3RNVA

Structure of the autocatalytic cysteine protease domain of potyvirus helper-component proteinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
MYIAKEGYCYINIFLAMLVNVKESQAKEFTKVVRDKLVGELGKWPTLLDVATACYFLKVFYPDVANAELPRMLVDHKTKIIHVVDSYGSLSTGYHVLKTNTVEQLIKFTRCNLESSLKHYRVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Helper component proteinase
publication title Structure of the autocatalytic cysteine protease domain of potyvirus helper-component proteinase
rcsb
source organism Turnip mosaic virus
molecule tags Hydrolase
total genus 38
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.150 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3rnvA00
3RNVA
chains in the Genus database with same CATH superfamily
4AXLA 1Y4HA 3WXFA 2PBHA 4MM3B 2JQFR 1PPDA 2AGAA 2AUXA 3I06A 1ATKA 2FT2A 1ME3A 3H8BA 2PADA 1ITOA 4R3DA 1O0EA 2DJFB 2JRIA 3P5WA 1PBHA 3N3GA 2AVWA 3MP2A 3USVA 2FTDA 3PSEA 1AECA 2Y5BA 2JTCA 3QT4A 2AYOA 3QJ3A 5JZEA 3N4CA 3IV2A 2CB5A 1NB3A 3S3QA 2OZ2A 4P6GA 1CSBB 1BQIA 3E1ZB 3H8CA 3K9MA 1U9WA 4PT5A 4CDFB 1MEMA 2NQIA 1PPPA 4KLBA 2HHNA 2IBIA 3V6CA 2BU3A 1EWMA 2B1NA 1BGOA 1ZIVA 5F02A 3KW9A 1DF0A 4QH6A 1CQDA 4CZWA 2P86A 5CVMA 4FJCA 1FH0A 3PHXA 2FYEA 4X6HA 2AUZA 1NPZA 1GECE 2PREA 4IP3A 1CB5A 1PXVA 3KWZA 1EWOA 4QRVA 2ATOA 1DEUA 1QDQA 1PPOA 3BOWA 1MEGA 4QRXA 4D8BA 7PCKA 1JQPA 4YYVA 3MTVA 1MIRA 3BY4A 3PNRA 3PHWA 5KO3A 1CTEA 4MZSA 4N8WA 4PP2E 4A5UA 2PNSA 3QSDA 4XR7A 4CDCB 1AYUA 2VHSA 1KHPA 3BPFA 1MS6A 5EF4A 3RVVA 1A6RA 3HHAA 2DC6A 2JQGR 2DCAA 4Q8GA 3PT2A 4OEMA 2R9FA 3ERVA 3HHIA 1DKIA 3W31A 2XU1A 3M99A 2HWKA 3F75A 3ZNHA 4YVAA 2P0RA 3B79A 2G7YA 4ZUXU 1CJLA 3KSEA 3O0UA 3K24A 1AYWA 1HUCB 2YJ2A 3IUTA 3IMAA 3O65A 2F1GA 3U8EA 4OVZA 3CH2X 1F2BA 2B1MA 3V6EA 3KFQA 4OVZB 2NQGA 1PIPA 4XUIA 1KFXL 4MSXA 2Z84A 1YZBA 3BBAA 1ME4A 1PADA 1CV8A 3RNVA 1AU2A 4RF0A 4G54A 3BC3A 2FUDA 1QXPA 2DC9A 2FQ9A 1Y08A 2BDLA 2HD5A 1VSNA 4AXMA 4RKXA 3IEJA 3PRMA 4MI7A 4DMYA 2ACTA 1STFE 1CVZA 3MJ5A 3N3KA 1KHQA 3CBJA 4DMXA 1YALA 1U9XA 3BB7A 2BTWB 2YJ9A 4BOQA 4FK5A 2YJBA 2ARYA 2Y6EA 1Q6KA 3LFYA 1CPJA 3OF9A 4M0WA 3ZUAA 1S4VA 1ZCMA 3P5XA 1U9VA 1YT7A 1PPNA 3MTNA 3IFUA 2P7UA 4WA6A 3NHEA 3H89A 4I07A 2DCDA 3CBKA 5PADA 4P16A 2E01A 4BS5A 3RVWA 2GHUA 1AU4A 1F2CA 3OVZA 3OVXA 1IWDA 3IHPA 3WXEA 2G8JA 4P6EA 4X6IA 1YVBA 3OF8A 1NB5A 4W4UA 3TMPA 1QMYA 3I3TA 1CS8A 2VHFA 4WURA 3E9SA 4OELA 1SP4B 3IOQA 4GUAA 4I04A 4Q8HA 1THEA 2E02A 4I05A 3B21A 2R6NA 2FE8A 3DF0A 4OW0A 3BWKA 4BPVA 4W5BA 1KFUL 1NL6A 5JH3A 2DZZA 2XU4A 2HXZA 2DCBA 5CVNB 2YJ8A 5EZSA 2GFOA 4XZXA 1MDWA 2YJCA 5A24A 4BOPA 6PADA 1K3BB 1EWPA 2OP3A 1XKGA 4PP1A 5EGWA 1AU3A 2C0YA 1F29A 3PDFA 2J7QA 3MHSA 1NLJA 1AU0A 3S3RA 4N4ZA 3LXSA 5J94A 1UKFA 1YK7A 3F5VA 1BP4A 2G8EA 4BOZA 2DOSA 1M6DA 1PCIA 2R9OA 3AI8A 1EF7A 4BOSA 2G6DA 2DJGB 1YK8A 2AU1A 3GCBA 2XU5A 3H7DA 4RNAA 4K7CA 5CHVA 1TL9A 2UZJA 5EZQA 3HD3A 1KXRA 2J7QC 2WBFX 5JA7A 1QOLA 2BTWA 4X6JA 2XU3A 4BSQA 3PW3A 2FO5A 8PCHA 5K16A 4W5CA 1BY8A 3O1GA 5E6JA 4IUMA 2R9NA 1X9YA 1U9QX 1GMYA 3PRPA 2DC7A 4YYSA 4D8EA 1ICFA 5CVOB 3HWNA 4CDDB 2CIOA 3W30A 2O6XA 3MORA 1F2AA 1VJVA 4REZA 3H6SA 4RY2A 4ZTBA 4YYQA 3C9EA 2AIMA 3BPMA 3OQCA 3BCNA 2IPPB 4HWYA 4BS6A 1U5IA 4QBBA 2R9MA 3CH3X 4HXDB 2HH5A 1AIMA 4CDEB 1MHWA 4FIPA 2R9CA 2FRQA 3C0RA 4BQVA 4MZOA 1TU6A 4BOUA 2OULA 3P5VA 3P5UA 2H7JA 4YYWA 2NQAA 4D8IA 4PADA 2NQDB 3KX1A 5CHTA 3RVXA 3KKUA 4RF1A 1TLOA 1PE6A 3K8UA 9PAPA 2DC8A 4YYUA 2F7DA 1PVJA 3KWBX 2E00A 3TRKA 2E03A 4QRGA 3TNXA 1GCBA 2DCCA 4N79A 1SNKA 2BDZA 2AYNA 3PHUA 3PBHA 1POPA 1GLOA 3OISA 2FRAA 3WXGA 1AYVA 1EWLA 2DZYA 1NQCA 4YYRA 3D6SA 3MHHA 2AS8A 5FPWA 4PI3A 4YV8A
chains in the Genus database with same CATH topology
4A5UA 4MM3B 2AGAA 4P16A 5E6JA 4IUMA 4R3DA 2JRIA 3PT2A 3PRPA 3TMPA 4D8EA 3MP2A 1DKIA 3W31A 3W30A 3PSEA 2HWKA 3ZNHA 4WURA 2JTCA 3E9SA 4REZA 5JZEA 4ZTBA 4GUAA 3B21A 2FE8A 3OQCA 4OW0A 4PT5A 4HXDB 3O65A 4OVZA 3C0RA 4OVZB 5EZSA 2BU3A 4XZXA 4BOUA 4BOPA 2Z84A 1YZBA 3BBAA 3RNVA 4RF0A 4D8IA 2J7QA 4RF1A 4RKXA 1UKFA 3PRMA 4MI7A 4BOZA 1PVJA 3MJ5A 3PHXA 3TRKA 2DOSA 3BB7A 2BTWB 4BOSA 4BOQA 4IP3A 3PHUA 4RNAA 4D8BA 2UZJA 4M0WA 5EZQA 3MTVA 3BY4A 2J7QC 3PHWA 5KO3A 3IFUA 2BTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNV A; 
#chains in the Genus database with same CATH topology
 4AXL A;  1Y4H A;  3WXF A;  2PBH A;  4MM3 B;  2JQF R;  1PPD A;  2AGA A;  2AUX A;  3I06 A;  1ATK A;  2FT2 A;  1ME3 A;  3H8B A;  2PAD A;  1ITO A;  4R3D A;  1O0E A;  2DJF B;  2JRI A;  3P5W A;  1PBH A;  3N3G A;  2AVW A;  3MP2 A;  3USV A;  2FTD A;  3PSE A;  1AEC A;  2Y5B A;  2JTC A;  3QT4 A;  2AYO A;  3QJ3 A;  5JZE A;  3N4C A;  3IV2 A;  2CB5 A;  1NB3 A;  3S3Q A;  2OZ2 A;  4P6G A;  1CSB B;  1BQI A;  3E1Z B;  3H8C A;  3K9M A;  1U9W A;  4PT5 A;  4CDF B;  1MEM A;  2NQI A;  1PPP A;  4KLB A;  2HHN A;  2IBI A;  3V6C A;  2BU3 A;  1EWM A;  2B1N A;  1BGO A;  1ZIV A;  5F02 A;  3KW9 A;  1DF0 A;  4QH6 A;  1CQD A;  4CZW A;  2P86 A;  5CVM A;  4FJC A;  1FH0 A;  3PHX A;  2FYE A;  4X6H A;  2AUZ A;  1NPZ A;  1GEC E;  2PRE A;  4IP3 A;  1CB5 A;  1PXV A;  3KWZ A;  1EWO A;  4QRV A;  2ATO A;  1DEU A;  1QDQ A;  1PPO A;  3BOW A;  1MEG A;  4QRX A;  4D8B A;  7PCK A;  1JQP A;  4YYV A;  3MTV A;  1MIR A;  3BY4 A;  3PNR A;  3PHW A;  5KO3 A;  1CTE A;  4MZS A;  4N8W A;  4PP2 E;  4A5U A;  2PNS A;  3QSD A;  4XR7 A;  4CDC B;  1AYU A;  2VHS A;  1KHP A;  3BPF A;  1MS6 A;  5EF4 A;  3RVV A;  1A6R A;  3HHA A;  2DC6 A;  2JQG R;  2DCA A;  4Q8G A;  3PT2 A;  4OEM A;  2R9F A;  3ERV A;  3HHI A;  1DKI A;  3W31 A;  2XU1 A;  3M99 A;  2HWK A;  3F75 A;  3ZNH A;  4YVA A;  2P0R A;  3B79 A;  2G7Y A;  4ZUX U;  1CJL A;  3KSE A;  3O0U A;  3K24 A;  1AYW A;  1HUC B;  2YJ2 A;  3IUT A;  3IMA A;  3O65 A;  2F1G A;  3U8E A;  4OVZ A;  3CH2 X;  1F2B A;  2B1M A;  3V6E A;  3KFQ A;  4OVZ B;  2NQG A;  1PIP A;  4XUI A;  1KFX L;  4MSX A;  2Z84 A;  1YZB A;  3BBA A;  1ME4 A;  1PAD A;  1CV8 A;  3RNV A;  1AU2 A;  4RF0 A;  4G54 A;  3BC3 A;  2FUD A;  1QXP A;  2DC9 A;  2FQ9 A;  1Y08 A;  2BDL A;  2HD5 A;  1VSN A;  4AXM A;  4RKX A;  3IEJ A;  3PRM A;  4MI7 A;  4DMY A;  2ACT A;  1STF E;  1CVZ A;  3MJ5 A;  3N3K A;  1KHQ A;  3CBJ A;  4DMX A;  1YAL A;  1U9X A;  3BB7 A;  2BTW B;  2YJ9 A;  4BOQ A;  4FK5 A;  2YJB A;  2ARY A;  2Y6E A;  1Q6K A;  3LFY A;  1CPJ A;  3OF9 A;  4M0W A;  3ZUA A;  1S4V A;  1ZCM A;  3P5X A;  1U9V A;  1YT7 A;  1PPN A;  3MTN A;  3IFU A;  2P7U A;  4WA6 A;  3NHE A;  3H89 A;  4I07 A;  2DCD A;  3CBK A;  5PAD A;  4P16 A;  2E01 A;  4BS5 A;  3RVW A;  2GHU A;  1AU4 A;  1F2C A;  3OVZ A;  3OVX A;  1IWD A;  3IHP A;  3WXE A;  2G8J A;  4P6E A;  4X6I A;  1YVB A;  3OF8 A;  1NB5 A;  4W4U A;  3TMP A;  1QMY A;  3I3T A;  1CS8 A;  2VHF A;  4WUR A;  3E9S A;  4OEL A;  1SP4 B;  3IOQ A;  4GUA A;  4I04 A;  4Q8H A;  1THE A;  2E02 A;  4I05 A;  3B21 A;  2R6N A;  2FE8 A;  3DF0 A;  4OW0 A;  3BWK A;  4BPV A;  4W5B A;  1KFU L;  1NL6 A;  5JH3 A;  2DZZ A;  2XU4 A;  2HXZ A;  2DCB A;  5CVN B;  2YJ8 A;  5EZS A;  2GFO A;  4XZX A;  1MDW A;  2YJC A;  5A24 A;  4BOP A;  6PAD A;  1K3B B;  1EWP A;  2OP3 A;  1XKG A;  4PP1 A;  5EGW A;  1AU3 A;  2C0Y A;  1F29 A;  3PDF A;  2J7Q A;  3MHS A;  1NLJ A;  1AU0 A;  3S3R A;  4N4Z A;  3LXS A;  5J94 A;  1UKF A;  1YK7 A;  3F5V A;  1BP4 A;  2G8E A;  4BOZ A;  2DOS A;  1M6D A;  1PCI A;  2R9O A;  3AI8 A;  1EF7 A;  4BOS A;  2G6D A;  2DJG B;  1YK8 A;  2AU1 A;  3GCB A;  2XU5 A;  3H7D A;  4RNA A;  4K7C A;  5CHV A;  1TL9 A;  2UZJ A;  5EZQ A;  3HD3 A;  1KXR A;  2J7Q C;  2WBF X;  5JA7 A;  1QOL A;  2BTW A;  4X6J A;  2XU3 A;  4BSQ A;  3PW3 A;  2FO5 A;  8PCH A;  5K16 A;  4W5C A;  1BY8 A;  3O1G A;  5E6J A;  4IUM A;  2R9N A;  1X9Y A;  1U9Q X;  1GMY A;  3PRP A;  2DC7 A;  4YYS A;  4D8E A;  1ICF A;  5CVO B;  3HWN A;  4CDD B;  2CIO A;  3W30 A;  2O6X A;  3MOR A;  1F2A A;  1VJV A;  4REZ A;  3H6S A;  4RY2 A;  4ZTB A;  4YYQ A;  3C9E A;  2AIM A;  3BPM A;  3OQC A;  3BCN A;  2IPP B;  4HWY A;  4BS6 A;  1U5I A;  4QBB A;  2R9M A;  3CH3 X;  4HXD B;  2HH5 A;  1AIM A;  4CDE B;  1MHW A;  4FIP A;  2R9C A;  2FRQ A;  3C0R A;  4BQV A;  4MZO A;  1TU6 A;  4BOU A;  2OUL A;  3P5V A;  3P5U A;  2H7J A;  4YYW A;  2NQA A;  4D8I A;  4PAD A;  2NQD B;  3KX1 A;  5CHT A;  3RVX A;  3KKU A;  4RF1 A;  1TLO A;  1PE6 A;  3K8U A;  9PAP A;  2DC8 A;  4YYU A;  2F7D A;  1PVJ A;  3KWB X;  2E00 A;  3TRK A;  2E03 A;  4QRG A;  3TNX A;  1GCB A;  2DCC A;  4N79 A;  1SNK A;  2BDZ A;  2AYN A;  3PHU A;  3PBH A;  1POP A;  1GLO A;  3OIS A;  2FRA A;  3WXG A;  1AYV A;  1EWL A;  2DZY A;  1NQC A;  4YYR A;  3D6S A;  3MHH A;  2AS8 A;  5FPW A;  4PI3 A;  4YV8 A; 
#chains in the Genus database with same CATH homology
 4A5U A;  4MM3 B;  2AGA A;  4P16 A;  5E6J A;  4IUM A;  4R3D A;  2JRI A;  3PT2 A;  3PRP A;  3TMP A;  4D8E A;  3MP2 A;  1DKI A;  3W31 A;  3W30 A;  3PSE A;  2HWK A;  3ZNH A;  4WUR A;  2JTC A;  3E9S A;  4REZ A;  5JZE A;  4ZTB A;  4GUA A;  3B21 A;  2FE8 A;  3OQC A;  4OW0 A;  4PT5 A;  4HXD B;  3O65 A;  4OVZ A;  3C0R A;  4OVZ B;  5EZS A;  2BU3 A;  4XZX A;  4BOU A;  4BOP A;  2Z84 A;  1YZB A;  3BBA A;  3RNV A;  4RF0 A;  4D8I A;  2J7Q A;  4RF1 A;  4RKX A;  1UKF A;  3PRM A;  4MI7 A;  4BOZ A;  1PVJ A;  3MJ5 A;  3PHX A;  3TRK A;  2DOS A;  3BB7 A;  2BTW B;  4BOS A;  4BOQ A;  4IP3 A;  3PHU A;  4RNA A;  4D8B A;  2UZJ A;  4M0W A;  5EZQ A;  3MTV A;  3BY4 A;  2J7Q C;  3PHW A;  5KO3 A;  3IFU A;  2BTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...