2VHFA

Structure of the cyld usp domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
374
structure length
341
Chain Sequence
b'GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMAGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE CYLD
publication title The Structure of the Cyld Usp Domain Explains its Specificity for Lys63-Linked Polyubiquitin and Reveals a B-Box Module
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 341
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2vhfA00
4PADA 2HHNA 2VHSA 3MORA 1MDWA 2ACTA 5K16A 4QRVA 1U9WA 1VSNA 4CDDB 2WBFX 1F2CA 4PP1A 6PADA 4W5BA 3PBHA 4BS6A 4ZUXU 4XR7A 3AI8A 4YYRA 1O0EA 1POPA 1XKGA 3IUTA 2GHUA 4DMYA 2DCCA 1CS8A 4YVAA 2FQ9A 1Y08A 3N4CA 2DC7A 2DCAA 2XU3A 1S4VA 1BQIA 1CPJA 3WXEA 1NB3A 1PADA 3LFYA 1NB5A 3PNRA 3USVA 1EWPA 2YJ2A 4XUIA 4AXMA 2BDZA 1PPNA 2XU1A 2CIOA 1VJVA 1ME3A 4RY2A 2AUXA 2AU1A 2VHFA 4P6EA 2HH5A 2Y5BA 5JA7A 3BOWA 5A24A 1NQCA 1QMYA 1ZCMA 1M6DA 4YYUA 4FK5A 2DC8A 2G8JA 3P5WA 4YYWA 2C0YA 4YYVA 3CH2X 1Y4HA 4BQVA 3K9MA 1CSBB 3OVZA 4BPVA 3BCNA 1QXPA 1HUCB 4I05A 4YYQA 1TLOA 5FPWA 1PIPA 1AYUA 2OP3A 1GMYA 3KX1A 4MZSA 3ZUAA 1AU0A 2YJ9A 1YALA 1CQDA 1MEGA 2IPPB 2Y6EA 4CDFB 3K8UA 2NQDB 1ICFA 2AVWA 3QT4A 3H8CA 1SP4B 1CB5A 3P5VA 4X6IA 1PXVA 1SNKA 4W4UA 3S3RA 2JQGR 3N3GA 3H6SA 4MSXA 3TNXA 3H8BA 1BP4A 5CHVA 1EWOA 3O1GA 2R9OA 3I06A 3CH3X 2R9CA 1PBHA 4Q8HA 4Q8GA 1GCBA 2P0RA 1U9QX 4P6GA 5J94A 2B1NA 1CVZA 1JQPA 2FYEA 4QRXA 1IWDA 1U5IA 1F2AA 4K7CA 1X9YA 2JQFR 1TU6A 3MTNA 1EWMA 2E03A 4N4ZA 2PNSA 3HD3A 1GECE 1NL6A 2E02A 4OELA 3HHIA 1ZIVA 4QBBA 1GLOA 3C9EA 4PI3A 1MS6A 1CJLA 4FIPA 1K3BB 2E01A 1QDQA 3K24A 4G54A 1YK8A 1ME4A 5PADA 3BWKA 1MIRA 1AYWA 2ATOA 3H89A 3PW3A 1BGOA 2NQAA 3CBKA 1PPPA 5F02A 2R9NA 2DJFB 2AIMA 3N3KA 9PAPA 3E1ZB 2F7DA 4W5CA 4YV8A 4CDEB 1EF7A 3O0UA 2YJ8A 1CV8A 2ARYA 3I3TA 4HWYA 2OULA 1AYVA 2HD5A 5CVNB 2AYOA 2R6NA 1DEUA 2P86A 3H7DA 3BPFA 3RVVA 1CTEA 1YVBA 2G8EA 2H7JA 3RVWA 3PDFA 1FH0A 3BPMA 3B79A 4WA6A 1DF0A 4BS5A 2FO5A 3OISA 3MHSA 2G6DA 1Q6KA 4OEMA 1BY8A 3IOQA 3NHEA 4X6HA 2IBIA 5EF4A 3F5VA 1KXRA 2DZZA 3HHAA 4N8WA 8PCHA 3CBJA 1F29A 2DC6A 2AYNA 3KFQA 2FRAA 2OZ2A 3P5XA 3LXSA 4CZWA 2G7YA 3P5UA 1AU2A 1AIMA 2O6XA 2PBHA 1PPDA 3WXFA 3KSEA 3V6CA 4I07A 3IHPA 1QOLA 3IEJA 1ITOA 1ATKA 3KWZA 3IV2A 2AUZA 1A6RA 3HWNA 3OF8A 2E00A 1F2BA 3KW9A 4CDCB 1EWLA 3V6EA 2DC9A 3QJ3A 1AU3A 2FUDA 4AXLA 1AECA 2DZYA 3F75A 3KWBX 1KHQA 2F1GA 1U9VA 4QH6A 1TL9A 4DMXA 2PREA 4PP2E 4N79A 2XU4A 1NPZA 1KFXL 4MZOA 2XU5A 3M99A 3IMAA 1STFE 2CB5A 3QSDA 3S3QA 5CHTA 3WXGA 2R9FA 1PCIA 2FT2A 4YYSA 7PCKA 2AS8A 2FTDA 1YK7A 3KKUA 2GFOA 3RVXA 5EGWA 2DCBA 1PE6A 2HXZA 2R9MA 2NQGA 4I04A 2PADA 1KHPA 4FJCA 4QRGA 4KLBA 3ERVA 3D6SA 2FRQA 2BDLA 5CVOB 1MEMA 1THEA 3OF9A 4X6JA 2P7UA 3GCBA 2YJCA 1PPOA 1YT7A 3U8EA 2DCDA 5JH3A 2DJGB 4BSQA 2B1MA 3MHHA 3BC3A 1MHWA 1KFUL 1AU4A 5CVMA 1U9XA 3DF0A 2YJBA 2NQIA 3OVXA 1NLJA
chains in the Genus database with same CATH superfamily
3O65A 4MM3B 4RF1A 4PADA 2HHNA 2AGAA 1DKIA 2VHSA 3MORA 1MDWA 1YZBA 2ACTA 5K16A 4QRVA 1U9WA 1VSNA 4MI7A 4CDDB 2WBFX 1F2CA 4PP1A 6PADA 4W5BA 3PBHA 4BS6A 4ZUXU 4XR7A 3AI8A 4YYRA 1O0EA 1POPA 1XKGA 3IUTA 2GHUA 4DMYA 2DCCA 3B21A 1CS8A 4RNAA 2FQ9A 4YVAA 1Y08A 4D8BA 3N4CA 2DC7A 2DCAA 2XU3A 1S4VA 1BQIA 1CPJA 3WXEA 1NB3A 1PADA 3LFYA 1NB5A 3IFUA 3PNRA 3USVA 1EWPA 2YJ2A 4XUIA 4AXMA 2BDZA 1PPNA 2JTCA 2XU1A 2CIOA 1VJVA 1ME3A 4RY2A 2AUXA 2AU1A 2VHFA 4P6EA 2HH5A 2Y5BA 5JA7A 3BOWA 3RNVA 5A24A 1NQCA 4A5UA 1QMYA 1ZCMA 1M6DA 4YYUA 4FK5A 4BOUA 2DC8A 2G8JA 3P5WA 4YYWA 4ZTBA 2C0YA 4YYVA 3CH2X 5EZQA 1Y4HA 4BQVA 3K9MA 1CSBB 3OVZA 4IUMA 4BPVA 3BCNA 4BOQA 1QXPA 1HUCB 4I05A 4YYQA 5KO3A 1TLOA 5FPWA 1PIPA 1AYUA 2OP3A 1GMYA 3KX1A 4MZSA 4OVZB 3E9SA 3ZUAA 3BBAA 1AU0A 2YJ9A 1YALA 1CQDA 1MEGA 2IPPB 4GUAA 2Y6EA 4CDFB 3BB7A 2BTWA 3K8UA 2NQDB 1ICFA 2AVWA 3QT4A 3OQCA 3H8CA 1SP4B 4REZA 1CB5A 3P5VA 4X6IA 1PXVA 1SNKA 3MTVA 4W4UA 3S3RA 2JQGR 3N3GA 3H6SA 2BU3A 2DOSA 3MJ5A 2J7QA 4MSXA 3TNXA 3H8BA 1BP4A 4IP3A 5CHVA 1UKFA 1EWOA 3O1GA 2R9OA 3I06A 3CH3X 2R9CA 2UZJA 1PBHA 4Q8HA 3BY4A 4Q8GA 1GCBA 2P0RA 1U9QX 4P6GA 4XZXA 2FE8A 5J94A 2B1NA 1CVZA 1JQPA 3W30A 2HWKA 2FYEA 4QRXA 1IWDA 1U5IA 1F2AA 4K7CA 1X9YA 2JQFR 1TU6A 3MTNA 1EWMA 3TMPA 4BOSA 2E03A 4N4ZA 3W31A 2PNSA 3HD3A 1GECE 1NL6A 2E02A 4OELA 4P16A 3HHIA 1ZIVA 4QBBA 1GLOA 3C9EA 4PI3A 1MS6A 1CJLA 4FIPA 1K3BB 2E01A 1QDQA 3K24A 4G54A 1YK8A 1ME4A 5PADA 3BWKA 1MIRA 1AYWA 4PT5A 2ATOA 3TRKA 3H89A 3PW3A 1BGOA 2NQAA 3CBKA 1PPPA 5F02A 2R9NA 2DJFB 3MP2A 2AIMA 3N3KA 4D8EA 9PAPA 3E1ZB 2F7DA 4W5CA 4YV8A 4D8IA 4CDEB 1EF7A 3O0UA 2YJ8A 1CV8A 3ZNHA 2ARYA 3I3TA 4HWYA 2OULA 1AYVA 2HD5A 5CVNB 2AYOA 2R6NA 1DEUA 2P86A 5JZEA 3H7DA 3BPFA 3RVVA 1CTEA 1YVBA 4R3DA 2G8EA 2H7JA 2JRIA 3RVWA 3PDFA 1FH0A 3BPMA 3B79A 4WA6A 1DF0A 4BS5A 2FO5A 3OISA 3MHSA 1PVJA 2G6DA 4RKXA 3PSEA 1Q6KA 4OEMA 1BY8A 3IOQA 3NHEA 4X6HA 3PHXA 2IBIA 4BOZA 5EF4A 3C0RA 3F5VA 1KXRA 2DZZA 3HHAA 4N8WA 8PCHA 3CBJA 1F29A 2DC6A 2AYNA 3KFQA 2FRAA 2OZ2A 3P5XA 3LXSA 4CZWA 2G7YA 3P5UA 1AU2A 1AIMA 2O6XA 2PBHA 1PPDA 3WXFA 3KSEA 3PHUA 4OVZA 3V6CA 4BOPA 4I07A 3IHPA 1QOLA 3IEJA 1ITOA 1ATKA 3KWZA 3IV2A 2AUZA 1A6RA 3HWNA 3OF8A 2E00A 1F2BA 2BTWB 3KW9A 4CDCB 1EWLA 3V6EA 2DC9A 3QJ3A 1AU3A 2FUDA 4AXLA 3PT2A 1AECA 2DZYA 3F75A 3KWBX 1KHQA 2F1GA 1U9VA 4RF0A 4QH6A 1TL9A 4DMXA 2PREA 4PP2E 4N79A 2XU4A 1NPZA 1KFXL 3PRPA 4MZOA 2XU5A 3M99A 2Z84A 3IMAA 1STFE 2J7QC 2CB5A 3QSDA 4HXDB 3S3QA 5EZSA 5CHTA 3WXGA 2R9FA 1PCIA 2FT2A 4YYSA 7PCKA 2AS8A 2FTDA 1YK7A 3KKUA 2GFOA 4M0WA 3RVXA 5EGWA 2DCBA 1PE6A 2HXZA 3PRMA 2R9MA 3PHWA 2NQGA 4I04A 2PADA 1KHPA 4FJCA 4QRGA 4KLBA 3ERVA 3D6SA 2FRQA 2BDLA 5CVOB 1MEMA 1THEA 3OF9A 4X6JA 2P7UA 3GCBA 4OW0A 2YJCA 1PPOA 1YT7A 3U8EA 2DCDA 5JH3A 2DJGB 4BSQA 2B1MA 3MHHA 3BC3A 1MHWA 4WURA 5E6JA 1KFUL 1AU4A 5CVMA 1U9XA 3DF0A 2YJBA 2NQIA 3OVXA 1NLJA
chains in the Genus database with same CATH topology
4PADA 2HHNA 2VHSA 3MORA 1MDWA 2ACTA 5K16A 4QRVA 1U9WA 1VSNA 4CDDB 2WBFX 1F2CA 4PP1A 6PADA 4W5BA 3PBHA 4BS6A 4ZUXU 4XR7A 3AI8A 4YYRA 1O0EA 4BGFA 1POPA 1XKGA 3IUTA 2GHUA 4DMYA 2DCCA 1CS8A 4YVAA 2FQ9A 1Y08A 3N4CA 2DC7A 2DCAA 2XU3A 1S4VA 1BQIA 1CPJA 3WXEA 1NB3A 1PADA 3LFYA 1NB5A 3PNRA 3USVA 1EWPA 2YJ2A 4XUIA 4AXMA 2BDZA 1PPNA 2XU1A 2CIOA 1VJVA 1ME3A 4RY2A 4GUZA 2AUXA 2AU1A 2VHFA 4P6EA 2HH5A 2Y5BA 5JA7A 3BOWA 2VFBA 5A24A 1NQCA 1QMYA 1ZCMA 1M6DA 4YYUA 4FK5A 2DC8A 2G8JA 3P5WA 4YYWA 2C0YA 4YYVA 3CH2X 1Y4HA 4BQVA 3K9MA 1CSBB 3OVZA 4BPVA 3BCNA 1QXPA 1HUCB 4I05A 4YYQA 1W6FA 1TLOA 5FPWA 1PIPA 1AYUA 2OP3A 1GMYA 3KX1A 4MZSA 3ZUAA 1AU0A 2YJ9A 1YALA 1CQDA 1MEGA 2IPPB 2Y6EA 4CDFB 3K8UA 2NQDB 1ICFA 2AVWA 3QT4A 3H8CA 1SP4B 1CB5A 3P5VA 4X6IA 1PXVA 1SNKA 4W4UA 3S3RA 2JQGR 3N3GA 3H6SA 4MSXA 3TNXA 3H8BA 1BP4A 5CHVA 1EWOA 3O1GA 2R9OA 3I06A 3CH3X 2R9CA 1PBHA 4Q8HA 4Q8GA 1GCBA 2P0RA 1GX3A 1U9QX 4P6GA 5J94A 2B1NA 1CVZA 1JQPA 2FYEA 4QRXA 1IWDA 1U5IA 1F2AA 4K7CA 1X9YA 2JQFR 1TU6A 3MTNA 1EWMA 2E03A 4N4ZA 2PNSA 3HD3A 1GECE 1NL6A 2E02A 4OELA 3HHIA 1ZIVA 4QBBA 2VFCA 1GLOA 3C9EA 4PI3A 1MS6A 1CJLA 4FIPA 1K3BB 2E01A 1QDQA 3K24A 4G54A 1YK8A 1ME4A 5PADA 3BWKA 1MIRA 1AYWA 2ATOA 3H89A 3PW3A 1BGOA 2NQAA 3CBKA 1PPPA 5F02A 2R9NA 2DJFB 2AIMA 3N3KA 9PAPA 3E1ZB 2F7DA 4W5CA 4YV8A 4CDEB 1EF7A 3O0UA 2YJ8A 1CV8A 2ARYA 3I3TA 4HWYA 2OULA 1AYVA 2HD5A 5CVNB 2AYOA 2R6NA 1DEUA 2P86A 3H7DA 3BPFA 3RVVA 1CTEA 1YVBA 2G8EA 2H7JA 3RVWA 3PDFA 1FH0A 3BPMA 3B79A 4WA6A 1DF0A 4BS5A 2FO5A 3OISA 3MHSA 4NV7A 2G6DA 1Q6KA 4OEMA 1BY8A 3IOQA 3NHEA 4X6HA 2IBIA 5EF4A 3F5VA 1KXRA 2DZZA 3HHAA 4N8WA 8PCHA 3CBJA 1F29A 2DC6A 2AYNA 3KFQA 2FRAA 2OZ2A 3P5XA 4B55A 3LXSA 4CZWA 2G7YA 3P5UA 1AU2A 1AIMA 2O6XA 2PBHA 1W5RA 1PPDA 3WXFA 3KSEA 3V6CA 4I07A 3IHPA 1QOLA 3IEJA 1ITOA 1ATKA 3KWZA 3IV2A 2AUZA 1A6RA 3HWNA 3OF8A 2E00A 1F2BA 3KW9A 4CDCB 1EWLA 1E2TA 3V6EA 2DC9A 3QJ3A 1AU3A 2FUDA 4AXLA 1AECA 2DZYA 3F75A 3KWBX 1KHQA 2F1GA 1U9VA 4NV8A 4C5PA 4QH6A 1TL9A 4DMXA 2PREA 4PP2E 4N79A 1W4TA 2XU4A 1NPZA 1KFXL 4MZOA 2XU5A 3M99A 3IMAA 1STFE 2CB5A 3QSDA 3S3QA 5CHTA 3WXGA 2R9FA 3D9WA 1PCIA 2FT2A 4YYSA 7PCKA 2AS8A 2FTDA 1YK7A 3KKUA 2GFOA 3RVXA 5EGWA 2DCBA 1PE6A 2HXZA 2R9MA 2NQGA 4I04A 2PADA 1KHPA 4FJCA 4QRGA 4KLBA 3ERVA 3D6SA 2FRQA 2BDLA 5CVOB 1MEMA 1THEA 3OF9A 4X6JA 2P7UA 3GCBA 2YJCA 1PPOA 1YT7A 2BSZA 3U8EA 2DCDA 5JH3A 2DJGB 4BSQA 2B1MA 3MHHA 3BC3A 1MHWA 1KFUL 1AU4A 5CVMA 1U9XA 3DF0A 2YJBA 2NQIA 3OVXA 3LTWA 1NLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAD A;  2HHN A;  2VHS A;  3MOR A;  1MDW A;  2ACT A;  5K16 A;  4QRV A;  1U9W A;  1VSN A;  4CDD B;  2WBF X;  1F2C A;  4PP1 A;  6PAD A;  4W5B A;  3PBH A;  4BS6 A;  4ZUX U;  4XR7 A;  3AI8 A;  4YYR A;  1O0E A;  1POP A;  1XKG A;  3IUT A;  2GHU A;  4DMY A;  2DCC A;  1CS8 A;  4YVA A;  2FQ9 A;  1Y08 A;  3N4C A;  2DC7 A;  2DCA A;  2XU3 A;  1S4V A;  1BQI A;  1CPJ A;  3WXE A;  1NB3 A;  1PAD A;  3LFY A;  1NB5 A;  3PNR A;  3USV A;  1EWP A;  2YJ2 A;  4XUI A;  4AXM A;  2BDZ A;  1PPN A;  2XU1 A;  2CIO A;  1VJV A;  1ME3 A;  4RY2 A;  2AUX A;  2AU1 A;  2VHF A;  4P6E A;  2HH5 A;  2Y5B A;  5JA7 A;  3BOW A;  5A24 A;  1NQC A;  1QMY A;  1ZCM A;  1M6D A;  4YYU A;  4FK5 A;  2DC8 A;  2G8J A;  3P5W A;  4YYW A;  2C0Y A;  4YYV A;  3CH2 X;  1Y4H A;  4BQV A;  3K9M A;  1CSB B;  3OVZ A;  4BPV A;  3BCN A;  1QXP A;  1HUC B;  4I05 A;  4YYQ A;  1TLO A;  5FPW A;  1PIP A;  1AYU A;  2OP3 A;  1GMY A;  3KX1 A;  4MZS A;  3ZUA A;  1AU0 A;  2YJ9 A;  1YAL A;  1CQD A;  1MEG A;  2IPP B;  2Y6E A;  4CDF B;  3K8U A;  2NQD B;  1ICF A;  2AVW A;  3QT4 A;  3H8C A;  1SP4 B;  1CB5 A;  3P5V A;  4X6I A;  1PXV A;  1SNK A;  4W4U A;  3S3R A;  2JQG R;  3N3G A;  3H6S A;  4MSX A;  3TNX A;  3H8B A;  1BP4 A;  5CHV A;  1EWO A;  3O1G A;  2R9O A;  3I06 A;  3CH3 X;  2R9C A;  1PBH A;  4Q8H A;  4Q8G A;  1GCB A;  2P0R A;  1U9Q X;  4P6G A;  5J94 A;  2B1N A;  1CVZ A;  1JQP A;  2FYE A;  4QRX A;  1IWD A;  1U5I A;  1F2A A;  4K7C A;  1X9Y A;  2JQF R;  1TU6 A;  3MTN A;  1EWM A;  2E03 A;  4N4Z A;  2PNS A;  3HD3 A;  1GEC E;  1NL6 A;  2E02 A;  4OEL A;  3HHI A;  1ZIV A;  4QBB A;  1GLO A;  3C9E A;  4PI3 A;  1MS6 A;  1CJL A;  4FIP A;  1K3B B;  2E01 A;  1QDQ A;  3K24 A;  4G54 A;  1YK8 A;  1ME4 A;  5PAD A;  3BWK A;  1MIR A;  1AYW A;  2ATO A;  3H89 A;  3PW3 A;  1BGO A;  2NQA A;  3CBK A;  1PPP A;  5F02 A;  2R9N A;  2DJF B;  2AIM A;  3N3K A;  9PAP A;  3E1Z B;  2F7D A;  4W5C A;  4YV8 A;  4CDE B;  1EF7 A;  3O0U A;  2YJ8 A;  1CV8 A;  2ARY A;  3I3T A;  4HWY A;  2OUL A;  1AYV A;  2HD5 A;  5CVN B;  2AYO A;  2R6N A;  1DEU A;  2P86 A;  3H7D A;  3BPF A;  3RVV A;  1CTE A;  1YVB A;  2G8E A;  2H7J A;  3RVW A;  3PDF A;  1FH0 A;  3BPM A;  3B79 A;  4WA6 A;  1DF0 A;  4BS5 A;  2FO5 A;  3OIS A;  3MHS A;  2G6D A;  1Q6K A;  4OEM A;  1BY8 A;  3IOQ A;  3NHE A;  4X6H A;  2IBI A;  5EF4 A;  3F5V A;  1KXR A;  2DZZ A;  3HHA A;  4N8W A;  8PCH A;  3CBJ A;  1F29 A;  2DC6 A;  2AYN A;  3KFQ A;  2FRA A;  2OZ2 A;  3P5X A;  3LXS A;  4CZW A;  2G7Y A;  3P5U A;  1AU2 A;  1AIM A;  2O6X A;  2PBH A;  1PPD A;  3WXF A;  3KSE A;  3V6C A;  4I07 A;  3IHP A;  1QOL A;  3IEJ A;  1ITO A;  1ATK A;  3KWZ A;  3IV2 A;  2AUZ A;  1A6R A;  3HWN A;  3OF8 A;  2E00 A;  1F2B A;  3KW9 A;  4CDC B;  1EWL A;  3V6E A;  2DC9 A;  3QJ3 A;  1AU3 A;  2FUD A;  4AXL A;  1AEC A;  2DZY A;  3F75 A;  3KWB X;  1KHQ A;  2F1G A;  1U9V A;  4QH6 A;  1TL9 A;  4DMX A;  2PRE A;  4PP2 E;  4N79 A;  2XU4 A;  1NPZ A;  1KFX L;  4MZO A;  2XU5 A;  3M99 A;  3IMA A;  1STF E;  2CB5 A;  3QSD A;  3S3Q A;  5CHT A;  3WXG A;  2R9F A;  1PCI A;  2FT2 A;  4YYS A;  7PCK A;  2AS8 A;  2FTD A;  1YK7 A;  3KKU A;  2GFO A;  3RVX A;  5EGW A;  2DCB A;  1PE6 A;  2HXZ A;  2R9M A;  2NQG A;  4I04 A;  2PAD A;  1KHP A;  4FJC A;  4QRG A;  4KLB A;  3ERV A;  3D6S A;  2FRQ A;  2BDL A;  5CVO B;  1MEM A;  1THE A;  3OF9 A;  4X6J A;  2P7U A;  3GCB A;  2YJC A;  1PPO A;  1YT7 A;  3U8E A;  2DCD A;  5JH3 A;  2DJG B;  4BSQ A;  2B1M A;  3MHH A;  3BC3 A;  1MHW A;  1KFU L;  1AU4 A;  5CVM A;  1U9X A;  3DF0 A;  2YJB A;  2NQI A;  3OVX A;  1NLJ A; 
#chains in the Genus database with same CATH topology
 3O65 A;  4MM3 B;  4RF1 A;  4PAD A;  2HHN A;  2AGA A;  1DKI A;  2VHS A;  3MOR A;  1MDW A;  1YZB A;  2ACT A;  5K16 A;  4QRV A;  1U9W A;  1VSN A;  4MI7 A;  4CDD B;  2WBF X;  1F2C A;  4PP1 A;  6PAD A;  4W5B A;  3PBH A;  4BS6 A;  4ZUX U;  4XR7 A;  3AI8 A;  4YYR A;  1O0E A;  1POP A;  1XKG A;  3IUT A;  2GHU A;  4DMY A;  2DCC A;  3B21 A;  1CS8 A;  4RNA A;  2FQ9 A;  4YVA A;  1Y08 A;  4D8B A;  3N4C A;  2DC7 A;  2DCA A;  2XU3 A;  1S4V A;  1BQI A;  1CPJ A;  3WXE A;  1NB3 A;  1PAD A;  3LFY A;  1NB5 A;  3IFU A;  3PNR A;  3USV A;  1EWP A;  2YJ2 A;  4XUI A;  4AXM A;  2BDZ A;  1PPN A;  2JTC A;  2XU1 A;  2CIO A;  1VJV A;  1ME3 A;  4RY2 A;  2AUX A;  2AU1 A;  2VHF A;  4P6E A;  2HH5 A;  2Y5B A;  5JA7 A;  3BOW A;  3RNV A;  5A24 A;  1NQC A;  4A5U A;  1QMY A;  1ZCM A;  1M6D A;  4YYU A;  4FK5 A;  4BOU A;  2DC8 A;  2G8J A;  3P5W A;  4YYW A;  4ZTB A;  2C0Y A;  4YYV A;  3CH2 X;  5EZQ A;  1Y4H A;  4BQV A;  3K9M A;  1CSB B;  3OVZ A;  4IUM A;  4BPV A;  3BCN A;  4BOQ A;  1QXP A;  1HUC B;  4I05 A;  4YYQ A;  5KO3 A;  1TLO A;  5FPW A;  1PIP A;  1AYU A;  2OP3 A;  1GMY A;  3KX1 A;  4MZS A;  4OVZ B;  3E9S A;  3ZUA A;  3BBA A;  1AU0 A;  2YJ9 A;  1YAL A;  1CQD A;  1MEG A;  2IPP B;  4GUA A;  2Y6E A;  4CDF B;  3BB7 A;  2BTW A;  3K8U A;  2NQD B;  1ICF A;  2AVW A;  3QT4 A;  3OQC A;  3H8C A;  1SP4 B;  4REZ A;  1CB5 A;  3P5V A;  4X6I A;  1PXV A;  1SNK A;  3MTV A;  4W4U A;  3S3R A;  2JQG R;  3N3G A;  3H6S A;  2BU3 A;  2DOS A;  3MJ5 A;  2J7Q A;  4MSX A;  3TNX A;  3H8B A;  1BP4 A;  4IP3 A;  5CHV A;  1UKF A;  1EWO A;  3O1G A;  2R9O A;  3I06 A;  3CH3 X;  2R9C A;  2UZJ A;  1PBH A;  4Q8H A;  3BY4 A;  4Q8G A;  1GCB A;  2P0R A;  1U9Q X;  4P6G A;  4XZX A;  2FE8 A;  5J94 A;  2B1N A;  1CVZ A;  1JQP A;  3W30 A;  2HWK A;  2FYE A;  4QRX A;  1IWD A;  1U5I A;  1F2A A;  4K7C A;  1X9Y A;  2JQF R;  1TU6 A;  3MTN A;  1EWM A;  3TMP A;  4BOS A;  2E03 A;  4N4Z A;  3W31 A;  2PNS A;  3HD3 A;  1GEC E;  1NL6 A;  2E02 A;  4OEL A;  4P16 A;  3HHI A;  1ZIV A;  4QBB A;  1GLO A;  3C9E A;  4PI3 A;  1MS6 A;  1CJL A;  4FIP A;  1K3B B;  2E01 A;  1QDQ A;  3K24 A;  4G54 A;  1YK8 A;  1ME4 A;  5PAD A;  3BWK A;  1MIR A;  1AYW A;  4PT5 A;  2ATO A;  3TRK A;  3H89 A;  3PW3 A;  1BGO A;  2NQA A;  3CBK A;  1PPP A;  5F02 A;  2R9N A;  2DJF B;  3MP2 A;  2AIM A;  3N3K A;  4D8E A;  9PAP A;  3E1Z B;  2F7D A;  4W5C A;  4YV8 A;  4D8I A;  4CDE B;  1EF7 A;  3O0U A;  2YJ8 A;  1CV8 A;  3ZNH A;  2ARY A;  3I3T A;  4HWY A;  2OUL A;  1AYV A;  2HD5 A;  5CVN B;  2AYO A;  2R6N A;  1DEU A;  2P86 A;  5JZE A;  3H7D A;  3BPF A;  3RVV A;  1CTE A;  1YVB A;  4R3D A;  2G8E A;  2H7J A;  2JRI A;  3RVW A;  3PDF A;  1FH0 A;  3BPM A;  3B79 A;  4WA6 A;  1DF0 A;  4BS5 A;  2FO5 A;  3OIS A;  3MHS A;  1PVJ A;  2G6D A;  4RKX A;  3PSE A;  1Q6K A;  4OEM A;  1BY8 A;  3IOQ A;  3NHE A;  4X6H A;  3PHX A;  2IBI A;  4BOZ A;  5EF4 A;  3C0R A;  3F5V A;  1KXR A;  2DZZ A;  3HHA A;  4N8W A;  8PCH A;  3CBJ A;  1F29 A;  2DC6 A;  2AYN A;  3KFQ A;  2FRA A;  2OZ2 A;  3P5X A;  3LXS A;  4CZW A;  2G7Y A;  3P5U A;  1AU2 A;  1AIM A;  2O6X A;  2PBH A;  1PPD A;  3WXF A;  3KSE A;  3PHU A;  4OVZ A;  3V6C A;  4BOP A;  4I07 A;  3IHP A;  1QOL A;  3IEJ A;  1ITO A;  1ATK A;  3KWZ A;  3IV2 A;  2AUZ A;  1A6R A;  3HWN A;  3OF8 A;  2E00 A;  1F2B A;  2BTW B;  3KW9 A;  4CDC B;  1EWL A;  3V6E A;  2DC9 A;  3QJ3 A;  1AU3 A;  2FUD A;  4AXL A;  3PT2 A;  1AEC A;  2DZY A;  3F75 A;  3KWB X;  1KHQ A;  2F1G A;  1U9V A;  4RF0 A;  4QH6 A;  1TL9 A;  4DMX A;  2PRE A;  4PP2 E;  4N79 A;  2XU4 A;  1NPZ A;  1KFX L;  3PRP A;  4MZO A;  2XU5 A;  3M99 A;  2Z84 A;  3IMA A;  1STF E;  2J7Q C;  2CB5 A;  3QSD A;  4HXD B;  3S3Q A;  5EZS A;  5CHT A;  3WXG A;  2R9F A;  1PCI A;  2FT2 A;  4YYS A;  7PCK A;  2AS8 A;  2FTD A;  1YK7 A;  3KKU A;  2GFO A;  4M0W A;  3RVX A;  5EGW A;  2DCB A;  1PE6 A;  2HXZ A;  3PRM A;  2R9M A;  3PHW A;  2NQG A;  4I04 A;  2PAD A;  1KHP A;  4FJC A;  4QRG A;  4KLB A;  3ERV A;  3D6S A;  2FRQ A;  2BDL A;  5CVO B;  1MEM A;  1THE A;  3OF9 A;  4X6J A;  2P7U A;  3GCB A;  4OW0 A;  2YJC A;  1PPO A;  1YT7 A;  3U8E A;  2DCD A;  5JH3 A;  2DJG B;  4BSQ A;  2B1M A;  3MHH A;  3BC3 A;  1MHW A;  4WUR A;  5E6J A;  1KFU L;  1AU4 A;  5CVM A;  1U9X A;  3DF0 A;  2YJB A;  2NQI A;  3OVX A;  1NLJ A; 
#chains in the Genus database with same CATH homology
 4PAD A;  2HHN A;  2VHS A;  3MOR A;  1MDW A;  2ACT A;  5K16 A;  4QRV A;  1U9W A;  1VSN A;  4CDD B;  2WBF X;  1F2C A;  4PP1 A;  6PAD A;  4W5B A;  3PBH A;  4BS6 A;  4ZUX U;  4XR7 A;  3AI8 A;  4YYR A;  1O0E A;  4BGF A;  1POP A;  1XKG A;  3IUT A;  2GHU A;  4DMY A;  2DCC A;  1CS8 A;  4YVA A;  2FQ9 A;  1Y08 A;  3N4C A;  2DC7 A;  2DCA A;  2XU3 A;  1S4V A;  1BQI A;  1CPJ A;  3WXE A;  1NB3 A;  1PAD A;  3LFY A;  1NB5 A;  3PNR A;  3USV A;  1EWP A;  2YJ2 A;  4XUI A;  4AXM A;  2BDZ A;  1PPN A;  2XU1 A;  2CIO A;  1VJV A;  1ME3 A;  4RY2 A;  4GUZ A;  2AUX A;  2AU1 A;  2VHF A;  4P6E A;  2HH5 A;  2Y5B A;  5JA7 A;  3BOW A;  2VFB A;  5A24 A;  1NQC A;  1QMY A;  1ZCM A;  1M6D A;  4YYU A;  4FK5 A;  2DC8 A;  2G8J A;  3P5W A;  4YYW A;  2C0Y A;  4YYV A;  3CH2 X;  1Y4H A;  4BQV A;  3K9M A;  1CSB B;  3OVZ A;  4BPV A;  3BCN A;  1QXP A;  1HUC B;  4I05 A;  4YYQ A;  1W6F A;  1TLO A;  5FPW A;  1PIP A;  1AYU A;  2OP3 A;  1GMY A;  3KX1 A;  4MZS A;  3ZUA A;  1AU0 A;  2YJ9 A;  1YAL A;  1CQD A;  1MEG A;  2IPP B;  2Y6E A;  4CDF B;  3K8U A;  2NQD B;  1ICF A;  2AVW A;  3QT4 A;  3H8C A;  1SP4 B;  1CB5 A;  3P5V A;  4X6I A;  1PXV A;  1SNK A;  4W4U A;  3S3R A;  2JQG R;  3N3G A;  3H6S A;  4MSX A;  3TNX A;  3H8B A;  1BP4 A;  5CHV A;  1EWO A;  3O1G A;  2R9O A;  3I06 A;  3CH3 X;  2R9C A;  1PBH A;  4Q8H A;  4Q8G A;  1GCB A;  2P0R A;  1GX3 A;  1U9Q X;  4P6G A;  5J94 A;  2B1N A;  1CVZ A;  1JQP A;  2FYE A;  4QRX A;  1IWD A;  1U5I A;  1F2A A;  4K7C A;  1X9Y A;  2JQF R;  1TU6 A;  3MTN A;  1EWM A;  2E03 A;  4N4Z A;  2PNS A;  3HD3 A;  1GEC E;  1NL6 A;  2E02 A;  4OEL A;  3HHI A;  1ZIV A;  4QBB A;  2VFC A;  1GLO A;  3C9E A;  4PI3 A;  1MS6 A;  1CJL A;  4FIP A;  1K3B B;  2E01 A;  1QDQ A;  3K24 A;  4G54 A;  1YK8 A;  1ME4 A;  5PAD A;  3BWK A;  1MIR A;  1AYW A;  2ATO A;  3H89 A;  3PW3 A;  1BGO A;  2NQA A;  3CBK A;  1PPP A;  5F02 A;  2R9N A;  2DJF B;  2AIM A;  3N3K A;  9PAP A;  3E1Z B;  2F7D A;  4W5C A;  4YV8 A;  4CDE B;  1EF7 A;  3O0U A;  2YJ8 A;  1CV8 A;  2ARY A;  3I3T A;  4HWY A;  2OUL A;  1AYV A;  2HD5 A;  5CVN B;  2AYO A;  2R6N A;  1DEU A;  2P86 A;  3H7D A;  3BPF A;  3RVV A;  1CTE A;  1YVB A;  2G8E A;  2H7J A;  3RVW A;  3PDF A;  1FH0 A;  3BPM A;  3B79 A;  4WA6 A;  1DF0 A;  4BS5 A;  2FO5 A;  3OIS A;  3MHS A;  4NV7 A;  2G6D A;  1Q6K A;  4OEM A;  1BY8 A;  3IOQ A;  3NHE A;  4X6H A;  2IBI A;  5EF4 A;  3F5V A;  1KXR A;  2DZZ A;  3HHA A;  4N8W A;  8PCH A;  3CBJ A;  1F29 A;  2DC6 A;  2AYN A;  3KFQ A;  2FRA A;  2OZ2 A;  3P5X A;  4B55 A;  3LXS A;  4CZW A;  2G7Y A;  3P5U A;  1AU2 A;  1AIM A;  2O6X A;  2PBH A;  1W5R A;  1PPD A;  3WXF A;  3KSE A;  3V6C A;  4I07 A;  3IHP A;  1QOL A;  3IEJ A;  1ITO A;  1ATK A;  3KWZ A;  3IV2 A;  2AUZ A;  1A6R A;  3HWN A;  3OF8 A;  2E00 A;  1F2B A;  3KW9 A;  4CDC B;  1EWL A;  1E2T A;  3V6E A;  2DC9 A;  3QJ3 A;  1AU3 A;  2FUD A;  4AXL A;  1AEC A;  2DZY A;  3F75 A;  3KWB X;  1KHQ A;  2F1G A;  1U9V A;  4NV8 A;  4C5P A;  4QH6 A;  1TL9 A;  4DMX A;  2PRE A;  4PP2 E;  4N79 A;  1W4T A;  2XU4 A;  1NPZ A;  1KFX L;  4MZO A;  2XU5 A;  3M99 A;  3IMA A;  1STF E;  2CB5 A;  3QSD A;  3S3Q A;  5CHT A;  3WXG A;  2R9F A;  3D9W A;  1PCI A;  2FT2 A;  4YYS A;  7PCK A;  2AS8 A;  2FTD A;  1YK7 A;  3KKU A;  2GFO A;  3RVX A;  5EGW A;  2DCB A;  1PE6 A;  2HXZ A;  2R9M A;  2NQG A;  4I04 A;  2PAD A;  1KHP A;  4FJC A;  4QRG A;  4KLB A;  3ERV A;  3D6S A;  2FRQ A;  2BDL A;  5CVO B;  1MEM A;  1THE A;  3OF9 A;  4X6J A;  2P7U A;  3GCB A;  2YJC A;  1PPO A;  1YT7 A;  2BSZ A;  3U8E A;  2DCD A;  5JH3 A;  2DJG B;  4BSQ A;  2B1M A;  3MHH A;  3BC3 A;  1MHW A;  1KFU L;  1AU4 A;  5CVM A;  1U9X A;  3DF0 A;  2YJB A;  2NQI A;  3OVX A;  3LTW A;  1NLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...