNR A;  1KHP A;  2DC6 A;  4DMX A;  4C5P A;  3H7D A;  2AS8 A;  1MHW A;  1THE A;  4OEL A;  1W5R A;  4YYW A;  3RVX A;  3TNX A;  3GCB A;  3LFY A;  1YAL A;  1PPN A;  1GCB A;  2R9M A;  2GFO A;  5JA7 A;  1ATK A;  2E02 A;  2NQD B;  3BC3 A;  3K24 A;  1SP4 B;  4BQV A;  4QRG A;  4OEM A;  3KWZ A;  1S4V A;  2AYO A;  4CDC B;  2G8J A;  2FRA A;  4ZUX U;  1CVZ A;  4YYV A;  2NQI A;  3U8E A;  2VFB A;  5CHT A;  3BCN A;  2YJ9 A;  3CBJ A;  6PAD A;  2OUL A;  4N4Z A;  1KFU L;  4QRX A;  4YYQ A;  1F29 A;  4I04 A;  4YV8 A;  2DCC A;  1ZIV A;  2F1G A;  2DC9 A;  1CTE A;  4CDD B;  1PBH A;  1PXV A;  2DC7 A;  2DCB A;  4QRV A;  3M99 A;  1O0E A;  3HWN A;  5EF4 A;  4CZW A;  3QJ3 A;  4P6E A;  2BDZ A;  1SNK A;  4QH6 A;  3AI8 A;  1VSN A;  2Y6E A;  3QT4 A;  1AU2 A;  2AUX A;  3LTW A;  1ITO A;  2VHS A;  2R9F A;  2NQA A;  3LXS A;  2NQG A;  2DZY A;  3OIS A;  2F7D A;  1F2C A;  4W5B A;  3HHA A;  5EGW A;  3S3R A;  3O0U A;  4YYR A;  4BSQ A;  2JQG R;  2E01 A;  4CDF B;  3KSE A;  1XKG A;  1KFX L;  2B1M A;  1PCI A;  1TLO A;  2VHF A;  1VJV A;  2P0R A;  2HHN A;  4WA6 A;  3OF9 A;  3OVX A;  2HD5 A;  1NL6 A;  1M6D A;  4P6G A;  2HXZ A;  3PW3 A;  4W5C A;  3E1Z B;  1QMY A;  3CH2 X;  4YYU A;  4HWY A;  2AIM A;  1EF7 A;  3BPF A;  1TU6 A;  3HHI A;  1FH0 A;  2G7Y A;  2E03 A;  2DZZ A;  3C9E A;  1HUC B;  2O6X A;  1MIR A;  4X6I A;  1PE6 A;  3BPM A;  2FQ9 A;  5A24 A;  2DJG B;  3IEJ A;  4CDE B;  4XUI A;  3CBK A;  3BWK A;  1ME3 A;  1EWP A;  1CQD A;  4PP1 A;  3H8B A;  4AXM A;  4FJC A;  4XR7 A;  1W6F A;  3I06 A;  3USV A;  2BSZ A;  5F02 A;  4YVA A;  3KFQ A;  1MEM A;  1NB3 A;  2PBH A;  2FRQ A;  4K7C A;  4MSX A;  3HD3 A;  2XU1 A;  1JQP A;  1PIP A;  3CH3 X;  3B79 A;  4B55 A;  5CVN B;  1F2A A;  1BY8 A;  2FUD A;  2R9N A;  2IPP B;  1KXR A;  2FO5 A;  2DC8 A;  4NV8 A;  1E2T A;  1CPJ A;  3K8U A;  4BPV A;  3ZUA A;  1QOL A;  2YJC A;  1AU4 A;  1MDW A;  3N4C A;  5K16 A;  3OVZ A;  3K9M A;  1A6R A;  2YJ2 A;  3WXF A;  3MTN A;  3P5W A;  3KX1 A;  2CB5 A;  3D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...