3RNVA

Structure of the autocatalytic cysteine protease domain of potyvirus helper-component proteinase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
b'MYIAKEGYCYINIFLAMLVNVKESQAKEFTKVVRDKLVGELGKWPTLLDVATACYFLKVFYPDVANAELPRMLVDHKTKIIHVVDSYGSLSTGYHVLKTNTVEQLIKFTRCNLESSLKHYRVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Helper component proteinase
publication title Structure of the autocatalytic cysteine protease domain of potyvirus helper-component proteinase
rcsb
source organism Turnip mosaic virus
molecule tags Hydrolase
total genus 38
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.150 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3rnvA00
3RNVA
chains in the Genus database with same CATH superfamily
3C0RA 3MJ5A 4WURA 3O1GA 1U9QX 4QRXA 2DOSA 3B21A 1SP4B 1KHQA 5JH3A 2J7QA 2B1MA 1TL9A 4A5UA 1AECA 1KFXL 3OF9A 4MZOA 4I05A 3MHHA 2IPPB 3CH3X 1CSBB 3KSEA 4ZTBA 4D8EA 3MTNA 2DZZA 3KW9A 4AXLA 2FT2A 1F2AA 1KHPA 2J7QC 3BPFA 1CJLA 1EF7A 3P5UA 1FH0A 2E01A 4AXMA 3ZNHA 2DCDA 3H7DA 1NL6A 3OQCA 4REZA 3E9SA 3OF8A 3B79A 2OP3A 2NQAA 1TU6A 2O6XA 3BY4A 1NB3A 1PVJA 2AGAA 1GMYA 1KXRA 5KO3A 4OEMA 3MORA 4BOSA 1AYVA 1F29A 1YZBA 4YV8A 4W4UA 2DZYA 3O65A 3ZUAA 3V6EA 3BC3A 4BS5A 1ZCMA 4CZWA 1MHWA 1MEMA 3S3RA 2G7YA 1S4VA 1QOLA 1PBHA 2JQGR 2PBHA 3IMAA 5J94A 1U9VA 1POPA 4K7CA 2VHSA 4Q8GA 3MP2A 4YYUA 2GHUA 2IBIA 1VJVA 3PRPA 1EWPA 1AU4A 1ITOA 4R3DA 2Z84A 1BQIA 4MSXA 3H6SA 4YVAA 2GFOA 4RF0A 2F1GA 3C9EA 1NLJA 4BOZA 1YK7A 2DC9A 1MS6A 5CHTA 5EF4A 4XR7A 3P5XA 3QSDA 4KLBA 3PBHA 2FYEA 2Y6EA 2AS8A 1YK8A 2Y5BA 2DC8A 2AYNA 3F75A 2E03A 4RY2A 4MM3B 2YJBA 4BS6A 2AVWA 2DCCA 2BDLA 1HUCB 3RVWA 1Q6KA 4HXDB 3HHIA 4X6IA 1CQDA 4BPVA 1X9YA 4RKXA 2FRQA 7PCKA 2P86A 3IHPA 1PXVA 5CVNB 3QJ3A 1U9XA 4OVZA 2YJCA 1DF0A 3HWNA 2FE8A 1ZIVA 3WXFA 1EWOA 1UKFA 3LXSA 2OULA 4XZXA 4M0WA 2R9CA 4W5CA 4BOUA 4CDFB 1AU3A 2HHNA 1PPNA 1CTEA 2E00A 2FO5A 2AU1A 4P6GA 5E6JA 2BTWA 2AIMA 5JA7A 2FQ9A 1QMYA 2JRIA 3WXEA 5F02A 2YJ9A 1PADA 1QXPA 1NPZA 3PHUA 4RNAA 3N4CA 2JQFR 4OVZB 4IP3A 3OVZA 1QDQA 1CB5A 3CBKA 1JQPA 4QRVA 2XU4A 3QT4A 4PT5A 3D6SA 3MTVA 2R9MA 5CVMA 2G8EA 3BOWA 3PDFA 3RVVA 3E1ZB 3KX1A 4X6HA 4MI7A 4PP2E 1AYWA 2FTDA 2UZJA 4N8WA 3TNXA 3RVXA 1PE6A 2C0YA 2DCBA 3KWBX 4MZSA 1MEGA 1AU0A 1Y08A 9PAPA 1EWLA 4N4ZA 2BTWB 3OVXA 3W30A 3HD3A 1DEUA 4ZUXU 1CPJA 3KFQA 2CB5A 1AU2A 4I07A 2DJGB 3BPMA 1M6DA 4RF1A 4D8IA 2NQIA 1F2CA 4GUAA 2OZ2A 1NB5A 5PADA 2VHFA 4BOQA 1O0EA 3S3QA 2G6DA 3IV2A 4DMYA 3N3GA 2HH5A 1IWDA 3GCBA 2P7UA 1SNKA 2DC6A 4FIPA 5CVOB 2CIOA 4BOPA 3U8EA 1K3BB 4FK5A 2ACTA 4XUIA 4Q8HA 1U5IA 3BB7A 3HHAA 3P5WA 3CH2X 5EZSA 5FPWA 5EGWA 1YALA 3ERVA 3CBJA 4YYVA 3K24A 1BP4A 2R9OA 2PNSA 4CDEB 1CVZA 1PPPA 1GECE 4OW0A 1PPOA 3OISA 3I3TA 1EWMA 2H7JA 4CDCB 2HWKA 1PPDA 3I06A 2DCAA 2BDZA 2XU1A 4WA6A 4YYSA 1BY8A 3KWZA 1THEA 3PRMA 3P5VA 1ATKA 4HWYA 3PSEA 3KKUA 3BBAA 2YJ8A 1TLOA 3O0UA 3PW3A 2AUXA 1PCIA 2PADA 5A24A 3DF0A 4P6EA 1GCBA 1CV8A 4PI3A 1U9WA 1DKIA 3BCNA 4I04A 2WBFX 2BU3A 2YJ2A 4DMXA 2JTCA 3USVA 3TMPA 5EZQA 2DJFB 3IFUA 1F2BA 3IUTA 3N3KA 1XKGA 1KFUL 1VSNA 3MHSA 4BSQA 2PREA 3H89A 2E02A 3PT2A 4N79A 1MDWA 3V6CA 3M99A 1BGOA 4PP1A 4BQVA 2FUDA 1ICFA 1YVBA 2NQGA 3WXGA 3BWKA 3PHWA 2HD5A 4QH6A 4QBBA 2B1NA 1GLOA 4PADA 2R6NA 3H8BA 5CHVA 2HXZA 3NHEA 4OELA 1MIRA 3IEJA 3K8UA 1AIMA 2ARYA 4W5BA 2FRAA 8PCHA 3IOQA 4FJCA 4YYQA 3F5VA 2G8JA 3PNRA 6PADA 1STFE 2DC7A 2XU3A 4IUMA 4P16A 1Y4HA 2AUZA 3W31A 2R9NA 2P0RA 1AYUA 3RNVA 4D8BA 1CS8A 3H8CA 4G54A 3LFYA 4YYWA 2F7DA 3AI8A 2AYOA 2R9FA 1YT7A 3PHXA 4YYRA 3K9MA 1A6RA 5JZEA 5K16A 1NQCA 1ME3A 2ATOA 4QRGA 3TRKA 2XU5A 2NQDB 4X6JA 4CDDB 1PIPA 1ME4A
chains in the Genus database with same CATH topology
2UZJA 3C0RA 3BBAA 3MJ5A 4WURA 2DOSA 3B21A 2J7QA 2BTWB 4MM3B 4A5UA 3W30A 1DKIA 2BU3A 4ZTBA 2JTCA 4RF1A 4D8IA 4D8EA 4HXDB 4RKXA 3TMPA 5EZQA 3IFUA 4GUAA 2J7QC 4BOQA 3ZNHA 4OVZA 3PT2A 3OQCA 4REZA 3E9SA 2FE8A 1UKFA 3BY4A 4XZXA 1PVJA 2AGAA 4M0WA 4BOUA 5KO3A 4BOPA 3PHWA 4BOSA 1YZBA 3BB7A 5EZSA 5E6JA 3O65A 2BTWA 4OW0A 2JRIA 3PHUA 4IUMA 4P16A 3W31A 4D8BA 3RNVA 3MP2A 2HWKA 4OVZB 4IP3A 3PRPA 3PHXA 4PT5A 4R3DA 5JZEA 3MTVA 2Z84A 3PRMA 4RF0A 3TRKA 4MI7A 3PSEA 4BOZA 4RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNV A; 
#chains in the Genus database with same CATH topology
 3C0R A;  3MJ5 A;  4WUR A;  3O1G A;  1U9Q X;  4QRX A;  2DOS A;  3B21 A;  1SP4 B;  1KHQ A;  5JH3 A;  2J7Q A;  2B1M A;  1TL9 A;  4A5U A;  1AEC A;  1KFX L;  3OF9 A;  4MZO A;  4I05 A;  3MHH A;  2IPP B;  3CH3 X;  1CSB B;  3KSE A;  4ZTB A;  4D8E A;  3MTN A;  2DZZ A;  3KW9 A;  4AXL A;  2FT2 A;  1F2A A;  1KHP A;  2J7Q C;  3BPF A;  1CJL A;  1EF7 A;  3P5U A;  1FH0 A;  2E01 A;  4AXM A;  3ZNH A;  2DCD A;  3H7D A;  1NL6 A;  3OQC A;  4REZ A;  3E9S A;  3OF8 A;  3B79 A;  2OP3 A;  2NQA A;  1TU6 A;  2O6X A;  3BY4 A;  1NB3 A;  1PVJ A;  2AGA A;  1GMY A;  1KXR A;  5KO3 A;  4OEM A;  3MOR A;  4BOS A;  1AYV A;  1F29 A;  1YZB A;  4YV8 A;  4W4U A;  2DZY A;  3O65 A;  3ZUA A;  3V6E A;  3BC3 A;  4BS5 A;  1ZCM A;  4CZW A;  1MHW A;  1MEM A;  3S3R A;  2G7Y A;  1S4V A;  1QOL A;  1PBH A;  2JQG R;  2PBH A;  3IMA A;  5J94 A;  1U9V A;  1POP A;  4K7C A;  2VHS A;  4Q8G A;  3MP2 A;  4YYU A;  2GHU A;  2IBI A;  1VJV A;  3PRP A;  1EWP A;  1AU4 A;  1ITO A;  4R3D A;  2Z84 A;  1BQI A;  4MSX A;  3H6S A;  4YVA A;  2GFO A;  4RF0 A;  2F1G A;  3C9E A;  1NLJ A;  4BOZ A;  1YK7 A;  2DC9 A;  1MS6 A;  5CHT A;  5EF4 A;  4XR7 A;  3P5X A;  3QSD A;  4KLB A;  3PBH A;  2FYE A;  2Y6E A;  2AS8 A;  1YK8 A;  2Y5B A;  2DC8 A;  2AYN A;  3F75 A;  2E03 A;  4RY2 A;  4MM3 B;  2YJB A;  4BS6 A;  2AVW A;  2DCC A;  2BDL A;  1HUC B;  3RVW A;  1Q6K A;  4HXD B;  3HHI A;  4X6I A;  1CQD A;  4BPV A;  1X9Y A;  4RKX A;  2FRQ A;  7PCK A;  2P86 A;  3IHP A;  1PXV A;  5CVN B;  3QJ3 A;  1U9X A;  4OVZ A;  2YJC A;  1DF0 A;  3HWN A;  2FE8 A;  1ZIV A;  3WXF A;  1EWO A;  1UKF A;  3LXS A;  2OUL A;  4XZX A;  4M0W A;  2R9C A;  4W5C A;  4BOU A;  4CDF B;  1AU3 A;  2HHN A;  1PPN A;  1CTE A;  2E00 A;  2FO5 A;  2AU1 A;  4P6G A;  5E6J A;  2BTW A;  2AIM A;  5JA7 A;  2FQ9 A;  1QMY A;  2JRI A;  3WXE A;  5F02 A;  2YJ9 A;  1PAD A;  1QXP A;  1NPZ A;  3PHU A;  4RNA A;  3N4C A;  2JQF R;  4OVZ B;  4IP3 A;  3OVZ A;  1QDQ A;  1CB5 A;  3CBK A;  1JQP A;  4QRV A;  2XU4 A;  3QT4 A;  4PT5 A;  3D6S A;  3MTV A;  2R9M A;  5CVM A;  2G8E A;  3BOW A;  3PDF A;  3RVV A;  3E1Z B;  3KX1 A;  4X6H A;  4MI7 A;  4PP2 E;  1AYW A;  2FTD A;  2UZJ A;  4N8W A;  3TNX A;  3RVX A;  1PE6 A;  2C0Y A;  2DCB A;  3KWB X;  4MZS A;  1MEG A;  1AU0 A;  1Y08 A;  9PAP A;  1EWL A;  4N4Z A;  2BTW B;  3OVX A;  3W30 A;  3HD3 A;  1DEU A;  4ZUX U;  1CPJ A;  3KFQ A;  2CB5 A;  1AU2 A;  4I07 A;  2DJG B;  3BPM A;  1M6D A;  4RF1 A;  4D8I A;  2NQI A;  1F2C A;  4GUA A;  2OZ2 A;  1NB5 A;  5PAD A;  2VHF A;  4BOQ A;  1O0E A;  3S3Q A;  2G6D A;  3IV2 A;  4DMY A;  3N3G A;  2HH5 A;  1IWD A;  3GCB A;  2P7U A;  1SNK A;  2DC6 A;  4FIP A;  5CVO B;  2CIO A;  4BOP A;  3U8E A;  1K3B B;  4FK5 A;  2ACT A;  4XUI A;  4Q8H A;  1U5I A;  3BB7 A;  3HHA A;  3P5W A;  3CH2 X;  5EZS A;  5FPW A;  5EGW A;  1YAL A;  3ERV A;  3CBJ A;  4YYV A;  3K24 A;  1BP4 A;  2R9O A;  2PNS A;  4CDE B;  1CVZ A;  1PPP A;  1GEC E;  4OW0 A;  1PPO A;  3OIS A;  3I3T A;  1EWM A;  2H7J A;  4CDC B;  2HWK A;  1PPD A;  3I06 A;  2DCA A;  2BDZ A;  2XU1 A;  4WA6 A;  4YYS A;  1BY8 A;  3KWZ A;  1THE A;  3PRM A;  3P5V A;  1ATK A;  4HWY A;  3PSE A;  3KKU A;  3BBA A;  2YJ8 A;  1TLO A;  3O0U A;  3PW3 A;  2AUX A;  1PCI A;  2PAD A;  5A24 A;  3DF0 A;  4P6E A;  1GCB A;  1CV8 A;  4PI3 A;  1U9W A;  1DKI A;  3BCN A;  4I04 A;  2WBF X;  2BU3 A;  2YJ2 A;  4DMX A;  2JTC A;  3USV A;  3TMP A;  5EZQ A;  2DJF B;  3IFU A;  1F2B A;  3IUT A;  3N3K A;  1XKG A;  1KFU L;  1VSN A;  3MHS A;  4BSQ A;  2PRE A;  3H89 A;  2E02 A;  3PT2 A;  4N79 A;  1MDW A;  3V6C A;  3M99 A;  1BGO A;  4PP1 A;  4BQV A;  2FUD A;  1ICF A;  1YVB A;  2NQG A;  3WXG A;  3BWK A;  3PHW A;  2HD5 A;  4QH6 A;  4QBB A;  2B1N A;  1GLO A;  4PAD A;  2R6N A;  3H8B A;  5CHV A;  2HXZ A;  3NHE A;  4OEL A;  1MIR A;  3IEJ A;  3K8U A;  1AIM A;  2ARY A;  4W5B A;  2FRA A;  8PCH A;  3IOQ A;  4FJC A;  4YYQ A;  3F5V A;  2G8J A;  3PNR A;  6PAD A;  1STF E;  2DC7 A;  2XU3 A;  4IUM A;  4P16 A;  1Y4H A;  2AUZ A;  3W31 A;  2R9N A;  2P0R A;  1AYU A;  3RNV A;  4D8B A;  1CS8 A;  3H8C A;  4G54 A;  3LFY A;  4YYW A;  2F7D A;  3AI8 A;  2AYO A;  2R9F A;  1YT7 A;  3PHX A;  4YYR A;  3K9M A;  1A6R A;  5JZE A;  5K16 A;  1NQC A;  1ME3 A;  2ATO A;  4QRG A;  3TRK A;  2XU5 A;  2NQD B;  4X6J A;  4CDD B;  1PIP A;  1ME4 A; 
#chains in the Genus database with same CATH homology
 2UZJ A;  3C0R A;  3BBA A;  3MJ5 A;  4WUR A;  2DOS A;  3B21 A;  2J7Q A;  2BTW B;  4MM3 B;  4A5U A;  3W30 A;  1DKI A;  2BU3 A;  4ZTB A;  2JTC A;  4RF1 A;  4D8I A;  4D8E A;  4HXD B;  4RKX A;  3TMP A;  5EZQ A;  3IFU A;  4GUA A;  2J7Q C;  4BOQ A;  3ZNH A;  4OVZ A;  3PT2 A;  3OQC A;  4REZ A;  3E9S A;  2FE8 A;  1UKF A;  3BY4 A;  4XZX A;  1PVJ A;  2AGA A;  4M0W A;  4BOU A;  5KO3 A;  4BOP A;  3PHW A;  4BOS A;  1YZB A;  3BB7 A;  5EZS A;  5E6J A;  3O65 A;  2BTW A;  4OW0 A;  2JRI A;  3PHU A;  4IUM A;  4P16 A;  3W31 A;  4D8B A;  3RNV A;  3MP2 A;  2HWK A;  4OVZ B;  4IP3 A;  3PRP A;  3PHX A;  4PT5 A;  4R3D A;  5JZE A;  3MTV A;  2Z84 A;  3PRM A;  4RF0 A;  3TRK A;  4MI7 A;  3PSE A;  4BOZ A;  4RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...