1PCIA

Procaricain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
311
structure length
311
Chain Sequence
LTSTERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNNSYWLGLNEFADLSNDEFNEKYVGSLIDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPVRHQGSCGSCWAFSAVATVEGINKIRTGKLVELSEQELVDCERRSHGCKGGYPPYALEYVAKNGIHLRSKYPYKAKQGTCRAKQVGGPIVKTSGVGRVQPNNEGNLLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDGAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKRAPGNSPGVCGLYKSSYYPTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The prosequence of procaricain forms an alpha-helical domain that prevents access to the substrate-binding cleft.
pubmed doi rcsb
source organism Carica papaya
molecule tags Thiol protease
molecule keywords PROCARICAIN
total genus 54
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.22.30: Caricain.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1pciA00
4G54A 1GCBA 4HWYA 1A6RA 4K7CA 3OF9A 3ZUAA 4N4ZA 3BC3A 1GMYA 1CB5A 2R9CA 2DC8A 2O6XA 3BOWA 1BY8A 3OISA 1PPNA 2YJ8A 3HD3A 1PPDA 1MEMA 1X9YA 3HHIA 2OULA 5A24A 2HD5A 1MHWA 3KWBX 1KFXL 3IMAA 1ITOA 2E00A 2E01A 3U8EA 4I05A 2DCBA 4QBBA 1PADA 3QT4A 2DC9A 1KFUL 2XU4A 1EWOA 2XU5A 1QXPA 3D6SA 2F1GA 4W5CA 4DMYA 3H8CA 3QJ3A 8PCHA 4PP2E 3KW9A 2AYOA 3P5XA 3I3TA 3WXEA 1YK7A 3E1ZB 2YJBA 2OZ2A 2AS8A 1U9XA 2AUXA 3ERVA 3P5UA 1ZCMA 2IPPB 1POPA 3MTNA 4FK5A 3P5WA 4QH6A 3BPFA 3B79A 2Y6EA 2FUDA 1PPPA 2CB5A 3RVWA 2XU3A 2DCCA 1JQPA 3O1GA 1TU6A 2BDLA 1BGOA 1U9QX 1KXRA 1EWMA 2HXZA 3S3RA 2P86A 2DJFB 1NLJA 3K24A 3CBKA 1TL9A 3AI8A 2G7YA 2Y5BA 5PADA 1MS6A 2R9NA 1F2BA 1KHQA 1SNKA 5K16A 1STFE 2PBHA 3KFQA 3H7DA 4FIPA 4XR7A 4X6HA 2AUZA 4X6JA 3I06A 3KWZA 4MZSA 4CDFB 1Q6KA 3F5VA 4PI3A 1BP4A 5CHVA 2F7DA 3IEJA 1AYUA 3OVZA 4RY2A 2E02A 2FT2A 4ZUXU 2R9OA 3H6SA 2G8JA 4X6IA 4QRXA 1NQCA 2FQ9A 3N3KA 3MHSA 2DCAA 1YK8A 2C0YA 3OF8A 1F2CA 2PNSA 2FRQA 1U9WA 4BQVA 1MDWA 1IWDA 2DCDA 3O0UA 3KKUA 2NQAA 1DF0A 2NQGA 3BPMA 5JA7A 3LXSA 2DC7A 2FTDA 5EF4A 3K8UA 1NL6A 3CH3X 4MSXA 1O0EA 2XU1A 5J94A 4YYVA 1F2AA 1F29A 1Y08A 4CDDB 4KLBA 4BPVA 1Y4HA 2DZZA 1TLOA 3KX1A 3CH2X 5CVNB 1ATKA 1HUCB 2G8EA 5FPWA 4CDCB 1ME4A 4YVAA 2ARYA 3OVXA 2YJ2A 1CS8A 4Q8HA 1KHPA 1THEA 2GHUA 4PP1A 4YYUA 1YT7A 3HWNA 3M99A 1PCIA 5CVOB 1YALA 1FH0A 2BDZA 4BSQA 3TNXA 4BS6A 1NB5A 1AU3A 3H8BA 5JH3A 1EF7A 2CIOA 1S4VA 2ACTA 1GLOA 4AXMA 4W5BA 3K9MA 1CJLA 4YYRA 2NQDB 5F02A 4W4UA 1BQIA 4BS5A 1CVZA 4OEMA 1EWPA 3WXGA 3IV2A 2GFOA 1QOLA 1XKGA 2NQIA 2YJ9A 1ICFA 4N79A 3BCNA 2P7UA 1YVBA 1M6DA 4PADA 1ME3A 3GCBA 2OP3A 5EGWA 2HH5A 2AU1A 4YYQA 5CHTA 2WBFX 1ZIVA 3HHAA 2YJCA 2JQGR 1AU2A 1AECA 3N3GA 7PCKA 5CVMA 3WXFA 4CDEB 1MIRA 3IHPA 2R9MA 4QRVA 1NPZA 3S3QA 2P0RA 3N4CA 4P6GA 2DZYA 3MHHA 4FJCA 4QRGA 3PNRA 3PBHA 4YYSA 9PAPA 2HHNA 1PBHA 1AYWA 1PPOA 3LFYA 2AVWA 1VSNA 1SP4B 3KSEA 4I04A 4Q8GA 1CPJA 1AYVA 1QMYA 3H89A 1GECE 3MORA 1AU0A 2G6DA 1CQDA 3PW3A 1PE6A 1K3BB 3F75A 1CTEA 4OELA 1CV8A 3DF0A 1DEUA 1AIMA 1NB3A 1VJVA 2DC6A 2VHFA 3NHEA 3P5VA 3V6CA 4CZWA 3RVVA 2R9FA 2B1MA 3PDFA 1PIPA 4XUIA 1EWLA 1AU4A 4YV8A 4N8WA 1U5IA 4I07A 1QDQA 3C9EA 6PADA 4AXLA 2H7JA 3IOQA 2AIMA 2ATOA 4P6EA 4YYWA 3CBJA 3QSDA 4WA6A 4DMXA 1MEGA 2PADA 2FRAA 3V6EA 2IBIA 2FO5A 2FYEA 3USVA 2VHSA 1CSBB 3BWKA 1PXVA 2AYNA 2JQFR 1U9VA 4MZOA 3RVXA 2E03A 3IUTA 2DJGB 2R6NA 2PREA 2B1NA
chains in the Genus database with same CATH superfamily
1YZBA 4G54A 2BTWA 1GCBA 4HWYA 1A6RA 4K7CA 3OF9A 3ZUAA 4N4ZA 3BC3A 1GMYA 1CB5A 2R9CA 2DC8A 2O6XA 3BOWA 1BY8A 3OISA 1PPNA 2YJ8A 3HD3A 1PPDA 1MEMA 1X9YA 1PVJA 3HHIA 2OULA 5A24A 2HD5A 1MHWA 3KWBX 1KFXL 3IMAA 1ITOA 2E00A 2E01A 3U8EA 4I05A 2DCBA 4QBBA 1PADA 5E6JA 3PHUA 3QT4A 2DC9A 1KFUL 2XU4A 1EWOA 2XU5A 1QXPA 3TRKA 3D6SA 2F1GA 4W5CA 4DMYA 3H8CA 3QJ3A 8PCHA 4PP2E 3MJ5A 3KW9A 2AYOA 3P5XA 3I3TA 3WXEA 1YK7A 3RNVA 3E1ZB 2YJBA 2OZ2A 2AS8A 1U9XA 2AUXA 3ERVA 3P5UA 1ZCMA 2IPPB 1POPA 3MTNA 4FK5A 3P5WA 4QH6A 3BPFA 3B21A 3B79A 2Y6EA 2FUDA 1PPPA 2CB5A 3RVWA 2XU3A 2DCCA 3W31A 1JQPA 3O1GA 1TU6A 2BDLA 1BGOA 1U9QX 1KXRA 1EWMA 4MI7A 2HXZA 3S3RA 2P86A 3TMPA 2DJFB 1NLJA 3K24A 3CBKA 1TL9A 3AI8A 2G7YA 2Y5BA 5PADA 1MS6A 2R9NA 1F2BA 2FE8A 1KHQA 1SNKA 5K16A 1STFE 2PBHA 3KFQA 3H7DA 4FIPA 4XR7A 4X6HA 2AUZA 4X6JA 3I06A 3KWZA 4MZSA 4CDFB 1Q6KA 3F5VA 4PI3A 1BP4A 3C0RA 5CHVA 2F7DA 3IEJA 1AYUA 3OVZA 3PHXA 4RY2A 2E02A 2JRIA 2FT2A 4ZUXU 2R9OA 1UKFA 3H6SA 2G8JA 4X6IA 4QRXA 4P16A 4OVZA 1NQCA 2FQ9A 3N3KA 3BB7A 3MHSA 2DCAA 1YK8A 2C0YA 3OF8A 1F2CA 4BOZA 2PNSA 2FRQA 4BOQA 1U9WA 4BQVA 1MDWA 4RF1A 1IWDA 2DCDA 3O0UA 3PT2A 3KKUA 2NQAA 1DF0A 2NQGA 3BPMA 5JA7A 3LXSA 2DC7A 2FTDA 5EF4A 3K8UA 2DOSA 1NL6A 3CH3X 4MSXA 1DKIA 3IFUA 1O0EA 2XU1A 5J94A 4YYVA 1F2AA 1F29A 4BOPA 1Y08A 4CDDB 4KLBA 3BBAA 4BPVA 2BU3A 1Y4HA 2DZZA 1TLOA 3KX1A 3PRMA 3CH2X 5CVNB 2AGAA 1ATKA 1HUCB 2G8EA 5FPWA 4CDCB 1ME4A 4BOUA 4YVAA 2ARYA 3OVXA 2YJ2A 1CS8A 4Q8HA 5KO3A 1KHPA 1THEA 2BTWB 2GHUA 4PP1A 4RKXA 1YT7A 4YYUA 3HWNA 3M99A 1PCIA 5CVOB 1YALA 1FH0A 2BDZA 4BSQA 4RNAA 3TNXA 4BS6A 1NB5A 3PRPA 1AU3A 4PT5A 3H8BA 5JH3A 1EF7A 2CIOA 1S4VA 2ACTA 4GUAA 1GLOA 4AXMA 4W5BA 2JTCA 3K9MA 1CJLA 3MTVA 4YYRA 2NQDB 5F02A 4W4UA 1BQIA 4BS5A 1CVZA 5EZSA 4OEMA 1EWPA 3WXGA 3IV2A 2GFOA 1QOLA 5EZQA 1XKGA 2NQIA 2YJ9A 1ICFA 4N79A 3BCNA 2P7UA 1YVBA 1M6DA 4PADA 1ME3A 3GCBA 2OP3A 4OVZB 5EGWA 2HH5A 4ZTBA 2HWKA 2AU1A 4YYQA 5CHTA 2WBFX 1ZIVA 3HHAA 3PSEA 2YJCA 2JQGR 1AU2A 1AECA 3N3GA 7PCKA 5CVMA 3WXFA 4CDEB 1MIRA 3IHPA 2R9MA 4QRVA 1NPZA 3S3QA 2P0RA 3PHWA 3N4CA 4P6GA 2DZYA 3MHHA 4WURA 4FJCA 4IUMA 4QRGA 3ZNHA 3PNRA 3PBHA 4YYSA 9PAPA 2HHNA 1PBHA 1AYWA 1PPOA 3LFYA 2AVWA 1VSNA 1SP4B 3KSEA 4I04A 4Q8GA 3OQCA 1CPJA 1AYVA 4IP3A 1QMYA 3H89A 1GECE 3MORA 1AU0A 4HXDB 2G6DA 1CQDA 3PW3A 1PE6A 1K3BB 3F75A 3O65A 3W30A 1CTEA 4BOSA 4OELA 4D8EA 1CV8A 3DF0A 1DEUA 1AIMA 4M0WA 2J7QA 1NB3A 1VJVA 2DC6A 2VHFA 3NHEA 3P5VA 4OW0A 3V6CA 4CZWA 3RVVA 2R9FA 2B1MA 2UZJA 3PDFA 1PIPA 4XUIA 2Z84A 1EWLA 1AU4A 4YV8A 4N8WA 1U5IA 5JZEA 3BY4A 4I07A 1QDQA 3C9EA 4RF0A 4A5UA 6PADA 4AXLA 2H7JA 4REZA 3IOQA 2AIMA 2ATOA 4P6EA 4YYWA 3CBJA 3QSDA 4MM3B 4WA6A 4DMXA 1MEGA 2PADA 4XZXA 2FRAA 4D8BA 3V6EA 2IBIA 2FO5A 2FYEA 3USVA 2VHSA 4D8IA 1CSBB 2J7QC 3BWKA 1PXVA 3MP2A 2AYNA 2JQFR 1U9VA 4MZOA 3RVXA 2E03A 3IUTA 2DJGB 2R6NA 2PREA 4R3DA 3E9SA 2B1NA
chains in the Genus database with same CATH topology
4G54A 1GCBA 4HWYA 1A6RA 4K7CA 3OF9A 3ZUAA 4N4ZA 3BC3A 1GMYA 1CB5A 2R9CA 2DC8A 2O6XA 3BOWA 1BY8A 3OISA 1PPNA 2YJ8A 3HD3A 1PPDA 1MEMA 1X9YA 3HHIA 2OULA 5A24A 2HD5A 1MHWA 3KWBX 1KFXL 3IMAA 1ITOA 2E00A 2E01A 3U8EA 1W5RA 4I05A 2DCBA 4QBBA 1PADA 3QT4A 2DC9A 1KFUL 2XU4A 1EWOA 2XU5A 1QXPA 3D6SA 2F1GA 4W5CA 4DMYA 3H8CA 3QJ3A 8PCHA 4PP2E 3KW9A 2AYOA 3P5XA 3I3TA 3WXEA 1YK7A 3E1ZB 2YJBA 4BGFA 2OZ2A 2AS8A 1U9XA 2AUXA 3ERVA 3P5UA 1ZCMA 2IPPB 1POPA 3MTNA 4FK5A 3P5WA 4QH6A 3BPFA 3B79A 2Y6EA 2FUDA 1PPPA 2CB5A 3RVWA 2XU3A 2DCCA 1JQPA 3O1GA 1TU6A 2BDLA 1BGOA 1W6FA 1U9QX 1KXRA 3D9WA 1EWMA 2HXZA 3S3RA 2P86A 2VFBA 2DJFB 1NLJA 3K24A 3CBKA 1TL9A 3AI8A 4B55A 2G7YA 2Y5BA 5PADA 1MS6A 2R9NA 1F2BA 1KHQA 1SNKA 5K16A 1STFE 2PBHA 3KFQA 3H7DA 4FIPA 4XR7A 4X6HA 2AUZA 4X6JA 3I06A 3KWZA 4MZSA 4CDFB 1Q6KA 3F5VA 4PI3A 1BP4A 5CHVA 2F7DA 3IEJA 1AYUA 3OVZA 4RY2A 2E02A 2FT2A 4ZUXU 2R9OA 3H6SA 2G8JA 4X6IA 4QRXA 1NQCA 2FQ9A 3N3KA 3MHSA 2DCAA 1YK8A 2C0YA 3OF8A 1F2CA 2PNSA 2FRQA 1U9WA 4BQVA 1MDWA 1IWDA 2DCDA 3O0UA 3KKUA 2NQAA 1DF0A 2NQGA 3BPMA 2VFCA 5JA7A 3LXSA 2DC7A 2FTDA 5EF4A 3K8UA 1NL6A 4C5PA 3CH3X 4MSXA 1O0EA 2XU1A 5J94A 4YYVA 1F2AA 1F29A 1Y08A 4CDDB 4KLBA 4BPVA 1Y4HA 2DZZA 1TLOA 3KX1A 3CH2X 5CVNB 1ATKA 1HUCB 2G8EA 5FPWA 4CDCB 1ME4A 4YVAA 2ARYA 3OVXA 2YJ2A 1CS8A 4Q8HA 1GX3A 1KHPA 1THEA 2GHUA 4PP1A 4YYUA 1YT7A 3HWNA 3M99A 1PCIA 5CVOB 1YALA 1FH0A 2BDZA 4BSQA 3TNXA 4BS6A 1NB5A 1AU3A 3H8BA 5JH3A 3LTWA 1EF7A 2CIOA 1S4VA 4GUZA 2ACTA 1GLOA 4AXMA 4W5BA 3K9MA 1CJLA 4YYRA 2NQDB 5F02A 4W4UA 1BQIA 4BS5A 1CVZA 4OEMA 1EWPA 3WXGA 3IV2A 2GFOA 1QOLA 1XKGA 2NQIA 2YJ9A 1ICFA 4N79A 3BCNA 2P7UA 1YVBA 1M6DA 4PADA 1ME3A 3GCBA 2OP3A 5EGWA 2HH5A 2AU1A 4YYQA 5CHTA 2WBFX 1ZIVA 3HHAA 2YJCA 2JQGR 1AU2A 1AECA 3N3GA 7PCKA 5CVMA 3WXFA 4CDEB 1MIRA 4NV8A 3IHPA 2R9MA 4QRVA 1NPZA 3S3QA 2P0RA 3N4CA 4P6GA 2DZYA 3MHHA 4FJCA 4QRGA 3PNRA 3PBHA 4YYSA 9PAPA 2HHNA 1PBHA 1AYWA 1PPOA 3LFYA 2AVWA 1VSNA 1SP4B 3KSEA 4I04A 4Q8GA 1CPJA 1AYVA 1QMYA 1E2TA 3H89A 1GECE 3MORA 1AU0A 2G6DA 1CQDA 3PW3A 1PE6A 1K3BB 3F75A 1CTEA 4OELA 1CV8A 3DF0A 1DEUA 1AIMA 1NB3A 1VJVA 2DC6A 2VHFA 3NHEA 3P5VA 2BSZA 3V6CA 4CZWA 3RVVA 2R9FA 2B1MA 3PDFA 1PIPA 4XUIA 1EWLA 1AU4A 4YV8A 4N8WA 1U5IA 4I07A 1QDQA 3C9EA 6PADA 4AXLA 2H7JA 3IOQA 2AIMA 2ATOA 4P6EA 4YYWA 3CBJA 3QSDA 4WA6A 4DMXA 1MEGA 1W4TA 2PADA 2FRAA 3V6EA 2IBIA 2FO5A 2FYEA 3USVA 2VHSA 1CSBB 3BWKA 1PXVA 2AYNA 2JQFR 1U9VA 4MZOA 3RVXA 2E03A 3IUTA 2DJGB 2R6NA 2PREA 4NV7A 2B1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G54 A;  1GCB A;  4HWY A;  1A6R A;  4K7C A;  3OF9 A;  3ZUA A;  4N4Z A;  3BC3 A;  1GMY A;  1CB5 A;  2R9C A;  2DC8 A;  2O6X A;  3BOW A;  1BY8 A;  3OIS A;  1PPN A;  2YJ8 A;  3HD3 A;  1PPD A;  1MEM A;  1X9Y A;  3HHI A;  2OUL A;  5A24 A;  2HD5 A;  1MHW A;  3KWB X;  1KFX L;  3IMA A;  1ITO A;  2E00 A;  2E01 A;  3U8E A;  4I05 A;  2DCB A;  4QBB A;  1PAD A;  3QT4 A;  2DC9 A;  1KFU L;  2XU4 A;  1EWO A;  2XU5 A;  1QXP A;  3D6S A;  2F1G A;  4W5C A;  4DMY A;  3H8C A;  3QJ3 A;  8PCH A;  4PP2 E;  3KW9 A;  2AYO A;  3P5X A;  3I3T A;  3WXE A;  1YK7 A;  3E1Z B;  2YJB A;  2OZ2 A;  2AS8 A;  1U9X A;  2AUX A;  3ERV A;  3P5U A;  1ZCM A;  2IPP B;  1POP A;  3MTN A;  4FK5 A;  3P5W A;  4QH6 A;  3BPF A;  3B79 A;  2Y6E A;  2FUD A;  1PPP A;  2CB5 A;  3RVW A;  2XU3 A;  2DCC A;  1JQP A;  3O1G A;  1TU6 A;  2BDL A;  1BGO A;  1U9Q X;  1KXR A;  1EWM A;  2HXZ A;  3S3R A;  2P86 A;  2DJF B;  1NLJ A;  3K24 A;  3CBK A;  1TL9 A;  3AI8 A;  2G7Y A;  2Y5B A;  5PAD A;  1MS6 A;  2R9N A;  1F2B A;  1KHQ A;  1SNK A;  5K16 A;  1STF E;  2PBH A;  3KFQ A;  3H7D A;  4FIP A;  4XR7 A;  4X6H A;  2AUZ A;  4X6J A;  3I06 A;  3KWZ A;  4MZS A;  4CDF B;  1Q6K A;  3F5V A;  4PI3 A;  1BP4 A;  5CHV A;  2F7D A;  3IEJ A;  1AYU A;  3OVZ A;  4RY2 A;  2E02 A;  2FT2 A;  4ZUX U;  2R9O A;  3H6S A;  2G8J A;  4X6I A;  4QRX A;  1NQC A;  2FQ9 A;  3N3K A;  3MHS A;  2DCA A;  1YK8 A;  2C0Y A;  3OF8 A;  1F2C A;  2PNS A;  2FRQ A;  1U9W A;  4BQV A;  1MDW A;  1IWD A;  2DCD A;  3O0U A;  3KKU A;  2NQA A;  1DF0 A;  2NQG A;  3BPM A;  5JA7 A;  3LXS A;  2DC7 A;  2FTD A;  5EF4 A;  3K8U A;  1NL6 A;  3CH3 X;  4MSX A;  1O0E A;  2XU1 A;  5J94 A;  4YYV A;  1F2A A;  1F29 A;  1Y08 A;  4CDD B;  4KLB A;  4BPV A;  1Y4H A;  2DZZ A;  1TLO A;  3KX1 A;  3CH2 X;  5CVN B;  1ATK A;  1HUC B;  2G8E A;  5FPW A;  4CDC B;  1ME4 A;  4YVA A;  2ARY A;  3OVX A;  2YJ2 A;  1CS8 A;  4Q8H A;  1KHP A;  1THE A;  2GHU A;  4PP1 A;  4YYU A;  1YT7 A;  3HWN A;  3M99 A;  1PCI A;  5CVO B;  1YAL A;  1FH0 A;  2BDZ A;  4BSQ A;  3TNX A;  4BS6 A;  1NB5 A;  1AU3 A;  3H8B A;  5JH3 A;  1EF7 A;  2CIO A;  1S4V A;  2ACT A;  1GLO A;  4AXM A;  4W5B A;  3K9M A;  1CJL A;  4YYR A;  2NQD B;  5F02 A;  4W4U A;  1BQI A;  4BS5 A;  1CVZ A;  4OEM A;  1EWP A;  3WXG A;  3IV2 A;  2GFO A;  1QOL A;  1XKG A;  2NQI A;  2YJ9 A;  1ICF A;  4N79 A;  3BCN A;  2P7U A;  1YVB A;  1M6D A;  4PAD A;  1ME3 A;  3GCB A;  2OP3 A;  5EGW A;  2HH5 A;  2AU1 A;  4YYQ A;  5CHT A;  2WBF X;  1ZIV A;  3HHA A;  2YJC A;  2JQG R;  1AU2 A;  1AEC A;  3N3G A;  7PCK A;  5CVM A;  3WXF A;  4CDE B;  1MIR A;  3IHP A;  2R9M A;  4QRV A;  1NPZ A;  3S3Q A;  2P0R A;  3N4C A;  4P6G A;  2DZY A;  3MHH A;  4FJC A;  4QRG A;  3PNR A;  3PBH A;  4YYS A;  9PAP A;  2HHN A;  1PBH A;  1AYW A;  1PPO A;  3LFY A;  2AVW A;  1VSN A;  1SP4 B;  3KSE A;  4I04 A;  4Q8G A;  1CPJ A;  1AYV A;  1QMY A;  3H89 A;  1GEC E;  3MOR A;  1AU0 A;  2G6D A;  1CQD A;  3PW3 A;  1PE6 A;  1K3B B;  3F75 A;  1CTE A;  4OEL A;  1CV8 A;  3DF0 A;  1DEU A;  1AIM A;  1NB3 A;  1VJV A;  2DC6 A;  2VHF A;  3NHE A;  3P5V A;  3V6C A;  4CZW A;  3RVV A;  2R9F A;  2B1M A;  3PDF A;  1PIP A;  4XUI A;  1EWL A;  1AU4 A;  4YV8 A;  4N8W A;  1U5I A;  4I07 A;  1QDQ A;  3C9E A;  6PAD A;  4AXL A;  2H7J A;  3IOQ A;  2AIM A;  2ATO A;  4P6E A;  4YYW A;  3CBJ A;  3QSD A;  4WA6 A;  4DMX A;  1MEG A;  2PAD A;  2FRA A;  3V6E A;  2IBI A;  2FO5 A;  2FYE A;  3USV A;  2VHS A;  1CSB B;  3BWK A;  1PXV A;  2AYN A;  2JQF R;  1U9V A;  4MZO A;  3RVX A;  2E03 A;  3IUT A;  2DJG B;  2R6N A;  2PRE A;  2B1N A; 
#chains in the Genus database with same CATH topology
 1YZB A;  4G54 A;  2BTW A;  1GCB A;  4HWY A;  1A6R A;  4K7C A;  3OF9 A;  3ZUA A;  4N4Z A;  3BC3 A;  1GMY A;  1CB5 A;  2R9C A;  2DC8 A;  2O6X A;  3BOW A;  1BY8 A;  3OIS A;  1PPN A;  2YJ8 A;  3HD3 A;  1PPD A;  1MEM A;  1X9Y A;  1PVJ A;  3HHI A;  2OUL A;  5A24 A;  2HD5 A;  1MHW A;  3KWB X;  1KFX L;  3IMA A;  1ITO A;  2E00 A;  2E01 A;  3U8E A;  4I05 A;  2DCB A;  4QBB A;  1PAD A;  5E6J A;  3PHU A;  3QT4 A;  2DC9 A;  1KFU L;  2XU4 A;  1EWO A;  2XU5 A;  1QXP A;  3TRK A;  3D6S A;  2F1G A;  4W5C A;  4DMY A;  3H8C A;  3QJ3 A;  8PCH A;  4PP2 E;  3MJ5 A;  3KW9 A;  2AYO A;  3P5X A;  3I3T A;  3WXE A;  1YK7 A;  3RNV A;  3E1Z B;  2YJB A;  2OZ2 A;  2AS8 A;  1U9X A;  2AUX A;  3ERV A;  3P5U A;  1ZCM A;  2IPP B;  1POP A;  3MTN A;  4FK5 A;  3P5W A;  4QH6 A;  3BPF A;  3B21 A;  3B79 A;  2Y6E A;  2FUD A;  1PPP A;  2CB5 A;  3RVW A;  2XU3 A;  2DCC A;  3W31 A;  1JQP A;  3O1G A;  1TU6 A;  2BDL A;  1BGO A;  1U9Q X;  1KXR A;  1EWM A;  4MI7 A;  2HXZ A;  3S3R A;  2P86 A;  3TMP A;  2DJF B;  1NLJ A;  3K24 A;  3CBK A;  1TL9 A;  3AI8 A;  2G7Y A;  2Y5B A;  5PAD A;  1MS6 A;  2R9N A;  1F2B A;  2FE8 A;  1KHQ A;  1SNK A;  5K16 A;  1STF E;  2PBH A;  3KFQ A;  3H7D A;  4FIP A;  4XR7 A;  4X6H A;  2AUZ A;  4X6J A;  3I06 A;  3KWZ A;  4MZS A;  4CDF B;  1Q6K A;  3F5V A;  4PI3 A;  1BP4 A;  3C0R A;  5CHV A;  2F7D A;  3IEJ A;  1AYU A;  3OVZ A;  3PHX A;  4RY2 A;  2E02 A;  2JRI A;  2FT2 A;  4ZUX U;  2R9O A;  1UKF A;  3H6S A;  2G8J A;  4X6I A;  4QRX A;  4P16 A;  4OVZ A;  1NQC A;  2FQ9 A;  3N3K A;  3BB7 A;  3MHS A;  2DCA A;  1YK8 A;  2C0Y A;  3OF8 A;  1F2C A;  4BOZ A;  2PNS A;  2FRQ A;  4BOQ A;  1U9W A;  4BQV A;  1MDW A;  4RF1 A;  1IWD A;  2DCD A;  3O0U A;  3PT2 A;  3KKU A;  2NQA A;  1DF0 A;  2NQG A;  3BPM A;  5JA7 A;  3LXS A;  2DC7 A;  2FTD A;  5EF4 A;  3K8U A;  2DOS A;  1NL6 A;  3CH3 X;  4MSX A;  1DKI A;  3IFU A;  1O0E A;  2XU1 A;  5J94 A;  4YYV A;  1F2A A;  1F29 A;  4BOP A;  1Y08 A;  4CDD B;  4KLB A;  3BBA A;  4BPV A;  2BU3 A;  1Y4H A;  2DZZ A;  1TLO A;  3KX1 A;  3PRM A;  3CH2 X;  5CVN B;  2AGA A;  1ATK A;  1HUC B;  2G8E A;  5FPW A;  4CDC B;  1ME4 A;  4BOU A;  4YVA A;  2ARY A;  3OVX A;  2YJ2 A;  1CS8 A;  4Q8H A;  5KO3 A;  1KHP A;  1THE A;  2BTW B;  2GHU A;  4PP1 A;  4RKX A;  1YT7 A;  4YYU A;  3HWN A;  3M99 A;  1PCI A;  5CVO B;  1YAL A;  1FH0 A;  2BDZ A;  4BSQ A;  4RNA A;  3TNX A;  4BS6 A;  1NB5 A;  3PRP A;  1AU3 A;  4PT5 A;  3H8B A;  5JH3 A;  1EF7 A;  2CIO A;  1S4V A;  2ACT A;  4GUA A;  1GLO A;  4AXM A;  4W5B A;  2JTC A;  3K9M A;  1CJL A;  3MTV A;  4YYR A;  2NQD B;  5F02 A;  4W4U A;  1BQI A;  4BS5 A;  1CVZ A;  5EZS A;  4OEM A;  1EWP A;  3WXG A;  3IV2 A;  2GFO A;  1QOL A;  5EZQ A;  1XKG A;  2NQI A;  2YJ9 A;  1ICF A;  4N79 A;  3BCN A;  2P7U A;  1YVB A;  1M6D A;  4PAD A;  1ME3 A;  3GCB A;  2OP3 A;  4OVZ B;  5EGW A;  2HH5 A;  4ZTB A;  2HWK A;  2AU1 A;  4YYQ A;  5CHT A;  2WBF X;  1ZIV A;  3HHA A;  3PSE A;  2YJC A;  2JQG R;  1AU2 A;  1AEC A;  3N3G A;  7PCK A;  5CVM A;  3WXF A;  4CDE B;  1MIR A;  3IHP A;  2R9M A;  4QRV A;  1NPZ A;  3S3Q A;  2P0R A;  3PHW A;  3N4C A;  4P6G A;  2DZY A;  3MHH A;  4WUR A;  4FJC A;  4IUM A;  4QRG A;  3ZNH A;  3PNR A;  3PBH A;  4YYS A;  9PAP A;  2HHN A;  1PBH A;  1AYW A;  1PPO A;  3LFY A;  2AVW A;  1VSN A;  1SP4 B;  3KSE A;  4I04 A;  4Q8G A;  3OQC A;  1CPJ A;  1AYV A;  4IP3 A;  1QMY A;  3H89 A;  1GEC E;  3MOR A;  1AU0 A;  4HXD B;  2G6D A;  1CQD A;  3PW3 A;  1PE6 A;  1K3B B;  3F75 A;  3O65 A;  3W30 A;  1CTE A;  4BOS A;  4OEL A;  4D8E A;  1CV8 A;  3DF0 A;  1DEU A;  1AIM A;  4M0W A;  2J7Q A;  1NB3 A;  1VJV A;  2DC6 A;  2VHF A;  3NHE A;  3P5V A;  4OW0 A;  3V6C A;  4CZW A;  3RVV A;  2R9F A;  2B1M A;  2UZJ A;  3PDF A;  1PIP A;  4XUI A;  2Z84 A;  1EWL A;  1AU4 A;  4YV8 A;  4N8W A;  1U5I A;  5JZE A;  3BY4 A;  4I07 A;  1QDQ A;  3C9E A;  4RF0 A;  4A5U A;  6PAD A;  4AXL A;  2H7J A;  4REZ A;  3IOQ A;  2AIM A;  2ATO A;  4P6E A;  4YYW A;  3CBJ A;  3QSD A;  4MM3 B;  4WA6 A;  4DMX A;  1MEG A;  2PAD A;  4XZX A;  2FRA A;  4D8B A;  3V6E A;  2IBI A;  2FO5 A;  2FYE A;  3USV A;  2VHS A;  4D8I A;  1CSB B;  2J7Q C;  3BWK A;  1PXV A;  3MP2 A;  2AYN A;  2JQF R;  1U9V A;  4MZO A;  3RVX A;  2E03 A;  3IUT A;  2DJG B;  2R6N A;  2PRE A;  4R3D A;  3E9S A;  2B1N A; 
#chains in the Genus database with same CATH homology
 4G54 A;  1GCB A;  4HWY A;  1A6R A;  4K7C A;  3OF9 A;  3ZUA A;  4N4Z A;  3BC3 A;  1GMY A;  1CB5 A;  2R9C A;  2DC8 A;  2O6X A;  3BOW A;  1BY8 A;  3OIS A;  1PPN A;  2YJ8 A;  3HD3 A;  1PPD A;  1MEM A;  1X9Y A;  3HHI A;  2OUL A;  5A24 A;  2HD5 A;  1MHW A;  3KWB X;  1KFX L;  3IMA A;  1ITO A;  2E00 A;  2E01 A;  3U8E A;  1W5R A;  4I05 A;  2DCB A;  4QBB A;  1PAD A;  3QT4 A;  2DC9 A;  1KFU L;  2XU4 A;  1EWO A;  2XU5 A;  1QXP A;  3D6S A;  2F1G A;  4W5C A;  4DMY A;  3H8C A;  3QJ3 A;  8PCH A;  4PP2 E;  3KW9 A;  2AYO A;  3P5X A;  3I3T A;  3WXE A;  1YK7 A;  3E1Z B;  2YJB A;  4BGF A;  2OZ2 A;  2AS8 A;  1U9X A;  2AUX A;  3ERV A;  3P5U A;  1ZCM A;  2IPP B;  1POP A;  3MTN A;  4FK5 A;  3P5W A;  4QH6 A;  3BPF A;  3B79 A;  2Y6E A;  2FUD A;  1PPP A;  2CB5 A;  3RVW A;  2XU3 A;  2DCC A;  1JQP A;  3O1G A;  1TU6 A;  2BDL A;  1BGO A;  1W6F A;  1U9Q X;  1KXR A;  3D9W A;  1EWM A;  2HXZ A;  3S3R A;  2P86 A;  2VFB A;  2DJF B;  1NLJ A;  3K24 A;  3CBK A;  1TL9 A;  3AI8 A;  4B55 A;  2G7Y A;  2Y5B A;  5PAD A;  1MS6 A;  2R9N A;  1F2B A;  1KHQ A;  1SNK A;  5K16 A;  1STF E;  2PBH A;  3KFQ A;  3H7D A;  4FIP A;  4XR7 A;  4X6H A;  2AUZ A;  4X6J A;  3I06 A;  3KWZ A;  4MZS A;  4CDF B;  1Q6K A;  3F5V A;  4PI3 A;  1BP4 A;  5CHV A;  2F7D A;  3IEJ A;  1AYU A;  3OVZ A;  4RY2 A;  2E02 A;  2FT2 A;  4ZUX U;  2R9O A;  3H6S A;  2G8J A;  4X6I A;  4QRX A;  1NQC A;  2FQ9 A;  3N3K A;  3MHS A;  2DCA A;  1YK8 A;  2C0Y A;  3OF8 A;  1F2C A;  2PNS A;  2FRQ A;  1U9W A;  4BQV A;  1MDW A;  1IWD A;  2DCD A;  3O0U A;  3KKU A;  2NQA A;  1DF0 A;  2NQG A;  3BPM A;  2VFC A;  5JA7 A;  3LXS A;  2DC7 A;  2FTD A;  5EF4 A;  3K8U A;  1NL6 A;  4C5P A;  3CH3 X;  4MSX A;  1O0E A;  2XU1 A;  5J94 A;  4YYV A;  1F2A A;  1F29 A;  1Y08 A;  4CDD B;  4KLB A;  4BPV A;  1Y4H A;  2DZZ A;  1TLO A;  3KX1 A;  3CH2 X;  5CVN B;  1ATK A;  1HUC B;  2G8E A;  5FPW A;  4CDC B;  1ME4 A;  4YVA A;  2ARY A;  3OVX A;  2YJ2 A;  1CS8 A;  4Q8H A;  1GX3 A;  1KHP A;  1THE A;  2GHU A;  4PP1 A;  4YYU A;  1YT7 A;  3HWN A;  3M99 A;  1PCI A;  5CVO B;  1YAL A;  1FH0 A;  2BDZ A;  4BSQ A;  3TNX A;  4BS6 A;  1NB5 A;  1AU3 A;  3H8B A;  5JH3 A;  3LTW A;  1EF7 A;  2CIO A;  1S4V A;  4GUZ A;  2ACT A;  1GLO A;  4AXM A;  4W5B A;  3K9M A;  1CJL A;  4YYR A;  2NQD B;  5F02 A;  4W4U A;  1BQI A;  4BS5 A;  1CVZ A;  4OEM A;  1EWP A;  3WXG A;  3IV2 A;  2GFO A;  1QOL A;  1XKG A;  2NQI A;  2YJ9 A;  1ICF A;  4N79 A;  3BCN A;  2P7U A;  1YVB A;  1M6D A;  4PAD A;  1ME3 A;  3GCB A;  2OP3 A;  5EGW A;  2HH5 A;  2AU1 A;  4YYQ A;  5CHT A;  2WBF X;  1ZIV A;  3HHA A;  2YJC A;  2JQG R;  1AU2 A;  1AEC A;  3N3G A;  7PCK A;  5CVM A;  3WXF A;  4CDE B;  1MIR A;  4NV8 A;  3IHP A;  2R9M A;  4QRV A;  1NPZ A;  3S3Q A;  2P0R A;  3N4C A;  4P6G A;  2DZY A;  3MHH A;  4FJC A;  4QRG A;  3PNR A;  3PBH A;  4YYS A;  9PAP A;  2HHN A;  1PBH A;  1AYW A;  1PPO A;  3LFY A;  2AVW A;  1VSN A;  1SP4 B;  3KSE A;  4I04 A;  4Q8G A;  1CPJ A;  1AYV A;  1QMY A;  1E2T A;  3H89 A;  1GEC E;  3MOR A;  1AU0 A;  2G6D A;  1CQD A;  3PW3 A;  1PE6 A;  1K3B B;  3F75 A;  1CTE A;  4OEL A;  1CV8 A;  3DF0 A;  1DEU A;  1AIM A;  1NB3 A;  1VJV A;  2DC6 A;  2VHF A;  3NHE A;  3P5V A;  2BSZ A;  3V6C A;  4CZW A;  3RVV A;  2R9F A;  2B1M A;  3PDF A;  1PIP A;  4XUI A;  1EWL A;  1AU4 A;  4YV8 A;  4N8W A;  1U5I A;  4I07 A;  1QDQ A;  3C9E A;  6PAD A;  4AXL A;  2H7J A;  3IOQ A;  2AIM A;  2ATO A;  4P6E A;  4YYW A;  3CBJ A;  3QSD A;  4WA6 A;  4DMX A;  1MEG A;  1W4T A;  2PAD A;  2FRA A;  3V6E A;  2IBI A;  2FO5 A;  2FYE A;  3USV A;  2VHS A;  1CSB B;  3BWK A;  1PXV A;  2AYN A;  2JQF R;  1U9V A;  4MZO A;  3RVX A;  2E03 A;  3IUT A;  2DJG B;  2R6N A;  2PRE A;  4NV7 A;  2B1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...