1FH0A

Crystal structure of human cathepsin v complexed with an irreversible vinyl sulfone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
221
structure length
221
Chain Sequence
LPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSDNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN V
publication title Crystal structure of human cathepsin V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 68
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.4.22.43: Cathepsin V.
pdb deposition date 2000-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1fh0A00
1PE6A 1THEA 2DCAA 4CDEB 3IV2A 2B1MA 3KWZA 4PP1A 1VJVA 2DZZA 1AU0A 4P6GA 3MTNA 4P6EA 5F02A 5CHVA 3V6EA 9PAPA 1U5IA 1NB3A 4YYQA 2XU3A 2FT2A 4X6JA 2JQFR 2AUZA 1DF0A 3H7DA 3QSDA 3F5VA 2NQGA 4W4UA 1X9YA 3TNXA 4QH6A 2PREA 5EF4A 1ITOA 1NB5A 5FPWA 4G54A 3AI8A 5PADA 1KFXL 1PPNA 3O0UA 3OVZA 4I05A 3C9EA 2FTDA 1CPJA 2YJ9A 2R9OA 2GFOA 4CDCB 2R9NA 3N3GA 1CQDA 4I07A 3WXFA 2YJBA 4W5CA 5CVMA 1AU3A 4Q8HA 4K7CA 2FQ9A 2DC6A 3H8BA 1BP4A 3WXGA 1NQCA 1CJLA 3KW9A 1TU6A 1PPOA 1M6DA 3CBKA 1EWMA 4DMXA 1BGOA 2VHFA 4QRVA 4Q8GA 1NPZA 3P5UA 3E1ZB 1TLOA 3CH3X 3F75A 1CTEA 2JQGR 2G6DA 1CB5A 2AIMA 1BQIA 1NL6A 2ACTA 4AXMA 2FYEA 3HWNA 1AYVA 1PPDA 3BPFA 1A6RA 1QXPA 1PCIA 4CDFB 3H6SA 3M99A 4N4ZA 1AECA 1U9WA 4YV8A 2DCCA 3B79A 1AIMA 5CVOB 1AU2A 3MORA 3KKUA 4BSQA 1YK8A 4XUIA 3RVVA 3IOQA 1ME4A 1YK7A 1GCBA 4DMYA 3S3RA 1ICFA 3PBHA 2AS8A 1F29A 4ZUXU 1ZCMA 2H7JA 1TL9A 4HWYA 1BY8A 1KHQA 4YYUA 1KHPA 3LFYA 1HUCB 1GECE 4XR7A 2OZ2A 1SNKA 1POPA 3OF9A 4OELA 2PADA 1U9VA 4YYRA 3QT4A 2E03A 1YVBA 1F2BA 3ERVA 4BPVA 2Y6EA 4CDDB 1EF7A 2YJCA 3MHSA 1GMYA 1F2AA 8PCHA 2G8JA 3O1GA 1MS6A 1PIPA 1EWPA 2WBFX 2XU4A 1KFUL 3K9MA 1DEUA 1KXRA 2BDZA 3BPMA 4KLBA 4CZWA 2NQIA 2E00A 3K8UA 3P5WA 2BDLA 4N8WA 1VSNA 4AXLA 2NQAA 2AYNA 2O6XA 3HHAA 3P5XA 2DCBA 3H8CA 1O0EA 1Y08A 2P0RA 2HD5A 3QJ3A 2YJ2A 1QOLA 4BS5A 3WXEA 3PW3A 3BCNA 4QBBA 4MZSA 2E01A 2HHNA 3BWKA 1AYUA 2C0YA 1ME3A 2CIOA 3ZUAA 3BOWA 3OF8A 2FRQA 1MHWA 3I3TA 2E02A 3GCBA 3MHHA 2PNSA 2F1GA 2ATOA 1QMYA 1ZIVA 4YVAA 2IBIA 1MIRA 2G7YA 2DJGB 3RVXA 3RVWA 1MEGA 1U9QX 3USVA 2B1NA 1AYWA 2OULA 3CBJA 2OP3A 2DC7A 2F7DA 2P86A 3HD3A 5CVNB 2AUXA 1CSBB 2R9CA 2HXZA 2P7UA 3N4CA 2PBHA 7PCKA 2Y5BA 3IMAA 4YYSA 1CVZA 4X6HA 1EWOA 4QRGA 6PADA 3KWBX 1STFE 2DC8A 2ARYA 3H89A 4RY2A 1PADA 1GLOA 1YT7A 1QDQA 1Q6KA 1Y4HA 4PI3A 3OVXA 3KFQA 1AU4A 3I06A 3IEJA 1CV8A 4W5BA 1XKGA 4FK5A 3IHPA 3BC3A 3KX1A 2IPPB 3LXSA 4YYVA 1NLJA 2AU1A 1IWDA 1YALA 4QRXA 5CHTA 4YYWA 4X6IA 4WA6A 5J94A 2XU5A 4MSXA 1ATKA 3K24A 4FJCA 3V6CA 2GHUA 2FRAA 4N79A 5K16A 2AVWA 5JH3A 1PXVA 2DZYA 3PNRA 2R9FA 4FIPA 1U9XA 4OEMA 5A24A 2FO5A 4MZOA 3HHIA 1PBHA 3P5VA 2YJ8A 3DF0A 4PP2E 2DC9A 4BQVA 4BS6A 2NQDB 1S4VA 3KSEA 3CH2X 3N3KA 3NHEA 2R9MA 1F2CA 5JA7A 2XU1A 2HH5A 1EWLA 3PDFA 3OISA 2G8EA 1SP4B 4PADA 2R6NA 1K3BB 2AYOA 2DJFB 1JQPA 2VHSA 3S3QA 1MDWA 2CB5A 1PPPA 3D6SA 1CS8A 2FUDA 1FH0A 3IUTA 3U8EA 5EGWA 2DCDA 4I04A 1MEMA
chains in the Genus database with same CATH superfamily
1PE6A 1THEA 2DCAA 4CDEB 5KO3A 3IV2A 2B1MA 3KWZA 4PP1A 1VJVA 2DZZA 1AU0A 4P6GA 3MTNA 4P6EA 5F02A 5CHVA 5E6JA 3V6EA 9PAPA 1U5IA 1NB3A 4YYQA 3OQCA 2XU3A 2FT2A 4X6JA 2JQFR 2AUZA 1DF0A 3H7DA 3QSDA 3F5VA 2NQGA 4W4UA 1X9YA 3TNXA 4QH6A 2PREA 5EF4A 1ITOA 1NB5A 5FPWA 4G54A 3AI8A 3IFUA 5PADA 1KFXL 1PPNA 3O0UA 3OVZA 4I05A 3C9EA 2UZJA 2FTDA 1CPJA 2YJ9A 2R9OA 4RF0A 2GFOA 4CDCB 2R9NA 3N3GA 1CQDA 4I07A 3WXFA 2YJBA 4W5CA 5CVMA 1AU3A 4Q8HA 3TMPA 4K7CA 2FQ9A 4GUAA 3RNVA 2DC6A 3H8BA 1BP4A 4BOPA 3WXGA 1NQCA 1CJLA 3KW9A 1TU6A 4D8IA 1PPOA 1M6DA 3CBKA 1EWMA 4DMXA 1BGOA 2VHFA 4QRVA 4Q8GA 1NPZA 3P5UA 3E1ZB 1TLOA 3PHXA 3CH3X 4IP3A 3F75A 1CTEA 2JQGR 2G6DA 1CB5A 2AIMA 1BQIA 1NL6A 2ACTA 4AXMA 2FYEA 3HWNA 1AYVA 1PPDA 3BPFA 1A6RA 1QXPA 1PCIA 4CDFB 3H6SA 4PT5A 3M99A 4N4ZA 1AECA 1U9WA 4YV8A 4RNAA 2DCCA 3B79A 1AIMA 4BOQA 5CVOB 4RF1A 1AU2A 2BTWB 3MORA 3KKUA 4BSQA 4P16A 1YK8A 4XUIA 3MP2A 3RVVA 3IOQA 3MTVA 1ME4A 1YK7A 1GCBA 4DMYA 3S3RA 1ICFA 3PBHA 2AS8A 1F29A 4ZUXU 4OW0A 1ZCMA 2H7JA 1TL9A 4HWYA 1BY8A 1KHQA 5EZQA 1YZBA 4YYUA 1KHPA 3LFYA 1HUCB 1GECE 3O65A 4XR7A 2OZ2A 1SNKA 1POPA 2JTCA 3OF9A 4OELA 4BOUA 2BTWA 2PADA 3PRPA 1U9VA 4OVZB 4YYRA 3QT4A 2E03A 1YVBA 1F2BA 4WURA 3ERVA 4BPVA 2Y6EA 4M0WA 4CDDB 1EF7A 2YJCA 3MHSA 2HWKA 3PSEA 1GMYA 3PT2A 1F2AA 8PCHA 1UKFA 2G8JA 3O1GA 1MS6A 4RKXA 1PIPA 3BBAA 1EWPA 2WBFX 4MM3B 2XU4A 1KFUL 3K9MA 1DEUA 1KXRA 2BDZA 3BPMA 4BOZA 4KLBA 4CZWA 2NQIA 2E00A 3K8UA 3P5WA 2BDLA 4N8WA 1VSNA 4AXLA 2NQAA 2AYNA 2O6XA 3HHAA 3P5XA 2DCBA 3H8CA 1O0EA 3PHUA 1Y08A 3MJ5A 4IUMA 2P0RA 4OVZA 2HD5A 3QJ3A 2YJ2A 1QOLA 4ZTBA 4BS5A 3ZNHA 3WXEA 3PW3A 3BCNA 4QBBA 4MZSA 2E01A 2HHNA 3BWKA 1AYUA 2C0YA 1ME3A 2CIOA 3ZUAA 3BOWA 3OF8A 2AGAA 2FRQA 1MHWA 3I3TA 2E02A 3GCBA 3MHHA 2PNSA 3BY4A 4HXDB 2F1GA 2ATOA 4R3DA 4A5UA 1QMYA 1ZIVA 4YVAA 2IBIA 1MIRA 2G7YA 2DJGB 3RVXA 3RVWA 1MEGA 3E9SA 1U9QX 3USVA 2B1NA 1AYWA 2OULA 3CBJA 2OP3A 2DC7A 2F7DA 2P86A 3HD3A 1DKIA 5CVNB 2AUXA 1CSBB 2R9CA 2HXZA 2P7UA 3N4CA 3PHWA 2PBHA 7PCKA 2Y5BA 3IMAA 4YYSA 1CVZA 4X6HA 1EWOA 4QRGA 6PADA 3KWBX 1STFE 2DC8A 2ARYA 3H89A 4RY2A 1PADA 1GLOA 1YT7A 1QDQA 1Q6KA 1Y4HA 3W31A 4PI3A 3OVXA 3KFQA 1AU4A 3I06A 3IEJA 1CV8A 4W5BA 1XKGA 4FK5A 3IHPA 3BC3A 2IPPB 3KX1A 2FE8A 3LXSA 4YYVA 2J7QA 1NLJA 2AU1A 1IWDA 5JZEA 3C0RA 3W30A 1YALA 4QRXA 5CHTA 4YYWA 4X6IA 4WA6A 3PRMA 5J94A 2XU5A 4MSXA 1ATKA 4XZXA 3K24A 4FJCA 3V6CA 2DOSA 2FRAA 2GHUA 2Z84A 4N79A 5K16A 3BB7A 2AVWA 2J7QC 2JRIA 5JH3A 1PXVA 2DZYA 3PNRA 5EZSA 2R9FA 4FIPA 1U9XA 4OEMA 5A24A 2FO5A 1PVJA 4MZOA 3HHIA 2BU3A 1PBHA 3P5VA 2YJ8A 3DF0A 4PP2E 2DC9A 4BQVA 4BS6A 2NQDB 1S4VA 3KSEA 3CH2X 3N3KA 3NHEA 2R9MA 1F2CA 5JA7A 2XU1A 2HH5A 1EWLA 3PDFA 4REZA 3OISA 3B21A 2G8EA 1SP4B 4PADA 2R6NA 1K3BB 2AYOA 2DJFB 1JQPA 2VHSA 4MI7A 3S3QA 1MDWA 2CB5A 1PPPA 3D6SA 1CS8A 4D8BA 4BOSA 2FUDA 1FH0A 3TRKA 3IUTA 3U8EA 5EGWA 2DCDA 4I04A 4D8EA 1MEMA
chains in the Genus database with same CATH topology
1PE6A 1THEA 2DCAA 3LTWA 4CDEB 3IV2A 2B1MA 3KWZA 4PP1A 1VJVA 2DZZA 1AU0A 4P6GA 3MTNA 4P6EA 5F02A 5CHVA 3V6EA 1GX3A 9PAPA 1U5IA 1NB3A 4YYQA 2XU3A 2FT2A 4X6JA 2JQFR 2AUZA 1DF0A 2VFBA 3H7DA 3QSDA 3F5VA 2NQGA 4W4UA 1X9YA 3TNXA 4NV8A 4QH6A 2PREA 5EF4A 1ITOA 1NB5A 5FPWA 4G54A 3AI8A 5PADA 1KFXL 1PPNA 3O0UA 3OVZA 4I05A 3C9EA 2FTDA 1CPJA 2YJ9A 2R9OA 2GFOA 4CDCB 2R9NA 3N3GA 1CQDA 4I07A 3WXFA 2YJBA 4W5CA 5CVMA 4C5PA 1AU3A 4Q8HA 4K7CA 2FQ9A 2DC6A 3H8BA 1BP4A 3WXGA 1NQCA 1CJLA 3KW9A 1TU6A 1PPOA 1M6DA 3CBKA 1EWMA 4DMXA 1BGOA 2VHFA 4QRVA 4Q8GA 1NPZA 3P5UA 3E1ZB 1TLOA 3CH3X 3F75A 1CTEA 2JQGR 2G6DA 1CB5A 2AIMA 1BQIA 1NL6A 2ACTA 4AXMA 2FYEA 3HWNA 1AYVA 1PPDA 3BPFA 1A6RA 1QXPA 1PCIA 4CDFB 3H6SA 3M99A 4N4ZA 1AECA 1U9WA 4YV8A 2DCCA 3B79A 1AIMA 5CVOB 1AU2A 3MORA 3KKUA 4BSQA 1YK8A 4XUIA 3RVVA 3IOQA 3D9WA 1ME4A 1YK7A 1GCBA 4DMYA 3S3RA 1ICFA 3PBHA 2AS8A 1F29A 4ZUXU 1ZCMA 2H7JA 1TL9A 4HWYA 1BY8A 1KHQA 4YYUA 1KHPA 3LFYA 1HUCB 1GECE 4XR7A 2OZ2A 1SNKA 1POPA 1E2TA 3OF9A 4B55A 4OELA 4NV7A 2PADA 1U9VA 4YYRA 3QT4A 2E03A 1YVBA 1F2BA 3ERVA 4BPVA 2Y6EA 4CDDB 1EF7A 2YJCA 3MHSA 1GMYA 1F2AA 8PCHA 2G8JA 3O1GA 1MS6A 1PIPA 1EWPA 2WBFX 2XU4A 1KFUL 3K9MA 1DEUA 1KXRA 2BDZA 3BPMA 4KLBA 4CZWA 2NQIA 2E00A 3K8UA 3P5WA 2BDLA 4N8WA 1VSNA 4AXLA 2NQAA 2AYNA 2O6XA 3HHAA 3P5XA 2DCBA 3H8CA 1O0EA 1Y08A 2P0RA 2HD5A 3QJ3A 2YJ2A 1QOLA 4BS5A 3WXEA 3PW3A 3BCNA 4QBBA 4MZSA 1W5RA 2E01A 2HHNA 3BWKA 1AYUA 2C0YA 1ME3A 2CIOA 3ZUAA 2VFCA 3BOWA 3OF8A 2FRQA 1MHWA 3I3TA 2E02A 3GCBA 3MHHA 2PNSA 2F1GA 2ATOA 1QMYA 1ZIVA 4YVAA 2IBIA 1MIRA 2G7YA 2DJGB 3RVXA 3RVWA 1MEGA 1U9QX 3USVA 2B1NA 1AYWA 2OULA 3CBJA 2OP3A 2DC7A 2F7DA 2P86A 3HD3A 5CVNB 2AUXA 1CSBB 2R9CA 2HXZA 2P7UA 3N4CA 2PBHA 7PCKA 2Y5BA 3IMAA 4YYSA 1CVZA 4X6HA 1EWOA 4QRGA 6PADA 3KWBX 1STFE 2DC8A 2ARYA 3H89A 4RY2A 4GUZA 1PADA 1GLOA 1YT7A 1QDQA 1Q6KA 1Y4HA 4PI3A 3OVXA 3KFQA 1AU4A 3I06A 3IEJA 1CV8A 4W5BA 1XKGA 4FK5A 3IHPA 3BC3A 3KX1A 2IPPB 3LXSA 4YYVA 1NLJA 2AU1A 1IWDA 1YALA 4QRXA 5CHTA 4YYWA 1W6FA 4X6IA 4WA6A 5J94A 2XU5A 4MSXA 1ATKA 3K24A 4FJCA 3V6CA 2GHUA 2FRAA 4N79A 5K16A 2AVWA 5JH3A 1PXVA 2DZYA 3PNRA 2R9FA 4FIPA 1U9XA 4OEMA 5A24A 2FO5A 4MZOA 3HHIA 1PBHA 3P5VA 2YJ8A 3DF0A 4PP2E 2DC9A 4BQVA 4BS6A 2NQDB 1S4VA 3KSEA 3CH2X 3N3KA 3NHEA 2R9MA 1F2CA 5JA7A 2XU1A 2HH5A 1EWLA 3PDFA 3OISA 1W4TA 2G8EA 1SP4B 4PADA 2R6NA 1K3BB 2AYOA 2DJFB 1JQPA 2VHSA 3S3QA 1MDWA 2CB5A 1PPPA 3D6SA 1CS8A 2FUDA 1FH0A 2BSZA 3IUTA 3U8EA 5EGWA 2DCDA 4I04A 1MEMA 4BGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE6 A;  1THE A;  2DCA A;  4CDE B;  3IV2 A;  2B1M A;  3KWZ A;  4PP1 A;  1VJV A;  2DZZ A;  1AU0 A;  4P6G A;  3MTN A;  4P6E A;  5F02 A;  5CHV A;  3V6E A;  9PAP A;  1U5I A;  1NB3 A;  4YYQ A;  2XU3 A;  2FT2 A;  4X6J A;  2JQF R;  2AUZ A;  1DF0 A;  3H7D A;  3QSD A;  3F5V A;  2NQG A;  4W4U A;  1X9Y A;  3TNX A;  4QH6 A;  2PRE A;  5EF4 A;  1ITO A;  1NB5 A;  5FPW A;  4G54 A;  3AI8 A;  5PAD A;  1KFX L;  1PPN A;  3O0U A;  3OVZ A;  4I05 A;  3C9E A;  2FTD A;  1CPJ A;  2YJ9 A;  2R9O A;  2GFO A;  4CDC B;  2R9N A;  3N3G A;  1CQD A;  4I07 A;  3WXF A;  2YJB A;  4W5C A;  5CVM A;  1AU3 A;  4Q8H A;  4K7C A;  2FQ9 A;  2DC6 A;  3H8B A;  1BP4 A;  3WXG A;  1NQC A;  1CJL A;  3KW9 A;  1TU6 A;  1PPO A;  1M6D A;  3CBK A;  1EWM A;  4DMX A;  1BGO A;  2VHF A;  4QRV A;  4Q8G A;  1NPZ A;  3P5U A;  3E1Z B;  1TLO A;  3CH3 X;  3F75 A;  1CTE A;  2JQG R;  2G6D A;  1CB5 A;  2AIM A;  1BQI A;  1NL6 A;  2ACT A;  4AXM A;  2FYE A;  3HWN A;  1AYV A;  1PPD A;  3BPF A;  1A6R A;  1QXP A;  1PCI A;  4CDF B;  3H6S A;  3M99 A;  4N4Z A;  1AEC A;  1U9W A;  4YV8 A;  2DCC A;  3B79 A;  1AIM A;  5CVO B;  1AU2 A;  3MOR A;  3KKU A;  4BSQ A;  1YK8 A;  4XUI A;  3RVV A;  3IOQ A;  1ME4 A;  1YK7 A;  1GCB A;  4DMY A;  3S3R A;  1ICF A;  3PBH A;  2AS8 A;  1F29 A;  4ZUX U;  1ZCM A;  2H7J A;  1TL9 A;  4HWY A;  1BY8 A;  1KHQ A;  4YYU A;  1KHP A;  3LFY A;  1HUC B;  1GEC E;  4XR7 A;  2OZ2 A;  1SNK A;  1POP A;  3OF9 A;  4OEL A;  2PAD A;  1U9V A;  4YYR A;  3QT4 A;  2E03 A;  1YVB A;  1F2B A;  3ERV A;  4BPV A;  2Y6E A;  4CDD B;  1EF7 A;  2YJC A;  3MHS A;  1GMY A;  1F2A A;  8PCH A;  2G8J A;  3O1G A;  1MS6 A;  1PIP A;  1EWP A;  2WBF X;  2XU4 A;  1KFU L;  3K9M A;  1DEU A;  1KXR A;  2BDZ A;  3BPM A;  4KLB A;  4CZW A;  2NQI A;  2E00 A;  3K8U A;  3P5W A;  2BDL A;  4N8W A;  1VSN A;  4AXL A;  2NQA A;  2AYN A;  2O6X A;  3HHA A;  3P5X A;  2DCB A;  3H8C A;  1O0E A;  1Y08 A;  2P0R A;  2HD5 A;  3QJ3 A;  2YJ2 A;  1QOL A;  4BS5 A;  3WXE A;  3PW3 A;  3BCN A;  4QBB A;  4MZS A;  2E01 A;  2HHN A;  3BWK A;  1AYU A;  2C0Y A;  1ME3 A;  2CIO A;  3ZUA A;  3BOW A;  3OF8 A;  2FRQ A;  1MHW A;  3I3T A;  2E02 A;  3GCB A;  3MHH A;  2PNS A;  2F1G A;  2ATO A;  1QMY A;  1ZIV A;  4YVA A;  2IBI A;  1MIR A;  2G7Y A;  2DJG B;  3RVX A;  3RVW A;  1MEG A;  1U9Q X;  3USV A;  2B1N A;  1AYW A;  2OUL A;  3CBJ A;  2OP3 A;  2DC7 A;  2F7D A;  2P86 A;  3HD3 A;  5CVN B;  2AUX A;  1CSB B;  2R9C A;  2HXZ A;  2P7U A;  3N4C A;  2PBH A;  7PCK A;  2Y5B A;  3IMA A;  4YYS A;  1CVZ A;  4X6H A;  1EWO A;  4QRG A;  6PAD A;  3KWB X;  1STF E;  2DC8 A;  2ARY A;  3H89 A;  4RY2 A;  1PAD A;  1GLO A;  1YT7 A;  1QDQ A;  1Q6K A;  1Y4H A;  4PI3 A;  3OVX A;  3KFQ A;  1AU4 A;  3I06 A;  3IEJ A;  1CV8 A;  4W5B A;  1XKG A;  4FK5 A;  3IHP A;  3BC3 A;  3KX1 A;  2IPP B;  3LXS A;  4YYV A;  1NLJ A;  2AU1 A;  1IWD A;  1YAL A;  4QRX A;  5CHT A;  4YYW A;  4X6I A;  4WA6 A;  5J94 A;  2XU5 A;  4MSX A;  1ATK A;  3K24 A;  4FJC A;  3V6C A;  2GHU A;  2FRA A;  4N79 A;  5K16 A;  2AVW A;  5JH3 A;  1PXV A;  2DZY A;  3PNR A;  2R9F A;  4FIP A;  1U9X A;  4OEM A;  5A24 A;  2FO5 A;  4MZO A;  3HHI A;  1PBH A;  3P5V A;  2YJ8 A;  3DF0 A;  4PP2 E;  2DC9 A;  4BQV A;  4BS6 A;  2NQD B;  1S4V A;  3KSE A;  3CH2 X;  3N3K A;  3NHE A;  2R9M A;  1F2C A;  5JA7 A;  2XU1 A;  2HH5 A;  1EWL A;  3PDF A;  3OIS A;  2G8E A;  1SP4 B;  4PAD A;  2R6N A;  1K3B B;  2AYO A;  2DJF B;  1JQP A;  2VHS A;  3S3Q A;  1MDW A;  2CB5 A;  1PPP A;  3D6S A;  1CS8 A;  2FUD A;  1FH0 A;  3IUT A;  3U8E A;  5EGW A;  2DCD A;  4I04 A;  1MEM A; 
#chains in the Genus database with same CATH topology
 1PE6 A;  1THE A;  2DCA A;  4CDE B;  5KO3 A;  3IV2 A;  2B1M A;  3KWZ A;  4PP1 A;  1VJV A;  2DZZ A;  1AU0 A;  4P6G A;  3MTN A;  4P6E A;  5F02 A;  5CHV A;  5E6J A;  3V6E A;  9PAP A;  1U5I A;  1NB3 A;  4YYQ A;  3OQC A;  2XU3 A;  2FT2 A;  4X6J A;  2JQF R;  2AUZ A;  1DF0 A;  3H7D A;  3QSD A;  3F5V A;  2NQG A;  4W4U A;  1X9Y A;  3TNX A;  4QH6 A;  2PRE A;  5EF4 A;  1ITO A;  1NB5 A;  5FPW A;  4G54 A;  3AI8 A;  3IFU A;  5PAD A;  1KFX L;  1PPN A;  3O0U A;  3OVZ A;  4I05 A;  3C9E A;  2UZJ A;  2FTD A;  1CPJ A;  2YJ9 A;  2R9O A;  4RF0 A;  2GFO A;  4CDC B;  2R9N A;  3N3G A;  1CQD A;  4I07 A;  3WXF A;  2YJB A;  4W5C A;  5CVM A;  1AU3 A;  4Q8H A;  3TMP A;  4K7C A;  2FQ9 A;  4GUA A;  3RNV A;  2DC6 A;  3H8B A;  1BP4 A;  4BOP A;  3WXG A;  1NQC A;  1CJL A;  3KW9 A;  1TU6 A;  4D8I A;  1PPO A;  1M6D A;  3CBK A;  1EWM A;  4DMX A;  1BGO A;  2VHF A;  4QRV A;  4Q8G A;  1NPZ A;  3P5U A;  3E1Z B;  1TLO A;  3PHX A;  3CH3 X;  4IP3 A;  3F75 A;  1CTE A;  2JQG R;  2G6D A;  1CB5 A;  2AIM A;  1BQI A;  1NL6 A;  2ACT A;  4AXM A;  2FYE A;  3HWN A;  1AYV A;  1PPD A;  3BPF A;  1A6R A;  1QXP A;  1PCI A;  4CDF B;  3H6S A;  4PT5 A;  3M99 A;  4N4Z A;  1AEC A;  1U9W A;  4YV8 A;  4RNA A;  2DCC A;  3B79 A;  1AIM A;  4BOQ A;  5CVO B;  4RF1 A;  1AU2 A;  2BTW B;  3MOR A;  3KKU A;  4BSQ A;  4P16 A;  1YK8 A;  4XUI A;  3MP2 A;  3RVV A;  3IOQ A;  3MTV A;  1ME4 A;  1YK7 A;  1GCB A;  4DMY A;  3S3R A;  1ICF A;  3PBH A;  2AS8 A;  1F29 A;  4ZUX U;  4OW0 A;  1ZCM A;  2H7J A;  1TL9 A;  4HWY A;  1BY8 A;  1KHQ A;  5EZQ A;  1YZB A;  4YYU A;  1KHP A;  3LFY A;  1HUC B;  1GEC E;  3O65 A;  4XR7 A;  2OZ2 A;  1SNK A;  1POP A;  2JTC A;  3OF9 A;  4OEL A;  4BOU A;  2BTW A;  2PAD A;  3PRP A;  1U9V A;  4OVZ B;  4YYR A;  3QT4 A;  2E03 A;  1YVB A;  1F2B A;  4WUR A;  3ERV A;  4BPV A;  2Y6E A;  4M0W A;  4CDD B;  1EF7 A;  2YJC A;  3MHS A;  2HWK A;  3PSE A;  1GMY A;  3PT2 A;  1F2A A;  8PCH A;  1UKF A;  2G8J A;  3O1G A;  1MS6 A;  4RKX A;  1PIP A;  3BBA A;  1EWP A;  2WBF X;  4MM3 B;  2XU4 A;  1KFU L;  3K9M A;  1DEU A;  1KXR A;  2BDZ A;  3BPM A;  4BOZ A;  4KLB A;  4CZW A;  2NQI A;  2E00 A;  3K8U A;  3P5W A;  2BDL A;  4N8W A;  1VSN A;  4AXL A;  2NQA A;  2AYN A;  2O6X A;  3HHA A;  3P5X A;  2DCB A;  3H8C A;  1O0E A;  3PHU A;  1Y08 A;  3MJ5 A;  4IUM A;  2P0R A;  4OVZ A;  2HD5 A;  3QJ3 A;  2YJ2 A;  1QOL A;  4ZTB A;  4BS5 A;  3ZNH A;  3WXE A;  3PW3 A;  3BCN A;  4QBB A;  4MZS A;  2E01 A;  2HHN A;  3BWK A;  1AYU A;  2C0Y A;  1ME3 A;  2CIO A;  3ZUA A;  3BOW A;  3OF8 A;  2AGA A;  2FRQ A;  1MHW A;  3I3T A;  2E02 A;  3GCB A;  3MHH A;  2PNS A;  3BY4 A;  4HXD B;  2F1G A;  2ATO A;  4R3D A;  4A5U A;  1QMY A;  1ZIV A;  4YVA A;  2IBI A;  1MIR A;  2G7Y A;  2DJG B;  3RVX A;  3RVW A;  1MEG A;  3E9S A;  1U9Q X;  3USV A;  2B1N A;  1AYW A;  2OUL A;  3CBJ A;  2OP3 A;  2DC7 A;  2F7D A;  2P86 A;  3HD3 A;  1DKI A;  5CVN B;  2AUX A;  1CSB B;  2R9C A;  2HXZ A;  2P7U A;  3N4C A;  3PHW A;  2PBH A;  7PCK A;  2Y5B A;  3IMA A;  4YYS A;  1CVZ A;  4X6H A;  1EWO A;  4QRG A;  6PAD A;  3KWB X;  1STF E;  2DC8 A;  2ARY A;  3H89 A;  4RY2 A;  1PAD A;  1GLO A;  1YT7 A;  1QDQ A;  1Q6K A;  1Y4H A;  3W31 A;  4PI3 A;  3OVX A;  3KFQ A;  1AU4 A;  3I06 A;  3IEJ A;  1CV8 A;  4W5B A;  1XKG A;  4FK5 A;  3IHP A;  3BC3 A;  2IPP B;  3KX1 A;  2FE8 A;  3LXS A;  4YYV A;  2J7Q A;  1NLJ A;  2AU1 A;  1IWD A;  5JZE A;  3C0R A;  3W30 A;  1YAL A;  4QRX A;  5CHT A;  4YYW A;  4X6I A;  4WA6 A;  3PRM A;  5J94 A;  2XU5 A;  4MSX A;  1ATK A;  4XZX A;  3K24 A;  4FJC A;  3V6C A;  2DOS A;  2FRA A;  2GHU A;  2Z84 A;  4N79 A;  5K16 A;  3BB7 A;  2AVW A;  2J7Q C;  2JRI A;  5JH3 A;  1PXV A;  2DZY A;  3PNR A;  5EZS A;  2R9F A;  4FIP A;  1U9X A;  4OEM A;  5A24 A;  2FO5 A;  1PVJ A;  4MZO A;  3HHI A;  2BU3 A;  1PBH A;  3P5V A;  2YJ8 A;  3DF0 A;  4PP2 E;  2DC9 A;  4BQV A;  4BS6 A;  2NQD B;  1S4V A;  3KSE A;  3CH2 X;  3N3K A;  3NHE A;  2R9M A;  1F2C A;  5JA7 A;  2XU1 A;  2HH5 A;  1EWL A;  3PDF A;  4REZ A;  3OIS A;  3B21 A;  2G8E A;  1SP4 B;  4PAD A;  2R6N A;  1K3B B;  2AYO A;  2DJF B;  1JQP A;  2VHS A;  4MI7 A;  3S3Q A;  1MDW A;  2CB5 A;  1PPP A;  3D6S A;  1CS8 A;  4D8B A;  4BOS A;  2FUD A;  1FH0 A;  3TRK A;  3IUT A;  3U8E A;  5EGW A;  2DCD A;  4I04 A;  4D8E A;  1MEM A; 
#chains in the Genus database with same CATH homology
 1PE6 A;  1THE A;  2DCA A;  3LTW A;  4CDE B;  3IV2 A;  2B1M A;  3KWZ A;  4PP1 A;  1VJV A;  2DZZ A;  1AU0 A;  4P6G A;  3MTN A;  4P6E A;  5F02 A;  5CHV A;  3V6E A;  1GX3 A;  9PAP A;  1U5I A;  1NB3 A;  4YYQ A;  2XU3 A;  2FT2 A;  4X6J A;  2JQF R;  2AUZ A;  1DF0 A;  2VFB A;  3H7D A;  3QSD A;  3F5V A;  2NQG A;  4W4U A;  1X9Y A;  3TNX A;  4NV8 A;  4QH6 A;  2PRE A;  5EF4 A;  1ITO A;  1NB5 A;  5FPW A;  4G54 A;  3AI8 A;  5PAD A;  1KFX L;  1PPN A;  3O0U A;  3OVZ A;  4I05 A;  3C9E A;  2FTD A;  1CPJ A;  2YJ9 A;  2R9O A;  2GFO A;  4CDC B;  2R9N A;  3N3G A;  1CQD A;  4I07 A;  3WXF A;  2YJB A;  4W5C A;  5CVM A;  4C5P A;  1AU3 A;  4Q8H A;  4K7C A;  2FQ9 A;  2DC6 A;  3H8B A;  1BP4 A;  3WXG A;  1NQC A;  1CJL A;  3KW9 A;  1TU6 A;  1PPO A;  1M6D A;  3CBK A;  1EWM A;  4DMX A;  1BGO A;  2VHF A;  4QRV A;  4Q8G A;  1NPZ A;  3P5U A;  3E1Z B;  1TLO A;  3CH3 X;  3F75 A;  1CTE A;  2JQG R;  2G6D A;  1CB5 A;  2AIM A;  1BQI A;  1NL6 A;  2ACT A;  4AXM A;  2FYE A;  3HWN A;  1AYV A;  1PPD A;  3BPF A;  1A6R A;  1QXP A;  1PCI A;  4CDF B;  3H6S A;  3M99 A;  4N4Z A;  1AEC A;  1U9W A;  4YV8 A;  2DCC A;  3B79 A;  1AIM A;  5CVO B;  1AU2 A;  3MOR A;  3KKU A;  4BSQ A;  1YK8 A;  4XUI A;  3RVV A;  3IOQ A;  3D9W A;  1ME4 A;  1YK7 A;  1GCB A;  4DMY A;  3S3R A;  1ICF A;  3PBH A;  2AS8 A;  1F29 A;  4ZUX U;  1ZCM A;  2H7J A;  1TL9 A;  4HWY A;  1BY8 A;  1KHQ A;  4YYU A;  1KHP A;  3LFY A;  1HUC B;  1GEC E;  4XR7 A;  2OZ2 A;  1SNK A;  1POP A;  1E2T A;  3OF9 A;  4B55 A;  4OEL A;  4NV7 A;  2PAD A;  1U9V A;  4YYR A;  3QT4 A;  2E03 A;  1YVB A;  1F2B A;  3ERV A;  4BPV A;  2Y6E A;  4CDD B;  1EF7 A;  2YJC A;  3MHS A;  1GMY A;  1F2A A;  8PCH A;  2G8J A;  3O1G A;  1MS6 A;  1PIP A;  1EWP A;  2WBF X;  2XU4 A;  1KFU L;  3K9M A;  1DEU A;  1KXR A;  2BDZ A;  3BPM A;  4KLB A;  4CZW A;  2NQI A;  2E00 A;  3K8U A;  3P5W A;  2BDL A;  4N8W A;  1VSN A;  4AXL A;  2NQA A;  2AYN A;  2O6X A;  3HHA A;  3P5X A;  2DCB A;  3H8C A;  1O0E A;  1Y08 A;  2P0R A;  2HD5 A;  3QJ3 A;  2YJ2 A;  1QOL A;  4BS5 A;  3WXE A;  3PW3 A;  3BCN A;  4QBB A;  4MZS A;  1W5R A;  2E01 A;  2HHN A;  3BWK A;  1AYU A;  2C0Y A;  1ME3 A;  2CIO A;  3ZUA A;  2VFC A;  3BOW A;  3OF8 A;  2FRQ A;  1MHW A;  3I3T A;  2E02 A;  3GCB A;  3MHH A;  2PNS A;  2F1G A;  2ATO A;  1QMY A;  1ZIV A;  4YVA A;  2IBI A;  1MIR A;  2G7Y A;  2DJG B;  3RVX A;  3RVW A;  1MEG A;  1U9Q X;  3USV A;  2B1N A;  1AYW A;  2OUL A;  3CBJ A;  2OP3 A;  2DC7 A;  2F7D A;  2P86 A;  3HD3 A;  5CVN B;  2AUX A;  1CSB B;  2R9C A;  2HXZ A;  2P7U A;  3N4C A;  2PBH A;  7PCK A;  2Y5B A;  3IMA A;  4YYS A;  1CVZ A;  4X6H A;  1EWO A;  4QRG A;  6PAD A;  3KWB X;  1STF E;  2DC8 A;  2ARY A;  3H89 A;  4RY2 A;  4GUZ A;  1PAD A;  1GLO A;  1YT7 A;  1QDQ A;  1Q6K A;  1Y4H A;  4PI3 A;  3OVX A;  3KFQ A;  1AU4 A;  3I06 A;  3IEJ A;  1CV8 A;  4W5B A;  1XKG A;  4FK5 A;  3IHP A;  3BC3 A;  3KX1 A;  2IPP B;  3LXS A;  4YYV A;  1NLJ A;  2AU1 A;  1IWD A;  1YAL A;  4QRX A;  5CHT A;  4YYW A;  1W6F A;  4X6I A;  4WA6 A;  5J94 A;  2XU5 A;  4MSX A;  1ATK A;  3K24 A;  4FJC A;  3V6C A;  2GHU A;  2FRA A;  4N79 A;  5K16 A;  2AVW A;  5JH3 A;  1PXV A;  2DZY A;  3PNR A;  2R9F A;  4FIP A;  1U9X A;  4OEM A;  5A24 A;  2FO5 A;  4MZO A;  3HHI A;  1PBH A;  3P5V A;  2YJ8 A;  3DF0 A;  4PP2 E;  2DC9 A;  4BQV A;  4BS6 A;  2NQD B;  1S4V A;  3KSE A;  3CH2 X;  3N3K A;  3NHE A;  2R9M A;  1F2C A;  5JA7 A;  2XU1 A;  2HH5 A;  1EWL A;  3PDF A;  3OIS A;  1W4T A;  2G8E A;  1SP4 B;  4PAD A;  2R6N A;  1K3B B;  2AYO A;  2DJF B;  1JQP A;  2VHS A;  3S3Q A;  1MDW A;  2CB5 A;  1PPP A;  3D6S A;  1CS8 A;  2FUD A;  1FH0 A;  2BSZ A;  3IUT A;  3U8E A;  5EGW A;  2DCD A;  4I04 A;  1MEM A;  4BGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...