3BC3A

Exploring inhibitor binding at the s subsites of cathepsin l
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
214
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L heavy and light chains
publication title Exploring inhibitor binding at the S' subsites of cathepsin L
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 214
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bc3A00
2YJ2A 1M6DA 2AYNA 4XUIA 4N8WA 4I04A 5J94A 3IUTA 2NQGA 3H8BA 4Q8HA 1GECE 2GHUA 5F02A 3HD3A 3OVZA 1NL6A 1MEGA 1PXVA 2HH5A 4W4UA 1CJLA 1GMYA 1Y4HA 3S3RA 3NHEA 1KFUL 2DCCA 3K8UA 1PPOA 1ZCMA 3IHPA 3CH2X 4OEMA 3IMAA 5CHTA 1KHPA 2H7JA 3OVXA 1YT7A 2DCDA 1VSNA 2FRAA 3KSEA 2NQIA 2B1MA 2OP3A 1XKGA 4CZWA 5FPWA 2E02A 3WXFA 4X6HA 3RVWA 1SNKA 3I3TA 2XU1A 1K3BB 2PBHA 3IEJA 4QRXA 2F1GA 4X6IA 1YALA 3V6CA 1EF7A 2YJBA 3OISA 2AIMA 4OELA 3B79A 5CVNB 2E00A 1U9WA 2R9OA 1PE6A 1EWOA 1EWLA 2F7DA 3QT4A 2AVWA 4BPVA 2FTDA 5JH3A 4X6JA 3D6SA 2XU3A 4YYWA 2FYEA 1QOLA 3IV2A 4Q8GA 2IBIA 3H7DA 4YYQA 3OF8A 2O6XA 2R9MA 4K7CA 3KX1A 1AU4A 2FO5A 3K9MA 2OULA 3N4CA 2IPPB 3P5XA 9PAPA 2DC7A 2NQDB 3BC3A 1NB5A 4AXMA 3V6EA 4YYUA 3N3KA 4W5CA 2R9NA 4PP1A 2AUXA 3GCBA 3QSDA 1YK8A 4CDFB 4G54A 4P6GA 1X9YA 1AU2A 1VJVA 4YVAA 4DMXA 1CSBB 1ME4A 2P0RA 3KWBX 5EF4A 3M99A 1PIPA 2ACTA 2HHNA 2HXZA 2AYOA 2Y5BA 3CH3X 3I06A 1CV8A 2JQFR 2PADA 3USVA 4WA6A 1ITOA 1TU6A 2DCBA 2E03A 2JQGR 4AXLA 1NLJA 2XU4A 3BWKA 1KHQA 4I05A 1DEUA 3HHAA 2ARYA 5JA7A 3DF0A 4YYRA 2G6DA 2VHFA 1AYUA 1F2CA 3CBJA 1MS6A 2AUZA 3PDFA 1TLOA 1EWPA 1F2AA 2R6NA 3HWNA 2VHSA 2FT2A 1Q6KA 3WXGA 1CQDA 2C0YA 1S4VA 1KFXL 1CVZA 2NQAA 3H6SA 2P86A 5CHVA 1PBHA 2AS8A 1AECA 3WXEA 3OF9A 2YJCA 4P6EA 1MDWA 1ICFA 1YVBA 1YK7A 4PADA 8PCHA 3H89A 2DJGB 4RY2A 2CB5A 4QRGA 4CDCB 3ERVA 3F75A 3S3QA 1SP4B 1BP4A 1O0EA 1CB5A 2ATOA 1MHWA 2G7YA 1QMYA 3CBKA 2FUDA 2GFOA 1NQCA 1EWMA 3U8EA 4KLBA 2PREA 2DC6A 3E1ZB 2B1NA 3KWZA 4HWYA 7PCKA 4YYVA 1FH0A 4YV8A 3P5UA 2BDZA 3PW3A 3AI8A 4QRVA 1POPA 1MEMA 1JQPA 3BOWA 3LXSA 4PI3A 4CDEB 1BQIA 2DC9A 5A24A 1Y08A 4FJCA 4PP2E 2CIOA 4MZSA 4QBBA 3PBHA 4N4ZA 2FQ9A 1PCIA 1GLOA 2DCAA 3PNRA 2DZYA 4BS6A 1ME3A 3HHIA 2DJFB 4FIPA 2OZ2A 5K16A 1DF0A 3H8CA 1PPPA 1IWDA 4MZOA 1U9VA 2R9CA 3RVXA 5CVOB 2DZZA 2G8JA 2P7UA 1BGOA 1F2BA 3TNXA 5EGWA 1A6RA 1NB3A 2R9FA 1PPDA 4YYSA 4QH6A 2YJ9A 4DMYA 2YJ8A 1U9QX 3RVVA 3MORA 3O1GA 3QJ3A 4BQVA 1U5IA 1PADA 4N79A 3BPMA 3C9EA 3K24A 1AU0A 1KXRA 3BPFA 1F29A 2XU5A 1STFE 2WBFX 2DC8A 4FK5A 3F5VA 1ATKA 3KFQA 4XR7A 4MSXA 6PADA 5PADA 3KKUA 2E01A 3N3GA 1TL9A 3KW9A 1PPNA 2BDLA 4BS5A 1BY8A 1AIMA 1QXPA 1THEA 1MIRA 1CPJA 2Y6EA 3BCNA 4CDDB 1GCBA 1CTEA 3P5VA 1CS8A 1AU3A 1ZIVA 3LFYA 3ZUAA 5CVMA 1HUCB 4W5BA 1U9XA 2G8EA 3MTNA 1NPZA 3P5WA 2FRQA 2AU1A 3O0UA 3IOQA 1AYWA 3MHHA 4BSQA 2PNSA 4ZUXU 2HD5A 4I07A 3MHSA 1AYVA 1QDQA
chains in the Genus database with same CATH superfamily
3B21A 2YJ2A 1M6DA 2AYNA 4XUIA 4BOZA 4N8WA 4I04A 5J94A 3IUTA 2NQGA 3PHWA 3PHXA 3H8BA 4Q8HA 1GECE 2GHUA 5F02A 3HD3A 3OVZA 1NL6A 1MEGA 1PXVA 2BTWB 2HH5A 5E6JA 4W4UA 1CJLA 1GMYA 1Y4HA 3S3RA 3NHEA 1KFUL 2DCCA 3K8UA 1PPOA 1ZCMA 3IHPA 3CH2X 4OEMA 3IMAA 5CHTA 1KHPA 2H7JA 4MM3B 3OVXA 1YT7A 2DCDA 1VSNA 2FRAA 3KSEA 2Z84A 2NQIA 5KO3A 2B1MA 2OP3A 1XKGA 4CZWA 5FPWA 2E02A 3WXFA 3PHUA 4X6HA 3RVWA 1SNKA 3I3TA 2XU1A 1K3BB 2PBHA 3IEJA 4QRXA 2F1GA 4X6IA 1YALA 3V6CA 1EF7A 2YJBA 3OISA 2AIMA 4OELA 3B79A 5CVNB 2E00A 1U9WA 2R9OA 1PE6A 1EWOA 1EWLA 2F7DA 3QT4A 2AVWA 4BPVA 4R3DA 2FTDA 5JZEA 5EZQA 5JH3A 4X6JA 3D6SA 2XU3A 4YYWA 2FYEA 1QOLA 3IV2A 4Q8GA 2IBIA 3H7DA 4YYQA 4BOUA 3OF8A 2O6XA 2R9MA 4K7CA 3KX1A 1AU4A 3TRKA 2FO5A 3K9MA 2OULA 3N4CA 2IPPB 3P5XA 4WURA 9PAPA 2DC7A 2NQDB 3BC3A 3TMPA 1NB5A 4AXMA 3V6EA 4YYUA 4A5UA 3N3KA 4W5CA 2R9NA 4PP1A 2AUXA 3GCBA 3QSDA 1YK8A 4CDFB 4G54A 4P6GA 4M0WA 1X9YA 1AU2A 1VJVA 4HXDB 4YVAA 4DMXA 1CSBB 1ME4A 2AGAA 2P0RA 3KWBX 5EF4A 3M99A 1PIPA 2ACTA 2FE8A 2HHNA 2HXZA 3E9SA 2AYOA 2BU3A 2JTCA 2Y5BA 3CH3X 4D8EA 3I06A 1CV8A 2JQFR 2PADA 3USVA 4WA6A 1ITOA 3PRMA 1TU6A 2DCBA 3MJ5A 2E03A 2JQGR 4AXLA 1NLJA 2XU4A 3BWKA 1KHQA 4I05A 1DEUA 3HHAA 2ARYA 5JA7A 3DF0A 4YYRA 2G6DA 2VHFA 4IUMA 1AYUA 1F2CA 3CBJA 1MS6A 2AUZA 3PDFA 1TLOA 4MI7A 1EWPA 3BY4A 1F2AA 2R6NA 3PT2A 3HWNA 2VHSA 2FT2A 1Q6KA 3WXGA 1CQDA 2C0YA 1S4VA 1KFXL 1CVZA 2NQAA 3H6SA 3RNVA 2P86A 3BB7A 5CHVA 4REZA 1PBHA 2AS8A 1AECA 3WXEA 3OF9A 2YJCA 4P6EA 1MDWA 1ICFA 1YVBA 1YK7A 4PADA 8PCHA 1UKFA 3H89A 4BOPA 2DJGB 4RY2A 2CB5A 4QRGA 4CDCB 3ERVA 3F75A 3S3QA 1SP4B 1BP4A 1O0EA 1CB5A 2ATOA 1MHWA 2G7YA 1QMYA 3ZNHA 3CBKA 2FUDA 2GFOA 3PRPA 1NQCA 1EWMA 3U8EA 4KLBA 2PREA 2DC6A 4XZXA 3E1ZB 2B1NA 3KWZA 4HWYA 7PCKA 4YYVA 1FH0A 4YV8A 4OVZA 3P5UA 2BDZA 3PW3A 3AI8A 4QRVA 4IP3A 4PT5A 1POPA 3MTVA 1MEMA 1JQPA 3BOWA 3LXSA 4PI3A 3PSEA 4D8IA 4CDEB 1BQIA 2J7QC 1YZBA 3W30A 2DC9A 5A24A 1Y08A 3MP2A 4FJCA 4PP2E 2CIOA 4MZSA 4QBBA 3PBHA 4N4ZA 2FQ9A 3IFUA 1PCIA 1GLOA 2DCAA 3PNRA 2DZYA 4BS6A 4P16A 1ME3A 3HHIA 2DJFB 4FIPA 2J7QA 2OZ2A 5K16A 1DF0A 3H8CA 1PPPA 1IWDA 4MZOA 1U9VA 2R9CA 4OW0A 3RVXA 3W31A 5CVOB 2DZZA 2G8JA 2P7UA 1BGOA 1F2BA 4D8BA 3TNXA 5EGWA 4RF0A 1A6RA 1NB3A 2R9FA 2JRIA 1PPDA 4YYSA 4QH6A 2YJ9A 4DMYA 2YJ8A 1U9QX 3RVVA 2BTWA 3MORA 3O1GA 3QJ3A 4RKXA 4BQVA 1U5IA 2UZJA 1PADA 4N79A 3BPMA 3C9EA 3K24A 1AU0A 4BOQA 1KXRA 3BPFA 1F29A 1PVJA 2XU5A 1STFE 4BOSA 4RNAA 2WBFX 3O65A 3BBAA 2DC8A 4FK5A 3F5VA 1ATKA 3KFQA 4XR7A 4MSXA 6PADA 5PADA 4OVZB 3KKUA 2E01A 3N3GA 1TL9A 5EZSA 3KW9A 1PPNA 2BDLA 4BS5A 1BY8A 1AIMA 1QXPA 1THEA 2DOSA 1MIRA 1CPJA 2Y6EA 3BCNA 4CDDB 1GCBA 1CTEA 3P5VA 1CS8A 1AU3A 1ZIVA 3LFYA 3OQCA 3ZUAA 2HWKA 5CVMA 1HUCB 4W5BA 1U9XA 2G8EA 3MTNA 1NPZA 3P5WA 1DKIA 2FRQA 2AU1A 3O0UA 3IOQA 1AYWA 3MHHA 4BSQA 2PNSA 4ZUXU 2HD5A 4I07A 3MHSA 4GUAA 4RF1A 1AYVA 3C0RA 4ZTBA 1QDQA
chains in the Genus database with same CATH topology
2YJ2A 1M6DA 2AYNA 4XUIA 3D9WA 4N8WA 4I04A 5J94A 3IUTA 2NQGA 3H8BA 4Q8HA 1GECE 2GHUA 5F02A 3HD3A 3OVZA 1NL6A 1MEGA 1PXVA 2HH5A 4GUZA 4W4UA 1CJLA 1GMYA 1GX3A 1Y4HA 3S3RA 3NHEA 1KFUL 2DCCA 3K8UA 1PPOA 1ZCMA 3IHPA 3CH2X 4OEMA 3IMAA 5CHTA 1KHPA 2H7JA 3OVXA 1YT7A 2DCDA 1VSNA 2FRAA 3KSEA 2NQIA 2B1MA 2OP3A 1XKGA 4CZWA 5FPWA 2E02A 3WXFA 4X6HA 3RVWA 1SNKA 3I3TA 2XU1A 1K3BB 2PBHA 3IEJA 4QRXA 2F1GA 4X6IA 1YALA 3V6CA 1EF7A 2YJBA 3OISA 2AIMA 4OELA 3B79A 5CVNB 2E00A 1U9WA 1W6FA 1PE6A 2R9OA 1EWOA 1EWLA 2F7DA 3QT4A 2AVWA 4BPVA 2FTDA 5JH3A 4X6JA 3D6SA 2XU3A 4YYWA 2FYEA 1QOLA 3IV2A 4Q8GA 2IBIA 3H7DA 4YYQA 3OF8A 2O6XA 2R9MA 4K7CA 3KX1A 1AU4A 2FO5A 3K9MA 2OULA 3N4CA 2IPPB 3P5XA 9PAPA 2DC7A 2NQDB 3BC3A 1NB5A 4AXMA 3V6EA 4YYUA 3N3KA 4W5CA 2R9NA 4PP1A 2AUXA 3GCBA 3QSDA 1YK8A 4CDFB 4G54A 4P6GA 1X9YA 1AU2A 1VJVA 4YVAA 4DMXA 1CSBB 1ME4A 2P0RA 3KWBX 5EF4A 2BSZA 3M99A 1PIPA 2ACTA 2HHNA 2HXZA 2AYOA 2Y5BA 3CH3X 3I06A 1CV8A 2JQFR 2PADA 3USVA 4WA6A 1ITOA 1TU6A 2DCBA 2E03A 2JQGR 4AXLA 1NLJA 2XU4A 3BWKA 1KHQA 4I05A 1DEUA 3HHAA 2ARYA 5JA7A 3DF0A 4YYRA 2G6DA 2VHFA 1AYUA 1F2CA 2VFBA 3CBJA 1MS6A 2AUZA 3PDFA 1TLOA 4BGFA 1EWPA 1F2AA 2R6NA 3HWNA 2VHSA 2FT2A 1Q6KA 3WXGA 1CQDA 2C0YA 1S4VA 1KFXL 1CVZA 2NQAA 3H6SA 2P86A 5CHVA 1PBHA 2VFCA 2AS8A 1AECA 3WXEA 3OF9A 2YJCA 4P6EA 1MDWA 1ICFA 1YVBA 1YK7A 4PADA 8PCHA 3H89A 2DJGB 4RY2A 2CB5A 4QRGA 4CDCB 3ERVA 3F75A 4NV7A 3S3QA 1SP4B 1BP4A 1O0EA 1CB5A 2ATOA 1MHWA 2G7YA 1QMYA 3CBKA 2FUDA 2GFOA 1NQCA 1EWMA 3U8EA 4KLBA 2PREA 2DC6A 3E1ZB 2B1NA 3KWZA 4HWYA 7PCKA 4YYVA 1FH0A 4YV8A 3P5UA 2BDZA 3PW3A 3AI8A 4QRVA 1POPA 1MEMA 1JQPA 3BOWA 3LXSA 4PI3A 4CDEB 1BQIA 2DC9A 5A24A 1Y08A 4FJCA 4PP2E 4C5PA 2CIOA 4MZSA 4QBBA 3PBHA 4N4ZA 2FQ9A 1PCIA 1GLOA 2DCAA 3PNRA 2DZYA 4BS6A 1ME3A 3HHIA 2DJFB 4FIPA 2OZ2A 5K16A 1DF0A 3H8CA 1PPPA 1IWDA 4MZOA 1U9VA 2R9CA 3RVXA 5CVOB 2DZZA 2G8JA 2P7UA 1BGOA 1F2BA 3TNXA 4NV8A 5EGWA 1A6RA 1NB3A 2R9FA 1PPDA 4YYSA 4QH6A 2YJ9A 4DMYA 2YJ8A 1U9QX 3RVVA 3MORA 3O1GA 3QJ3A 4BQVA 1U5IA 1PADA 1W5RA 4N79A 3BPMA 3C9EA 3LTWA 3K24A 1AU0A 1KXRA 3BPFA 1F29A 2XU5A 1STFE 2WBFX 2DC8A 4FK5A 3F5VA 1ATKA 3KFQA 4XR7A 4MSXA 6PADA 5PADA 1W4TA 3KKUA 2E01A 3N3GA 1TL9A 3KW9A 1PPNA 2BDLA 4BS5A 1BY8A 1AIMA 1QXPA 1THEA 1MIRA 1CPJA 2Y6EA 3BCNA 4CDDB 1GCBA 1CTEA 3P5VA 1CS8A 1AU3A 1ZIVA 3LFYA 3ZUAA 4B55A 5CVMA 1HUCB 4W5BA 1U9XA 2G8EA 3MTNA 1NPZA 3P5WA 2FRQA 2AU1A 3O0UA 3IOQA 1AYWA 3MHHA 4BSQA 2PNSA 4ZUXU 2HD5A 4I07A 3MHSA 1E2TA 1AYVA 1QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ2 A;  1M6D A;  2AYN A;  4XUI A;  4N8W A;  4I04 A;  5J94 A;  3IUT A;  2NQG A;  3H8B A;  4Q8H A;  1GEC E;  2GHU A;  5F02 A;  3HD3 A;  3OVZ A;  1NL6 A;  1MEG A;  1PXV A;  2HH5 A;  4W4U A;  1CJL A;  1GMY A;  1Y4H A;  3S3R A;  3NHE A;  1KFU L;  2DCC A;  3K8U A;  1PPO A;  1ZCM A;  3IHP A;  3CH2 X;  4OEM A;  3IMA A;  5CHT A;  1KHP A;  2H7J A;  3OVX A;  1YT7 A;  2DCD A;  1VSN A;  2FRA A;  3KSE A;  2NQI A;  2B1M A;  2OP3 A;  1XKG A;  4CZW A;  5FPW A;  2E02 A;  3WXF A;  4X6H A;  3RVW A;  1SNK A;  3I3T A;  2XU1 A;  1K3B B;  2PBH A;  3IEJ A;  4QRX A;  2F1G A;  4X6I A;  1YAL A;  3V6C A;  1EF7 A;  2YJB A;  3OIS A;  2AIM A;  4OEL A;  3B79 A;  5CVN B;  2E00 A;  1U9W A;  2R9O A;  1PE6 A;  1EWO A;  1EWL A;  2F7D A;  3QT4 A;  2AVW A;  4BPV A;  2FTD A;  5JH3 A;  4X6J A;  3D6S A;  2XU3 A;  4YYW A;  2FYE A;  1QOL A;  3IV2 A;  4Q8G A;  2IBI A;  3H7D A;  4YYQ A;  3OF8 A;  2O6X A;  2R9M A;  4K7C A;  3KX1 A;  1AU4 A;  2FO5 A;  3K9M A;  2OUL A;  3N4C A;  2IPP B;  3P5X A;  9PAP A;  2DC7 A;  2NQD B;  3BC3 A;  1NB5 A;  4AXM A;  3V6E A;  4YYU A;  3N3K A;  4W5C A;  2R9N A;  4PP1 A;  2AUX A;  3GCB A;  3QSD A;  1YK8 A;  4CDF B;  4G54 A;  4P6G A;  1X9Y A;  1AU2 A;  1VJV A;  4YVA A;  4DMX A;  1CSB B;  1ME4 A;  2P0R A;  3KWB X;  5EF4 A;  3M99 A;  1PIP A;  2ACT A;  2HHN A;  2HXZ A;  2AYO A;  2Y5B A;  3CH3 X;  3I06 A;  1CV8 A;  2JQF R;  2PAD A;  3USV A;  4WA6 A;  1ITO A;  1TU6 A;  2DCB A;  2E03 A;  2JQG R;  4AXL A;  1NLJ A;  2XU4 A;  3BWK A;  1KHQ A;  4I05 A;  1DEU A;  3HHA A;  2ARY A;  5JA7 A;  3DF0 A;  4YYR A;  2G6D A;  2VHF A;  1AYU A;  1F2C A;  3CBJ A;  1MS6 A;  2AUZ A;  3PDF A;  1TLO A;  1EWP A;  1F2A A;  2R6N A;  3HWN A;  2VHS A;  2FT2 A;  1Q6K A;  3WXG A;  1CQD A;  2C0Y A;  1S4V A;  1KFX L;  1CVZ A;  2NQA A;  3H6S A;  2P86 A;  5CHV A;  1PBH A;  2AS8 A;  1AEC A;  3WXE A;  3OF9 A;  2YJC A;  4P6E A;  1MDW A;  1ICF A;  1YVB A;  1YK7 A;  4PAD A;  8PCH A;  3H89 A;  2DJG B;  4RY2 A;  2CB5 A;  4QRG A;  4CDC B;  3ERV A;  3F75 A;  3S3Q A;  1SP4 B;  1BP4 A;  1O0E A;  1CB5 A;  2ATO A;  1MHW A;  2G7Y A;  1QMY A;  3CBK A;  2FUD A;  2GFO A;  1NQC A;  1EWM A;  3U8E A;  4KLB A;  2PRE A;  2DC6 A;  3E1Z B;  2B1N A;  3KWZ A;  4HWY A;  7PCK A;  4YYV A;  1FH0 A;  4YV8 A;  3P5U A;  2BDZ A;  3PW3 A;  3AI8 A;  4QRV A;  1POP A;  1MEM A;  1JQP A;  3BOW A;  3LXS A;  4PI3 A;  4CDE B;  1BQI A;  2DC9 A;  5A24 A;  1Y08 A;  4FJC A;  4PP2 E;  2CIO A;  4MZS A;  4QBB A;  3PBH A;  4N4Z A;  2FQ9 A;  1PCI A;  1GLO A;  2DCA A;  3PNR A;  2DZY A;  4BS6 A;  1ME3 A;  3HHI A;  2DJF B;  4FIP A;  2OZ2 A;  5K16 A;  1DF0 A;  3H8C A;  1PPP A;  1IWD A;  4MZO A;  1U9V A;  2R9C A;  3RVX A;  5CVO B;  2DZZ A;  2G8J A;  2P7U A;  1BGO A;  1F2B A;  3TNX A;  5EGW A;  1A6R A;  1NB3 A;  2R9F A;  1PPD A;  4YYS A;  4QH6 A;  2YJ9 A;  4DMY A;  2YJ8 A;  1U9Q X;  3RVV A;  3MOR A;  3O1G A;  3QJ3 A;  4BQV A;  1U5I A;  1PAD A;  4N79 A;  3BPM A;  3C9E A;  3K24 A;  1AU0 A;  1KXR A;  3BPF A;  1F29 A;  2XU5 A;  1STF E;  2WBF X;  2DC8 A;  4FK5 A;  3F5V A;  1ATK A;  3KFQ A;  4XR7 A;  4MSX A;  6PAD A;  5PAD A;  3KKU A;  2E01 A;  3N3G A;  1TL9 A;  3KW9 A;  1PPN A;  2BDL A;  4BS5 A;  1BY8 A;  1AIM A;  1QXP A;  1THE A;  1MIR A;  1CPJ A;  2Y6E A;  3BCN A;  4CDD B;  1GCB A;  1CTE A;  3P5V A;  1CS8 A;  1AU3 A;  1ZIV A;  3LFY A;  3ZUA A;  5CVM A;  1HUC B;  4W5B A;  1U9X A;  2G8E A;  3MTN A;  1NPZ A;  3P5W A;  2FRQ A;  2AU1 A;  3O0U A;  3IOQ A;  1AYW A;  3MHH A;  4BSQ A;  2PNS A;  4ZUX U;  2HD5 A;  4I07 A;  3MHS A;  1AYV A;  1QDQ A; 
#chains in the Genus database with same CATH topology
 3B21 A;  2YJ2 A;  1M6D A;  2AYN A;  4XUI A;  4BOZ A;  4N8W A;  4I04 A;  5J94 A;  3IUT A;  2NQG A;  3PHW A;  3PHX A;  3H8B A;  4Q8H A;  1GEC E;  2GHU A;  5F02 A;  3HD3 A;  3OVZ A;  1NL6 A;  1MEG A;  1PXV A;  2BTW B;  2HH5 A;  5E6J A;  4W4U A;  1CJL A;  1GMY A;  1Y4H A;  3S3R A;  3NHE A;  1KFU L;  2DCC A;  3K8U A;  1PPO A;  1ZCM A;  3IHP A;  3CH2 X;  4OEM A;  3IMA A;  5CHT A;  1KHP A;  2H7J A;  4MM3 B;  3OVX A;  1YT7 A;  2DCD A;  1VSN A;  2FRA A;  3KSE A;  2Z84 A;  2NQI A;  5KO3 A;  2B1M A;  2OP3 A;  1XKG A;  4CZW A;  5FPW A;  2E02 A;  3WXF A;  3PHU A;  4X6H A;  3RVW A;  1SNK A;  3I3T A;  2XU1 A;  1K3B B;  2PBH A;  3IEJ A;  4QRX A;  2F1G A;  4X6I A;  1YAL A;  3V6C A;  1EF7 A;  2YJB A;  3OIS A;  2AIM A;  4OEL A;  3B79 A;  5CVN B;  2E00 A;  1U9W A;  2R9O A;  1PE6 A;  1EWO A;  1EWL A;  2F7D A;  3QT4 A;  2AVW A;  4BPV A;  4R3D A;  2FTD A;  5JZE A;  5EZQ A;  5JH3 A;  4X6J A;  3D6S A;  2XU3 A;  4YYW A;  2FYE A;  1QOL A;  3IV2 A;  4Q8G A;  2IBI A;  3H7D A;  4YYQ A;  4BOU A;  3OF8 A;  2O6X A;  2R9M A;  4K7C A;  3KX1 A;  1AU4 A;  3TRK A;  2FO5 A;  3K9M A;  2OUL A;  3N4C A;  2IPP B;  3P5X A;  4WUR A;  9PAP A;  2DC7 A;  2NQD B;  3BC3 A;  3TMP A;  1NB5 A;  4AXM A;  3V6E A;  4YYU A;  4A5U A;  3N3K A;  4W5C A;  2R9N A;  4PP1 A;  2AUX A;  3GCB A;  3QSD A;  1YK8 A;  4CDF B;  4G54 A;  4P6G A;  4M0W A;  1X9Y A;  1AU2 A;  1VJV A;  4HXD B;  4YVA A;  4DMX A;  1CSB B;  1ME4 A;  2AGA A;  2P0R A;  3KWB X;  5EF4 A;  3M99 A;  1PIP A;  2ACT A;  2FE8 A;  2HHN A;  2HXZ A;  3E9S A;  2AYO A;  2BU3 A;  2JTC A;  2Y5B A;  3CH3 X;  4D8E A;  3I06 A;  1CV8 A;  2JQF R;  2PAD A;  3USV A;  4WA6 A;  1ITO A;  3PRM A;  1TU6 A;  2DCB A;  3MJ5 A;  2E03 A;  2JQG R;  4AXL A;  1NLJ A;  2XU4 A;  3BWK A;  1KHQ A;  4I05 A;  1DEU A;  3HHA A;  2ARY A;  5JA7 A;  3DF0 A;  4YYR A;  2G6D A;  2VHF A;  4IUM A;  1AYU A;  1F2C A;  3CBJ A;  1MS6 A;  2AUZ A;  3PDF A;  1TLO A;  4MI7 A;  1EWP A;  3BY4 A;  1F2A A;  2R6N A;  3PT2 A;  3HWN A;  2VHS A;  2FT2 A;  1Q6K A;  3WXG A;  1CQD A;  2C0Y A;  1S4V A;  1KFX L;  1CVZ A;  2NQA A;  3H6S A;  3RNV A;  2P86 A;  3BB7 A;  5CHV A;  4REZ A;  1PBH A;  2AS8 A;  1AEC A;  3WXE A;  3OF9 A;  2YJC A;  4P6E A;  1MDW A;  1ICF A;  1YVB A;  1YK7 A;  4PAD A;  8PCH A;  1UKF A;  3H89 A;  4BOP A;  2DJG B;  4RY2 A;  2CB5 A;  4QRG A;  4CDC B;  3ERV A;  3F75 A;  3S3Q A;  1SP4 B;  1BP4 A;  1O0E A;  1CB5 A;  2ATO A;  1MHW A;  2G7Y A;  1QMY A;  3ZNH A;  3CBK A;  2FUD A;  2GFO A;  3PRP A;  1NQC A;  1EWM A;  3U8E A;  4KLB A;  2PRE A;  2DC6 A;  4XZX A;  3E1Z B;  2B1N A;  3KWZ A;  4HWY A;  7PCK A;  4YYV A;  1FH0 A;  4YV8 A;  4OVZ A;  3P5U A;  2BDZ A;  3PW3 A;  3AI8 A;  4QRV A;  4IP3 A;  4PT5 A;  1POP A;  3MTV A;  1MEM A;  1JQP A;  3BOW A;  3LXS A;  4PI3 A;  3PSE A;  4D8I A;  4CDE B;  1BQI A;  2J7Q C;  1YZB A;  3W30 A;  2DC9 A;  5A24 A;  1Y08 A;  3MP2 A;  4FJC A;  4PP2 E;  2CIO A;  4MZS A;  4QBB A;  3PBH A;  4N4Z A;  2FQ9 A;  3IFU A;  1PCI A;  1GLO A;  2DCA A;  3PNR A;  2DZY A;  4BS6 A;  4P16 A;  1ME3 A;  3HHI A;  2DJF B;  4FIP A;  2J7Q A;  2OZ2 A;  5K16 A;  1DF0 A;  3H8C A;  1PPP A;  1IWD A;  4MZO A;  1U9V A;  2R9C A;  4OW0 A;  3RVX A;  3W31 A;  5CVO B;  2DZZ A;  2G8J A;  2P7U A;  1BGO A;  1F2B A;  4D8B A;  3TNX A;  5EGW A;  4RF0 A;  1A6R A;  1NB3 A;  2R9F A;  2JRI A;  1PPD A;  4YYS A;  4QH6 A;  2YJ9 A;  4DMY A;  2YJ8 A;  1U9Q X;  3RVV A;  2BTW A;  3MOR A;  3O1G A;  3QJ3 A;  4RKX A;  4BQV A;  1U5I A;  2UZJ A;  1PAD A;  4N79 A;  3BPM A;  3C9E A;  3K24 A;  1AU0 A;  4BOQ A;  1KXR A;  3BPF A;  1F29 A;  1PVJ A;  2XU5 A;  1STF E;  4BOS A;  4RNA A;  2WBF X;  3O65 A;  3BBA A;  2DC8 A;  4FK5 A;  3F5V A;  1ATK A;  3KFQ A;  4XR7 A;  4MSX A;  6PAD A;  5PAD A;  4OVZ B;  3KKU A;  2E01 A;  3N3G A;  1TL9 A;  5EZS A;  3KW9 A;  1PPN A;  2BDL A;  4BS5 A;  1BY8 A;  1AIM A;  1QXP A;  1THE A;  2DOS A;  1MIR A;  1CPJ A;  2Y6E A;  3BCN A;  4CDD B;  1GCB A;  1CTE A;  3P5V A;  1CS8 A;  1AU3 A;  1ZIV A;  3LFY A;  3OQC A;  3ZUA A;  2HWK A;  5CVM A;  1HUC B;  4W5B A;  1U9X A;  2G8E A;  3MTN A;  1NPZ A;  3P5W A;  1DKI A;  2FRQ A;  2AU1 A;  3O0U A;  3IOQ A;  1AYW A;  3MHH A;  4BSQ A;  2PNS A;  4ZUX U;  2HD5 A;  4I07 A;  3MHS A;  4GUA A;  4RF1 A;  1AYV A;  3C0R A;  4ZTB A;  1QDQ A; 
#chains in the Genus database with same CATH homology
 2YJ2 A;  1M6D A;  2AYN A;  4XUI A;  3D9W A;  4N8W A;  4I04 A;  5J94 A;  3IUT A;  2NQG A;  3H8B A;  4Q8H A;  1GEC E;  2GHU A;  5F02 A;  3HD3 A;  3OVZ A;  1NL6 A;  1MEG A;  1PXV A;  2HH5 A;  4GUZ A;  4W4U A;  1CJL A;  1GMY A;  1GX3 A;  1Y4H A;  3S3R A;  3NHE A;  1KFU L;  2DCC A;  3K8U A;  1PPO A;  1ZCM A;  3IHP A;  3CH2 X;  4OEM A;  3IMA A;  5CHT A;  1KHP A;  2H7J A;  3OVX A;  1YT7 A;  2DCD A;  1VSN A;  2FRA A;  3KSE A;  2NQI A;  2B1M A;  2OP3 A;  1XKG A;  4CZW A;  5FPW A;  2E02 A;  3WXF A;  4X6H A;  3RVW A;  1SNK A;  3I3T A;  2XU1 A;  1K3B B;  2PBH A;  3IEJ A;  4QRX A;  2F1G A;  4X6I A;  1YAL A;  3V6C A;  1EF7 A;  2YJB A;  3OIS A;  2AIM A;  4OEL A;  3B79 A;  5CVN B;  2E00 A;  1U9W A;  1W6F A;  1PE6 A;  2R9O A;  1EWO A;  1EWL A;  2F7D A;  3QT4 A;  2AVW A;  4BPV A;  2FTD A;  5JH3 A;  4X6J A;  3D6S A;  2XU3 A;  4YYW A;  2FYE A;  1QOL A;  3IV2 A;  4Q8G A;  2IBI A;  3H7D A;  4YYQ A;  3OF8 A;  2O6X A;  2R9M A;  4K7C A;  3KX1 A;  1AU4 A;  2FO5 A;  3K9M A;  2OUL A;  3N4C A;  2IPP B;  3P5X A;  9PAP A;  2DC7 A;  2NQD B;  3BC3 A;  1NB5 A;  4AXM A;  3V6E A;  4YYU A;  3N3K A;  4W5C A;  2R9N A;  4PP1 A;  2AUX A;  3GCB A;  3QSD A;  1YK8 A;  4CDF B;  4G54 A;  4P6G A;  1X9Y A;  1AU2 A;  1VJV A;  4YVA A;  4DMX A;  1CSB B;  1ME4 A;  2P0R A;  3KWB X;  5EF4 A;  2BSZ A;  3M99 A;  1PIP A;  2ACT A;  2HHN A;  2HXZ A;  2AYO A;  2Y5B A;  3CH3 X;  3I06 A;  1CV8 A;  2JQF R;  2PAD A;  3USV A;  4WA6 A;  1ITO A;  1TU6 A;  2DCB A;  2E03 A;  2JQG R;  4AXL A;  1NLJ A;  2XU4 A;  3BWK A;  1KHQ A;  4I05 A;  1DEU A;  3HHA A;  2ARY A;  5JA7 A;  3DF0 A;  4YYR A;  2G6D A;  2VHF A;  1AYU A;  1F2C A;  2VFB A;  3CBJ A;  1MS6 A;  2AUZ A;  3PDF A;  1TLO A;  4BGF A;  1EWP A;  1F2A A;  2R6N A;  3HWN A;  2VHS A;  2FT2 A;  1Q6K A;  3WXG A;  1CQD A;  2C0Y A;  1S4V A;  1KFX L;  1CVZ A;  2NQA A;  3H6S A;  2P86 A;  5CHV A;  1PBH A;  2VFC A;  2AS8 A;  1AEC A;  3WXE A;  3OF9 A;  2YJC A;  4P6E A;  1MDW A;  1ICF A;  1YVB A;  1YK7 A;  4PAD A;  8PCH A;  3H89 A;  2DJG B;  4RY2 A;  2CB5 A;  4QRG A;  4CDC B;  3ERV A;  3F75 A;  4NV7 A;  3S3Q A;  1SP4 B;  1BP4 A;  1O0E A;  1CB5 A;  2ATO A;  1MHW A;  2G7Y A;  1QMY A;  3CBK A;  2FUD A;  2GFO A;  1NQC A;  1EWM A;  3U8E A;  4KLB A;  2PRE A;  2DC6 A;  3E1Z B;  2B1N A;  3KWZ A;  4HWY A;  7PCK A;  4YYV A;  1FH0 A;  4YV8 A;  3P5U A;  2BDZ A;  3PW3 A;  3AI8 A;  4QRV A;  1POP A;  1MEM A;  1JQP A;  3BOW A;  3LXS A;  4PI3 A;  4CDE B;  1BQI A;  2DC9 A;  5A24 A;  1Y08 A;  4FJC A;  4PP2 E;  4C5P A;  2CIO A;  4MZS A;  4QBB A;  3PBH A;  4N4Z A;  2FQ9 A;  1PCI A;  1GLO A;  2DCA A;  3PNR A;  2DZY A;  4BS6 A;  1ME3 A;  3HHI A;  2DJF B;  4FIP A;  2OZ2 A;  5K16 A;  1DF0 A;  3H8C A;  1PPP A;  1IWD A;  4MZO A;  1U9V A;  2R9C A;  3RVX A;  5CVO B;  2DZZ A;  2G8J A;  2P7U A;  1BGO A;  1F2B A;  3TNX A;  4NV8 A;  5EGW A;  1A6R A;  1NB3 A;  2R9F A;  1PPD A;  4YYS A;  4QH6 A;  2YJ9 A;  4DMY A;  2YJ8 A;  1U9Q X;  3RVV A;  3MOR A;  3O1G A;  3QJ3 A;  4BQV A;  1U5I A;  1PAD A;  1W5R A;  4N79 A;  3BPM A;  3C9E A;  3LTW A;  3K24 A;  1AU0 A;  1KXR A;  3BPF A;  1F29 A;  2XU5 A;  1STF E;  2WBF X;  2DC8 A;  4FK5 A;  3F5V A;  1ATK A;  3KFQ A;  4XR7 A;  4MSX A;  6PAD A;  5PAD A;  1W4T A;  3KKU A;  2E01 A;  3N3G A;  1TL9 A;  3KW9 A;  1PPN A;  2BDL A;  4BS5 A;  1BY8 A;  1AIM A;  1QXP A;  1THE A;  1MIR A;  1CPJ A;  2Y6E A;  3BCN A;  4CDD B;  1GCB A;  1CTE A;  3P5V A;  1CS8 A;  1AU3 A;  1ZIV A;  3LFY A;  3ZUA A;  4B55 A;  5CVM A;  1HUC B;  4W5B A;  1U9X A;  2G8E A;  3MTN A;  1NPZ A;  3P5W A;  2FRQ A;  2AU1 A;  3O0U A;  3IOQ A;  1AYW A;  3MHH A;  4BSQ A;  2PNS A;  4ZUX U;  2HD5 A;  4I07 A;  3MHS A;  1E2T A;  1AYV A;  1QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...