3BC3A

Exploring inhibitor binding at the s subsites of cathepsin l
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
214
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L heavy and light chains
publication title Exploring inhibitor binding at the S' subsites of cathepsin L
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 214
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bc3A00
4I04A 4OEMA 2DCBA 4I07A 2O6XA 2HHNA 3HHAA 2ACTA 2DJFB 3V6CA 5A24A 1NLJA 3BPFA 3F75A 1O0EA 4YV8A 2YJ2A 1GECE 1STFE 1A6RA 5JH3A 3I3TA 3F5VA 1QXPA 1TL9A 1F29A 2P86A 1MEGA 3OVXA 1EWPA 1KHQA 4RY2A 2NQDB 2DC7A 1F2AA 2FQ9A 2FT2A 4WA6A 1U9VA 2E02A 1MS6A 4W5BA 3O1GA 2G6DA 1PCIA 2XU5A 1VJVA 1NB3A 1ME4A 1EWLA 2DZYA 3CH3X 1YK8A 3BCNA 1XKGA 4YYRA 4K7CA 3H8CA 2AIMA 3AI8A 4QRVA 2R9CA 3O0UA 4Q8GA 3DF0A 3KKUA 5EF4A 2G7YA 2B1MA 3MHHA 3KW9A 4PP1A 2FTDA 4X6IA 4MZSA 4XUIA 1CS8A 3PBHA 1SNKA 2AVWA 2FO5A 3H8BA 3P5WA 1CTEA 2DC6A 1PPOA 4P6EA 1AIMA 3B79A 2DC8A 4CDCB 4P6GA 2AUZA 3RVXA 4XR7A 3PDFA 4I05A 8PCHA 7PCKA 3P5XA 3OF9A 2FRQA 2YJ9A 1NL6A 4FIPA 1U9XA 4QBBA 1YVBA 3HD3A 2PREA 1AU4A 1YK7A 5CVNB 2P7UA 4ZUXU 1AU3A 3S3RA 1IWDA 4DMXA 2HH5A 4BSQA 2FRAA 4N79A 4G54A 2HXZA 4CDFB 2FUDA 1M6DA 2DCCA 2XU3A 1VSNA 4QRGA 1F2CA 1YALA 3E1ZB 3QT4A 1Y4HA 1QDQA 1SP4B 4FK5A 3KWBX 4N4ZA 1KXRA 3K24A 2YJCA 4YYSA 1NQCA 3M99A 3P5UA 1PADA 1BY8A 3MHSA 5CVMA 3QSDA 1TU6A 3RVVA 4QRXA 1AU2A 4BPVA 1PIPA 4MZOA 1BGOA 3WXFA 2NQAA 1S4VA 1CPJA 2E03A 5PADA 2PBHA 2CIOA 4AXLA 1BQIA 3BWKA 4N8WA 4W4UA 5F02A 1PPNA 2XU4A 1AYVA 5CHVA 1YT7A 3V6EA 2R9MA 3KX1A 2AU1A 1Y08A 1Q6KA 2OULA 1EF7A 1AU0A 3PW3A 3N4CA 4KLBA 1ICFA 1U9WA 1ATKA 1ZCMA 1EWMA 1EWOA 2NQIA 1PPDA 3GCBA 2YJBA 1FH0A 2BDZA 2Y5BA 4DMYA 4YYVA 3U8EA 1CJLA 4PP2E 2P0RA 2G8EA 3H7DA 4CDEB 2HD5A 3BPMA 3IOQA 2R9NA 2DC9A 1GCBA 2YJ8A 1QMYA 1PXVA 1PBHA 4YYQA 3QJ3A 2OP3A 3HWNA 1DF0A 6PADA 3OVZA 2GHUA 3CH2X 1NPZA 3HHIA 4AXMA 1U9QX 3IEJA 4YYWA 5EGWA 2VHSA 1THEA 2R9OA 3ZUAA 3IMAA 9PAPA 1GMYA 1PPPA 1BP4A 3KWZA 2GFOA 3PNRA 3MTNA 1CVZA 1KFXL 1MEMA 2AUXA 1HUCB 2PNSA 4CZWA 2AS8A 5CVOB 1ITOA 4W5CA 4PADA 1AYWA 1ME3A 3K8UA 2XU1A 4PI3A 2DJGB 5J94A 5JA7A 1K3BB 2E01A 3H89A 4OELA 4YYUA 1F2BA 3K9MA 4BS5A 2F7DA 1KFUL 4MSXA 4X6HA 4HWYA 1QOLA 1AECA 2VHFA 3BC3A 2PADA 4YVAA 3I06A 2OZ2A 2C0YA 2E00A 2Y6EA 3BOWA 2IBIA 3USVA 2ARYA 1CQDA 3KFQA 3IUTA 1DEUA 3H6SA 3CBKA 2FYEA 1PE6A 4CDDB 2R9FA 3D6SA 3RVWA 2DZZA 1AYUA 1CB5A 4BS6A 3LXSA 3NHEA 2NQGA 1MIRA 3MORA 4QH6A 2R6NA 4BQVA 2AYNA 3WXEA 4Q8HA 2ATOA 3C9EA 1KHPA 5CHTA 2IPPB 2G8JA 1U5IA 5FPWA 2JQFR 1GLOA 4FJCA 3WXGA 3N3GA 1POPA 3P5VA 3LFYA 1MHWA 2H7JA 1CV8A 4X6JA 3ERVA 1CSBB 2CB5A 2WBFX 2AYOA 1JQPA 3N3KA 3S3QA 3CBJA 3IHPA 3IV2A 2BDLA 1ZIVA 3OISA 1MDWA 1NB5A 5K16A 2B1NA 2DCAA 3TNXA 2JQGR 1X9YA 3OF8A 1TLOA 2F1GA 2DCDA 3KSEA
chains in the Genus database with same CATH superfamily
4I04A 4OEMA 2DCBA 4I07A 2O6XA 2HHNA 3HHAA 2ACTA 3W31A 2DJFB 3V6CA 4PT5A 2AGAA 5A24A 1NLJA 2JRIA 3BPFA 3F75A 4RNAA 3MTVA 1O0EA 4YV8A 2YJ2A 1GECE 1STFE 4RF0A 1A6RA 3MP2A 2JTCA 5JH3A 3I3TA 4HXDB 3F5VA 1QXPA 1TL9A 1F29A 2P86A 1MEGA 3OVXA 1EWPA 1KHQA 4RY2A 2NQDB 2BTWB 2DC7A 1F2AA 4ZTBA 2FQ9A 2FT2A 4WA6A 1U9VA 2E02A 1MS6A 4W5BA 3O1GA 2G6DA 4OVZA 1PCIA 2XU5A 1VJVA 1NB3A 1ME4A 1EWLA 2J7QC 2DZYA 4BOZA 3CH3X 3C0RA 4BOQA 1YK8A 3BCNA 1XKGA 4YYRA 4K7CA 4OW0A 3H8CA 2AIMA 3AI8A 4QRVA 4BOSA 2R9CA 3O0UA 4Q8GA 4D8BA 2HWKA 3DF0A 3KKUA 5EF4A 2G7YA 2B1MA 3MHHA 5EZSA 3KW9A 1PVJA 4PP1A 2FTDA 4X6IA 4MZSA 4XUIA 1CS8A 3PBHA 1SNKA 2AVWA 2FO5A 3H8BA 3P5WA 1DKIA 3IFUA 5E6JA 1CTEA 2DC6A 1PPOA 3PRMA 4P6EA 1AIMA 3B79A 2DC8A 3BB7A 4CDCB 4P6GA 2AUZA 2BTWA 3RVXA 4XR7A 3TRKA 3PDFA 4I05A 8PCHA 2UZJA 7PCKA 3O65A 3P5XA 3OF9A 3E9SA 2FRQA 4XZXA 2YJ9A 1NL6A 4FIPA 1U9XA 4QBBA 1YVBA 3HD3A 2PREA 1AU4A 1YK7A 5CVNB 2P7UA 4ZUXU 1AU3A 3S3RA 1IWDA 4DMXA 2HH5A 4BSQA 2FRAA 4N79A 4G54A 2HXZA 4CDFB 2FUDA 1M6DA 2DCCA 2XU3A 5JZEA 5KO3A 1VSNA 4QRGA 4GUAA 1F2CA 1YALA 3E1ZB 3QT4A 1Y4HA 1QDQA 1SP4B 4FK5A 3KWBX 4N4ZA 3PHUA 1KXRA 3K24A 2FE8A 4WURA 2YJCA 4YYSA 1NQCA 3M99A 3P5UA 1PADA 1BY8A 3MHSA 5CVMA 4R3DA 3QSDA 1TU6A 3RVVA 4QRXA 1AU2A 4BPVA 1PIPA 4MZOA 1BGOA 3WXFA 3OQCA 2NQAA 4REZA 1S4VA 1CPJA 2E03A 5PADA 3RNVA 4M0WA 2DOSA 2PBHA 2CIOA 4AXLA 1BQIA 3BWKA 3TMPA 3W30A 4N8WA 4W4UA 5F02A 1PPNA 2XU4A 1AYVA 2BU3A 5CHVA 1YT7A 3V6EA 2R9MA 3KX1A 2AU1A 1Y08A 1Q6KA 2OULA 1EF7A 1AU0A 3PW3A 3N4CA 4RKXA 4KLBA 1ICFA 1U9WA 1ATKA 1ZCMA 1EWMA 1EWOA 2NQIA 1PPDA 3GCBA 2YJBA 1FH0A 2BDZA 2Y5BA 4DMYA 4P16A 4YYVA 3U8EA 1CJLA 4PP2E 2P0RA 2G8EA 3H7DA 4CDEB 2HD5A 3BPMA 3IOQA 2R9NA 2DC9A 1GCBA 4MM3B 2YJ8A 1QMYA 1PXVA 1PBHA 4YYQA 4BOPA 3QJ3A 2OP3A 3HWNA 1UKFA 1DF0A 6PADA 3BBAA 3OVZA 3PHXA 2GHUA 3CH2X 1NPZA 4OVZB 3HHIA 4AXMA 1U9QX 4D8IA 3IEJA 4YYWA 5EGWA 2VHSA 1THEA 2R9OA 3ZUAA 3IMAA 9PAPA 1GMYA 1PPPA 1BP4A 3KWZA 2GFOA 3PNRA 3MTNA 1CVZA 1KFXL 1MEMA 2AUXA 1HUCB 2PNSA 4CZWA 2AS8A 5CVOB 4BOUA 4RF1A 3PRPA 1ITOA 4W5CA 4PADA 1AYWA 1ME3A 3K8UA 2XU1A 3MJ5A 4PI3A 2DJGB 5J94A 5JA7A 1K3BB 2E01A 3H89A 4OELA 4YYUA 1F2BA 3K9MA 4BS5A 2F7DA 1KFUL 4IP3A 4MSXA 4X6HA 4HWYA 4D8EA 1QOLA 1AECA 2VHFA 3BC3A 2PADA 4YVAA 3I06A 2OZ2A 2C0YA 3PHWA 2E00A 2Y6EA 3BOWA 2IBIA 3USVA 2ARYA 1CQDA 3KFQA 3IUTA 1DEUA 2J7QA 3H6SA 3CBKA 2FYEA 1PE6A 4CDDB 2R9FA 3D6SA 3RVWA 2DZZA 1AYUA 1CB5A 4BS6A 5EZQA 3LXSA 3NHEA 3ZNHA 2NQGA 1MIRA 3MORA 4QH6A 2R6NA 4BQVA 2AYNA 3WXEA 4Q8HA 2ATOA 3C9EA 1KHPA 5CHTA 2IPPB 2G8JA 1U5IA 5FPWA 3B21A 2JQFR 1GLOA 4FJCA 3BY4A 4IUMA 3WXGA 3N3GA 1POPA 3P5VA 3LFYA 1MHWA 2H7JA 1CV8A 4X6JA 4A5UA 2Z84A 1YZBA 3ERVA 1CSBB 2CB5A 2WBFX 2AYOA 1JQPA 3N3KA 3S3QA 3CBJA 3IHPA 3IV2A 2BDLA 1ZIVA 3OISA 1MDWA 1NB5A 5K16A 2B1NA 2DCAA 3PT2A 4MI7A 3TNXA 2JQGR 1X9YA 3OF8A 1TLOA 2F1GA 3PSEA 2DCDA 3KSEA
chains in the Genus database with same CATH topology
4I04A 4OEMA 2DCBA 4I07A 2O6XA 2HHNA 3HHAA 2ACTA 2DJFB 3V6CA 5A24A 1NLJA 3BPFA 3F75A 1O0EA 4YV8A 2YJ2A 1GECE 1STFE 1A6RA 5JH3A 3I3TA 3F5VA 1QXPA 1TL9A 1F29A 2P86A 1MEGA 3OVXA 1EWPA 1KHQA 4RY2A 2NQDB 2DC7A 1F2AA 1W4TA 2FQ9A 2FT2A 4GUZA 4WA6A 1U9VA 2E02A 1MS6A 4W5BA 3O1GA 2G6DA 1PCIA 2XU5A 1VJVA 1NB3A 1ME4A 1EWLA 2DZYA 3CH3X 1YK8A 3BCNA 1XKGA 4YYRA 4K7CA 3H8CA 2AIMA 3AI8A 4QRVA 2R9CA 3O0UA 4Q8GA 1GX3A 3DF0A 3KKUA 5EF4A 2G7YA 2B1MA 3MHHA 4NV7A 3KW9A 4PP1A 2FTDA 4X6IA 4MZSA 4XUIA 1CS8A 3PBHA 1SNKA 2AVWA 2FO5A 3H8BA 3P5WA 1CTEA 2DC6A 1PPOA 4P6EA 1AIMA 3B79A 2DC8A 4CDCB 4P6GA 2AUZA 3RVXA 4XR7A 3PDFA 4I05A 8PCHA 7PCKA 3P5XA 3OF9A 2FRQA 4B55A 2YJ9A 1NL6A 4FIPA 1U9XA 4QBBA 1YVBA 3HD3A 2PREA 1AU4A 1YK7A 5CVNB 2P7UA 4ZUXU 1AU3A 3S3RA 1IWDA 4DMXA 2HH5A 4BSQA 2FRAA 4N79A 4G54A 2HXZA 4CDFB 2FUDA 1M6DA 2DCCA 2XU3A 1VSNA 4QRGA 1F2CA 1YALA 3E1ZB 1E2TA 3QT4A 1Y4HA 1QDQA 1SP4B 4FK5A 3KWBX 4N4ZA 1KXRA 3K24A 2YJCA 4YYSA 1NQCA 3M99A 3P5UA 1PADA 1BY8A 3MHSA 5CVMA 3QSDA 1TU6A 3RVVA 4QRXA 1AU2A 4BPVA 1PIPA 4MZOA 1BGOA 3WXFA 2NQAA 1S4VA 1CPJA 2E03A 5PADA 2PBHA 2CIOA 4AXLA 1BQIA 3BWKA 4N8WA 4W4UA 5F02A 1W5RA 1PPNA 2XU4A 1AYVA 5CHVA 1YT7A 3V6EA 2R9MA 3KX1A 2AU1A 1Y08A 1Q6KA 2OULA 1EF7A 1AU0A 3PW3A 3N4CA 4KLBA 1ICFA 1U9WA 1ATKA 4NV8A 1ZCMA 1EWMA 1EWOA 2NQIA 1PPDA 3GCBA 2YJBA 1FH0A 1W6FA 2BDZA 2Y5BA 4DMYA 4YYVA 3U8EA 1CJLA 4PP2E 2P0RA 2G8EA 3H7DA 4CDEB 2VFCA 2HD5A 3BPMA 3IOQA 2R9NA 2DC9A 1GCBA 2YJ8A 1QMYA 1PXVA 1PBHA 4YYQA 3QJ3A 2OP3A 3HWNA 1DF0A 6PADA 3OVZA 2GHUA 3CH2X 1NPZA 3HHIA 4AXMA 1U9QX 4BGFA 3IEJA 4YYWA 5EGWA 2VHSA 1THEA 2R9OA 3ZUAA 3IMAA 9PAPA 1GMYA 1PPPA 1BP4A 3KWZA 2GFOA 3PNRA 3MTNA 1CVZA 1KFXL 1MEMA 2AUXA 1HUCB 2PNSA 4CZWA 2AS8A 2BSZA 5CVOB 1ITOA 4W5CA 4PADA 4C5PA 1AYWA 1ME3A 3K8UA 2XU1A 4PI3A 2DJGB 5J94A 5JA7A 1K3BB 2E01A 3H89A 4OELA 4YYUA 1F2BA 3K9MA 4BS5A 2F7DA 1KFUL 4MSXA 4X6HA 4HWYA 1QOLA 1AECA 2VHFA 3BC3A 2PADA 4YVAA 3I06A 2OZ2A 2C0YA 2E00A 2Y6EA 3BOWA 2IBIA 3USVA 2ARYA 1CQDA 3KFQA 3IUTA 1DEUA 3H6SA 3CBKA 2FYEA 1PE6A 4CDDB 2R9FA 3D6SA 3RVWA 2DZZA 1AYUA 1CB5A 4BS6A 3LXSA 3NHEA 2NQGA 1MIRA 3MORA 4QH6A 2R6NA 4BQVA 2AYNA 3WXEA 4Q8HA 2ATOA 3C9EA 1KHPA 5CHTA 2IPPB 2VFBA 2G8JA 1U5IA 5FPWA 2JQFR 1GLOA 4FJCA 3WXGA 3N3GA 1POPA 3P5VA 3LFYA 1MHWA 2H7JA 1CV8A 4X6JA 3ERVA 1CSBB 2CB5A 2WBFX 2AYOA 1JQPA 3N3KA 3S3QA 3CBJA 3IHPA 3IV2A 2BDLA 1ZIVA 3OISA 1MDWA 1NB5A 5K16A 3LTWA 2B1NA 2DCAA 3D9WA 3TNXA 2JQGR 1X9YA 3OF8A 1TLOA 2F1GA 2DCDA 3KSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I04 A;  4OEM A;  2DCB A;  4I07 A;  2O6X A;  2HHN A;  3HHA A;  2ACT A;  2DJF B;  3V6C A;  5A24 A;  1NLJ A;  3BPF A;  3F75 A;  1O0E A;  4YV8 A;  2YJ2 A;  1GEC E;  1STF E;  1A6R A;  5JH3 A;  3I3T A;  3F5V A;  1QXP A;  1TL9 A;  1F29 A;  2P86 A;  1MEG A;  3OVX A;  1EWP A;  1KHQ A;  4RY2 A;  2NQD B;  2DC7 A;  1F2A A;  2FQ9 A;  2FT2 A;  4WA6 A;  1U9V A;  2E02 A;  1MS6 A;  4W5B A;  3O1G A;  2G6D A;  1PCI A;  2XU5 A;  1VJV A;  1NB3 A;  1ME4 A;  1EWL A;  2DZY A;  3CH3 X;  1YK8 A;  3BCN A;  1XKG A;  4YYR A;  4K7C A;  3H8C A;  2AIM A;  3AI8 A;  4QRV A;  2R9C A;  3O0U A;  4Q8G A;  3DF0 A;  3KKU A;  5EF4 A;  2G7Y A;  2B1M A;  3MHH A;  3KW9 A;  4PP1 A;  2FTD A;  4X6I A;  4MZS A;  4XUI A;  1CS8 A;  3PBH A;  1SNK A;  2AVW A;  2FO5 A;  3H8B A;  3P5W A;  1CTE A;  2DC6 A;  1PPO A;  4P6E A;  1AIM A;  3B79 A;  2DC8 A;  4CDC B;  4P6G A;  2AUZ A;  3RVX A;  4XR7 A;  3PDF A;  4I05 A;  8PCH A;  7PCK A;  3P5X A;  3OF9 A;  2FRQ A;  2YJ9 A;  1NL6 A;  4FIP A;  1U9X A;  4QBB A;  1YVB A;  3HD3 A;  2PRE A;  1AU4 A;  1YK7 A;  5CVN B;  2P7U A;  4ZUX U;  1AU3 A;  3S3R A;  1IWD A;  4DMX A;  2HH5 A;  4BSQ A;  2FRA A;  4N79 A;  4G54 A;  2HXZ A;  4CDF B;  2FUD A;  1M6D A;  2DCC A;  2XU3 A;  1VSN A;  4QRG A;  1F2C A;  1YAL A;  3E1Z B;  3QT4 A;  1Y4H A;  1QDQ A;  1SP4 B;  4FK5 A;  3KWB X;  4N4Z A;  1KXR A;  3K24 A;  2YJC A;  4YYS A;  1NQC A;  3M99 A;  3P5U A;  1PAD A;  1BY8 A;  3MHS A;  5CVM A;  3QSD A;  1TU6 A;  3RVV A;  4QRX A;  1AU2 A;  4BPV A;  1PIP A;  4MZO A;  1BGO A;  3WXF A;  2NQA A;  1S4V A;  1CPJ A;  2E03 A;  5PAD A;  2PBH A;  2CIO A;  4AXL A;  1BQI A;  3BWK A;  4N8W A;  4W4U A;  5F02 A;  1PPN A;  2XU4 A;  1AYV A;  5CHV A;  1YT7 A;  3V6E A;  2R9M A;  3KX1 A;  2AU1 A;  1Y08 A;  1Q6K A;  2OUL A;  1EF7 A;  1AU0 A;  3PW3 A;  3N4C A;  4KLB A;  1ICF A;  1U9W A;  1ATK A;  1ZCM A;  1EWM A;  1EWO A;  2NQI A;  1PPD A;  3GCB A;  2YJB A;  1FH0 A;  2BDZ A;  2Y5B A;  4DMY A;  4YYV A;  3U8E A;  1CJL A;  4PP2 E;  2P0R A;  2G8E A;  3H7D A;  4CDE B;  2HD5 A;  3BPM A;  3IOQ A;  2R9N A;  2DC9 A;  1GCB A;  2YJ8 A;  1QMY A;  1PXV A;  1PBH A;  4YYQ A;  3QJ3 A;  2OP3 A;  3HWN A;  1DF0 A;  6PAD A;  3OVZ A;  2GHU A;  3CH2 X;  1NPZ A;  3HHI A;  4AXM A;  1U9Q X;  3IEJ A;  4YYW A;  5EGW A;  2VHS A;  1THE A;  2R9O A;  3ZUA A;  3IMA A;  9PAP A;  1GMY A;  1PPP A;  1BP4 A;  3KWZ A;  2GFO A;  3PNR A;  3MTN A;  1CVZ A;  1KFX L;  1MEM A;  2AUX A;  1HUC B;  2PNS A;  4CZW A;  2AS8 A;  5CVO B;  1ITO A;  4W5C A;  4PAD A;  1AYW A;  1ME3 A;  3K8U A;  2XU1 A;  4PI3 A;  2DJG B;  5J94 A;  5JA7 A;  1K3B B;  2E01 A;  3H89 A;  4OEL A;  4YYU A;  1F2B A;  3K9M A;  4BS5 A;  2F7D A;  1KFU L;  4MSX A;  4X6H A;  4HWY A;  1QOL A;  1AEC A;  2VHF A;  3BC3 A;  2PAD A;  4YVA A;  3I06 A;  2OZ2 A;  2C0Y A;  2E00 A;  2Y6E A;  3BOW A;  2IBI A;  3USV A;  2ARY A;  1CQD A;  3KFQ A;  3IUT A;  1DEU A;  3H6S A;  3CBK A;  2FYE A;  1PE6 A;  4CDD B;  2R9F A;  3D6S A;  3RVW A;  2DZZ A;  1AYU A;  1CB5 A;  4BS6 A;  3LXS A;  3NHE A;  2NQG A;  1MIR A;  3MOR A;  4QH6 A;  2R6N A;  4BQV A;  2AYN A;  3WXE A;  4Q8H A;  2ATO A;  3C9E A;  1KHP A;  5CHT A;  2IPP B;  2G8J A;  1U5I A;  5FPW A;  2JQF R;  1GLO A;  4FJC A;  3WXG A;  3N3G A;  1POP A;  3P5V A;  3LFY A;  1MHW A;  2H7J A;  1CV8 A;  4X6J A;  3ERV A;  1CSB B;  2CB5 A;  2WBF X;  2AYO A;  1JQP A;  3N3K A;  3S3Q A;  3CBJ A;  3IHP A;  3IV2 A;  2BDL A;  1ZIV A;  3OIS A;  1MDW A;  1NB5 A;  5K16 A;  2B1N A;  2DCA A;  3TNX A;  2JQG R;  1X9Y A;  3OF8 A;  1TLO A;  2F1G A;  2DCD A;  3KSE A; 
#chains in the Genus database with same CATH topology
 4I04 A;  4OEM A;  2DCB A;  4I07 A;  2O6X A;  2HHN A;  3HHA A;  2ACT A;  3W31 A;  2DJF B;  3V6C A;  4PT5 A;  2AGA A;  5A24 A;  1NLJ A;  2JRI A;  3BPF A;  3F75 A;  4RNA A;  3MTV A;  1O0E A;  4YV8 A;  2YJ2 A;  1GEC E;  1STF E;  4RF0 A;  1A6R A;  3MP2 A;  2JTC A;  5JH3 A;  3I3T A;  4HXD B;  3F5V A;  1QXP A;  1TL9 A;  1F29 A;  2P86 A;  1MEG A;  3OVX A;  1EWP A;  1KHQ A;  4RY2 A;  2NQD B;  2BTW B;  2DC7 A;  1F2A A;  4ZTB A;  2FQ9 A;  2FT2 A;  4WA6 A;  1U9V A;  2E02 A;  1MS6 A;  4W5B A;  3O1G A;  2G6D A;  4OVZ A;  1PCI A;  2XU5 A;  1VJV A;  1NB3 A;  1ME4 A;  1EWL A;  2J7Q C;  2DZY A;  4BOZ A;  3CH3 X;  3C0R A;  4BOQ A;  1YK8 A;  3BCN A;  1XKG A;  4YYR A;  4K7C A;  4OW0 A;  3H8C A;  2AIM A;  3AI8 A;  4QRV A;  4BOS A;  2R9C A;  3O0U A;  4Q8G A;  4D8B A;  2HWK A;  3DF0 A;  3KKU A;  5EF4 A;  2G7Y A;  2B1M A;  3MHH A;  5EZS A;  3KW9 A;  1PVJ A;  4PP1 A;  2FTD A;  4X6I A;  4MZS A;  4XUI A;  1CS8 A;  3PBH A;  1SNK A;  2AVW A;  2FO5 A;  3H8B A;  3P5W A;  1DKI A;  3IFU A;  5E6J A;  1CTE A;  2DC6 A;  1PPO A;  3PRM A;  4P6E A;  1AIM A;  3B79 A;  2DC8 A;  3BB7 A;  4CDC B;  4P6G A;  2AUZ A;  2BTW A;  3RVX A;  4XR7 A;  3TRK A;  3PDF A;  4I05 A;  8PCH A;  2UZJ A;  7PCK A;  3O65 A;  3P5X A;  3OF9 A;  3E9S A;  2FRQ A;  4XZX A;  2YJ9 A;  1NL6 A;  4FIP A;  1U9X A;  4QBB A;  1YVB A;  3HD3 A;  2PRE A;  1AU4 A;  1YK7 A;  5CVN B;  2P7U A;  4ZUX U;  1AU3 A;  3S3R A;  1IWD A;  4DMX A;  2HH5 A;  4BSQ A;  2FRA A;  4N79 A;  4G54 A;  2HXZ A;  4CDF B;  2FUD A;  1M6D A;  2DCC A;  2XU3 A;  5JZE A;  5KO3 A;  1VSN A;  4QRG A;  4GUA A;  1F2C A;  1YAL A;  3E1Z B;  3QT4 A;  1Y4H A;  1QDQ A;  1SP4 B;  4FK5 A;  3KWB X;  4N4Z A;  3PHU A;  1KXR A;  3K24 A;  2FE8 A;  4WUR A;  2YJC A;  4YYS A;  1NQC A;  3M99 A;  3P5U A;  1PAD A;  1BY8 A;  3MHS A;  5CVM A;  4R3D A;  3QSD A;  1TU6 A;  3RVV A;  4QRX A;  1AU2 A;  4BPV A;  1PIP A;  4MZO A;  1BGO A;  3WXF A;  3OQC A;  2NQA A;  4REZ A;  1S4V A;  1CPJ A;  2E03 A;  5PAD A;  3RNV A;  4M0W A;  2DOS A;  2PBH A;  2CIO A;  4AXL A;  1BQI A;  3BWK A;  3TMP A;  3W30 A;  4N8W A;  4W4U A;  5F02 A;  1PPN A;  2XU4 A;  1AYV A;  2BU3 A;  5CHV A;  1YT7 A;  3V6E A;  2R9M A;  3KX1 A;  2AU1 A;  1Y08 A;  1Q6K A;  2OUL A;  1EF7 A;  1AU0 A;  3PW3 A;  3N4C A;  4RKX A;  4KLB A;  1ICF A;  1U9W A;  1ATK A;  1ZCM A;  1EWM A;  1EWO A;  2NQI A;  1PPD A;  3GCB A;  2YJB A;  1FH0 A;  2BDZ A;  2Y5B A;  4DMY A;  4P16 A;  4YYV A;  3U8E A;  1CJL A;  4PP2 E;  2P0R A;  2G8E A;  3H7D A;  4CDE B;  2HD5 A;  3BPM A;  3IOQ A;  2R9N A;  2DC9 A;  1GCB A;  4MM3 B;  2YJ8 A;  1QMY A;  1PXV A;  1PBH A;  4YYQ A;  4BOP A;  3QJ3 A;  2OP3 A;  3HWN A;  1UKF A;  1DF0 A;  6PAD A;  3BBA A;  3OVZ A;  3PHX A;  2GHU A;  3CH2 X;  1NPZ A;  4OVZ B;  3HHI A;  4AXM A;  1U9Q X;  4D8I A;  3IEJ A;  4YYW A;  5EGW A;  2VHS A;  1THE A;  2R9O A;  3ZUA A;  3IMA A;  9PAP A;  1GMY A;  1PPP A;  1BP4 A;  3KWZ A;  2GFO A;  3PNR A;  3MTN A;  1CVZ A;  1KFX L;  1MEM A;  2AUX A;  1HUC B;  2PNS A;  4CZW A;  2AS8 A;  5CVO B;  4BOU A;  4RF1 A;  3PRP A;  1ITO A;  4W5C A;  4PAD A;  1AYW A;  1ME3 A;  3K8U A;  2XU1 A;  3MJ5 A;  4PI3 A;  2DJG B;  5J94 A;  5JA7 A;  1K3B B;  2E01 A;  3H89 A;  4OEL A;  4YYU A;  1F2B A;  3K9M A;  4BS5 A;  2F7D A;  1KFU L;  4IP3 A;  4MSX A;  4X6H A;  4HWY A;  4D8E A;  1QOL A;  1AEC A;  2VHF A;  3BC3 A;  2PAD A;  4YVA A;  3I06 A;  2OZ2 A;  2C0Y A;  3PHW A;  2E00 A;  2Y6E A;  3BOW A;  2IBI A;  3USV A;  2ARY A;  1CQD A;  3KFQ A;  3IUT A;  1DEU A;  2J7Q A;  3H6S A;  3CBK A;  2FYE A;  1PE6 A;  4CDD B;  2R9F A;  3D6S A;  3RVW A;  2DZZ A;  1AYU A;  1CB5 A;  4BS6 A;  5EZQ A;  3LXS A;  3NHE A;  3ZNH A;  2NQG A;  1MIR A;  3MOR A;  4QH6 A;  2R6N A;  4BQV A;  2AYN A;  3WXE A;  4Q8H A;  2ATO A;  3C9E A;  1KHP A;  5CHT A;  2IPP B;  2G8J A;  1U5I A;  5FPW A;  3B21 A;  2JQF R;  1GLO A;  4FJC A;  3BY4 A;  4IUM A;  3WXG A;  3N3G A;  1POP A;  3P5V A;  3LFY A;  1MHW A;  2H7J A;  1CV8 A;  4X6J A;  4A5U A;  2Z84 A;  1YZB A;  3ERV A;  1CSB B;  2CB5 A;  2WBF X;  2AYO A;  1JQP A;  3N3K A;  3S3Q A;  3CBJ A;  3IHP A;  3IV2 A;  2BDL A;  1ZIV A;  3OIS A;  1MDW A;  1NB5 A;  5K16 A;  2B1N A;  2DCA A;  3PT2 A;  4MI7 A;  3TNX A;  2JQG R;  1X9Y A;  3OF8 A;  1TLO A;  2F1G A;  3PSE A;  2DCD A;  3KSE A; 
#chains in the Genus database with same CATH homology
 4I04 A;  4OEM A;  2DCB A;  4I07 A;  2O6X A;  2HHN A;  3HHA A;  2ACT A;  2DJF B;  3V6C A;  5A24 A;  1NLJ A;  3BPF A;  3F75 A;  1O0E A;  4YV8 A;  2YJ2 A;  1GEC E;  1STF E;  1A6R A;  5JH3 A;  3I3T A;  3F5V A;  1QXP A;  1TL9 A;  1F29 A;  2P86 A;  1MEG A;  3OVX A;  1EWP A;  1KHQ A;  4RY2 A;  2NQD B;  2DC7 A;  1F2A A;  1W4T A;  2FQ9 A;  2FT2 A;  4GUZ A;  4WA6 A;  1U9V A;  2E02 A;  1MS6 A;  4W5B A;  3O1G A;  2G6D A;  1PCI A;  2XU5 A;  1VJV A;  1NB3 A;  1ME4 A;  1EWL A;  2DZY A;  3CH3 X;  1YK8 A;  3BCN A;  1XKG A;  4YYR A;  4K7C A;  3H8C A;  2AIM A;  3AI8 A;  4QRV A;  2R9C A;  3O0U A;  4Q8G A;  1GX3 A;  3DF0 A;  3KKU A;  5EF4 A;  2G7Y A;  2B1M A;  3MHH A;  4NV7 A;  3KW9 A;  4PP1 A;  2FTD A;  4X6I A;  4MZS A;  4XUI A;  1CS8 A;  3PBH A;  1SNK A;  2AVW A;  2FO5 A;  3H8B A;  3P5W A;  1CTE A;  2DC6 A;  1PPO A;  4P6E A;  1AIM A;  3B79 A;  2DC8 A;  4CDC B;  4P6G A;  2AUZ A;  3RVX A;  4XR7 A;  3PDF A;  4I05 A;  8PCH A;  7PCK A;  3P5X A;  3OF9 A;  2FRQ A;  4B55 A;  2YJ9 A;  1NL6 A;  4FIP A;  1U9X A;  4QBB A;  1YVB A;  3HD3 A;  2PRE A;  1AU4 A;  1YK7 A;  5CVN B;  2P7U A;  4ZUX U;  1AU3 A;  3S3R A;  1IWD A;  4DMX A;  2HH5 A;  4BSQ A;  2FRA A;  4N79 A;  4G54 A;  2HXZ A;  4CDF B;  2FUD A;  1M6D A;  2DCC A;  2XU3 A;  1VSN A;  4QRG A;  1F2C A;  1YAL A;  3E1Z B;  1E2T A;  3QT4 A;  1Y4H A;  1QDQ A;  1SP4 B;  4FK5 A;  3KWB X;  4N4Z A;  1KXR A;  3K24 A;  2YJC A;  4YYS A;  1NQC A;  3M99 A;  3P5U A;  1PAD A;  1BY8 A;  3MHS A;  5CVM A;  3QSD A;  1TU6 A;  3RVV A;  4QRX A;  1AU2 A;  4BPV A;  1PIP A;  4MZO A;  1BGO A;  3WXF A;  2NQA A;  1S4V A;  1CPJ A;  2E03 A;  5PAD A;  2PBH A;  2CIO A;  4AXL A;  1BQI A;  3BWK A;  4N8W A;  4W4U A;  5F02 A;  1W5R A;  1PPN A;  2XU4 A;  1AYV A;  5CHV A;  1YT7 A;  3V6E A;  2R9M A;  3KX1 A;  2AU1 A;  1Y08 A;  1Q6K A;  2OUL A;  1EF7 A;  1AU0 A;  3PW3 A;  3N4C A;  4KLB A;  1ICF A;  1U9W A;  1ATK A;  4NV8 A;  1ZCM A;  1EWM A;  1EWO A;  2NQI A;  1PPD A;  3GCB A;  2YJB A;  1FH0 A;  1W6F A;  2BDZ A;  2Y5B A;  4DMY A;  4YYV A;  3U8E A;  1CJL A;  4PP2 E;  2P0R A;  2G8E A;  3H7D A;  4CDE B;  2VFC A;  2HD5 A;  3BPM A;  3IOQ A;  2R9N A;  2DC9 A;  1GCB A;  2YJ8 A;  1QMY A;  1PXV A;  1PBH A;  4YYQ A;  3QJ3 A;  2OP3 A;  3HWN A;  1DF0 A;  6PAD A;  3OVZ A;  2GHU A;  3CH2 X;  1NPZ A;  3HHI A;  4AXM A;  1U9Q X;  4BGF A;  3IEJ A;  4YYW A;  5EGW A;  2VHS A;  1THE A;  2R9O A;  3ZUA A;  3IMA A;  9PAP A;  1GMY A;  1PPP A;  1BP4 A;  3KWZ A;  2GFO A;  3PNR A;  3MTN A;  1CVZ A;  1KFX L;  1MEM A;  2AUX A;  1HUC B;  2PNS A;  4CZW A;  2AS8 A;  2BSZ A;  5CVO B;  1ITO A;  4W5C A;  4PAD A;  4C5P A;  1AYW A;  1ME3 A;  3K8U A;  2XU1 A;  4PI3 A;  2DJG B;  5J94 A;  5JA7 A;  1K3B B;  2E01 A;  3H89 A;  4OEL A;  4YYU A;  1F2B A;  3K9M A;  4BS5 A;  2F7D A;  1KFU L;  4MSX A;  4X6H A;  4HWY A;  1QOL A;  1AEC A;  2VHF A;  3BC3 A;  2PAD A;  4YVA A;  3I06 A;  2OZ2 A;  2C0Y A;  2E00 A;  2Y6E A;  3BOW A;  2IBI A;  3USV A;  2ARY A;  1CQD A;  3KFQ A;  3IUT A;  1DEU A;  3H6S A;  3CBK A;  2FYE A;  1PE6 A;  4CDD B;  2R9F A;  3D6S A;  3RVW A;  2DZZ A;  1AYU A;  1CB5 A;  4BS6 A;  3LXS A;  3NHE A;  2NQG A;  1MIR A;  3MOR A;  4QH6 A;  2R6N A;  4BQV A;  2AYN A;  3WXE A;  4Q8H A;  2ATO A;  3C9E A;  1KHP A;  5CHT A;  2IPP B;  2VFB A;  2G8J A;  1U5I A;  5FPW A;  2JQF R;  1GLO A;  4FJC A;  3WXG A;  3N3G A;  1POP A;  3P5V A;  3LFY A;  1MHW A;  2H7J A;  1CV8 A;  4X6J A;  3ERV A;  1CSB B;  2CB5 A;  2WBF X;  2AYO A;  1JQP A;  3N3K A;  3S3Q A;  3CBJ A;  3IHP A;  3IV2 A;  2BDL A;  1ZIV A;  3OIS A;  1MDW A;  1NB5 A;  5K16 A;  3LTW A;  2B1N A;  2DCA A;  3D9W A;  3TNX A;  2JQG R;  1X9Y A;  3OF8 A;  1TLO A;  2F1G A;  2DCD A;  3KSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...