1U9QX

Crystal structure of cruzain bound to an alpha-ketoester
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cruzipain
publication title Development of alpha-keto-based inhibitors of cruzain, a cysteine protease implicated in Chagas disease
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2004-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1u9qX00
1ATKA 3LFYA 3PNRA 1SP4B 3H8CA 1GECE 2FYEA 1AYVA 3HD3A 1CS8A 3QSDA 3NHEA 3CBJA 4CZWA 4G54A 4P6EA 4KLBA 1PE6A 3F75A 1CJLA 1K3BB 3IMAA 2YJCA 2DZYA 2CB5A 4PP1A 2PADA 2FTDA 3ERVA 3KFQA 1F2CA 2B1NA 2R9CA 1CVZA 3BPMA 3USVA 4FK5A 3OF8A 1STFE 1F29A 4X6HA 4BS5A 2YJ8A 1EWOA 2FQ9A 3I06A 1AU4A 2AS8A 1PBHA 2FO5A 4QH6A 1BQIA 2NQGA 9PAPA 1F2BA 2ACTA 3WXGA 3IV2A 2ATOA 2DC7A 1YT7A 1ME3A 4Q8HA 2G8EA 5J94A 3F5VA 4QRGA 1S4VA 2PREA 1Y4HA 1PXVA 1NPZA 2AUXA 2G6DA 3IUTA 4BPVA 1PADA 1ITOA 5CVMA 2VHSA 2VHFA 2NQIA 1CTEA 3HHAA 2YJ2A 1YK8A 2R6NA 2DCCA 2DC6A 2E01A 3PW3A 2G7YA 1KHPA 1YVBA 2DC8A 3M99A 1KFUL 1SNKA 2R9FA 3K24A 1JQPA 3BC3A 4OEMA 1U9QX 3KWBX 2B1MA 4HWYA 5CHVA 3MTNA 3P5UA 1U5IA 4QBBA 1QDQA 4ZUXU 1CV8A 2C0YA 1QXPA 2CIOA 1YK7A 2GFOA 3S3QA 4N8WA 4W4UA 1PPDA 2ARYA 3MHSA 5CVOB 3ZUAA 3S3RA 1XKGA 6PADA 3DF0A 3I3TA 2G8JA 1X9YA 1NB3A 4W5BA 4AXLA 1CPJA 1TU6A 3H7DA 1PPPA 2FRAA 1MS6A 4X6JA 2AYNA 3RVWA 4I05A 2IBIA 1BP4A 1Q6KA 5JA7A 1AYUA 4X6IA 3H89A 1AIMA 1M6DA 2HH5A 4QRXA 4WA6A 5EGWA 2DJFB 5CHTA 1F2AA 4I07A 4BSQA 4I04A 1Y08A 1GLOA 2XU5A 2F7DA 3WXEA 2E00A 3V6CA 4DMXA 3H6SA 3N3GA 2NQAA 3K8UA 2DCDA 5F02A 2R9NA 2PBHA 2F1GA 1NL6A 1TL9A 2BDLA 1VSNA 1POPA 2XU1A 4XUIA 2AUZA 4BQVA 3HHIA 2FUDA 4AXMA 3OF9A 5CVNB 3OVZA 3CH3X 2JQFR 2AYOA 1AU0A 1NB5A 1QOLA 4DMYA 3O1GA 5JH3A 1AYWA 3QJ3A 4YYRA 2PNSA 2OULA 2R9MA 3B79A 3IEJA 2OP3A 3PDFA 4P6GA 1BGOA 4MZSA 1DEUA 2E02A 4YV8A 4K7CA 1BY8A 2HXZA 4N4ZA 2E03A 4YVAA 3KKUA 3E1ZB 4CDDB 4XR7A 1PIPA 3RVXA 4CDFB 3CH2X 1FH0A 1DF0A 1AU3A 3WXFA 3O0UA 1PCIA 5A24A 4YYWA 4YYSA 4N79A 3KW9A 4QRVA 4W5CA 1MIRA 5PADA 1GCBA 3BPFA 1U9XA 4PP2E 2P7UA 4Q8GA 4PI3A 3V6EA 1MHWA 2GHUA 4CDCB 2Y6EA 2XU4A 1KHQA 3P5VA 1A6RA 2DCBA 4YYVA 2DZZA 3D6SA 3LXSA 1ICFA 3RVVA 2YJ9A 2BDZA 3CBKA 1EWMA 1AECA 3P5XA 1ZCMA 1PPOA 4MSXA 3KX1A 1IWDA 4YYUA 2HHNA 2AU1A 2NQDB 4CDEB 7PCKA 3OISA 2YJBA 1PPNA 2Y5BA 2FRQA 1ZIVA 5FPWA 3MHHA 4PADA 1GMYA 1U9WA 3U8EA 3IOQA 1CSBB 3N3KA 1ME4A 4BS6A 3BWKA 2JQGR 1EWLA 3HWNA 3BOWA 4MZOA 1CB5A 3N4CA 1KFXL 1KXRA 2AIMA 1AU2A 1MEMA 1THEA 3OVXA 1NQCA 1EF7A 3TNXA 3BCNA 2WBFX 4OELA 3P5WA 3QT4A 2P86A 2FT2A 1MDWA 2XU3A 3KSEA 2IPPB 3GCBA 2DC9A 3C9EA 2AVWA 1HUCB 1QMYA 2H7JA 3AI8A 1CQDA 1EWPA 2O6XA 5K16A 3IHPA 4FIPA 2OZ2A 4FJCA 1TLOA 3H8BA 2HD5A 3MORA 2R9OA 8PCHA 2DCAA 1VJVA 3K9MA 1MEGA 2DJGB 2P0RA 4RY2A 4YYQA 1YALA 3PBHA 5EF4A 1O0EA 3KWZA 1NLJA 1U9VA
chains in the Genus database with same CATH superfamily
1ATKA 3LFYA 5EZSA 3PNRA 4BOUA 1SP4B 3H8CA 1GECE 2FYEA 1AYVA 4GUAA 5E6JA 3HD3A 1CS8A 2HWKA 3IFUA 3QSDA 3NHEA 3CBJA 4CZWA 4G54A 4P6EA 4KLBA 1PE6A 3F75A 1CJLA 2BU3A 1K3BB 4RF1A 3IMAA 2YJCA 2DZYA 2CB5A 4PP1A 2PADA 2FTDA 3ERVA 3KFQA 1F2CA 2B1NA 2R9CA 1CVZA 3BPMA 3USVA 4FK5A 3OF8A 1STFE 1F29A 4X6HA 4BS5A 2YJ8A 1EWOA 2FQ9A 3I06A 1AU4A 2AS8A 3BY4A 1PBHA 2FO5A 4QH6A 4BOPA 4R3DA 1BQIA 2NQGA 9PAPA 1F2BA 2ACTA 4M0WA 3WXGA 3IV2A 2ATOA 2DC7A 1YT7A 1ME3A 4Q8HA 2G8EA 5J94A 3F5VA 4QRGA 5EZQA 1S4VA 2PREA 4MM3B 1Y4HA 1PXVA 1NPZA 2AUXA 2G6DA 3IUTA 4BPVA 1PADA 1ITOA 5CVMA 2VHSA 2VHFA 2NQIA 4A5UA 1CTEA 3HHAA 2YJ2A 1YK8A 2BTWA 2R6NA 2DCCA 2DC6A 2E01A 3PW3A 2G7YA 4ZTBA 1KHPA 1YVBA 2DC8A 3M99A 1KFUL 1SNKA 2R9FA 3K24A 2JRIA 1JQPA 3BC3A 4OEMA 1U9QX 4IP3A 3OQCA 3O65A 3KWBX 2B1MA 4HWYA 5CHVA 3MTNA 3BB7A 3P5UA 1U5IA 4QBBA 4RF0A 1QDQA 4ZUXU 1CV8A 2C0YA 1QXPA 2CIOA 1YK7A 2GFOA 3S3QA 3PHUA 4N8WA 4W4UA 1PPDA 2ARYA 3MHSA 5CVOB 3ZUAA 3S3RA 1XKGA 6PADA 2J7QC 3DF0A 4RNAA 3I3TA 2G8JA 1X9YA 1NB3A 4W5BA 4OVZA 4AXLA 1CPJA 1TU6A 3H7DA 1PPPA 2FRAA 1MS6A 4X6JA 2AYNA 4XZXA 3RVWA 4I05A 2IBIA 1BP4A 1Q6KA 5JA7A 1YZBA 3W31A 4BOQA 1AYUA 4X6IA 3H89A 1AIMA 1M6DA 2HH5A 4QRXA 4WA6A 5EGWA 2DJFB 5CHTA 1F2AA 4I07A 4BSQA 4I04A 1Y08A 1GLOA 2XU5A 2F7DA 3WXEA 2E00A 3V6CA 4DMXA 3H6SA 3N3GA 2NQAA 3RNVA 3B21A 3PRMA 3K8UA 2DCDA 3PT2A 5F02A 5JZEA 2R9NA 2PBHA 2F1GA 1NL6A 1TL9A 2BDLA 1VSNA 1POPA 2XU1A 4XUIA 2AUZA 4BQVA 2AGAA 3MP2A 2FE8A 3HHIA 2FUDA 4AXMA 3OF9A 5CVNB 3OVZA 3CH3X 2JQFR 2AYOA 1AU0A 1NB5A 4OW0A 1QOLA 1UKFA 4DMYA 3O1GA 5JH3A 1AYWA 3QJ3A 4YYRA 3E9SA 4HXDB 4IUMA 2PNSA 2OULA 2R9MA 4RKXA 3B79A 3IEJA 2OP3A 3MJ5A 3PDFA 4P6GA 1BGOA 4MZSA 1DEUA 2E02A 4YV8A 4K7CA 3BBAA 3PHWA 1BY8A 2HXZA 4N4ZA 4WURA 2E03A 4YVAA 3KKUA 1PVJA 3E1ZB 4CDDB 2BTWB 4XR7A 1PIPA 3RVXA 4CDFB 3CH2X 1FH0A 1DF0A 1AU3A 3WXFA 3O0UA 4BOSA 1PCIA 5A24A 4YYWA 4YYSA 4N79A 4D8IA 3KW9A 4QRVA 4W5CA 1MIRA 5PADA 1GCBA 3BPFA 1U9XA 4PP2E 2P7UA 4Q8GA 4PI3A 4BOZA 3V6EA 2UZJA 1MHWA 2GHUA 4CDCB 2Y6EA 2XU4A 1KHQA 3ZNHA 3P5VA 1A6RA 2DCBA 4YYVA 2DZZA 3D6SA 3MTVA 3LXSA 1ICFA 3PHXA 3RVVA 2YJ9A 4PT5A 2BDZA 3CBKA 1EWMA 1AECA 3P5XA 1ZCMA 1PPOA 4MSXA 3KX1A 1IWDA 4YYUA 2HHNA 4OVZB 2AU1A 3TRKA 2Z84A 2NQDB 4CDEB 7PCKA 3OISA 2YJBA 1PPNA 2Y5BA 2FRQA 3PSEA 1ZIVA 5FPWA 3MHHA 4PADA 1GMYA 4P16A 1U9WA 3U8EA 3IOQA 2DOSA 1CSBB 3N3KA 1ME4A 4BS6A 3BWKA 2JQGR 1EWLA 3HWNA 3BOWA 4REZA 4MZOA 1CB5A 3N4CA 1KFXL 3W30A 1KXRA 1DKIA 2AIMA 1AU2A 1MEMA 2J7QA 1THEA 3OVXA 5KO3A 1NQCA 1EF7A 3TNXA 3BCNA 2WBFX 4OELA 3P5WA 3QT4A 2P86A 2FT2A 1MDWA 2XU3A 4D8BA 3KSEA 2IPPB 4D8EA 3GCBA 3PRPA 2DC9A 2JTCA 3C9EA 2AVWA 1HUCB 1QMYA 2H7JA 3AI8A 1CQDA 1EWPA 2O6XA 5K16A 3IHPA 4FIPA 2OZ2A 3C0RA 4FJCA 1TLOA 3H8BA 2HD5A 3MORA 2R9OA 3TMPA 8PCHA 2DCAA 1VJVA 3K9MA 1MEGA 2DJGB 2P0RA 4RY2A 4MI7A 4YYQA 1YALA 3PBHA 5EF4A 1O0EA 3KWZA 1NLJA 1U9VA
chains in the Genus database with same CATH topology
1ATKA 3LFYA 3PNRA 1SP4B 3H8CA 1GECE 2FYEA 1AYVA 3HD3A 1CS8A 1GX3A 3QSDA 3NHEA 3CBJA 4CZWA 4G54A 4P6EA 4KLBA 1PE6A 3F75A 1CJLA 1K3BB 3IMAA 2YJCA 2DZYA 2CB5A 4PP1A 2PADA 2FTDA 3ERVA 3KFQA 1F2CA 2B1NA 2R9CA 1CVZA 3BPMA 3USVA 1E2TA 4FK5A 3OF8A 1STFE 1F29A 4X6HA 4BS5A 2YJ8A 1EWOA 2FQ9A 3I06A 1AU4A 2AS8A 1PBHA 2FO5A 4QH6A 1BQIA 2NQGA 9PAPA 1F2BA 2ACTA 3WXGA 3IV2A 1W4TA 2ATOA 2DC7A 1YT7A 1ME3A 4Q8HA 2G8EA 5J94A 3F5VA 4QRGA 4NV8A 1S4VA 2PREA 1Y4HA 1PXVA 1NPZA 2AUXA 2G6DA 3IUTA 4BPVA 1PADA 1ITOA 5CVMA 2VHSA 2VHFA 2NQIA 1CTEA 3HHAA 2YJ2A 1YK8A 2R6NA 2DCCA 2DC6A 2E01A 3PW3A 2G7YA 1KHPA 1YVBA 2DC8A 3M99A 1KFUL 1SNKA 2R9FA 3K24A 1JQPA 3BC3A 4OEMA 1U9QX 3KWBX 2B1MA 4HWYA 5CHVA 3MTNA 3P5UA 1U5IA 4QBBA 1QDQA 4ZUXU 1CV8A 2C0YA 1QXPA 2CIOA 1YK7A 2GFOA 3S3QA 4N8WA 4W4UA 1PPDA 2ARYA 3MHSA 5CVOB 3ZUAA 3S3RA 1XKGA 6PADA 3DF0A 3I3TA 2G8JA 1X9YA 1NB3A 4W5BA 4AXLA 1CPJA 1TU6A 3H7DA 1PPPA 4B55A 2FRAA 1MS6A 4X6JA 2AYNA 3RVWA 4I05A 2IBIA 1BP4A 1Q6KA 5JA7A 1AYUA 4X6IA 3H89A 1AIMA 1M6DA 2HH5A 4QRXA 4WA6A 5EGWA 2DJFB 5CHTA 1F2AA 4I07A 4BGFA 4BSQA 2VFCA 4I04A 1Y08A 1GLOA 2XU5A 2F7DA 3WXEA 2E00A 3V6CA 4DMXA 3H6SA 3N3GA 2NQAA 1W6FA 3K8UA 2DCDA 5F02A 2R9NA 2PBHA 2F1GA 1NL6A 1TL9A 2BDLA 1VSNA 1POPA 2XU1A 4XUIA 2AUZA 4BQVA 3HHIA 2FUDA 4AXMA 3OF9A 5CVNB 3OVZA 3CH3X 2JQFR 2AYOA 1AU0A 1NB5A 1QOLA 4DMYA 3O1GA 5JH3A 1AYWA 3QJ3A 4YYRA 2PNSA 2OULA 2R9MA 3B79A 3IEJA 2OP3A 4NV7A 3PDFA 4P6GA 1BGOA 4MZSA 1DEUA 2E02A 4YV8A 4K7CA 1BY8A 2HXZA 4N4ZA 2E03A 4YVAA 3KKUA 3E1ZB 4CDDB 4XR7A 1PIPA 3RVXA 4CDFB 3CH2X 1FH0A 1DF0A 1AU3A 3WXFA 3O0UA 1PCIA 5A24A 4YYWA 4YYSA 4N79A 3KW9A 4QRVA 4W5CA 1MIRA 5PADA 1GCBA 3BPFA 1U9XA 4PP2E 2P7UA 4Q8GA 4PI3A 3V6EA 1MHWA 2GHUA 4CDCB 2Y6EA 2XU4A 1KHQA 3P5VA 1A6RA 2DCBA 4YYVA 2DZZA 3D6SA 3LXSA 1ICFA 1W5RA 3RVVA 2YJ9A 2BDZA 3CBKA 1EWMA 1AECA 3P5XA 1ZCMA 1PPOA 4MSXA 3KX1A 1IWDA 2BSZA 4YYUA 2HHNA 4GUZA 2AU1A 2NQDB 4CDEB 7PCKA 3OISA 2YJBA 1PPNA 2Y5BA 2FRQA 1ZIVA 5FPWA 3MHHA 4PADA 1GMYA 1U9WA 3U8EA 3IOQA 1CSBB 3N3KA 1ME4A 4BS6A 3BWKA 2JQGR 1EWLA 3HWNA 3BOWA 4C5PA 4MZOA 1CB5A 3N4CA 1KFXL 1KXRA 2AIMA 1AU2A 1MEMA 3LTWA 1THEA 3OVXA 1NQCA 3D9WA 1EF7A 3TNXA 3BCNA 2WBFX 4OELA 3P5WA 3QT4A 2P86A 2FT2A 1MDWA 2XU3A 3KSEA 2IPPB 3GCBA 2DC9A 3C9EA 2AVWA 1HUCB 1QMYA 2H7JA 2VFBA 1CQDA 3AI8A 1EWPA 2O6XA 5K16A 3IHPA 4FIPA 2OZ2A 4FJCA 1TLOA 3H8BA 2HD5A 3MORA 2R9OA 8PCHA 2DCAA 1VJVA 3K9MA 1MEGA 2DJGB 2P0RA 4RY2A 4YYQA 1YALA 3PBHA 5EF4A 1O0EA 3KWZA 1NLJA 1U9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATK A;  3LFY A;  3PNR A;  1SP4 B;  3H8C A;  1GEC E;  2FYE A;  1AYV A;  3HD3 A;  1CS8 A;  3QSD A;  3NHE A;  3CBJ A;  4CZW A;  4G54 A;  4P6E A;  4KLB A;  1PE6 A;  3F75 A;  1CJL A;  1K3B B;  3IMA A;  2YJC A;  2DZY A;  2CB5 A;  4PP1 A;  2PAD A;  2FTD A;  3ERV A;  3KFQ A;  1F2C A;  2B1N A;  2R9C A;  1CVZ A;  3BPM A;  3USV A;  4FK5 A;  3OF8 A;  1STF E;  1F29 A;  4X6H A;  4BS5 A;  2YJ8 A;  1EWO A;  2FQ9 A;  3I06 A;  1AU4 A;  2AS8 A;  1PBH A;  2FO5 A;  4QH6 A;  1BQI A;  2NQG A;  9PAP A;  1F2B A;  2ACT A;  3WXG A;  3IV2 A;  2ATO A;  2DC7 A;  1YT7 A;  1ME3 A;  4Q8H A;  2G8E A;  5J94 A;  3F5V A;  4QRG A;  1S4V A;  2PRE A;  1Y4H A;  1PXV A;  1NPZ A;  2AUX A;  2G6D A;  3IUT A;  4BPV A;  1PAD A;  1ITO A;  5CVM A;  2VHS A;  2VHF A;  2NQI A;  1CTE A;  3HHA A;  2YJ2 A;  1YK8 A;  2R6N A;  2DCC A;  2DC6 A;  2E01 A;  3PW3 A;  2G7Y A;  1KHP A;  1YVB A;  2DC8 A;  3M99 A;  1KFU L;  1SNK A;  2R9F A;  3K24 A;  1JQP A;  3BC3 A;  4OEM A;  1U9Q X;  3KWB X;  2B1M A;  4HWY A;  5CHV A;  3MTN A;  3P5U A;  1U5I A;  4QBB A;  1QDQ A;  4ZUX U;  1CV8 A;  2C0Y A;  1QXP A;  2CIO A;  1YK7 A;  2GFO A;  3S3Q A;  4N8W A;  4W4U A;  1PPD A;  2ARY A;  3MHS A;  5CVO B;  3ZUA A;  3S3R A;  1XKG A;  6PAD A;  3DF0 A;  3I3T A;  2G8J A;  1X9Y A;  1NB3 A;  4W5B A;  4AXL A;  1CPJ A;  1TU6 A;  3H7D A;  1PPP A;  2FRA A;  1MS6 A;  4X6J A;  2AYN A;  3RVW A;  4I05 A;  2IBI A;  1BP4 A;  1Q6K A;  5JA7 A;  1AYU A;  4X6I A;  3H89 A;  1AIM A;  1M6D A;  2HH5 A;  4QRX A;  4WA6 A;  5EGW A;  2DJF B;  5CHT A;  1F2A A;  4I07 A;  4BSQ A;  4I04 A;  1Y08 A;  1GLO A;  2XU5 A;  2F7D A;  3WXE A;  2E00 A;  3V6C A;  4DMX A;  3H6S A;  3N3G A;  2NQA A;  3K8U A;  2DCD A;  5F02 A;  2R9N A;  2PBH A;  2F1G A;  1NL6 A;  1TL9 A;  2BDL A;  1VSN A;  1POP A;  2XU1 A;  4XUI A;  2AUZ A;  4BQV A;  3HHI A;  2FUD A;  4AXM A;  3OF9 A;  5CVN B;  3OVZ A;  3CH3 X;  2JQF R;  2AYO A;  1AU0 A;  1NB5 A;  1QOL A;  4DMY A;  3O1G A;  5JH3 A;  1AYW A;  3QJ3 A;  4YYR A;  2PNS A;  2OUL A;  2R9M A;  3B79 A;  3IEJ A;  2OP3 A;  3PDF A;  4P6G A;  1BGO A;  4MZS A;  1DEU A;  2E02 A;  4YV8 A;  4K7C A;  1BY8 A;  2HXZ A;  4N4Z A;  2E03 A;  4YVA A;  3KKU A;  3E1Z B;  4CDD B;  4XR7 A;  1PIP A;  3RVX A;  4CDF B;  3CH2 X;  1FH0 A;  1DF0 A;  1AU3 A;  3WXF A;  3O0U A;  1PCI A;  5A24 A;  4YYW A;  4YYS A;  4N79 A;  3KW9 A;  4QRV A;  4W5C A;  1MIR A;  5PAD A;  1GCB A;  3BPF A;  1U9X A;  4PP2 E;  2P7U A;  4Q8G A;  4PI3 A;  3V6E A;  1MHW A;  2GHU A;  4CDC B;  2Y6E A;  2XU4 A;  1KHQ A;  3P5V A;  1A6R A;  2DCB A;  4YYV A;  2DZZ A;  3D6S A;  3LXS A;  1ICF A;  3RVV A;  2YJ9 A;  2BDZ A;  3CBK A;  1EWM A;  1AEC A;  3P5X A;  1ZCM A;  1PPO A;  4MSX A;  3KX1 A;  1IWD A;  4YYU A;  2HHN A;  2AU1 A;  2NQD B;  4CDE B;  7PCK A;  3OIS A;  2YJB A;  1PPN A;  2Y5B A;  2FRQ A;  1ZIV A;  5FPW A;  3MHH A;  4PAD A;  1GMY A;  1U9W A;  3U8E A;  3IOQ A;  1CSB B;  3N3K A;  1ME4 A;  4BS6 A;  3BWK A;  2JQG R;  1EWL A;  3HWN A;  3BOW A;  4MZO A;  1CB5 A;  3N4C A;  1KFX L;  1KXR A;  2AIM A;  1AU2 A;  1MEM A;  1THE A;  3OVX A;  1NQC A;  1EF7 A;  3TNX A;  3BCN A;  2WBF X;  4OEL A;  3P5W A;  3QT4 A;  2P86 A;  2FT2 A;  1MDW A;  2XU3 A;  3KSE A;  2IPP B;  3GCB A;  2DC9 A;  3C9E A;  2AVW A;  1HUC B;  1QMY A;  2H7J A;  3AI8 A;  1CQD A;  1EWP A;  2O6X A;  5K16 A;  3IHP A;  4FIP A;  2OZ2 A;  4FJC A;  1TLO A;  3H8B A;  2HD5 A;  3MOR A;  2R9O A;  8PCH A;  2DCA A;  1VJV A;  3K9M A;  1MEG A;  2DJG B;  2P0R A;  4RY2 A;  4YYQ A;  1YAL A;  3PBH A;  5EF4 A;  1O0E A;  3KWZ A;  1NLJ A;  1U9V A; 
#chains in the Genus database with same CATH topology
 1ATK A;  3LFY A;  5EZS A;  3PNR A;  4BOU A;  1SP4 B;  3H8C A;  1GEC E;  2FYE A;  1AYV A;  4GUA A;  5E6J A;  3HD3 A;  1CS8 A;  2HWK A;  3IFU A;  3QSD A;  3NHE A;  3CBJ A;  4CZW A;  4G54 A;  4P6E A;  4KLB A;  1PE6 A;  3F75 A;  1CJL A;  2BU3 A;  1K3B B;  4RF1 A;  3IMA A;  2YJC A;  2DZY A;  2CB5 A;  4PP1 A;  2PAD A;  2FTD A;  3ERV A;  3KFQ A;  1F2C A;  2B1N A;  2R9C A;  1CVZ A;  3BPM A;  3USV A;  4FK5 A;  3OF8 A;  1STF E;  1F29 A;  4X6H A;  4BS5 A;  2YJ8 A;  1EWO A;  2FQ9 A;  3I06 A;  1AU4 A;  2AS8 A;  3BY4 A;  1PBH A;  2FO5 A;  4QH6 A;  4BOP A;  4R3D A;  1BQI A;  2NQG A;  9PAP A;  1F2B A;  2ACT A;  4M0W A;  3WXG A;  3IV2 A;  2ATO A;  2DC7 A;  1YT7 A;  1ME3 A;  4Q8H A;  2G8E A;  5J94 A;  3F5V A;  4QRG A;  5EZQ A;  1S4V A;  2PRE A;  4MM3 B;  1Y4H A;  1PXV A;  1NPZ A;  2AUX A;  2G6D A;  3IUT A;  4BPV A;  1PAD A;  1ITO A;  5CVM A;  2VHS A;  2VHF A;  2NQI A;  4A5U A;  1CTE A;  3HHA A;  2YJ2 A;  1YK8 A;  2BTW A;  2R6N A;  2DCC A;  2DC6 A;  2E01 A;  3PW3 A;  2G7Y A;  4ZTB A;  1KHP A;  1YVB A;  2DC8 A;  3M99 A;  1KFU L;  1SNK A;  2R9F A;  3K24 A;  2JRI A;  1JQP A;  3BC3 A;  4OEM A;  1U9Q X;  4IP3 A;  3OQC A;  3O65 A;  3KWB X;  2B1M A;  4HWY A;  5CHV A;  3MTN A;  3BB7 A;  3P5U A;  1U5I A;  4QBB A;  4RF0 A;  1QDQ A;  4ZUX U;  1CV8 A;  2C0Y A;  1QXP A;  2CIO A;  1YK7 A;  2GFO A;  3S3Q A;  3PHU A;  4N8W A;  4W4U A;  1PPD A;  2ARY A;  3MHS A;  5CVO B;  3ZUA A;  3S3R A;  1XKG A;  6PAD A;  2J7Q C;  3DF0 A;  4RNA A;  3I3T A;  2G8J A;  1X9Y A;  1NB3 A;  4W5B A;  4OVZ A;  4AXL A;  1CPJ A;  1TU6 A;  3H7D A;  1PPP A;  2FRA A;  1MS6 A;  4X6J A;  2AYN A;  4XZX A;  3RVW A;  4I05 A;  2IBI A;  1BP4 A;  1Q6K A;  5JA7 A;  1YZB A;  3W31 A;  4BOQ A;  1AYU A;  4X6I A;  3H89 A;  1AIM A;  1M6D A;  2HH5 A;  4QRX A;  4WA6 A;  5EGW A;  2DJF B;  5CHT A;  1F2A A;  4I07 A;  4BSQ A;  4I04 A;  1Y08 A;  1GLO A;  2XU5 A;  2F7D A;  3WXE A;  2E00 A;  3V6C A;  4DMX A;  3H6S A;  3N3G A;  2NQA A;  3RNV A;  3B21 A;  3PRM A;  3K8U A;  2DCD A;  3PT2 A;  5F02 A;  5JZE A;  2R9N A;  2PBH A;  2F1G A;  1NL6 A;  1TL9 A;  2BDL A;  1VSN A;  1POP A;  2XU1 A;  4XUI A;  2AUZ A;  4BQV A;  2AGA A;  3MP2 A;  2FE8 A;  3HHI A;  2FUD A;  4AXM A;  3OF9 A;  5CVN B;  3OVZ A;  3CH3 X;  2JQF R;  2AYO A;  1AU0 A;  1NB5 A;  4OW0 A;  1QOL A;  1UKF A;  4DMY A;  3O1G A;  5JH3 A;  1AYW A;  3QJ3 A;  4YYR A;  3E9S A;  4HXD B;  4IUM A;  2PNS A;  2OUL A;  2R9M A;  4RKX A;  3B79 A;  3IEJ A;  2OP3 A;  3MJ5 A;  3PDF A;  4P6G A;  1BGO A;  4MZS A;  1DEU A;  2E02 A;  4YV8 A;  4K7C A;  3BBA A;  3PHW A;  1BY8 A;  2HXZ A;  4N4Z A;  4WUR A;  2E03 A;  4YVA A;  3KKU A;  1PVJ A;  3E1Z B;  4CDD B;  2BTW B;  4XR7 A;  1PIP A;  3RVX A;  4CDF B;  3CH2 X;  1FH0 A;  1DF0 A;  1AU3 A;  3WXF A;  3O0U A;  4BOS A;  1PCI A;  5A24 A;  4YYW A;  4YYS A;  4N79 A;  4D8I A;  3KW9 A;  4QRV A;  4W5C A;  1MIR A;  5PAD A;  1GCB A;  3BPF A;  1U9X A;  4PP2 E;  2P7U A;  4Q8G A;  4PI3 A;  4BOZ A;  3V6E A;  2UZJ A;  1MHW A;  2GHU A;  4CDC B;  2Y6E A;  2XU4 A;  1KHQ A;  3ZNH A;  3P5V A;  1A6R A;  2DCB A;  4YYV A;  2DZZ A;  3D6S A;  3MTV A;  3LXS A;  1ICF A;  3PHX A;  3RVV A;  2YJ9 A;  4PT5 A;  2BDZ A;  3CBK A;  1EWM A;  1AEC A;  3P5X A;  1ZCM A;  1PPO A;  4MSX A;  3KX1 A;  1IWD A;  4YYU A;  2HHN A;  4OVZ B;  2AU1 A;  3TRK A;  2Z84 A;  2NQD B;  4CDE B;  7PCK A;  3OIS A;  2YJB A;  1PPN A;  2Y5B A;  2FRQ A;  3PSE A;  1ZIV A;  5FPW A;  3MHH A;  4PAD A;  1GMY A;  4P16 A;  1U9W A;  3U8E A;  3IOQ A;  2DOS A;  1CSB B;  3N3K A;  1ME4 A;  4BS6 A;  3BWK A;  2JQG R;  1EWL A;  3HWN A;  3BOW A;  4REZ A;  4MZO A;  1CB5 A;  3N4C A;  1KFX L;  3W30 A;  1KXR A;  1DKI A;  2AIM A;  1AU2 A;  1MEM A;  2J7Q A;  1THE A;  3OVX A;  5KO3 A;  1NQC A;  1EF7 A;  3TNX A;  3BCN A;  2WBF X;  4OEL A;  3P5W A;  3QT4 A;  2P86 A;  2FT2 A;  1MDW A;  2XU3 A;  4D8B A;  3KSE A;  2IPP B;  4D8E A;  3GCB A;  3PRP A;  2DC9 A;  2JTC A;  3C9E A;  2AVW A;  1HUC B;  1QMY A;  2H7J A;  3AI8 A;  1CQD A;  1EWP A;  2O6X A;  5K16 A;  3IHP A;  4FIP A;  2OZ2 A;  3C0R A;  4FJC A;  1TLO A;  3H8B A;  2HD5 A;  3MOR A;  2R9O A;  3TMP A;  8PCH A;  2DCA A;  1VJV A;  3K9M A;  1MEG A;  2DJG B;  2P0R A;  4RY2 A;  4MI7 A;  4YYQ A;  1YAL A;  3PBH A;  5EF4 A;  1O0E A;  3KWZ A;  1NLJ A;  1U9V A; 
#chains in the Genus database with same CATH homology
 1ATK A;  3LFY A;  3PNR A;  1SP4 B;  3H8C A;  1GEC E;  2FYE A;  1AYV A;  3HD3 A;  1CS8 A;  1GX3 A;  3QSD A;  3NHE A;  3CBJ A;  4CZW A;  4G54 A;  4P6E A;  4KLB A;  1PE6 A;  3F75 A;  1CJL A;  1K3B B;  3IMA A;  2YJC A;  2DZY A;  2CB5 A;  4PP1 A;  2PAD A;  2FTD A;  3ERV A;  3KFQ A;  1F2C A;  2B1N A;  2R9C A;  1CVZ A;  3BPM A;  3USV A;  1E2T A;  4FK5 A;  3OF8 A;  1STF E;  1F29 A;  4X6H A;  4BS5 A;  2YJ8 A;  1EWO A;  2FQ9 A;  3I06 A;  1AU4 A;  2AS8 A;  1PBH A;  2FO5 A;  4QH6 A;  1BQI A;  2NQG A;  9PAP A;  1F2B A;  2ACT A;  3WXG A;  3IV2 A;  1W4T A;  2ATO A;  2DC7 A;  1YT7 A;  1ME3 A;  4Q8H A;  2G8E A;  5J94 A;  3F5V A;  4QRG A;  4NV8 A;  1S4V A;  2PRE A;  1Y4H A;  1PXV A;  1NPZ A;  2AUX A;  2G6D A;  3IUT A;  4BPV A;  1PAD A;  1ITO A;  5CVM A;  2VHS A;  2VHF A;  2NQI A;  1CTE A;  3HHA A;  2YJ2 A;  1YK8 A;  2R6N A;  2DCC A;  2DC6 A;  2E01 A;  3PW3 A;  2G7Y A;  1KHP A;  1YVB A;  2DC8 A;  3M99 A;  1KFU L;  1SNK A;  2R9F A;  3K24 A;  1JQP A;  3BC3 A;  4OEM A;  1U9Q X;  3KWB X;  2B1M A;  4HWY A;  5CHV A;  3MTN A;  3P5U A;  1U5I A;  4QBB A;  1QDQ A;  4ZUX U;  1CV8 A;  2C0Y A;  1QXP A;  2CIO A;  1YK7 A;  2GFO A;  3S3Q A;  4N8W A;  4W4U A;  1PPD A;  2ARY A;  3MHS A;  5CVO B;  3ZUA A;  3S3R A;  1XKG A;  6PAD A;  3DF0 A;  3I3T A;  2G8J A;  1X9Y A;  1NB3 A;  4W5B A;  4AXL A;  1CPJ A;  1TU6 A;  3H7D A;  1PPP A;  4B55 A;  2FRA A;  1MS6 A;  4X6J A;  2AYN A;  3RVW A;  4I05 A;  2IBI A;  1BP4 A;  1Q6K A;  5JA7 A;  1AYU A;  4X6I A;  3H89 A;  1AIM A;  1M6D A;  2HH5 A;  4QRX A;  4WA6 A;  5EGW A;  2DJF B;  5CHT A;  1F2A A;  4I07 A;  4BGF A;  4BSQ A;  2VFC A;  4I04 A;  1Y08 A;  1GLO A;  2XU5 A;  2F7D A;  3WXE A;  2E00 A;  3V6C A;  4DMX A;  3H6S A;  3N3G A;  2NQA A;  1W6F A;  3K8U A;  2DCD A;  5F02 A;  2R9N A;  2PBH A;  2F1G A;  1NL6 A;  1TL9 A;  2BDL A;  1VSN A;  1POP A;  2XU1 A;  4XUI A;  2AUZ A;  4BQV A;  3HHI A;  2FUD A;  4AXM A;  3OF9 A;  5CVN B;  3OVZ A;  3CH3 X;  2JQF R;  2AYO A;  1AU0 A;  1NB5 A;  1QOL A;  4DMY A;  3O1G A;  5JH3 A;  1AYW A;  3QJ3 A;  4YYR A;  2PNS A;  2OUL A;  2R9M A;  3B79 A;  3IEJ A;  2OP3 A;  4NV7 A;  3PDF A;  4P6G A;  1BGO A;  4MZS A;  1DEU A;  2E02 A;  4YV8 A;  4K7C A;  1BY8 A;  2HXZ A;  4N4Z A;  2E03 A;  4YVA A;  3KKU A;  3E1Z B;  4CDD B;  4XR7 A;  1PIP A;  3RVX A;  4CDF B;  3CH2 X;  1FH0 A;  1DF0 A;  1AU3 A;  3WXF A;  3O0U A;  1PCI A;  5A24 A;  4YYW A;  4YYS A;  4N79 A;  3KW9 A;  4QRV A;  4W5C A;  1MIR A;  5PAD A;  1GCB A;  3BPF A;  1U9X A;  4PP2 E;  2P7U A;  4Q8G A;  4PI3 A;  3V6E A;  1MHW A;  2GHU A;  4CDC B;  2Y6E A;  2XU4 A;  1KHQ A;  3P5V A;  1A6R A;  2DCB A;  4YYV A;  2DZZ A;  3D6S A;  3LXS A;  1ICF A;  1W5R A;  3RVV A;  2YJ9 A;  2BDZ A;  3CBK A;  1EWM A;  1AEC A;  3P5X A;  1ZCM A;  1PPO A;  4MSX A;  3KX1 A;  1IWD A;  2BSZ A;  4YYU A;  2HHN A;  4GUZ A;  2AU1 A;  2NQD B;  4CDE B;  7PCK A;  3OIS A;  2YJB A;  1PPN A;  2Y5B A;  2FRQ A;  1ZIV A;  5FPW A;  3MHH A;  4PAD A;  1GMY A;  1U9W A;  3U8E A;  3IOQ A;  1CSB B;  3N3K A;  1ME4 A;  4BS6 A;  3BWK A;  2JQG R;  1EWL A;  3HWN A;  3BOW A;  4C5P A;  4MZO A;  1CB5 A;  3N4C A;  1KFX L;  1KXR A;  2AIM A;  1AU2 A;  1MEM A;  3LTW A;  1THE A;  3OVX A;  1NQC A;  3D9W A;  1EF7 A;  3TNX A;  3BCN A;  2WBF X;  4OEL A;  3P5W A;  3QT4 A;  2P86 A;  2FT2 A;  1MDW A;  2XU3 A;  3KSE A;  2IPP B;  3GCB A;  2DC9 A;  3C9E A;  2AVW A;  1HUC B;  1QMY A;  2H7J A;  2VFB A;  1CQD A;  3AI8 A;  1EWP A;  2O6X A;  5K16 A;  3IHP A;  4FIP A;  2OZ2 A;  4FJC A;  1TLO A;  3H8B A;  2HD5 A;  3MOR A;  2R9O A;  8PCH A;  2DCA A;  1VJV A;  3K9M A;  1MEG A;  2DJG B;  2P0R A;  4RY2 A;  4YYQ A;  1YAL A;  3PBH A;  5EF4 A;  1O0E A;  3KWZ A;  1NLJ A;  1U9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...