1PCIA

Procaricain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
311
structure length
311
Chain Sequence
LTSTERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNNSYWLGLNEFADLSNDEFNEKYVGSLIDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDGAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Thiol protease
molecule keywords PROCARICAIN
publication title The prosequence of procaricain forms an alpha-helical domain that prevents access to the substrate-binding cleft.
pubmed doi rcsb
source organism Carica papaya
total genus 54
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pciA00
2AUZA 4X6IA 2R9NA 1AU3A 1EWLA 2HD5A 4PI3A 5FPWA 2DC7A 4KLBA 1BP4A 1NPZA 2JQGR 1X9YA 3PNRA 3PDFA 3IUTA 3H7DA 4CDFB 1AYWA 1GMYA 3E1ZB 2HHNA 1KFXL 2E00A 1ME3A 2YJ2A 1U9WA 3O1GA 4P6EA 3S3RA 3AI8A 5J94A 1SNKA 2AS8A 1POPA 1PPOA 3BOWA 1KXRA 4PP1A 2F7DA 3OVXA 3KX1A 1A6RA 5K16A 1K3BB 4QRXA 2HXZA 1DF0A 3K9MA 1PADA 2YJBA 4X6HA 2XU5A 5CHTA 1FH0A 4XUIA 1QMYA 1PBHA 1CJLA 5A24A 1AU0A 1TL9A 2FT2A 3RVWA 3N4CA 2NQGA 2G8JA 1CB5A 3BPMA 4FK5A 1NB5A 4PADA 1MEGA 1U9XA 2PNSA 1MDWA 1NLJA 1AIMA 1M6DA 1KFUL 3QT4A 1F2CA 2XU3A 2FTDA 1F2BA 4N4ZA 4BS6A 1ME4A 4BS5A 3KSEA 2DCBA 3HWNA 5CVMA 1YK7A 1ICFA 1AYUA 3IMAA 1S4VA 1U5IA 3QSDA 2B1NA 2GFOA 2PREA 2DCDA 2IPPB 3OISA 3H89A 3U8EA 3HHIA 1PPNA 2WBFX 3P5VA 3V6CA 3BPFA 3P5WA 3KW9A 2OP3A 3KKUA 4QRGA 1MS6A 1CSBB 4DMXA 3WXFA 4X6JA 4XR7A 1ZCMA 1YALA 1KHPA 2DCCA 2H7JA 3USVA 2DZZA 2XU1A 4N79A 1MHWA 2PADA 3V6EA 7PCKA 2AUXA 4G54A 4W5CA 3KWZA 2E03A 3P5UA 4YYRA 4Q8GA 3N3KA 3MHHA 3RVVA 1F29A 1NB3A 1THEA 2FQ9A 3N3GA 2YJCA 3WXGA 4W4UA 3MORA 4YYQA 2NQAA 2DJGB 1U9QX 1YVBA 3PW3A 2CIOA 1EWOA 3BCNA 5EF4A 4BSQA 3BC3A 3QJ3A 3CH2X 3KFQA 3ZUAA 3HD3A 4I07A 4FJCA 2OULA 1NL6A 1PPPA 4N8WA 2YJ9A 1U9VA 3OF9A 2Y5BA 1IWDA 2FYEA 4DMYA 4Q8HA 1QXPA 1CVZA 2HH5A 3MTNA 4CZWA 2IBIA 3ERVA 1NQCA 4AXLA 1ZIVA 1KHQA 3H8BA 1STFE 4YYUA 1F2AA 1TU6A 2VHFA 4CDDB 1PXVA 2DC6A 2Y6EA 1AYVA 1MIRA 2C0YA 3HHAA 1CTEA 3P5XA 2DJFB 2O6XA 1BGOA 3GCBA 4AXMA 3D6SA 1JQPA 2OZ2A 4YVAA 4OELA 1DEUA 3I3TA 1EF7A 1CS8A 1Q6KA 1O0EA 1TLOA 2R9OA 3B79A 4PP2E 3K24A 4K7CA 2AIMA 2P0RA 2CB5A 2BDLA 3RVXA 1Y4HA 2DZYA 3IV2A 4FIPA 2FO5A 3MHSA 3C9EA 4ZUXU 9PAPA 2JQFR 3KWBX 3BWKA 2BDZA 5CVNB 8PCHA 3O0UA 1CPJA 3OVZA 1AU2A 3IOQA 5EGWA 2F1GA 4MZSA 4OEMA 2E01A 4MZOA 3M99A 1PIPA 3F75A 4BPVA 1MEMA 2R6NA 5JA7A 1VSNA 2FRAA 4RY2A 5JH3A 1AECA 2G7YA 1PCIA 1EWMA 2E02A 1CV8A 1BY8A 3H8CA 1XKGA 3K8UA 2AU1A 1AU4A 4HWYA 4YV8A 2AYNA 1ITOA 3CBKA 2AYOA 1PE6A 2NQDB 1YK8A 1VJVA 2VHSA 4CDEB 5F02A 3CH3X 3TNXA 2FRQA 4YYVA 2GHUA 4YYWA 3F5VA 3NHEA 2P86A 3S3QA 4QRVA 2ATOA 5PADA 1Y08A 2B1MA 2DC8A 3DF0A 1ATKA 3WXEA 2YJ8A 4BQVA 1CQDA 3H6SA 2R9FA 1QOLA 1YT7A 2R9CA 4QBBA 6PADA 4I05A 4YYSA 2G8EA 3OF8A 1GLOA 5CHVA 4CDCB 4MSXA 2G6DA 1GCBA 2ACTA 4QH6A 2NQIA 4W5BA 1QDQA 1PPDA 3PBHA 1BQIA 2DCAA 2DC9A 4I04A 1GECE 1EWPA 2AVWA 1SP4B 2ARYA 2P7UA 2PBHA 1HUCB 2FUDA 2R9MA 5CVOB 3LFYA 3LXSA 4WA6A 3CBJA 2XU4A 3IHPA 3IEJA 4P6GA 3I06A
chains in the Genus database with same CATH superfamily
2AUZA 4X6IA 2R9NA 2BU3A 1AU3A 1EWLA 2HD5A 1YZBA 4PI3A 5FPWA 2DC7A 4KLBA 1BP4A 4RF0A 1NPZA 4BOSA 4RNAA 2JQGR 1X9YA 3PNRA 3PDFA 3IUTA 2BTWA 3H7DA 4CDFB 1AYWA 1GMYA 3E1ZB 2HHNA 1KFXL 2E00A 1ME3A 2YJ2A 1U9WA 3O1GA 4P6EA 3S3RA 3AI8A 5J94A 1SNKA 2AS8A 1POPA 4A5UA 1PPOA 3BOWA 1KXRA 4PP1A 2F7DA 3OVXA 3KX1A 1A6RA 5K16A 1K3BB 4QRXA 2HXZA 1DF0A 3K9MA 4IP3A 1PADA 2YJBA 4X6HA 2XU5A 5CHTA 1FH0A 4XUIA 1QMYA 1PBHA 4IUMA 1CJLA 5A24A 1AU0A 1TL9A 2FT2A 3RVWA 3N4CA 2NQGA 2G8JA 1CB5A 3BPMA 4FK5A 1NB5A 4PADA 1MEGA 1U9XA 2PNSA 1MDWA 1NLJA 1AIMA 4BOZA 1M6DA 1KFUL 3QT4A 1F2CA 2XU3A 2FTDA 3OQCA 1F2BA 4N4ZA 4BS6A 1ME4A 4BS5A 3KSEA 2DCBA 3HWNA 5CVMA 1YK7A 1ICFA 1AYUA 3ZNHA 3IMAA 1S4VA 1U5IA 3QSDA 2B1NA 2GFOA 2PREA 2DCDA 2IPPB 3OISA 4ZTBA 3H89A 3U8EA 3HHIA 3W30A 1PPNA 2WBFX 3P5VA 3V6CA 3BPFA 3P5WA 3KW9A 2OP3A 3KKUA 4QRGA 1MS6A 1CSBB 3RNVA 4DMXA 2JTCA 3WXFA 4XZXA 2BTWB 4X6JA 3IFUA 4XR7A 1ZCMA 1YALA 1KHPA 3PHUA 2DCCA 2H7JA 3USVA 2DZZA 2XU1A 4N79A 1MHWA 2PADA 3MP2A 3V6EA 7PCKA 2AUXA 4G54A 4W5CA 3KWZA 2E03A 2Z84A 3P5UA 4YYRA 4Q8GA 3N3KA 3MHHA 3RVVA 1F29A 1NB3A 1THEA 2FQ9A 2UZJA 3N3GA 2YJCA 3WXGA 4W4UA 3MORA 4YYQA 2NQAA 4RF1A 2DJGB 1U9QX 1YVBA 3PW3A 2CIOA 1EWOA 3BCNA 5EF4A 3C0RA 4D8BA 3BB7A 4BSQA 3BC3A 3QJ3A 3CH2X 3KFQA 4GUAA 5KO3A 3ZUAA 3HD3A 2JRIA 3PRMA 4I07A 3MTVA 4FJCA 2J7QC 2OULA 4BOPA 1NL6A 1PPPA 4OW0A 3TMPA 4N8WA 2YJ9A 1U9VA 3OF9A 2Y5BA 1IWDA 2FYEA 4MI7A 4DMYA 4Q8HA 1QXPA 1CVZA 2HH5A 3MTNA 4RKXA 4CZWA 2IBIA 3ERVA 1NQCA 4AXLA 1ZIVA 1KHQA 3BY4A 3H8BA 1STFE 4YYUA 1F2AA 1TU6A 2VHFA 4CDDB 1PXVA 2DC6A 2Y6EA 1AYVA 1MIRA 2C0YA 4M0WA 3HHAA 1CTEA 3P5XA 2DJFB 4REZA 2O6XA 1BGOA 4D8EA 3GCBA 3PSEA 3PHXA 4AXMA 3PT2A 3D6SA 1JQPA 2OZ2A 4YVAA 4OELA 1DEUA 2J7QA 4BOQA 3I3TA 1EF7A 3B21A 1CS8A 1Q6KA 1O0EA 1TLOA 2R9OA 3B79A 3BBAA 4PP2E 3K24A 4K7CA 2AIMA 2P0RA 2CB5A 2BDLA 3RVXA 1Y4HA 2DZYA 3IV2A 4FIPA 2FO5A 3MHSA 3C9EA 4ZUXU 9PAPA 2JQFR 3KWBX 3BWKA 2BDZA 5CVNB 8PCHA 3O0UA 1CPJA 3OVZA 1AU2A 3IOQA 5EGWA 2F1GA 4MZSA 4OEMA 4P16A 2E01A 4MZOA 5EZQA 3M99A 1PIPA 3F75A 2AGAA 4BPVA 1MEMA 2R6NA 4PT5A 5JA7A 1VSNA 2FRAA 4RY2A 5JH3A 1AECA 2G7YA 1UKFA 1PCIA 1EWMA 2E02A 1CV8A 1BY8A 3H8CA 1XKGA 3K8UA 2AU1A 4WURA 1AU4A 4HWYA 4YV8A 2AYNA 3E9SA 1ITOA 4R3DA 3CBKA 5E6JA 2AYOA 1PE6A 1PVJA 3MJ5A 2NQDB 1YK8A 1VJVA 2VHSA 4CDEB 5F02A 3CH3X 3TNXA 2FRQA 4YYVA 2GHUA 4MM3B 4YYWA 3F5VA 3NHEA 5EZSA 2P86A 3S3QA 5JZEA 4QRVA 2ATOA 5PADA 1Y08A 2B1MA 2DC8A 3DF0A 1ATKA 3WXEA 2YJ8A 4BOUA 1CQDA 4BQVA 3H6SA 2R9FA 1QOLA 1YT7A 2R9CA 4QBBA 6PADA 3W31A 4I05A 4YYSA 2G8EA 3OF8A 1GLOA 5CHVA 4CDCB 2DOSA 4MSXA 2G6DA 1GCBA 2ACTA 4QH6A 2NQIA 3PRPA 3TRKA 2FE8A 4OVZB 4W5BA 3PHWA 4HXDB 1QDQA 4D8IA 1PPDA 3O65A 2HWKA 3PBHA 1BQIA 1DKIA 2DCAA 2DC9A 4I04A 1GECE 1EWPA 2AVWA 4OVZA 1SP4B 2ARYA 2P7UA 2PBHA 1HUCB 2FUDA 2R9MA 5CVOB 3LFYA 3LXSA 4WA6A 3CBJA 2XU4A 3IHPA 3IEJA 4P6GA 3I06A
chains in the Genus database with same CATH topology
2AUZA 4BGFA 4X6IA 2R9NA 1AU3A 1EWLA 2HD5A 4PI3A 5FPWA 2DC7A 4KLBA 1BP4A 4NV7A 1NPZA 2JQGR 1X9YA 3PNRA 3PDFA 3IUTA 3H7DA 4CDFB 1AYWA 1GMYA 3E1ZB 2HHNA 1KFXL 2E00A 1ME3A 2YJ2A 1U9WA 3LTWA 3O1GA 4P6EA 3S3RA 3AI8A 5J94A 1SNKA 2AS8A 1POPA 1PPOA 3BOWA 1KXRA 4PP1A 2F7DA 3OVXA 3KX1A 1A6RA 5K16A 1K3BB 4QRXA 2HXZA 1DF0A 3K9MA 1PADA 2YJBA 4X6HA 2XU5A 5CHTA 1FH0A 1W6FA 4XUIA 1QMYA 1PBHA 1CJLA 5A24A 1AU0A 1TL9A 2FT2A 3RVWA 3N4CA 2NQGA 2G8JA 1CB5A 3BPMA 4FK5A 1NB5A 4PADA 1MEGA 1U9XA 2PNSA 1MDWA 1NLJA 1AIMA 1M6DA 1KFUL 3QT4A 1F2CA 2XU3A 2FTDA 1F2BA 4N4ZA 4BS6A 1ME4A 4BS5A 3KSEA 2VFCA 2DCBA 3HWNA 5CVMA 1YK7A 1ICFA 1AYUA 3IMAA 1S4VA 1U5IA 3QSDA 2B1NA 2GFOA 2PREA 2DCDA 2IPPB 3OISA 3H89A 3U8EA 3HHIA 1PPNA 2WBFX 3P5VA 3V6CA 3BPFA 3P5WA 3KW9A 2OP3A 3KKUA 4QRGA 1MS6A 1CSBB 4DMXA 3WXFA 4X6JA 4XR7A 1ZCMA 1YALA 1KHPA 2DCCA 4B55A 2H7JA 3USVA 2DZZA 2XU1A 4N79A 1MHWA 2PADA 3V6EA 7PCKA 2AUXA 4G54A 4W5CA 3KWZA 2E03A 3P5UA 4YYRA 4Q8GA 3N3KA 3MHHA 3RVVA 1F29A 1NB3A 1THEA 2FQ9A 3N3GA 2YJCA 3WXGA 4W4UA 3MORA 4YYQA 2NQAA 2DJGB 1U9QX 1YVBA 3PW3A 2CIOA 1EWOA 3BCNA 5EF4A 4BSQA 3BC3A 3QJ3A 3CH2X 3KFQA 3ZUAA 3HD3A 4I07A 4FJCA 2OULA 1NL6A 1PPPA 4N8WA 2YJ9A 1U9VA 3OF9A 2Y5BA 1IWDA 2FYEA 4DMYA 4Q8HA 1QXPA 1CVZA 2HH5A 3MTNA 1GX3A 4CZWA 2IBIA 3ERVA 1NQCA 4AXLA 1ZIVA 1KHQA 3H8BA 1STFE 4YYUA 1F2AA 1TU6A 2VHFA 4CDDB 1PXVA 2DC6A 2Y6EA 1E2TA 1AYVA 1MIRA 2C0YA 3HHAA 1CTEA 3P5XA 2DJFB 2O6XA 1BGOA 3GCBA 4AXMA 3D6SA 1JQPA 1W5RA 2BSZA 2OZ2A 4YVAA 4OELA 1DEUA 3I3TA 1EF7A 1CS8A 1Q6KA 1O0EA 1TLOA 2R9OA 3B79A 4C5PA 4PP2E 3K24A 4K7CA 2AIMA 2P0RA 2CB5A 2BDLA 3RVXA 1Y4HA 2DZYA 3IV2A 4FIPA 2FO5A 3D9WA 3MHSA 3C9EA 4ZUXU 9PAPA 2JQFR 3KWBX 3BWKA 2BDZA 5CVNB 8PCHA 3O0UA 1CPJA 3OVZA 1AU2A 3IOQA 5EGWA 2F1GA 4MZSA 4OEMA 2E01A 1W4TA 4MZOA 3M99A 1PIPA 3F75A 4BPVA 1MEMA 2R6NA 5JA7A 1VSNA 2FRAA 4RY2A 5JH3A 1AECA 2G7YA 2VFBA 1PCIA 1EWMA 2E02A 1CV8A 1BY8A 3H8CA 1XKGA 3K8UA 2AU1A 1AU4A 4HWYA 4YV8A 2AYNA 1ITOA 3CBKA 2AYOA 1PE6A 2NQDB 1YK8A 1VJVA 2VHSA 4CDEB 5F02A 3CH3X 3TNXA 2FRQA 4YYVA 2GHUA 4YYWA 3F5VA 3NHEA 2P86A 3S3QA 4QRVA 2ATOA 5PADA 1Y08A 2B1MA 2DC8A 3DF0A 1ATKA 3WXEA 2YJ8A 4BQVA 1CQDA 3H6SA 2R9FA 1QOLA 1YT7A 2R9CA 4QBBA 6PADA 4I05A 4YYSA 2G8EA 3OF8A 1GLOA 5CHVA 4CDCB 4GUZA 4MSXA 2G6DA 1GCBA 2ACTA 4NV8A 4QH6A 2NQIA 4W5BA 1QDQA 1PPDA 3PBHA 1BQIA 2DCAA 2DC9A 4I04A 1GECE 1EWPA 2AVWA 1SP4B 2ARYA 2P7UA 2PBHA 1HUCB 2FUDA 2R9MA 5CVOB 3LFYA 3LXSA 4WA6A 3CBJA 2XU4A 3IHPA 3IEJA 4P6GA 3I06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUZ A;  4X6I A;  2R9N A;  1AU3 A;  1EWL A;  2HD5 A;  4PI3 A;  5FPW A;  2DC7 A;  4KLB A;  1BP4 A;  1NPZ A;  2JQG R;  1X9Y A;  3PNR A;  3PDF A;  3IUT A;  3H7D A;  4CDF B;  1AYW A;  1GMY A;  3E1Z B;  2HHN A;  1KFX L;  2E00 A;  1ME3 A;  2YJ2 A;  1U9W A;  3O1G A;  4P6E A;  3S3R A;  3AI8 A;  5J94 A;  1SNK A;  2AS8 A;  1POP A;  1PPO A;  3BOW A;  1KXR A;  4PP1 A;  2F7D A;  3OVX A;  3KX1 A;  1A6R A;  5K16 A;  1K3B B;  4QRX A;  2HXZ A;  1DF0 A;  3K9M A;  1PAD A;  2YJB A;  4X6H A;  2XU5 A;  5CHT A;  1FH0 A;  4XUI A;  1QMY A;  1PBH A;  1CJL A;  5A24 A;  1AU0 A;  1TL9 A;  2FT2 A;  3RVW A;  3N4C A;  2NQG A;  2G8J A;  1CB5 A;  3BPM A;  4FK5 A;  1NB5 A;  4PAD A;  1MEG A;  1U9X A;  2PNS A;  1MDW A;  1NLJ A;  1AIM A;  1M6D A;  1KFU L;  3QT4 A;  1F2C A;  2XU3 A;  2FTD A;  1F2B A;  4N4Z A;  4BS6 A;  1ME4 A;  4BS5 A;  3KSE A;  2DCB A;  3HWN A;  5CVM A;  1YK7 A;  1ICF A;  1AYU A;  3IMA A;  1S4V A;  1U5I A;  3QSD A;  2B1N A;  2GFO A;  2PRE A;  2DCD A;  2IPP B;  3OIS A;  3H89 A;  3U8E A;  3HHI A;  1PPN A;  2WBF X;  3P5V A;  3V6C A;  3BPF A;  3P5W A;  3KW9 A;  2OP3 A;  3KKU A;  4QRG A;  1MS6 A;  1CSB B;  4DMX A;  3WXF A;  4X6J A;  4XR7 A;  1ZCM A;  1YAL A;  1KHP A;  2DCC A;  2H7J A;  3USV A;  2DZZ A;  2XU1 A;  4N79 A;  1MHW A;  2PAD A;  3V6E A;  7PCK A;  2AUX A;  4G54 A;  4W5C A;  3KWZ A;  2E03 A;  3P5U A;  4YYR A;  4Q8G A;  3N3K A;  3MHH A;  3RVV A;  1F29 A;  1NB3 A;  1THE A;  2FQ9 A;  3N3G A;  2YJC A;  3WXG A;  4W4U A;  3MOR A;  4YYQ A;  2NQA A;  2DJG B;  1U9Q X;  1YVB A;  3PW3 A;  2CIO A;  1EWO A;  3BCN A;  5EF4 A;  4BSQ A;  3BC3 A;  3QJ3 A;  3CH2 X;  3KFQ A;  3ZUA A;  3HD3 A;  4I07 A;  4FJC A;  2OUL A;  1NL6 A;  1PPP A;  4N8W A;  2YJ9 A;  1U9V A;  3OF9 A;  2Y5B A;  1IWD A;  2FYE A;  4DMY A;  4Q8H A;  1QXP A;  1CVZ A;  2HH5 A;  3MTN A;  4CZW A;  2IBI A;  3ERV A;  1NQC A;  4AXL A;  1ZIV A;  1KHQ A;  3H8B A;  1STF E;  4YYU A;  1F2A A;  1TU6 A;  2VHF A;  4CDD B;  1PXV A;  2DC6 A;  2Y6E A;  1AYV A;  1MIR A;  2C0Y A;  3HHA A;  1CTE A;  3P5X A;  2DJF B;  2O6X A;  1BGO A;  3GCB A;  4AXM A;  3D6S A;  1JQP A;  2OZ2 A;  4YVA A;  4OEL A;  1DEU A;  3I3T A;  1EF7 A;  1CS8 A;  1Q6K A;  1O0E A;  1TLO A;  2R9O A;  3B79 A;  4PP2 E;  3K24 A;  4K7C A;  2AIM A;  2P0R A;  2CB5 A;  2BDL A;  3RVX A;  1Y4H A;  2DZY A;  3IV2 A;  4FIP A;  2FO5 A;  3MHS A;  3C9E A;  4ZUX U;  9PAP A;  2JQF R;  3KWB X;  3BWK A;  2BDZ A;  5CVN B;  8PCH A;  3O0U A;  1CPJ A;  3OVZ A;  1AU2 A;  3IOQ A;  5EGW A;  2F1G A;  4MZS A;  4OEM A;  2E01 A;  4MZO A;  3M99 A;  1PIP A;  3F75 A;  4BPV A;  1MEM A;  2R6N A;  5JA7 A;  1VSN A;  2FRA A;  4RY2 A;  5JH3 A;  1AEC A;  2G7Y A;  1PCI A;  1EWM A;  2E02 A;  1CV8 A;  1BY8 A;  3H8C A;  1XKG A;  3K8U A;  2AU1 A;  1AU4 A;  4HWY A;  4YV8 A;  2AYN A;  1ITO A;  3CBK A;  2AYO A;  1PE6 A;  2NQD B;  1YK8 A;  1VJV A;  2VHS A;  4CDE B;  5F02 A;  3CH3 X;  3TNX A;  2FRQ A;  4YYV A;  2GHU A;  4YYW A;  3F5V A;  3NHE A;  2P86 A;  3S3Q A;  4QRV A;  2ATO A;  5PAD A;  1Y08 A;  2B1M A;  2DC8 A;  3DF0 A;  1ATK A;  3WXE A;  2YJ8 A;  4BQV A;  1CQD A;  3H6S A;  2R9F A;  1QOL A;  1YT7 A;  2R9C A;  4QBB A;  6PAD A;  4I05 A;  4YYS A;  2G8E A;  3OF8 A;  1GLO A;  5CHV A;  4CDC B;  4MSX A;  2G6D A;  1GCB A;  2ACT A;  4QH6 A;  2NQI A;  4W5B A;  1QDQ A;  1PPD A;  3PBH A;  1BQI A;  2DCA A;  2DC9 A;  4I04 A;  1GEC E;  1EWP A;  2AVW A;  1SP4 B;  2ARY A;  2P7U A;  2PBH A;  1HUC B;  2FUD A;  2R9M A;  5CVO B;  3LFY A;  3LXS A;  4WA6 A;  3CBJ A;  2XU4 A;  3IHP A;  3IEJ A;  4P6G A;  3I06 A; 
#chains in the Genus database with same CATH topology
 2AUZ A;  4X6I A;  2R9N A;  2BU3 A;  1AU3 A;  1EWL A;  2HD5 A;  1YZB A;  4PI3 A;  5FPW A;  2DC7 A;  4KLB A;  1BP4 A;  4RF0 A;  1NPZ A;  4BOS A;  4RNA A;  2JQG R;  1X9Y A;  3PNR A;  3PDF A;  3IUT A;  2BTW A;  3H7D A;  4CDF B;  1AYW A;  1GMY A;  3E1Z B;  2HHN A;  1KFX L;  2E00 A;  1ME3 A;  2YJ2 A;  1U9W A;  3O1G A;  4P6E A;  3S3R A;  3AI8 A;  5J94 A;  1SNK A;  2AS8 A;  1POP A;  4A5U A;  1PPO A;  3BOW A;  1KXR A;  4PP1 A;  2F7D A;  3OVX A;  3KX1 A;  1A6R A;  5K16 A;  1K3B B;  4QRX A;  2HXZ A;  1DF0 A;  3K9M A;  4IP3 A;  1PAD A;  2YJB A;  4X6H A;  2XU5 A;  5CHT A;  1FH0 A;  4XUI A;  1QMY A;  1PBH A;  4IUM A;  1CJL A;  5A24 A;  1AU0 A;  1TL9 A;  2FT2 A;  3RVW A;  3N4C A;  2NQG A;  2G8J A;  1CB5 A;  3BPM A;  4FK5 A;  1NB5 A;  4PAD A;  1MEG A;  1U9X A;  2PNS A;  1MDW A;  1NLJ A;  1AIM A;  4BOZ A;  1M6D A;  1KFU L;  3QT4 A;  1F2C A;  2XU3 A;  2FTD A;  3OQC A;  1F2B A;  4N4Z A;  4BS6 A;  1ME4 A;  4BS5 A;  3KSE A;  2DCB A;  3HWN A;  5CVM A;  1YK7 A;  1ICF A;  1AYU A;  3ZNH A;  3IMA A;  1S4V A;  1U5I A;  3QSD A;  2B1N A;  2GFO A;  2PRE A;  2DCD A;  2IPP B;  3OIS A;  4ZTB A;  3H89 A;  3U8E A;  3HHI A;  3W30 A;  1PPN A;  2WBF X;  3P5V A;  3V6C A;  3BPF A;  3P5W A;  3KW9 A;  2OP3 A;  3KKU A;  4QRG A;  1MS6 A;  1CSB B;  3RNV A;  4DMX A;  2JTC A;  3WXF A;  4XZX A;  2BTW B;  4X6J A;  3IFU A;  4XR7 A;  1ZCM A;  1YAL A;  1KHP A;  3PHU A;  2DCC A;  2H7J A;  3USV A;  2DZZ A;  2XU1 A;  4N79 A;  1MHW A;  2PAD A;  3MP2 A;  3V6E A;  7PCK A;  2AUX A;  4G54 A;  4W5C A;  3KWZ A;  2E03 A;  2Z84 A;  3P5U A;  4YYR A;  4Q8G A;  3N3K A;  3MHH A;  3RVV A;  1F29 A;  1NB3 A;  1THE A;  2FQ9 A;  2UZJ A;  3N3G A;  2YJC A;  3WXG A;  4W4U A;  3MOR A;  4YYQ A;  2NQA A;  4RF1 A;  2DJG B;  1U9Q X;  1YVB A;  3PW3 A;  2CIO A;  1EWO A;  3BCN A;  5EF4 A;  3C0R A;  4D8B A;  3BB7 A;  4BSQ A;  3BC3 A;  3QJ3 A;  3CH2 X;  3KFQ A;  4GUA A;  5KO3 A;  3ZUA A;  3HD3 A;  2JRI A;  3PRM A;  4I07 A;  3MTV A;  4FJC A;  2J7Q C;  2OUL A;  4BOP A;  1NL6 A;  1PPP A;  4OW0 A;  3TMP A;  4N8W A;  2YJ9 A;  1U9V A;  3OF9 A;  2Y5B A;  1IWD A;  2FYE A;  4MI7 A;  4DMY A;  4Q8H A;  1QXP A;  1CVZ A;  2HH5 A;  3MTN A;  4RKX A;  4CZW A;  2IBI A;  3ERV A;  1NQC A;  4AXL A;  1ZIV A;  1KHQ A;  3BY4 A;  3H8B A;  1STF E;  4YYU A;  1F2A A;  1TU6 A;  2VHF A;  4CDD B;  1PXV A;  2DC6 A;  2Y6E A;  1AYV A;  1MIR A;  2C0Y A;  4M0W A;  3HHA A;  1CTE A;  3P5X A;  2DJF B;  4REZ A;  2O6X A;  1BGO A;  4D8E A;  3GCB A;  3PSE A;  3PHX A;  4AXM A;  3PT2 A;  3D6S A;  1JQP A;  2OZ2 A;  4YVA A;  4OEL A;  1DEU A;  2J7Q A;  4BOQ A;  3I3T A;  1EF7 A;  3B21 A;  1CS8 A;  1Q6K A;  1O0E A;  1TLO A;  2R9O A;  3B79 A;  3BBA A;  4PP2 E;  3K24 A;  4K7C A;  2AIM A;  2P0R A;  2CB5 A;  2BDL A;  3RVX A;  1Y4H A;  2DZY A;  3IV2 A;  4FIP A;  2FO5 A;  3MHS A;  3C9E A;  4ZUX U;  9PAP A;  2JQF R;  3KWB X;  3BWK A;  2BDZ A;  5CVN B;  8PCH A;  3O0U A;  1CPJ A;  3OVZ A;  1AU2 A;  3IOQ A;  5EGW A;  2F1G A;  4MZS A;  4OEM A;  4P16 A;  2E01 A;  4MZO A;  5EZQ A;  3M99 A;  1PIP A;  3F75 A;  2AGA A;  4BPV A;  1MEM A;  2R6N A;  4PT5 A;  5JA7 A;  1VSN A;  2FRA A;  4RY2 A;  5JH3 A;  1AEC A;  2G7Y A;  1UKF A;  1PCI A;  1EWM A;  2E02 A;  1CV8 A;  1BY8 A;  3H8C A;  1XKG A;  3K8U A;  2AU1 A;  4WUR A;  1AU4 A;  4HWY A;  4YV8 A;  2AYN A;  3E9S A;  1ITO A;  4R3D A;  3CBK A;  5E6J A;  2AYO A;  1PE6 A;  1PVJ A;  3MJ5 A;  2NQD B;  1YK8 A;  1VJV A;  2VHS A;  4CDE B;  5F02 A;  3CH3 X;  3TNX A;  2FRQ A;  4YYV A;  2GHU A;  4MM3 B;  4YYW A;  3F5V A;  3NHE A;  5EZS A;  2P86 A;  3S3Q A;  5JZE A;  4QRV A;  2ATO A;  5PAD A;  1Y08 A;  2B1M A;  2DC8 A;  3DF0 A;  1ATK A;  3WXE A;  2YJ8 A;  4BOU A;  1CQD A;  4BQV A;  3H6S A;  2R9F A;  1QOL A;  1YT7 A;  2R9C A;  4QBB A;  6PAD A;  3W31 A;  4I05 A;  4YYS A;  2G8E A;  3OF8 A;  1GLO A;  5CHV A;  4CDC B;  2DOS A;  4MSX A;  2G6D A;  1GCB A;  2ACT A;  4QH6 A;  2NQI A;  3PRP A;  3TRK A;  2FE8 A;  4OVZ B;  4W5B A;  3PHW A;  4HXD B;  1QDQ A;  4D8I A;  1PPD A;  3O65 A;  2HWK A;  3PBH A;  1BQI A;  1DKI A;  2DCA A;  2DC9 A;  4I04 A;  1GEC E;  1EWP A;  2AVW A;  4OVZ A;  1SP4 B;  2ARY A;  2P7U A;  2PBH A;  1HUC B;  2FUD A;  2R9M A;  5CVO B;  3LFY A;  3LXS A;  4WA6 A;  3CBJ A;  2XU4 A;  3IHP A;  3IEJ A;  4P6G A;  3I06 A; 
#chains in the Genus database with same CATH homology
 2AUZ A;  4BGF A;  4X6I A;  2R9N A;  1AU3 A;  1EWL A;  2HD5 A;  4PI3 A;  5FPW A;  2DC7 A;  4KLB A;  1BP4 A;  4NV7 A;  1NPZ A;  2JQG R;  1X9Y A;  3PNR A;  3PDF A;  3IUT A;  3H7D A;  4CDF B;  1AYW A;  1GMY A;  3E1Z B;  2HHN A;  1KFX L;  2E00 A;  1ME3 A;  2YJ2 A;  1U9W A;  3LTW A;  3O1G A;  4P6E A;  3S3R A;  3AI8 A;  5J94 A;  1SNK A;  2AS8 A;  1POP A;  1PPO A;  3BOW A;  1KXR A;  4PP1 A;  2F7D A;  3OVX A;  3KX1 A;  1A6R A;  5K16 A;  1K3B B;  4QRX A;  2HXZ A;  1DF0 A;  3K9M A;  1PAD A;  2YJB A;  4X6H A;  2XU5 A;  5CHT A;  1FH0 A;  1W6F A;  4XUI A;  1QMY A;  1PBH A;  1CJL A;  5A24 A;  1AU0 A;  1TL9 A;  2FT2 A;  3RVW A;  3N4C A;  2NQG A;  2G8J A;  1CB5 A;  3BPM A;  4FK5 A;  1NB5 A;  4PAD A;  1MEG A;  1U9X A;  2PNS A;  1MDW A;  1NLJ A;  1AIM A;  1M6D A;  1KFU L;  3QT4 A;  1F2C A;  2XU3 A;  2FTD A;  1F2B A;  4N4Z A;  4BS6 A;  1ME4 A;  4BS5 A;  3KSE A;  2VFC A;  2DCB A;  3HWN A;  5CVM A;  1YK7 A;  1ICF A;  1AYU A;  3IMA A;  1S4V A;  1U5I A;  3QSD A;  2B1N A;  2GFO A;  2PRE A;  2DCD A;  2IPP B;  3OIS A;  3H89 A;  3U8E A;  3HHI A;  1PPN A;  2WBF X;  3P5V A;  3V6C A;  3BPF A;  3P5W A;  3KW9 A;  2OP3 A;  3KKU A;  4QRG A;  1MS6 A;  1CSB B;  4DMX A;  3WXF A;  4X6J A;  4XR7 A;  1ZCM A;  1YAL A;  1KHP A;  2DCC A;  4B55 A;  2H7J A;  3USV A;  2DZZ A;  2XU1 A;  4N79 A;  1MHW A;  2PAD A;  3V6E A;  7PCK A;  2AUX A;  4G54 A;  4W5C A;  3KWZ A;  2E03 A;  3P5U A;  4YYR A;  4Q8G A;  3N3K A;  3MHH A;  3RVV A;  1F29 A;  1NB3 A;  1THE A;  2FQ9 A;  3N3G A;  2YJC A;  3WXG A;  4W4U A;  3MOR A;  4YYQ A;  2NQA A;  2DJG B;  1U9Q X;  1YVB A;  3PW3 A;  2CIO A;  1EWO A;  3BCN A;  5EF4 A;  4BSQ A;  3BC3 A;  3QJ3 A;  3CH2 X;  3KFQ A;  3ZUA A;  3HD3 A;  4I07 A;  4FJC A;  2OUL A;  1NL6 A;  1PPP A;  4N8W A;  2YJ9 A;  1U9V A;  3OF9 A;  2Y5B A;  1IWD A;  2FYE A;  4DMY A;  4Q8H A;  1QXP A;  1CVZ A;  2HH5 A;  3MTN A;  1GX3 A;  4CZW A;  2IBI A;  3ERV A;  1NQC A;  4AXL A;  1ZIV A;  1KHQ A;  3H8B A;  1STF E;  4YYU A;  1F2A A;  1TU6 A;  2VHF A;  4CDD B;  1PXV A;  2DC6 A;  2Y6E A;  1E2T A;  1AYV A;  1MIR A;  2C0Y A;  3HHA A;  1CTE A;  3P5X A;  2DJF B;  2O6X A;  1BGO A;  3GCB A;  4AXM A;  3D6S A;  1JQP A;  1W5R A;  2BSZ A;  2OZ2 A;  4YVA A;  4OEL A;  1DEU A;  3I3T A;  1EF7 A;  1CS8 A;  1Q6K A;  1O0E A;  1TLO A;  2R9O A;  3B79 A;  4C5P A;  4PP2 E;  3K24 A;  4K7C A;  2AIM A;  2P0R A;  2CB5 A;  2BDL A;  3RVX A;  1Y4H A;  2DZY A;  3IV2 A;  4FIP A;  2FO5 A;  3D9W A;  3MHS A;  3C9E A;  4ZUX U;  9PAP A;  2JQF R;  3KWB X;  3BWK A;  2BDZ A;  5CVN B;  8PCH A;  3O0U A;  1CPJ A;  3OVZ A;  1AU2 A;  3IOQ A;  5EGW A;  2F1G A;  4MZS A;  4OEM A;  2E01 A;  1W4T A;  4MZO A;  3M99 A;  1PIP A;  3F75 A;  4BPV A;  1MEM A;  2R6N A;  5JA7 A;  1VSN A;  2FRA A;  4RY2 A;  5JH3 A;  1AEC A;  2G7Y A;  2VFB A;  1PCI A;  1EWM A;  2E02 A;  1CV8 A;  1BY8 A;  3H8C A;  1XKG A;  3K8U A;  2AU1 A;  1AU4 A;  4HWY A;  4YV8 A;  2AYN A;  1ITO A;  3CBK A;  2AYO A;  1PE6 A;  2NQD B;  1YK8 A;  1VJV A;  2VHS A;  4CDE B;  5F02 A;  3CH3 X;  3TNX A;  2FRQ A;  4YYV A;  2GHU A;  4YYW A;  3F5V A;  3NHE A;  2P86 A;  3S3Q A;  4QRV A;  2ATO A;  5PAD A;  1Y08 A;  2B1M A;  2DC8 A;  3DF0 A;  1ATK A;  3WXE A;  2YJ8 A;  4BQV A;  1CQD A;  3H6S A;  2R9F A;  1QOL A;  1YT7 A;  2R9C A;  4QBB A;  6PAD A;  4I05 A;  4YYS A;  2G8E A;  3OF8 A;  1GLO A;  5CHV A;  4CDC B;  4GUZ A;  4MSX A;  2G6D A;  1GCB A;  2ACT A;  4NV8 A;  4QH6 A;  2NQI A;  4W5B A;  1QDQ A;  1PPD A;  3PBH A;  1BQI A;  2DCA A;  2DC9 A;  4I04 A;  1GEC E;  1EWP A;  2AVW A;  1SP4 B;  2ARY A;  2P7U A;  2PBH A;  1HUC B;  2FUD A;  2R9M A;  5CVO B;  3LFY A;  3LXS A;  4WA6 A;  3CBJ A;  2XU4 A;  3IHP A;  3IEJ A;  4P6G A;  3I06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...