2VHFA

Structure of the cyld usp domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
374
structure length
341
Chain Sequence
GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMAGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE CYLD
publication title The Structure of the Cyld Usp Domain Explains its Specificity for Lys63-Linked Polyubiquitin and Reveals a B-Box Module
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 341
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2vhfA00
1Q6KA 2E03A 4BS6A 3OF9A 4P6GA 2HD5A 4YYUA 1NQCA 4AXLA 2PNSA 1MS6A 1O0EA 4QRGA 2XU4A 1ME3A 1GCBA 1YVBA 2DC8A 1KHPA 3ERVA 3PW3A 4I05A 3BCNA 3DF0A 1XKGA 1ATKA 2OULA 1MHWA 4YYQA 2GFOA 2JQFR 1U9WA 5J94A 2DCDA 3BC3A 2CIOA 1AU3A 3BWKA 4PADA 3PNRA 5CVOB 3PDFA 5PADA 2FRQA 2PREA 5F02A 4QRXA 3V6CA 4YYWA 3RVVA 2F7DA 2R9CA 2NQGA 1AYWA 3BOWA 3K9MA 4Q8GA 4QBBA 4BSQA 1PBHA 3LXSA 1EWMA 1THEA 1ITOA 2G8JA 3WXEA 4I07A 3V6EA 3H6SA 2VHSA 3PBHA 1CS8A 5A24A 2H7JA 2XU3A 2OP3A 2AS8A 4CDFB 2C0YA 4FK5A 3O1GA 1A6RA 3HD3A 4ZUXU 1JQPA 3KSEA 5CVNB 2GHUA 2HH5A 4YYRA 1SNKA 2B1NA 3KWBX 3QT4A 4CDEB 3QJ3A 1GMYA 5EGWA 4N8WA 3I06A 3MHSA 1KHQA 1KFXL 2DC7A 2YJBA 1CJLA 3USVA 2HHNA 3H89A 1PCIA 1AU2A 1TL9A 1EF7A 3K24A 3KW9A 1IWDA 1AECA 1FH0A 2IPPB 1BY8A 3B79A 4XUIA 1CVZA 2FQ9A 2YJ8A 5K16A 3KFQA 2R9NA 1Y4HA 2JQGR 3LFYA 3IOQA 4CZWA 3IMAA 3CBJA 1PE6A 3CBKA 5CHTA 2DJFB 1HUCB 4BS5A 2ATOA 2FT2A 4MZSA 3OF8A 1CPJA 1AYUA 4MSXA 3GCBA 2FTDA 1PIPA 3F5VA 3N4CA 1MIRA 1DF0A 4YVAA 1KFUL 3BPMA 3MORA 2HXZA 2YJCA 2O6XA 3KKUA 3OVZA 2FO5A 1QDQA 3N3GA 3H7DA 1F2AA 1AYVA 2BDLA 3U8EA 3D6SA 4YV8A 4QH6A 4HWYA 1U9QX 2NQDB 1K3BB 3E1ZB 1MDWA 1F2BA 3P5VA 2ACTA 1EWPA 1CB5A 1YT7A 5FPWA 2DZYA 1NB3A 1NLJA 1BQIA 1M6DA 3HHAA 2P86A 1BGOA 3ZUAA 4W5BA 2DC6A 2NQAA 2DCCA 2F1GA 2G8EA 2E00A 3BPFA 4N79A 3NHEA 1YK7A 1YALA 9PAPA 8PCHA 3S3QA 1ME4A 1NB5A 2WBFX 2PBHA 4CDCB 1PXVA 4XR7A 2Y5BA 5CHVA 1CV8A 1VSNA 1ICFA 3H8BA 2CB5A 3IHPA 1AU0A 4FIPA 3RVWA 2DC9A 4YYVA 1PPOA 1X9YA 4Q8HA 4PP1A 1PPNA 4BQVA 2AVWA 2FYEA 1QXPA 4PP2E 2AYNA 4K7CA 1TU6A 2B1MA 4CDDB 1MEGA 2YJ9A 1F29A 2VHFA 1EWOA 4X6HA 2BDZA 5CVMA 2YJ2A 2AUXA 4X6IA 4BPVA 1TLOA 1QMYA 3OISA 2E02A 1EWLA 3S3RA 2G6DA 3P5UA 2XU5A 2R9MA 3M99A 4DMXA 3MTNA 7PCKA 1DEUA 1POPA 1U9XA 1CSBB 4G54A 2G7YA 2R6NA 4RY2A 4X6JA 2R9OA 1VJVA 3N3KA 1YK8A 3CH3X 3TNXA 2P0RA 5JA7A 3HWNA 2AYOA 1F2CA 2DCBA 4PI3A 3HHIA 3OVXA 3KX1A 2P7UA 1STFE 1NPZA 4DMYA 4OELA 2Y6EA 3WXFA 4P6EA 3MHHA 1PPPA 4W4UA 1SP4B 1S4VA 6PADA 1NL6A 4AXMA 3WXGA 1U5IA 1ZIVA 3I3TA 2DJGB 4YYSA 3IUTA 3P5WA 4I04A 2IBIA 4MZOA 3CH2X 1BP4A 5EF4A 2E01A 4FJCA 3AI8A 1AU4A 3P5XA 3K8UA 3O0UA 1U9VA 2PADA 2DZZA 1KXRA 1PPDA 3RVXA 4KLBA 4OEMA 2XU1A 2AUZA 1MEMA 4WA6A 4N4ZA 2ARYA 3IEJA 3QSDA 4W5CA 3KWZA 3F75A 2NQIA 3H8CA 4QRVA 2R9FA 1ZCMA 2AIMA 1CQDA 1AIMA 3IV2A 2FRAA 5JH3A 1GLOA 1PADA 2DCAA 2OZ2A 1CTEA 1QOLA 2FUDA 1GECE 1Y08A 3C9EA 2AU1A
chains in the Genus database with same CATH superfamily
1Q6KA 2E03A 4BS6A 3OF9A 4P6GA 4D8IA 2HD5A 4YYUA 1NQCA 4BOQA 3TMPA 4A5UA 4AXLA 4OW0A 2PNSA 1MS6A 1O0EA 3BY4A 4QRGA 3MTVA 2XU4A 1ME3A 1GCBA 1YVBA 2DC8A 3PHXA 1KHPA 3ERVA 3PW3A 4I05A 3BCNA 3DF0A 1XKGA 1ATKA 2JRIA 2OULA 1MHWA 4YYQA 2GFOA 2JQFR 1U9WA 5J94A 2DCDA 3BC3A 2CIOA 1AU3A 3BWKA 3MJ5A 3PSEA 4PADA 3PNRA 2HWKA 5CVOB 3PDFA 5PADA 2FRQA 2PREA 5F02A 4QRXA 3V6CA 4YYWA 3RVVA 2F7DA 2R9CA 3PT2A 2NQGA 3PRPA 1AYWA 3BOWA 3K9MA 4Q8GA 4QBBA 4BSQA 2Z84A 1PBHA 3LXSA 1EWMA 1THEA 1ITOA 2G8JA 3WXEA 4I07A 5JZEA 3V6EA 3H6SA 2VHSA 4OVZA 3PBHA 1CS8A 4IP3A 5A24A 2H7JA 2XU3A 4BOSA 2OP3A 2AS8A 4CDFB 2C0YA 4FK5A 3O1GA 1A6RA 3HD3A 4ZUXU 1PVJA 1JQPA 3KSEA 5CVNB 2GHUA 2HH5A 4YYRA 1SNKA 2B1NA 3KWBX 3QT4A 4CDEB 3BB7A 3QJ3A 1GMYA 5EGWA 4N8WA 3I06A 3MHSA 1KHQA 1KFXL 2DC7A 3PHUA 3ZNHA 2YJBA 4GUAA 4OVZB 1CJLA 3USVA 2HHNA 3H89A 1PCIA 1AU2A 1TL9A 1EF7A 3K24A 3KW9A 1IWDA 1AECA 1FH0A 3C0RA 2IPPB 1BY8A 3B79A 4XUIA 4ZTBA 1CVZA 2FQ9A 2YJ8A 5K16A 3KFQA 4WURA 2R9NA 1Y4HA 2JQGR 3LFYA 3IOQA 4CZWA 3IMAA 3CBJA 1PE6A 3CBKA 5CHTA 2DJFB 1HUCB 4BS5A 2ATOA 3W30A 1YZBA 3PHWA 2FT2A 4MZSA 3OF8A 1CPJA 1AYUA 4MSXA 3GCBA 2FTDA 1PIPA 3F5VA 2JTCA 3N4CA 1MIRA 1DF0A 4YVAA 1KFUL 3BPMA 3MORA 2HXZA 2YJCA 5EZSA 2O6XA 3KKUA 3OVZA 2FO5A 1QDQA 3N3GA 3H7DA 1F2AA 4BOUA 3TRKA 1AYVA 2BDLA 3U8EA 3D6SA 4YV8A 4QH6A 4HWYA 1U9QX 2NQDB 1K3BB 3E1ZB 1MDWA 1F2BA 3P5VA 2ACTA 1EWPA 1CB5A 1DKIA 1YT7A 5FPWA 2DZYA 1NB3A 1NLJA 1BQIA 1M6DA 3HHAA 2P86A 5EZQA 1BGOA 3ZUAA 4W5BA 2DC6A 2NQAA 2DCCA 2F1GA 4MI7A 2G8EA 3MP2A 2E00A 3BPFA 4N79A 3NHEA 1YK7A 4HXDB 4D8EA 3E9SA 1YALA 9PAPA 2DOSA 8PCHA 3S3QA 1ME4A 1NB5A 2BTWA 2WBFX 4RF0A 2PBHA 4CDCB 1PXVA 4P16A 4XR7A 2Y5BA 5CHVA 1CV8A 1VSNA 1ICFA 3OQCA 3H8BA 2CB5A 3IHPA 4D8BA 2UZJA 1AU0A 4FIPA 3RVWA 2DC9A 4YYVA 4BOZA 3RNVA 1PPOA 1X9YA 4Q8HA 4PP1A 1PPNA 4BQVA 3B21A 4RF1A 2AVWA 2FYEA 1QXPA 4PP2E 2AYNA 4K7CA 4REZA 1TU6A 2B1MA 4CDDB 2BU3A 1MEGA 2YJ9A 1F29A 2VHFA 1EWOA 4PT5A 4X6HA 2BDZA 5CVMA 2BTWB 2YJ2A 2AUXA 4X6IA 4BPVA 1TLOA 1QMYA 3OISA 2E02A 1EWLA 3S3RA 2G6DA 3P5UA 2XU5A 2R9MA 3BBAA 5E6JA 1UKFA 2J7QA 3M99A 4DMXA 3MTNA 7PCKA 1DEUA 1POPA 1U9XA 1CSBB 4G54A 2G7YA 2R6NA 4RY2A 2FE8A 4RNAA 4X6JA 2R9OA 1VJVA 3N3KA 3W31A 1YK8A 3CH3X 4XZXA 3TNXA 2P0RA 5JA7A 3HWNA 2AYOA 4M0WA 1F2CA 4BOPA 2DCBA 2J7QC 4PI3A 3HHIA 3OVXA 3KX1A 2P7UA 4R3DA 1STFE 1NPZA 4DMYA 3IFUA 4OELA 2Y6EA 3WXFA 4P6EA 3MHHA 1PPPA 4W4UA 1SP4B 1S4VA 6PADA 1NL6A 4AXMA 3WXGA 1U5IA 1ZIVA 3I3TA 2DJGB 2AGAA 4YYSA 3IUTA 3P5WA 4I04A 2IBIA 4MZOA 3CH2X 1BP4A 5EF4A 2E01A 4FJCA 3AI8A 4IUMA 1AU4A 3P5XA 3K8UA 3O0UA 1U9VA 2PADA 2DZZA 1KXRA 1PPDA 3RVXA 4KLBA 5KO3A 4OEMA 2XU1A 2AUZA 1MEMA 4WA6A 4N4ZA 3PRMA 2ARYA 3IEJA 3QSDA 4W5CA 3KWZA 3F75A 4MM3B 2NQIA 4RKXA 3H8CA 3O65A 4QRVA 2R9FA 1ZCMA 2AIMA 1CQDA 1AIMA 3IV2A 2FRAA 5JH3A 1GLOA 1PADA 2DCAA 2OZ2A 1CTEA 1QOLA 2FUDA 1GECE 1Y08A 3C9EA 2AU1A
chains in the Genus database with same CATH topology
1Q6KA 2E03A 4BS6A 2VFCA 3OF9A 4P6GA 2HD5A 4YYUA 1NQCA 4AXLA 2PNSA 1MS6A 1O0EA 4QRGA 2XU4A 1ME3A 1GCBA 1YVBA 2DC8A 1KHPA 3ERVA 3PW3A 4I05A 3BCNA 3DF0A 1XKGA 1ATKA 2OULA 1MHWA 4YYQA 2GFOA 2JQFR 1U9WA 5J94A 2DCDA 1GX3A 2CIOA 3BC3A 1AU3A 3BWKA 4PADA 3PNRA 5CVOB 3PDFA 5PADA 2FRQA 2PREA 5F02A 4QRXA 3V6CA 4YYWA 3RVVA 2F7DA 2R9CA 2NQGA 1AYWA 3BOWA 3K9MA 4Q8GA 4QBBA 4GUZA 4BSQA 1PBHA 3LXSA 1EWMA 1THEA 1ITOA 2G8JA 3WXEA 4I07A 3V6EA 3H6SA 2VHSA 3PBHA 1CS8A 5A24A 2H7JA 2XU3A 2OP3A 2AS8A 4CDFB 2C0YA 4FK5A 3O1GA 1A6RA 3HD3A 4ZUXU 1JQPA 3KSEA 5CVNB 2GHUA 2HH5A 1W6FA 4YYRA 1SNKA 2B1NA 3KWBX 3QT4A 4CDEB 2BSZA 1W4TA 1GMYA 3QJ3A 5EGWA 4N8WA 3I06A 3MHSA 1KHQA 1KFXL 2DC7A 2YJBA 3D9WA 1CJLA 3USVA 2HHNA 3H89A 1PCIA 1AU2A 1TL9A 1EF7A 1E2TA 3K24A 3KW9A 1IWDA 1AECA 1FH0A 2IPPB 1BY8A 3B79A 4XUIA 1CVZA 2FQ9A 2YJ8A 5K16A 3KFQA 2R9NA 1Y4HA 2JQGR 3LFYA 3IOQA 4CZWA 3IMAA 3CBJA 1PE6A 3CBKA 5CHTA 2DJFB 1HUCB 4BS5A 2ATOA 3LTWA 2FT2A 4MZSA 3OF8A 1CPJA 1AYUA 4MSXA 4NV8A 3GCBA 2FTDA 1PIPA 3F5VA 3N4CA 1MIRA 1DF0A 4YVAA 1KFUL 3BPMA 3MORA 2HXZA 2YJCA 2O6XA 3KKUA 3OVZA 2FO5A 1QDQA 3N3GA 3H7DA 1F2AA 1AYVA 2BDLA 3U8EA 3D6SA 4YV8A 4QH6A 4HWYA 1U9QX 2NQDB 1K3BB 4B55A 3E1ZB 4BGFA 1MDWA 1F2BA 3P5VA 2ACTA 1EWPA 1CB5A 1YT7A 5FPWA 2DZYA 1NB3A 1NLJA 1BQIA 1M6DA 3HHAA 2P86A 1BGOA 3ZUAA 4W5BA 2DC6A 2NQAA 2DCCA 2F1GA 2G8EA 2E00A 3BPFA 4N79A 3NHEA 1YK7A 1YALA 9PAPA 8PCHA 3S3QA 1ME4A 1NB5A 2WBFX 2PBHA 4CDCB 1PXVA 4XR7A 2Y5BA 5CHVA 1CV8A 1VSNA 1ICFA 3H8BA 2CB5A 3IHPA 1AU0A 4FIPA 3RVWA 2DC9A 4YYVA 1PPOA 1X9YA 4Q8HA 4PP1A 1PPNA 4BQVA 2AVWA 2FYEA 1QXPA 4PP2E 2AYNA 4K7CA 1TU6A 2B1MA 4CDDB 1MEGA 2YJ9A 1F29A 2VHFA 1EWOA 4X6HA 2BDZA 5CVMA 2YJ2A 2AUXA 4X6IA 4BPVA 1TLOA 1QMYA 3OISA 2E02A 1EWLA 3S3RA 2G6DA 3P5UA 2XU5A 2R9MA 4NV7A 3M99A 4DMXA 3MTNA 7PCKA 1DEUA 1POPA 2VFBA 1U9XA 1CSBB 4G54A 2G7YA 2R6NA 4RY2A 4X6JA 2R9OA 1VJVA 3N3KA 1YK8A 3CH3X 3TNXA 2P0RA 5JA7A 3HWNA 2AYOA 1F2CA 2DCBA 4PI3A 3HHIA 3OVXA 3KX1A 2P7UA 1STFE 1NPZA 4DMYA 4OELA 2Y6EA 3WXFA 4P6EA 3MHHA 1PPPA 4W4UA 1SP4B 1S4VA 6PADA 1NL6A 4AXMA 3WXGA 1U5IA 1ZIVA 3I3TA 2DJGB 4YYSA 3IUTA 3P5WA 4I04A 2IBIA 4MZOA 3CH2X 1BP4A 5EF4A 2E01A 4FJCA 3AI8A 1AU4A 3P5XA 3K8UA 3O0UA 1U9VA 1W5RA 2PADA 2DZZA 1KXRA 1PPDA 3RVXA 4KLBA 4OEMA 2XU1A 2AUZA 1MEMA 4WA6A 4N4ZA 2ARYA 3IEJA 3QSDA 4W5CA 3KWZA 3F75A 4C5PA 2NQIA 3H8CA 4QRVA 2R9FA 1ZCMA 2AIMA 1CQDA 1AIMA 3IV2A 2FRAA 5JH3A 1GLOA 1PADA 2DCAA 2OZ2A 1CTEA 1QOLA 2FUDA 1GECE 1Y08A 3C9EA 2AU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6K A;  2E03 A;  4BS6 A;  3OF9 A;  4P6G A;  2HD5 A;  4YYU A;  1NQC A;  4AXL A;  2PNS A;  1MS6 A;  1O0E A;  4QRG A;  2XU4 A;  1ME3 A;  1GCB A;  1YVB A;  2DC8 A;  1KHP A;  3ERV A;  3PW3 A;  4I05 A;  3BCN A;  3DF0 A;  1XKG A;  1ATK A;  2OUL A;  1MHW A;  4YYQ A;  2GFO A;  2JQF R;  1U9W A;  5J94 A;  2DCD A;  3BC3 A;  2CIO A;  1AU3 A;  3BWK A;  4PAD A;  3PNR A;  5CVO B;  3PDF A;  5PAD A;  2FRQ A;  2PRE A;  5F02 A;  4QRX A;  3V6C A;  4YYW A;  3RVV A;  2F7D A;  2R9C A;  2NQG A;  1AYW A;  3BOW A;  3K9M A;  4Q8G A;  4QBB A;  4BSQ A;  1PBH A;  3LXS A;  1EWM A;  1THE A;  1ITO A;  2G8J A;  3WXE A;  4I07 A;  3V6E A;  3H6S A;  2VHS A;  3PBH A;  1CS8 A;  5A24 A;  2H7J A;  2XU3 A;  2OP3 A;  2AS8 A;  4CDF B;  2C0Y A;  4FK5 A;  3O1G A;  1A6R A;  3HD3 A;  4ZUX U;  1JQP A;  3KSE A;  5CVN B;  2GHU A;  2HH5 A;  4YYR A;  1SNK A;  2B1N A;  3KWB X;  3QT4 A;  4CDE B;  3QJ3 A;  1GMY A;  5EGW A;  4N8W A;  3I06 A;  3MHS A;  1KHQ A;  1KFX L;  2DC7 A;  2YJB A;  1CJL A;  3USV A;  2HHN A;  3H89 A;  1PCI A;  1AU2 A;  1TL9 A;  1EF7 A;  3K24 A;  3KW9 A;  1IWD A;  1AEC A;  1FH0 A;  2IPP B;  1BY8 A;  3B79 A;  4XUI A;  1CVZ A;  2FQ9 A;  2YJ8 A;  5K16 A;  3KFQ A;  2R9N A;  1Y4H A;  2JQG R;  3LFY A;  3IOQ A;  4CZW A;  3IMA A;  3CBJ A;  1PE6 A;  3CBK A;  5CHT A;  2DJF B;  1HUC B;  4BS5 A;  2ATO A;  2FT2 A;  4MZS A;  3OF8 A;  1CPJ A;  1AYU A;  4MSX A;  3GCB A;  2FTD A;  1PIP A;  3F5V A;  3N4C A;  1MIR A;  1DF0 A;  4YVA A;  1KFU L;  3BPM A;  3MOR A;  2HXZ A;  2YJC A;  2O6X A;  3KKU A;  3OVZ A;  2FO5 A;  1QDQ A;  3N3G A;  3H7D A;  1F2A A;  1AYV A;  2BDL A;  3U8E A;  3D6S A;  4YV8 A;  4QH6 A;  4HWY A;  1U9Q X;  2NQD B;  1K3B B;  3E1Z B;  1MDW A;  1F2B A;  3P5V A;  2ACT A;  1EWP A;  1CB5 A;  1YT7 A;  5FPW A;  2DZY A;  1NB3 A;  1NLJ A;  1BQI A;  1M6D A;  3HHA A;  2P86 A;  1BGO A;  3ZUA A;  4W5B A;  2DC6 A;  2NQA A;  2DCC A;  2F1G A;  2G8E A;  2E00 A;  3BPF A;  4N79 A;  3NHE A;  1YK7 A;  1YAL A;  9PAP A;  8PCH A;  3S3Q A;  1ME4 A;  1NB5 A;  2WBF X;  2PBH A;  4CDC B;  1PXV A;  4XR7 A;  2Y5B A;  5CHV A;  1CV8 A;  1VSN A;  1ICF A;  3H8B A;  2CB5 A;  3IHP A;  1AU0 A;  4FIP A;  3RVW A;  2DC9 A;  4YYV A;  1PPO A;  1X9Y A;  4Q8H A;  4PP1 A;  1PPN A;  4BQV A;  2AVW A;  2FYE A;  1QXP A;  4PP2 E;  2AYN A;  4K7C A;  1TU6 A;  2B1M A;  4CDD B;  1MEG A;  2YJ9 A;  1F29 A;  2VHF A;  1EWO A;  4X6H A;  2BDZ A;  5CVM A;  2YJ2 A;  2AUX A;  4X6I A;  4BPV A;  1TLO A;  1QMY A;  3OIS A;  2E02 A;  1EWL A;  3S3R A;  2G6D A;  3P5U A;  2XU5 A;  2R9M A;  3M99 A;  4DMX A;  3MTN A;  7PCK A;  1DEU A;  1POP A;  1U9X A;  1CSB B;  4G54 A;  2G7Y A;  2R6N A;  4RY2 A;  4X6J A;  2R9O A;  1VJV A;  3N3K A;  1YK8 A;  3CH3 X;  3TNX A;  2P0R A;  5JA7 A;  3HWN A;  2AYO A;  1F2C A;  2DCB A;  4PI3 A;  3HHI A;  3OVX A;  3KX1 A;  2P7U A;  1STF E;  1NPZ A;  4DMY A;  4OEL A;  2Y6E A;  3WXF A;  4P6E A;  3MHH A;  1PPP A;  4W4U A;  1SP4 B;  1S4V A;  6PAD A;  1NL6 A;  4AXM A;  3WXG A;  1U5I A;  1ZIV A;  3I3T A;  2DJG B;  4YYS A;  3IUT A;  3P5W A;  4I04 A;  2IBI A;  4MZO A;  3CH2 X;  1BP4 A;  5EF4 A;  2E01 A;  4FJC A;  3AI8 A;  1AU4 A;  3P5X A;  3K8U A;  3O0U A;  1U9V A;  2PAD A;  2DZZ A;  1KXR A;  1PPD A;  3RVX A;  4KLB A;  4OEM A;  2XU1 A;  2AUZ A;  1MEM A;  4WA6 A;  4N4Z A;  2ARY A;  3IEJ A;  3QSD A;  4W5C A;  3KWZ A;  3F75 A;  2NQI A;  3H8C A;  4QRV A;  2R9F A;  1ZCM A;  2AIM A;  1CQD A;  1AIM A;  3IV2 A;  2FRA A;  5JH3 A;  1GLO A;  1PAD A;  2DCA A;  2OZ2 A;  1CTE A;  1QOL A;  2FUD A;  1GEC E;  1Y08 A;  3C9E A;  2AU1 A; 
#chains in the Genus database with same CATH topology
 1Q6K A;  2E03 A;  4BS6 A;  3OF9 A;  4P6G A;  4D8I A;  2HD5 A;  4YYU A;  1NQC A;  4BOQ A;  3TMP A;  4A5U A;  4AXL A;  4OW0 A;  2PNS A;  1MS6 A;  1O0E A;  3BY4 A;  4QRG A;  3MTV A;  2XU4 A;  1ME3 A;  1GCB A;  1YVB A;  2DC8 A;  3PHX A;  1KHP A;  3ERV A;  3PW3 A;  4I05 A;  3BCN A;  3DF0 A;  1XKG A;  1ATK A;  2JRI A;  2OUL A;  1MHW A;  4YYQ A;  2GFO A;  2JQF R;  1U9W A;  5J94 A;  2DCD A;  3BC3 A;  2CIO A;  1AU3 A;  3BWK A;  3MJ5 A;  3PSE A;  4PAD A;  3PNR A;  2HWK A;  5CVO B;  3PDF A;  5PAD A;  2FRQ A;  2PRE A;  5F02 A;  4QRX A;  3V6C A;  4YYW A;  3RVV A;  2F7D A;  2R9C A;  3PT2 A;  2NQG A;  3PRP A;  1AYW A;  3BOW A;  3K9M A;  4Q8G A;  4QBB A;  4BSQ A;  2Z84 A;  1PBH A;  3LXS A;  1EWM A;  1THE A;  1ITO A;  2G8J A;  3WXE A;  4I07 A;  5JZE A;  3V6E A;  3H6S A;  2VHS A;  4OVZ A;  3PBH A;  1CS8 A;  4IP3 A;  5A24 A;  2H7J A;  2XU3 A;  4BOS A;  2OP3 A;  2AS8 A;  4CDF B;  2C0Y A;  4FK5 A;  3O1G A;  1A6R A;  3HD3 A;  4ZUX U;  1PVJ A;  1JQP A;  3KSE A;  5CVN B;  2GHU A;  2HH5 A;  4YYR A;  1SNK A;  2B1N A;  3KWB X;  3QT4 A;  4CDE B;  3BB7 A;  3QJ3 A;  1GMY A;  5EGW A;  4N8W A;  3I06 A;  3MHS A;  1KHQ A;  1KFX L;  2DC7 A;  3PHU A;  3ZNH A;  2YJB A;  4GUA A;  4OVZ B;  1CJL A;  3USV A;  2HHN A;  3H89 A;  1PCI A;  1AU2 A;  1TL9 A;  1EF7 A;  3K24 A;  3KW9 A;  1IWD A;  1AEC A;  1FH0 A;  3C0R A;  2IPP B;  1BY8 A;  3B79 A;  4XUI A;  4ZTB A;  1CVZ A;  2FQ9 A;  2YJ8 A;  5K16 A;  3KFQ A;  4WUR A;  2R9N A;  1Y4H A;  2JQG R;  3LFY A;  3IOQ A;  4CZW A;  3IMA A;  3CBJ A;  1PE6 A;  3CBK A;  5CHT A;  2DJF B;  1HUC B;  4BS5 A;  2ATO A;  3W30 A;  1YZB A;  3PHW A;  2FT2 A;  4MZS A;  3OF8 A;  1CPJ A;  1AYU A;  4MSX A;  3GCB A;  2FTD A;  1PIP A;  3F5V A;  2JTC A;  3N4C A;  1MIR A;  1DF0 A;  4YVA A;  1KFU L;  3BPM A;  3MOR A;  2HXZ A;  2YJC A;  5EZS A;  2O6X A;  3KKU A;  3OVZ A;  2FO5 A;  1QDQ A;  3N3G A;  3H7D A;  1F2A A;  4BOU A;  3TRK A;  1AYV A;  2BDL A;  3U8E A;  3D6S A;  4YV8 A;  4QH6 A;  4HWY A;  1U9Q X;  2NQD B;  1K3B B;  3E1Z B;  1MDW A;  1F2B A;  3P5V A;  2ACT A;  1EWP A;  1CB5 A;  1DKI A;  1YT7 A;  5FPW A;  2DZY A;  1NB3 A;  1NLJ A;  1BQI A;  1M6D A;  3HHA A;  2P86 A;  5EZQ A;  1BGO A;  3ZUA A;  4W5B A;  2DC6 A;  2NQA A;  2DCC A;  2F1G A;  4MI7 A;  2G8E A;  3MP2 A;  2E00 A;  3BPF A;  4N79 A;  3NHE A;  1YK7 A;  4HXD B;  4D8E A;  3E9S A;  1YAL A;  9PAP A;  2DOS A;  8PCH A;  3S3Q A;  1ME4 A;  1NB5 A;  2BTW A;  2WBF X;  4RF0 A;  2PBH A;  4CDC B;  1PXV A;  4P16 A;  4XR7 A;  2Y5B A;  5CHV A;  1CV8 A;  1VSN A;  1ICF A;  3OQC A;  3H8B A;  2CB5 A;  3IHP A;  4D8B A;  2UZJ A;  1AU0 A;  4FIP A;  3RVW A;  2DC9 A;  4YYV A;  4BOZ A;  3RNV A;  1PPO A;  1X9Y A;  4Q8H A;  4PP1 A;  1PPN A;  4BQV A;  3B21 A;  4RF1 A;  2AVW A;  2FYE A;  1QXP A;  4PP2 E;  2AYN A;  4K7C A;  4REZ A;  1TU6 A;  2B1M A;  4CDD B;  2BU3 A;  1MEG A;  2YJ9 A;  1F29 A;  2VHF A;  1EWO A;  4PT5 A;  4X6H A;  2BDZ A;  5CVM A;  2BTW B;  2YJ2 A;  2AUX A;  4X6I A;  4BPV A;  1TLO A;  1QMY A;  3OIS A;  2E02 A;  1EWL A;  3S3R A;  2G6D A;  3P5U A;  2XU5 A;  2R9M A;  3BBA A;  5E6J A;  1UKF A;  2J7Q A;  3M99 A;  4DMX A;  3MTN A;  7PCK A;  1DEU A;  1POP A;  1U9X A;  1CSB B;  4G54 A;  2G7Y A;  2R6N A;  4RY2 A;  2FE8 A;  4RNA A;  4X6J A;  2R9O A;  1VJV A;  3N3K A;  3W31 A;  1YK8 A;  3CH3 X;  4XZX A;  3TNX A;  2P0R A;  5JA7 A;  3HWN A;  2AYO A;  4M0W A;  1F2C A;  4BOP A;  2DCB A;  2J7Q C;  4PI3 A;  3HHI A;  3OVX A;  3KX1 A;  2P7U A;  4R3D A;  1STF E;  1NPZ A;  4DMY A;  3IFU A;  4OEL A;  2Y6E A;  3WXF A;  4P6E A;  3MHH A;  1PPP A;  4W4U A;  1SP4 B;  1S4V A;  6PAD A;  1NL6 A;  4AXM A;  3WXG A;  1U5I A;  1ZIV A;  3I3T A;  2DJG B;  2AGA A;  4YYS A;  3IUT A;  3P5W A;  4I04 A;  2IBI A;  4MZO A;  3CH2 X;  1BP4 A;  5EF4 A;  2E01 A;  4FJC A;  3AI8 A;  4IUM A;  1AU4 A;  3P5X A;  3K8U A;  3O0U A;  1U9V A;  2PAD A;  2DZZ A;  1KXR A;  1PPD A;  3RVX A;  4KLB A;  5KO3 A;  4OEM A;  2XU1 A;  2AUZ A;  1MEM A;  4WA6 A;  4N4Z A;  3PRM A;  2ARY A;  3IEJ A;  3QSD A;  4W5C A;  3KWZ A;  3F75 A;  4MM3 B;  2NQI A;  4RKX A;  3H8C A;  3O65 A;  4QRV A;  2R9F A;  1ZCM A;  2AIM A;  1CQD A;  1AIM A;  3IV2 A;  2FRA A;  5JH3 A;  1GLO A;  1PAD A;  2DCA A;  2OZ2 A;  1CTE A;  1QOL A;  2FUD A;  1GEC E;  1Y08 A;  3C9E A;  2AU1 A; 
#chains in the Genus database with same CATH homology
 1Q6K A;  2E03 A;  4BS6 A;  2VFC A;  3OF9 A;  4P6G A;  2HD5 A;  4YYU A;  1NQC A;  4AXL A;  2PNS A;  1MS6 A;  1O0E A;  4QRG A;  2XU4 A;  1ME3 A;  1GCB A;  1YVB A;  2DC8 A;  1KHP A;  3ERV A;  3PW3 A;  4I05 A;  3BCN A;  3DF0 A;  1XKG A;  1ATK A;  2OUL A;  1MHW A;  4YYQ A;  2GFO A;  2JQF R;  1U9W A;  5J94 A;  2DCD A;  1GX3 A;  2CIO A;  3BC3 A;  1AU3 A;  3BWK A;  4PAD A;  3PNR A;  5CVO B;  3PDF A;  5PAD A;  2FRQ A;  2PRE A;  5F02 A;  4QRX A;  3V6C A;  4YYW A;  3RVV A;  2F7D A;  2R9C A;  2NQG A;  1AYW A;  3BOW A;  3K9M A;  4Q8G A;  4QBB A;  4GUZ A;  4BSQ A;  1PBH A;  3LXS A;  1EWM A;  1THE A;  1ITO A;  2G8J A;  3WXE A;  4I07 A;  3V6E A;  3H6S A;  2VHS A;  3PBH A;  1CS8 A;  5A24 A;  2H7J A;  2XU3 A;  2OP3 A;  2AS8 A;  4CDF B;  2C0Y A;  4FK5 A;  3O1G A;  1A6R A;  3HD3 A;  4ZUX U;  1JQP A;  3KSE A;  5CVN B;  2GHU A;  2HH5 A;  1W6F A;  4YYR A;  1SNK A;  2B1N A;  3KWB X;  3QT4 A;  4CDE B;  2BSZ A;  1W4T A;  1GMY A;  3QJ3 A;  5EGW A;  4N8W A;  3I06 A;  3MHS A;  1KHQ A;  1KFX L;  2DC7 A;  2YJB A;  3D9W A;  1CJL A;  3USV A;  2HHN A;  3H89 A;  1PCI A;  1AU2 A;  1TL9 A;  1EF7 A;  1E2T A;  3K24 A;  3KW9 A;  1IWD A;  1AEC A;  1FH0 A;  2IPP B;  1BY8 A;  3B79 A;  4XUI A;  1CVZ A;  2FQ9 A;  2YJ8 A;  5K16 A;  3KFQ A;  2R9N A;  1Y4H A;  2JQG R;  3LFY A;  3IOQ A;  4CZW A;  3IMA A;  3CBJ A;  1PE6 A;  3CBK A;  5CHT A;  2DJF B;  1HUC B;  4BS5 A;  2ATO A;  3LTW A;  2FT2 A;  4MZS A;  3OF8 A;  1CPJ A;  1AYU A;  4MSX A;  4NV8 A;  3GCB A;  2FTD A;  1PIP A;  3F5V A;  3N4C A;  1MIR A;  1DF0 A;  4YVA A;  1KFU L;  3BPM A;  3MOR A;  2HXZ A;  2YJC A;  2O6X A;  3KKU A;  3OVZ A;  2FO5 A;  1QDQ A;  3N3G A;  3H7D A;  1F2A A;  1AYV A;  2BDL A;  3U8E A;  3D6S A;  4YV8 A;  4QH6 A;  4HWY A;  1U9Q X;  2NQD B;  1K3B B;  4B55 A;  3E1Z B;  4BGF A;  1MDW A;  1F2B A;  3P5V A;  2ACT A;  1EWP A;  1CB5 A;  1YT7 A;  5FPW A;  2DZY A;  1NB3 A;  1NLJ A;  1BQI A;  1M6D A;  3HHA A;  2P86 A;  1BGO A;  3ZUA A;  4W5B A;  2DC6 A;  2NQA A;  2DCC A;  2F1G A;  2G8E A;  2E00 A;  3BPF A;  4N79 A;  3NHE A;  1YK7 A;  1YAL A;  9PAP A;  8PCH A;  3S3Q A;  1ME4 A;  1NB5 A;  2WBF X;  2PBH A;  4CDC B;  1PXV A;  4XR7 A;  2Y5B A;  5CHV A;  1CV8 A;  1VSN A;  1ICF A;  3H8B A;  2CB5 A;  3IHP A;  1AU0 A;  4FIP A;  3RVW A;  2DC9 A;  4YYV A;  1PPO A;  1X9Y A;  4Q8H A;  4PP1 A;  1PPN A;  4BQV A;  2AVW A;  2FYE A;  1QXP A;  4PP2 E;  2AYN A;  4K7C A;  1TU6 A;  2B1M A;  4CDD B;  1MEG A;  2YJ9 A;  1F29 A;  2VHF A;  1EWO A;  4X6H A;  2BDZ A;  5CVM A;  2YJ2 A;  2AUX A;  4X6I A;  4BPV A;  1TLO A;  1QMY A;  3OIS A;  2E02 A;  1EWL A;  3S3R A;  2G6D A;  3P5U A;  2XU5 A;  2R9M A;  4NV7 A;  3M99 A;  4DMX A;  3MTN A;  7PCK A;  1DEU A;  1POP A;  2VFB A;  1U9X A;  1CSB B;  4G54 A;  2G7Y A;  2R6N A;  4RY2 A;  4X6J A;  2R9O A;  1VJV A;  3N3K A;  1YK8 A;  3CH3 X;  3TNX A;  2P0R A;  5JA7 A;  3HWN A;  2AYO A;  1F2C A;  2DCB A;  4PI3 A;  3HHI A;  3OVX A;  3KX1 A;  2P7U A;  1STF E;  1NPZ A;  4DMY A;  4OEL A;  2Y6E A;  3WXF A;  4P6E A;  3MHH A;  1PPP A;  4W4U A;  1SP4 B;  1S4V A;  6PAD A;  1NL6 A;  4AXM A;  3WXG A;  1U5I A;  1ZIV A;  3I3T A;  2DJG B;  4YYS A;  3IUT A;  3P5W A;  4I04 A;  2IBI A;  4MZO A;  3CH2 X;  1BP4 A;  5EF4 A;  2E01 A;  4FJC A;  3AI8 A;  1AU4 A;  3P5X A;  3K8U A;  3O0U A;  1U9V A;  1W5R A;  2PAD A;  2DZZ A;  1KXR A;  1PPD A;  3RVX A;  4KLB A;  4OEM A;  2XU1 A;  2AUZ A;  1MEM A;  4WA6 A;  4N4Z A;  2ARY A;  3IEJ A;  3QSD A;  4W5C A;  3KWZ A;  3F75 A;  4C5P A;  2NQI A;  3H8C A;  4QRV A;  2R9F A;  1ZCM A;  2AIM A;  1CQD A;  1AIM A;  3IV2 A;  2FRA A;  5JH3 A;  1GLO A;  1PAD A;  2DCA A;  2OZ2 A;  1CTE A;  1QOL A;  2FUD A;  1GEC E;  1Y08 A;  3C9E A;  2AU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...