3BC3A

Exploring inhibitor binding at the s subsites of cathepsin l
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
214
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring inhibitor binding at the S' subsites of cathepsin L
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin L heavy and light chains
total genus 67
structure length 214
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bc3A00
3N4CA 2DCBA 2OP3A 1QXPA 1U9XA 3DF0A 4PI3A 1QMYA 2XU3A 1AYVA 1PBHA 4I05A 2P0RA 3H8CA 2AUZA 4MZOA 4G54A 3B79A 4N79A 1IWDA 1PADA 1FH0A 3S3RA 3BCNA 3IV2A 2E00A 2O6XA 5K16A 3HHIA 2ARYA 1XKGA 1CJLA 4FIPA 3U8EA 2JQGR 4KLBA 1YVBA 4MSXA 3H7DA 1AU4A 2PNSA 3O1GA 4ZUXU 1EWOA 2R9OA 3KX1A 4QH6A 2P7UA 2FQ9A 1SNKA 2FTDA 2G8JA 3H6SA 3F75A 3OVXA 2FUDA 2ATOA 1MS6A 3IEJA 3OF9A 2CIOA 4I04A 1NB3A 1YK8A 2AUXA 1DF0A 3V6CA 1MHWA 1ITOA 4X6IA 3RVXA 2WBFX 9PAPA 2DCCA 4PP1A 5PADA 1PXVA 3MHHA 2E02A 2G7YA 1F29A 2VHFA 2DCDA 3BWKA 3P5UA 4FJCA 4BSQA 1NQCA 3V6EA 5EF4A 3RVWA 5CVOB 1CV8A 3PDFA 1KXRA 1HUCB 2JQFR 3QT4A 2FO5A 3NHEA 4Q8GA 2XU1A 5CHVA 2H7JA 4OEMA 1ICFA 3ZUAA 1Y08A 4W5BA 3O0UA 4WA6A 2GHUA 4QRXA 2AVWA 3CBJA 4YYSA 3CH2X 2DJGB 2P86A 1KFXL 3IMAA 2R9MA 3HWNA 2YJ8A 1EWPA 3WXFA 3H89A 2AIMA 2E01A 1CS8A 3OVZA 4BS5A 4I07A 5CVMA 1CQDA 1TL9A 3H8BA 2R9FA 1MDWA 4X6JA 2DZYA 1F2CA 5CHTA 1ATKA 4BS6A 3IOQA 1QOLA 1THEA 3P5WA 3P5VA 3D6SA 3M99A 3MHSA 3RVVA 1O0EA 1U9QX 2CB5A 2BDZA 3HHAA 1Q6KA 1AIMA 3MORA 1CTEA 4Q8HA 1DEUA 3AI8A 1A6RA 4YV8A 1JQPA 2NQGA 2AS8A 1Y4HA 3IUTA 1PPDA 4XUIA 1F2BA 3BPMA 1GCBA 4PADA 1PIPA 3P5XA 3BC3A 4AXMA 4PP2E 1KHQA 1CVZA 1PPPA 3TNXA 4P6GA 4DMXA 1MEMA 2YJ2A 2DC9A 2G8EA 4W4UA 1BP4A 1TLOA 3GCBA 4CDFB 1MEGA 2NQDB 1K3BB 1M6DA 2NQAA 3N3KA 3WXEA 2ACTA 1PCIA 5CVNB 2G6DA 3BOWA 1CPJA 3F5VA 3S3QA 4CDDB 4YYUA 1ME4A 3KFQA 3PW3A 2HD5A 2E03A 7PCKA 1YALA 3C9EA 4YYRA 1POPA 1NPZA 2VHSA 2IBIA 2YJBA 5EGWA 2GFOA 3N3GA 1AYWA 1X9YA 3LFYA 1EWMA 1S4VA 3CH3X 3HD3A 1VSNA 3CBKA 3QSDA 2PBHA 1PE6A 1EF7A 1SP4B 2FRQA 1AYUA 8PCHA 1STFE 1GLOA 2Y5BA 4QBBA 2YJCA 4N4ZA 5JH3A 1BY8A 4P6EA 1CSBB 2HH5A 3K9MA 3KWBX 2FRAA 1CB5A 2FYEA 1AU0A 4FK5A 2XU4A 6PADA 1NLJA 3K8UA 1KFUL 1EWLA 2AYOA 1BGOA 3K24A 5JA7A 4W5CA 4BQVA 2R6NA 1GMYA 4QRGA 4OELA 2F1GA 2DC8A 1U9WA 2DC7A 3KW9A 1U5IA 3IHPA 4QRVA 5FPWA 2OULA 1KHPA 4YYVA 3QJ3A 1U9VA 4CZWA 1YK7A 1ZIVA 1MIRA 4RY2A 3WXGA 2DJFB 2C0YA 4CDCB 1AU3A 4K7CA 2OZ2A 5F02A 1AECA 4YVAA 2NQIA 1QDQA 4AXLA 2AU1A 2XU5A 2FT2A 1VJVA 2DCAA 1BQIA 2R9NA 3OISA 2HXZA 2AYNA 3OF8A 3I06A 3USVA 3PBHA 3BPFA 4XR7A 4BPVA 2BDLA 2HHNA 1PPNA 2B1MA 2R9CA 2YJ9A 4MZSA 1NB5A 4HWYA 4CDEB 1F2AA 2F7DA 1NL6A 3PNRA 4N8WA 3KWZA 3I3TA 1ME3A 3KKUA 2DC6A 2Y6EA 5J94A 2PREA 3ERVA 4X6HA 3KSEA 3LXSA 4YYWA 1ZCMA 1YT7A 2B1NA 4YYQA 2DZZA 1GECE 4DMYA 5A24A 1TU6A 2IPPB 1PPOA 1AU2A 3MTNA 2PADA 3E1ZB
chains in the Genus database with same CATH superfamily
3N4CA 2DCBA 2OP3A 1QXPA 1U9XA 3DF0A 4PI3A 1QMYA 2XU3A 1AYVA 4ZTBA 1PBHA 4I05A 2P0RA 3H8CA 4IP3A 2AUZA 4MZOA 4G54A 3B79A 4N79A 1IWDA 1PADA 1FH0A 3S3RA 3BCNA 3IV2A 2E00A 4P16A 2O6XA 5K16A 3HHIA 2ARYA 1XKGA 3ZNHA 1CJLA 4FIPA 3U8EA 2JQGR 4KLBA 1YVBA 4MSXA 3H7DA 4A5UA 1AU4A 2PNSA 3O1GA 4ZUXU 1EWOA 2R9OA 3KX1A 4QH6A 3PSEA 2P7UA 2FQ9A 4D8BA 3MJ5A 1SNKA 2FTDA 2G8JA 3H6SA 3F75A 3OVXA 2FUDA 3PHWA 2ATOA 1MS6A 3IEJA 3OF9A 2CIOA 4I04A 1NB3A 3BBAA 1YK8A 1DKIA 2AUXA 1DF0A 3TMPA 4IUMA 4RNAA 3V6CA 5EZQA 3IFUA 1MHWA 1ITOA 4X6IA 3RVXA 2WBFX 9PAPA 2AGAA 2DCCA 4PP1A 5PADA 4REZA 4BOSA 1PXVA 3MHHA 2E02A 2G7YA 1F29A 2VHFA 2DCDA 3BWKA 3P5UA 4FJCA 4BSQA 1NQCA 4D8IA 2JRIA 3V6EA 3W30A 4RF0A 5EF4A 3RVWA 5CVOB 1CV8A 3PDFA 2JTCA 4BOUA 1KXRA 4M0WA 2BU3A 1HUCB 1YZBA 2JQFR 4GUAA 2FE8A 3QT4A 2FO5A 4OW0A 3NHEA 4Q8GA 2XU1A 5CHVA 2H7JA 3B21A 4OEMA 1ICFA 3ZUAA 1Y08A 4W5BA 3O0UA 4WA6A 2GHUA 3PRMA 4QRXA 2AVWA 3CBJA 4YYSA 3CH2X 4XZXA 2DJGB 2P86A 1KFXL 3IMAA 2R9MA 5E6JA 3HWNA 2YJ8A 1EWPA 3WXFA 2J7QC 3H89A 2AIMA 2E01A 1CS8A 3OVZA 4BS5A 4I07A 5CVMA 1UKFA 1CQDA 1TL9A 3H8BA 2R9FA 1MDWA 4X6JA 2DZYA 1F2CA 1ATKA 5CHTA 4BS6A 3IOQA 2BTWA 3PHUA 1QOLA 1THEA 3OQCA 3P5WA 3P5VA 3D6SA 3O65A 3M99A 3MHSA 3RVVA 1O0EA 1U9QX 2CB5A 2BDZA 3HHAA 1Q6KA 3PT2A 1AIMA 3MORA 1CTEA 4Q8HA 1DEUA 3AI8A 1A6RA 4YV8A 1JQPA 2NQGA 2AS8A 5KO3A 1Y4HA 4BOPA 3IUTA 1PPDA 4XUIA 1F2BA 3BPMA 1GCBA 5EZSA 4PADA 1PIPA 3P5XA 3BC3A 4AXMA 4PP2E 1KHQA 1CVZA 1PPPA 4BOQA 3TNXA 3BY4A 4P6GA 4DMXA 1MEMA 2YJ2A 2DC9A 2G8EA 4W4UA 1BP4A 1TLOA 2HWKA 3GCBA 4CDFB 1MEGA 4D8EA 2NQDB 2J7QA 1K3BB 4MM3B 1M6DA 2NQAA 3N3KA 3WXEA 2ACTA 1PCIA 5CVNB 2G6DA 3BOWA 1CPJA 3F5VA 4WURA 3S3QA 4CDDB 4OVZA 4YYUA 1ME4A 3MP2A 3KFQA 3PW3A 2HD5A 2E03A 7PCKA 1YALA 3C9EA 4YYRA 1POPA 1NPZA 2VHSA 2IBIA 2YJBA 5EGWA 2GFOA 4PT5A 3N3GA 1AYWA 1X9YA 3LFYA 1EWMA 1S4VA 3CH3X 3HD3A 1VSNA 3CBKA 3PHXA 3QSDA 4RKXA 2PBHA 3TRKA 1PE6A 4RF1A 1EF7A 1SP4B 2FRQA 1AYUA 8PCHA 1STFE 1GLOA 2Y5BA 3W31A 4QBBA 2YJCA 4N4ZA 5JH3A 1BY8A 4P6EA 2BTWB 1CSBB 2HH5A 3K9MA 3KWBX 2FRAA 1CB5A 2FYEA 1AU0A 4FK5A 2XU4A 6PADA 1NLJA 3K8UA 5JZEA 1KFUL 1EWLA 3RNVA 2AYOA 1BGOA 3K24A 5JA7A 4W5CA 4BQVA 2R6NA 1GMYA 4QRGA 3BB7A 4OELA 2F1GA 4R3DA 3MTVA 2DC8A 1U9WA 2DC7A 3KW9A 1U5IA 3IHPA 4QRVA 4MI7A 5FPWA 2OULA 1KHPA 3C0RA 4YYVA 3QJ3A 1U9VA 4CZWA 1YK7A 1ZIVA 2UZJA 1MIRA 4RY2A 3WXGA 2DJFB 2C0YA 4CDCB 4BOZA 1AU3A 4HXDB 4K7CA 1PVJA 2OZ2A 5F02A 1AECA 4YVAA 2NQIA 1QDQA 4AXLA 2AU1A 2XU5A 2FT2A 1VJVA 2DCAA 1BQIA 2R9NA 3OISA 2HXZA 2AYNA 3OF8A 3I06A 3USVA 4OVZB 3PBHA 3BPFA 3E9SA 4XR7A 4BPVA 2BDLA 2HHNA 1PPNA 2B1MA 2R9CA 4MZSA 2YJ9A 1NB5A 4HWYA 4CDEB 1F2AA 2F7DA 1NL6A 3PNRA 4N8WA 3KWZA 3I3TA 3PRPA 1ME3A 3KKUA 2DC6A 2Y6EA 5J94A 2PREA 3ERVA 4X6HA 3KSEA 3LXSA 4YYWA 1ZCMA 1YT7A 2B1NA 4YYQA 2Z84A 2DZZA 1GECE 4DMYA 5A24A 1TU6A 2IPPB 1PPOA 1AU2A 2DOSA 3MTNA 2PADA 3E1ZB
chains in the Genus database with same CATH topology
3N4CA 1W5RA 2DCBA 2OP3A 1QXPA 1U9XA 3DF0A 4PI3A 1QMYA 2XU3A 1AYVA 1PBHA 4I05A 2P0RA 3H8CA 2AUZA 4MZOA 4G54A 3B79A 4N79A 1IWDA 1PADA 4BGFA 1FH0A 3S3RA 3BCNA 3IV2A 2E00A 2O6XA 5K16A 3HHIA 2ARYA 1XKGA 1CJLA 4FIPA 3U8EA 4GUZA 2JQGR 4KLBA 1YVBA 4MSXA 3H7DA 1AU4A 2PNSA 3O1GA 4ZUXU 1EWOA 2R9OA 3KX1A 4QH6A 2P7UA 2FQ9A 1E2TA 1SNKA 2FTDA 2G8JA 3H6SA 3F75A 3OVXA 2FUDA 2ATOA 1MS6A 3IEJA 3OF9A 2CIOA 4I04A 1NB3A 1YK8A 2AUXA 1DF0A 3V6CA 1MHWA 1ITOA 4X6IA 3RVXA 2WBFX 9PAPA 2DCCA 4PP1A 5PADA 1PXVA 3MHHA 2E02A 2G7YA 1F29A 2VHFA 2DCDA 3BWKA 3P5UA 4FJCA 4BSQA 1NQCA 3V6EA 5EF4A 3RVWA 5CVOB 1CV8A 3PDFA 1KXRA 4C5PA 1HUCB 2JQFR 3QT4A 2FO5A 3NHEA 4Q8GA 2XU1A 5CHVA 2H7JA 4OEMA 1ICFA 3ZUAA 1Y08A 4W5BA 3O0UA 4WA6A 2GHUA 4QRXA 2AVWA 2BSZA 3CBJA 4YYSA 3CH2X 2DJGB 2P86A 1KFXL 3IMAA 2R9MA 3HWNA 2YJ8A 1EWPA 3WXFA 1W4TA 3H89A 2AIMA 2E01A 1CS8A 3OVZA 4BS5A 4I07A 5CVMA 1CQDA 1TL9A 3H8BA 2R9FA 1MDWA 4X6JA 2DZYA 1F2CA 5CHTA 1ATKA 4BS6A 3IOQA 1QOLA 1THEA 3P5WA 1GX3A 3P5VA 3D6SA 3M99A 3MHSA 3RVVA 1O0EA 2VFBA 1U9QX 2CB5A 2BDZA 2VFCA 3HHAA 1Q6KA 1AIMA 3MORA 1CTEA 4Q8HA 1DEUA 3AI8A 1A6RA 4YV8A 1JQPA 2NQGA 2AS8A 1Y4HA 3IUTA 1PPDA 4XUIA 1F2BA 3BPMA 1GCBA 4PADA 1PIPA 3P5XA 3BC3A 4AXMA 4PP2E 1KHQA 1CVZA 1PPPA 3TNXA 4P6GA 4DMXA 1MEMA 2YJ2A 2DC9A 2G8EA 4W4UA 1BP4A 1TLOA 3GCBA 4CDFB 1W6FA 1MEGA 2NQDB 1K3BB 1M6DA 2NQAA 3N3KA 3WXEA 2ACTA 1PCIA 5CVNB 2G6DA 3BOWA 1CPJA 4B55A 3F5VA 3S3QA 4CDDB 4YYUA 1ME4A 3KFQA 3PW3A 2HD5A 2E03A 7PCKA 1YALA 3C9EA 4YYRA 1POPA 1NPZA 2VHSA 2IBIA 2YJBA 5EGWA 2GFOA 3N3GA 1AYWA 1X9YA 3LFYA 1EWMA 1S4VA 3CH3X 3HD3A 1VSNA 3CBKA 3QSDA 2PBHA 1PE6A 1EF7A 1SP4B 2FRQA 1AYUA 8PCHA 1STFE 1GLOA 2Y5BA 4QBBA 2YJCA 4N4ZA 5JH3A 1BY8A 4P6EA 1CSBB 2HH5A 3K9MA 4NV8A 3KWBX 2FRAA 1CB5A 2FYEA 1AU0A 4FK5A 2XU4A 6PADA 1NLJA 3K8UA 1KFUL 1EWLA 2AYOA 1BGOA 3K24A 5JA7A 4W5CA 4BQVA 2R6NA 1GMYA 4QRGA 4OELA 2F1GA 2DC8A 1U9WA 2DC7A 3KW9A 1U5IA 3IHPA 4QRVA 5FPWA 2OULA 1KHPA 4YYVA 3QJ3A 1U9VA 4CZWA 1YK7A 1ZIVA 1MIRA 4RY2A 3WXGA 2DJFB 2C0YA 4CDCB 1AU3A 3D9WA 4K7CA 3LTWA 2OZ2A 5F02A 1AECA 4YVAA 2NQIA 1QDQA 4AXLA 2AU1A 2XU5A 2FT2A 1VJVA 2DCAA 1BQIA 2R9NA 3OISA 2HXZA 2AYNA 3OF8A 3I06A 3USVA 3PBHA 3BPFA 4XR7A 4BPVA 2BDLA 2HHNA 1PPNA 2B1MA 2R9CA 2YJ9A 4MZSA 1NB5A 4HWYA 4CDEB 1F2AA 2F7DA 1NL6A 3PNRA 4N8WA 3KWZA 3I3TA 1ME3A 3KKUA 2DC6A 2Y6EA 5J94A 2PREA 3ERVA 4X6HA 3KSEA 3LXSA 4YYWA 1ZCMA 1YT7A 2B1NA 4YYQA 2DZZA 1GECE 4DMYA 4NV7A 5A24A 1TU6A 2IPPB 1PPOA 1AU2A 3MTNA 2PADA 3E1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4C A;  2DCB A;  2OP3 A;  1QXP A;  1U9X A;  3DF0 A;  4PI3 A;  1QMY A;  2XU3 A;  1AYV A;  1PBH A;  4I05 A;  2P0R A;  3H8C A;  2AUZ A;  4MZO A;  4G54 A;  3B79 A;  4N79 A;  1IWD A;  1PAD A;  1FH0 A;  3S3R A;  3BCN A;  3IV2 A;  2E00 A;  2O6X A;  5K16 A;  3HHI A;  2ARY A;  1XKG A;  1CJL A;  4FIP A;  3U8E A;  2JQG R;  4KLB A;  1YVB A;  4MSX A;  3H7D A;  1AU4 A;  2PNS A;  3O1G A;  4ZUX U;  1EWO A;  2R9O A;  3KX1 A;  4QH6 A;  2P7U A;  2FQ9 A;  1SNK A;  2FTD A;  2G8J A;  3H6S A;  3F75 A;  3OVX A;  2FUD A;  2ATO A;  1MS6 A;  3IEJ A;  3OF9 A;  2CIO A;  4I04 A;  1NB3 A;  1YK8 A;  2AUX A;  1DF0 A;  3V6C A;  1MHW A;  1ITO A;  4X6I A;  3RVX A;  2WBF X;  9PAP A;  2DCC A;  4PP1 A;  5PAD A;  1PXV A;  3MHH A;  2E02 A;  2G7Y A;  1F29 A;  2VHF A;  2DCD A;  3BWK A;  3P5U A;  4FJC A;  4BSQ A;  1NQC A;  3V6E A;  5EF4 A;  3RVW A;  5CVO B;  1CV8 A;  3PDF A;  1KXR A;  1HUC B;  2JQF R;  3QT4 A;  2FO5 A;  3NHE A;  4Q8G A;  2XU1 A;  5CHV A;  2H7J A;  4OEM A;  1ICF A;  3ZUA A;  1Y08 A;  4W5B A;  3O0U A;  4WA6 A;  2GHU A;  4QRX A;  2AVW A;  3CBJ A;  4YYS A;  3CH2 X;  2DJG B;  2P86 A;  1KFX L;  3IMA A;  2R9M A;  3HWN A;  2YJ8 A;  1EWP A;  3WXF A;  3H89 A;  2AIM A;  2E01 A;  1CS8 A;  3OVZ A;  4BS5 A;  4I07 A;  5CVM A;  1CQD A;  1TL9 A;  3H8B A;  2R9F A;  1MDW A;  4X6J A;  2DZY A;  1F2C A;  5CHT A;  1ATK A;  4BS6 A;  3IOQ A;  1QOL A;  1THE A;  3P5W A;  3P5V A;  3D6S A;  3M99 A;  3MHS A;  3RVV A;  1O0E A;  1U9Q X;  2CB5 A;  2BDZ A;  3HHA A;  1Q6K A;  1AIM A;  3MOR A;  1CTE A;  4Q8H A;  1DEU A;  3AI8 A;  1A6R A;  4YV8 A;  1JQP A;  2NQG A;  2AS8 A;  1Y4H A;  3IUT A;  1PPD A;  4XUI A;  1F2B A;  3BPM A;  1GCB A;  4PAD A;  1PIP A;  3P5X A;  3BC3 A;  4AXM A;  4PP2 E;  1KHQ A;  1CVZ A;  1PPP A;  3TNX A;  4P6G A;  4DMX A;  1MEM A;  2YJ2 A;  2DC9 A;  2G8E A;  4W4U A;  1BP4 A;  1TLO A;  3GCB A;  4CDF B;  1MEG A;  2NQD B;  1K3B B;  1M6D A;  2NQA A;  3N3K A;  3WXE A;  2ACT A;  1PCI A;  5CVN B;  2G6D A;  3BOW A;  1CPJ A;  3F5V A;  3S3Q A;  4CDD B;  4YYU A;  1ME4 A;  3KFQ A;  3PW3 A;  2HD5 A;  2E03 A;  7PCK A;  1YAL A;  3C9E A;  4YYR A;  1POP A;  1NPZ A;  2VHS A;  2IBI A;  2YJB A;  5EGW A;  2GFO A;  3N3G A;  1AYW A;  1X9Y A;  3LFY A;  1EWM A;  1S4V A;  3CH3 X;  3HD3 A;  1VSN A;  3CBK A;  3QSD A;  2PBH A;  1PE6 A;  1EF7 A;  1SP4 B;  2FRQ A;  1AYU A;  8PCH A;  1STF E;  1GLO A;  2Y5B A;  4QBB A;  2YJC A;  4N4Z A;  5JH3 A;  1BY8 A;  4P6E A;  1CSB B;  2HH5 A;  3K9M A;  3KWB X;  2FRA A;  1CB5 A;  2FYE A;  1AU0 A;  4FK5 A;  2XU4 A;  6PAD A;  1NLJ A;  3K8U A;  1KFU L;  1EWL A;  2AYO A;  1BGO A;  3K24 A;  5JA7 A;  4W5C A;  4BQV A;  2R6N A;  1GMY A;  4QRG A;  4OEL A;  2F1G A;  2DC8 A;  1U9W A;  2DC7 A;  3KW9 A;  1U5I A;  3IHP A;  4QRV A;  5FPW A;  2OUL A;  1KHP A;  4YYV A;  3QJ3 A;  1U9V A;  4CZW A;  1YK7 A;  1ZIV A;  1MIR A;  4RY2 A;  3WXG A;  2DJF B;  2C0Y A;  4CDC B;  1AU3 A;  4K7C A;  2OZ2 A;  5F02 A;  1AEC A;  4YVA A;  2NQI A;  1QDQ A;  4AXL A;  2AU1 A;  2XU5 A;  2FT2 A;  1VJV A;  2DCA A;  1BQI A;  2R9N A;  3OIS A;  2HXZ A;  2AYN A;  3OF8 A;  3I06 A;  3USV A;  3PBH A;  3BPF A;  4XR7 A;  4BPV A;  2BDL A;  2HHN A;  1PPN A;  2B1M A;  2R9C A;  2YJ9 A;  4MZS A;  1NB5 A;  4HWY A;  4CDE B;  1F2A A;  2F7D A;  1NL6 A;  3PNR A;  4N8W A;  3KWZ A;  3I3T A;  1ME3 A;  3KKU A;  2DC6 A;  2Y6E A;  5J94 A;  2PRE A;  3ERV A;  4X6H A;  3KSE A;  3LXS A;  4YYW A;  1ZCM A;  1YT7 A;  2B1N A;  4YYQ A;  2DZZ A;  1GEC E;  4DMY A;  5A24 A;  1TU6 A;  2IPP B;  1PPO A;  1AU2 A;  3MTN A;  2PAD A;  3E1Z B; 
#chains in the Genus database with same CATH topology
 3N4C A;  2DCB A;  2OP3 A;  1QXP A;  1U9X A;  3DF0 A;  4PI3 A;  1QMY A;  2XU3 A;  1AYV A;  4ZTB A;  1PBH A;  4I05 A;  2P0R A;  3H8C A;  4IP3 A;  2AUZ A;  4MZO A;  4G54 A;  3B79 A;  4N79 A;  1IWD A;  1PAD A;  1FH0 A;  3S3R A;  3BCN A;  3IV2 A;  2E00 A;  4P16 A;  2O6X A;  5K16 A;  3HHI A;  2ARY A;  1XKG A;  3ZNH A;  1CJL A;  4FIP A;  3U8E A;  2JQG R;  4KLB A;  1YVB A;  4MSX A;  3H7D A;  4A5U A;  1AU4 A;  2PNS A;  3O1G A;  4ZUX U;  1EWO A;  2R9O A;  3KX1 A;  4QH6 A;  3PSE A;  2P7U A;  2FQ9 A;  4D8B A;  3MJ5 A;  1SNK A;  2FTD A;  2G8J A;  3H6S A;  3F75 A;  3OVX A;  2FUD A;  3PHW A;  2ATO A;  1MS6 A;  3IEJ A;  3OF9 A;  2CIO A;  4I04 A;  1NB3 A;  3BBA A;  1YK8 A;  1DKI A;  2AUX A;  1DF0 A;  3TMP A;  4IUM A;  4RNA A;  3V6C A;  5EZQ A;  3IFU A;  1MHW A;  1ITO A;  4X6I A;  3RVX A;  2WBF X;  9PAP A;  2AGA A;  2DCC A;  4PP1 A;  5PAD A;  4REZ A;  4BOS A;  1PXV A;  3MHH A;  2E02 A;  2G7Y A;  1F29 A;  2VHF A;  2DCD A;  3BWK A;  3P5U A;  4FJC A;  4BSQ A;  1NQC A;  4D8I A;  2JRI A;  3V6E A;  3W30 A;  4RF0 A;  5EF4 A;  3RVW A;  5CVO B;  1CV8 A;  3PDF A;  2JTC A;  4BOU A;  1KXR A;  4M0W A;  2BU3 A;  1HUC B;  1YZB A;  2JQF R;  4GUA A;  2FE8 A;  3QT4 A;  2FO5 A;  4OW0 A;  3NHE A;  4Q8G A;  2XU1 A;  5CHV A;  2H7J A;  3B21 A;  4OEM A;  1ICF A;  3ZUA A;  1Y08 A;  4W5B A;  3O0U A;  4WA6 A;  2GHU A;  3PRM A;  4QRX A;  2AVW A;  3CBJ A;  4YYS A;  3CH2 X;  4XZX A;  2DJG B;  2P86 A;  1KFX L;  3IMA A;  2R9M A;  5E6J A;  3HWN A;  2YJ8 A;  1EWP A;  3WXF A;  2J7Q C;  3H89 A;  2AIM A;  2E01 A;  1CS8 A;  3OVZ A;  4BS5 A;  4I07 A;  5CVM A;  1UKF A;  1CQD A;  1TL9 A;  3H8B A;  2R9F A;  1MDW A;  4X6J A;  2DZY A;  1F2C A;  1ATK A;  5CHT A;  4BS6 A;  3IOQ A;  2BTW A;  3PHU A;  1QOL A;  1THE A;  3OQC A;  3P5W A;  3P5V A;  3D6S A;  3O65 A;  3M99 A;  3MHS A;  3RVV A;  1O0E A;  1U9Q X;  2CB5 A;  2BDZ A;  3HHA A;  1Q6K A;  3PT2 A;  1AIM A;  3MOR A;  1CTE A;  4Q8H A;  1DEU A;  3AI8 A;  1A6R A;  4YV8 A;  1JQP A;  2NQG A;  2AS8 A;  5KO3 A;  1Y4H A;  4BOP A;  3IUT A;  1PPD A;  4XUI A;  1F2B A;  3BPM A;  1GCB A;  5EZS A;  4PAD A;  1PIP A;  3P5X A;  3BC3 A;  4AXM A;  4PP2 E;  1KHQ A;  1CVZ A;  1PPP A;  4BOQ A;  3TNX A;  3BY4 A;  4P6G A;  4DMX A;  1MEM A;  2YJ2 A;  2DC9 A;  2G8E A;  4W4U A;  1BP4 A;  1TLO A;  2HWK A;  3GCB A;  4CDF B;  1MEG A;  4D8E A;  2NQD B;  2J7Q A;  1K3B B;  4MM3 B;  1M6D A;  2NQA A;  3N3K A;  3WXE A;  2ACT A;  1PCI A;  5CVN B;  2G6D A;  3BOW A;  1CPJ A;  3F5V A;  4WUR A;  3S3Q A;  4CDD B;  4OVZ A;  4YYU A;  1ME4 A;  3MP2 A;  3KFQ A;  3PW3 A;  2HD5 A;  2E03 A;  7PCK A;  1YAL A;  3C9E A;  4YYR A;  1POP A;  1NPZ A;  2VHS A;  2IBI A;  2YJB A;  5EGW A;  2GFO A;  4PT5 A;  3N3G A;  1AYW A;  1X9Y A;  3LFY A;  1EWM A;  1S4V A;  3CH3 X;  3HD3 A;  1VSN A;  3CBK A;  3PHX A;  3QSD A;  4RKX A;  2PBH A;  3TRK A;  1PE6 A;  4RF1 A;  1EF7 A;  1SP4 B;  2FRQ A;  1AYU A;  8PCH A;  1STF E;  1GLO A;  2Y5B A;  3W31 A;  4QBB A;  2YJC A;  4N4Z A;  5JH3 A;  1BY8 A;  4P6E A;  2BTW B;  1CSB B;  2HH5 A;  3K9M A;  3KWB X;  2FRA A;  1CB5 A;  2FYE A;  1AU0 A;  4FK5 A;  2XU4 A;  6PAD A;  1NLJ A;  3K8U A;  5JZE A;  1KFU L;  1EWL A;  3RNV A;  2AYO A;  1BGO A;  3K24 A;  5JA7 A;  4W5C A;  4BQV A;  2R6N A;  1GMY A;  4QRG A;  3BB7 A;  4OEL A;  2F1G A;  4R3D A;  3MTV A;  2DC8 A;  1U9W A;  2DC7 A;  3KW9 A;  1U5I A;  3IHP A;  4QRV A;  4MI7 A;  5FPW A;  2OUL A;  1KHP A;  3C0R A;  4YYV A;  3QJ3 A;  1U9V A;  4CZW A;  1YK7 A;  1ZIV A;  2UZJ A;  1MIR A;  4RY2 A;  3WXG A;  2DJF B;  2C0Y A;  4CDC B;  4BOZ A;  1AU3 A;  4HXD B;  4K7C A;  1PVJ A;  2OZ2 A;  5F02 A;  1AEC A;  4YVA A;  2NQI A;  1QDQ A;  4AXL A;  2AU1 A;  2XU5 A;  2FT2 A;  1VJV A;  2DCA A;  1BQI A;  2R9N A;  3OIS A;  2HXZ A;  2AYN A;  3OF8 A;  3I06 A;  3USV A;  4OVZ B;  3PBH A;  3BPF A;  3E9S A;  4XR7 A;  4BPV A;  2BDL A;  2HHN A;  1PPN A;  2B1M A;  2R9C A;  4MZS A;  2YJ9 A;  1NB5 A;  4HWY A;  4CDE B;  1F2A A;  2F7D A;  1NL6 A;  3PNR A;  4N8W A;  3KWZ A;  3I3T A;  3PRP A;  1ME3 A;  3KKU A;  2DC6 A;  2Y6E A;  5J94 A;  2PRE A;  3ERV A;  4X6H A;  3KSE A;  3LXS A;  4YYW A;  1ZCM A;  1YT7 A;  2B1N A;  4YYQ A;  2Z84 A;  2DZZ A;  1GEC E;  4DMY A;  5A24 A;  1TU6 A;  2IPP B;  1PPO A;  1AU2 A;  2DOS A;  3MTN A;  2PAD A;  3E1Z B; 
#chains in the Genus database with same CATH homology
 3N4C A;  1W5R A;  2DCB A;  2OP3 A;  1QXP A;  1U9X A;  3DF0 A;  4PI3 A;  1QMY A;  2XU3 A;  1AYV A;  1PBH A;  4I05 A;  2P0R A;  3H8C A;  2AUZ A;  4MZO A;  4G54 A;  3B79 A;  4N79 A;  1IWD A;  1PAD A;  4BGF A;  1FH0 A;  3S3R A;  3BCN A;  3IV2 A;  2E00 A;  2O6X A;  5K16 A;  3HHI A;  2ARY A;  1XKG A;  1CJL A;  4FIP A;  3U8E A;  4GUZ A;  2JQG R;  4KLB A;  1YVB A;  4MSX A;  3H7D A;  1AU4 A;  2PNS A;  3O1G A;  4ZUX U;  1EWO A;  2R9O A;  3KX1 A;  4QH6 A;  2P7U A;  2FQ9 A;  1E2T A;  1SNK A;  2FTD A;  2G8J A;  3H6S A;  3F75 A;  3OVX A;  2FUD A;  2ATO A;  1MS6 A;  3IEJ A;  3OF9 A;  2CIO A;  4I04 A;  1NB3 A;  1YK8 A;  2AUX A;  1DF0 A;  3V6C A;  1MHW A;  1ITO A;  4X6I A;  3RVX A;  2WBF X;  9PAP A;  2DCC A;  4PP1 A;  5PAD A;  1PXV A;  3MHH A;  2E02 A;  2G7Y A;  1F29 A;  2VHF A;  2DCD A;  3BWK A;  3P5U A;  4FJC A;  4BSQ A;  1NQC A;  3V6E A;  5EF4 A;  3RVW A;  5CVO B;  1CV8 A;  3PDF A;  1KXR A;  4C5P A;  1HUC B;  2JQF R;  3QT4 A;  2FO5 A;  3NHE A;  4Q8G A;  2XU1 A;  5CHV A;  2H7J A;  4OEM A;  1ICF A;  3ZUA A;  1Y08 A;  4W5B A;  3O0U A;  4WA6 A;  2GHU A;  4QRX A;  2AVW A;  2BSZ A;  3CBJ A;  4YYS A;  3CH2 X;  2DJG B;  2P86 A;  1KFX L;  3IMA A;  2R9M A;  3HWN A;  2YJ8 A;  1EWP A;  3WXF A;  1W4T A;  3H89 A;  2AIM A;  2E01 A;  1CS8 A;  3OVZ A;  4BS5 A;  4I07 A;  5CVM A;  1CQD A;  1TL9 A;  3H8B A;  2R9F A;  1MDW A;  4X6J A;  2DZY A;  1F2C A;  5CHT A;  1ATK A;  4BS6 A;  3IOQ A;  1QOL A;  1THE A;  3P5W A;  1GX3 A;  3P5V A;  3D6S A;  3M99 A;  3MHS A;  3RVV A;  1O0E A;  2VFB A;  1U9Q X;  2CB5 A;  2BDZ A;  2VFC A;  3HHA A;  1Q6K A;  1AIM A;  3MOR A;  1CTE A;  4Q8H A;  1DEU A;  3AI8 A;  1A6R A;  4YV8 A;  1JQP A;  2NQG A;  2AS8 A;  1Y4H A;  3IUT A;  1PPD A;  4XUI A;  1F2B A;  3BPM A;  1GCB A;  4PAD A;  1PIP A;  3P5X A;  3BC3 A;  4AXM A;  4PP2 E;  1KHQ A;  1CVZ A;  1PPP A;  3TNX A;  4P6G A;  4DMX A;  1MEM A;  2YJ2 A;  2DC9 A;  2G8E A;  4W4U A;  1BP4 A;  1TLO A;  3GCB A;  4CDF B;  1W6F A;  1MEG A;  2NQD B;  1K3B B;  1M6D A;  2NQA A;  3N3K A;  3WXE A;  2ACT A;  1PCI A;  5CVN B;  2G6D A;  3BOW A;  1CPJ A;  4B55 A;  3F5V A;  3S3Q A;  4CDD B;  4YYU A;  1ME4 A;  3KFQ A;  3PW3 A;  2HD5 A;  2E03 A;  7PCK A;  1YAL A;  3C9E A;  4YYR A;  1POP A;  1NPZ A;  2VHS A;  2IBI A;  2YJB A;  5EGW A;  2GFO A;  3N3G A;  1AYW A;  1X9Y A;  3LFY A;  1EWM A;  1S4V A;  3CH3 X;  3HD3 A;  1VSN A;  3CBK A;  3QSD A;  2PBH A;  1PE6 A;  1EF7 A;  1SP4 B;  2FRQ A;  1AYU A;  8PCH A;  1STF E;  1GLO A;  2Y5B A;  4QBB A;  2YJC A;  4N4Z A;  5JH3 A;  1BY8 A;  4P6E A;  1CSB B;  2HH5 A;  3K9M A;  4NV8 A;  3KWB X;  2FRA A;  1CB5 A;  2FYE A;  1AU0 A;  4FK5 A;  2XU4 A;  6PAD A;  1NLJ A;  3K8U A;  1KFU L;  1EWL A;  2AYO A;  1BGO A;  3K24 A;  5JA7 A;  4W5C A;  4BQV A;  2R6N A;  1GMY A;  4QRG A;  4OEL A;  2F1G A;  2DC8 A;  1U9W A;  2DC7 A;  3KW9 A;  1U5I A;  3IHP A;  4QRV A;  5FPW A;  2OUL A;  1KHP A;  4YYV A;  3QJ3 A;  1U9V A;  4CZW A;  1YK7 A;  1ZIV A;  1MIR A;  4RY2 A;  3WXG A;  2DJF B;  2C0Y A;  4CDC B;  1AU3 A;  3D9W A;  4K7C A;  3LTW A;  2OZ2 A;  5F02 A;  1AEC A;  4YVA A;  2NQI A;  1QDQ A;  4AXL A;  2AU1 A;  2XU5 A;  2FT2 A;  1VJV A;  2DCA A;  1BQI A;  2R9N A;  3OIS A;  2HXZ A;  2AYN A;  3OF8 A;  3I06 A;  3USV A;  3PBH A;  3BPF A;  4XR7 A;  4BPV A;  2BDL A;  2HHN A;  1PPN A;  2B1M A;  2R9C A;  2YJ9 A;  4MZS A;  1NB5 A;  4HWY A;  4CDE B;  1F2A A;  2F7D A;  1NL6 A;  3PNR A;  4N8W A;  3KWZ A;  3I3T A;  1ME3 A;  3KKU A;  2DC6 A;  2Y6E A;  5J94 A;  2PRE A;  3ERV A;  4X6H A;  3KSE A;  3LXS A;  4YYW A;  1ZCM A;  1YT7 A;  2B1N A;  4YYQ A;  2DZZ A;  1GEC E;  4DMY A;  4NV7 A;  5A24 A;  1TU6 A;  2IPP B;  1PPO A;  1AU2 A;  3MTN A;  2PAD A;  3E1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...