2R6NA

Crystal structure of a pyrrolopyrimidine inhibitor in complex with human cathepsin k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel scaffold for cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r6nA00
4X6IA 1NB3A 4CDCB 5PADA 4YYVA 2FUDA 2NQIA 2E00A 2NQDB 3S3RA 2H7JA 3D6SA 2HHNA 3HWNA 4YYRA 3IHPA 3HHIA 3IOQA 1QXPA 1AECA 2IPPB 3BCNA 2CIOA 2FRQA 4CDFB 2E02A 3WXFA 3CBKA 2VHFA 6PADA 1FH0A 2Y6EA 2NQAA 1HUCB 4W5BA 3WXGA 2ATOA 1NB5A 1BGOA 1Q6KA 2YJCA 3OF8A 1ATKA 2P7UA 2E03A 1AU3A 2AU1A 3CBJA 1AU2A 2BDLA 1EWMA 1TU6A 1ITOA 5EGWA 3P5WA 3TNXA 2GHUA 2ARYA 2R9MA 3I3TA 2R6NA 4CZWA 3BC3A 1PIPA 1QMYA 2XU1A 5K16A 2AUXA 4QRGA 1PPPA 4RY2A 3H6SA 5CVNB 3OVZA 5F02A 4FJCA 5CVOB 2HH5A 4CDDB 4OELA 2OP3A 3H89A 3H8BA 1ZCMA 1AU0A 1QOLA 3N4CA 1K3BB 2B1NA 2XU3A 4I07A 2JQFR 4I04A 1YK7A 1XKGA 4XR7A 2G8JA 1Y4HA 2YJ9A 4FK5A 2AYNA 3PDFA 5J94A 4ZUXU 4YV8A 1TLOA 4YYSA 4W5CA 3KX1A 2FYEA 5JA7A 4AXLA 2DCDA 3OVXA 4QRXA 3USVA 3C9EA 4BS6A 5EF4A 3E1ZB 3KKUA 4PP1A 1SP4B 2HXZA 1AYUA 3PBHA 3BWKA 1ME4A 1CS8A 2DC7A 1MEMA 3K9MA 1SNKA 3CH2X 5CVMA 4QH6A 4WA6A 1PPNA 4BSQA 1CVZA 2Y5BA 2DZYA 1KXRA 7PCKA 1CPJA 2DCAA 1MDWA 2CB5A 2AIMA 2PNSA 3GCBA 1KHQA 1NL6A 1U9WA 3IEJA 4HWYA 2IBIA 4YYWA 2YJBA 1EWPA 2XU4A 1Y08A 3ERVA 3OF9A 2WBFX 3RVWA 4KLBA 4CDEB 4QBBA 1U9QX 4N4ZA 3K8UA 1GCBA 3IUTA 4YVAA 4DMYA 1NPZA 2P86A 3KWBX 4MSXA 1VSNA 2P0RA 3MHHA 3MHSA 1QDQA 4YYQA 3RVVA 1NQCA 2OZ2A 3PW3A 1YVBA 1KHPA 1YK8A 2G7YA 1U5IA 1GECE 2NQGA 1EWOA 1AU4A 2FRAA 2YJ2A 1PE6A 4W4UA 3F75A 1MEGA 3MTNA 4N8WA 3WXEA 3M99A 3HD3A 3NHEA 2DCCA 1MS6A 1KFXL 3P5XA 1GLOA 1PCIA 2F1GA 1BP4A 1DEUA 3QSDA 1CB5A 5JH3A 3N3KA 3AI8A 2R9OA 3V6EA 1STFE 4MZSA 1IWDA 2ACTA 3KFQA 4AXMA 3BOWA 2O6XA 4QRVA 4N79A 3KWZA 2PREA 3S3QA 1U9VA 2GFOA 2FO5A 1PPOA 1BQIA 1GMYA 4OEMA 3IMAA 4X6JA 2FQ9A 2PADA 5FPWA 2BDZA 3OISA 2AS8A 4XUIA 2HD5A 4P6GA 4YYUA 2C0YA 2FT2A 1ME3A 1AIMA 3P5VA 9PAPA 1O0EA 2DC8A 4MZOA 4Q8HA 4Q8GA 3DF0A 1X9YA 3O1GA 4X6HA 3QT4A 3LFYA 5A24A 1AYWA 3ZUAA 4PADA 4K7CA 1CTEA 3I06A 4FIPA 2AVWA 4PP2E 4BS5A 4G54A 1MIRA 1A6RA 2XU5A 3B79A 3U8EA 1TL9A 1ICFA 2DCBA 3KW9A 5CHTA 1S4VA 1F29A 1CJLA 1EWLA 1PADA 4I05A 2FTDA 4PI3A 3H8CA 4P6EA 4DMXA 1BY8A 2DZZA 3HHAA 2OULA 2AYOA 1CV8A 2R9NA 3QJ3A 3PNRA 1F2CA 5CHVA 2G8EA 3BPMA 1CSBB 4BPVA 1ZIVA 2AUZA 1PPDA 3KSEA 1M6DA 3CH3X 3LXSA 3H7DA 2DJFB 3F5VA 3K24A 1KFUL 1AYVA 1NLJA 3O0UA 2DC6A 3RVXA 1THEA 2DC9A 4BQVA 2DJGB 1YT7A 2G6DA 2R9FA 2PBHA 1F2AA 1VJVA 8PCHA 1EF7A 1F2BA 2VHSA 3BPFA 2YJ8A 1DF0A 2JQGR 3P5UA 3V6CA 1MHWA 3N3GA 1U9XA 2F7DA 1CQDA 2B1MA 2E01A 2R9CA 1JQPA 3IV2A 3MORA 1POPA 1YALA 1PBHA 1PXVA
chains in the Genus database with same CATH superfamily
4MI7A 4X6IA 1NB3A 4CDCB 3BB7A 5PADA 4YYVA 2FUDA 2NQIA 2E00A 2NQDB 3S3RA 2H7JA 3D6SA 3MJ5A 2HHNA 3HWNA 2DOSA 4YYRA 3IHPA 3HHIA 3IOQA 1QXPA 1AECA 2AGAA 2IPPB 3BCNA 3PT2A 2CIOA 2FRQA 4CDFB 2E02A 3WXFA 3CBKA 4BOZA 2VHFA 6PADA 1FH0A 2Y6EA 2NQAA 1HUCB 4W5BA 3WXGA 2ATOA 1NB5A 1BGOA 1Q6KA 2YJCA 3OF8A 1ATKA 2P7UA 2E03A 1AU3A 2AU1A 3CBJA 4REZA 1AU2A 2BDLA 1EWMA 1TU6A 1ITOA 5EGWA 3P5WA 3BY4A 3TNXA 2GHUA 2ARYA 4D8BA 2R9MA 3I3TA 2R6NA 4CZWA 3BC3A 1PIPA 3B21A 1QMYA 2XU1A 4M0WA 5K16A 2AUXA 4QRGA 1PPPA 4RY2A 3H6SA 5CVNB 3OVZA 5F02A 4FJCA 5CVOB 2HH5A 4CDDB 4OVZA 4OELA 2OP3A 3H89A 3H8BA 1ZCMA 1DKIA 1AU0A 1QOLA 3N4CA 1K3BB 2B1NA 2XU3A 4I07A 2JQFR 4I04A 3ZNHA 1YK7A 1XKGA 4XR7A 4D8IA 2G8JA 1Y4HA 2YJ9A 4FK5A 2AYNA 3PDFA 5J94A 4ZUXU 4YV8A 2J7QA 1TLOA 2JTCA 4W5CA 4YYSA 3KX1A 2FYEA 5JA7A 4AXLA 2DCDA 3OVXA 4GUAA 4QRXA 4ZTBA 3USVA 3C9EA 4BS6A 5EF4A 3E1ZB 3KKUA 4BOUA 4PP1A 1SP4B 2HXZA 1AYUA 3PBHA 3BWKA 4OVZB 1ME4A 5EZSA 1CS8A 3PRPA 4BOPA 2DC7A 1MEMA 3OQCA 3K9MA 3PSEA 1SNKA 3CH2X 5CVMA 4QH6A 4WA6A 1PPNA 4BSQA 1CVZA 3RNVA 2Y5BA 2DZYA 1KXRA 7PCKA 1CPJA 4D8EA 2DCAA 1MDWA 2HWKA 2CB5A 4RF0A 2AIMA 2PNSA 3GCBA 1KHQA 1NL6A 1UKFA 1U9WA 3IEJA 4HWYA 2IBIA 3TRKA 4YYWA 2YJBA 1EWPA 2XU4A 1Y08A 3ERVA 3OF9A 2WBFX 3RVWA 4KLBA 4CDEB 4BOQA 4QBBA 1U9QX 4N4ZA 4RNAA 3K8UA 1GCBA 2BTWA 3IUTA 4YVAA 4DMYA 1NPZA 2P86A 3KWBX 4MSXA 1VSNA 2P0RA 3MHHA 3MHSA 1QDQA 2BTWB 4YYQA 1NQCA 3RVVA 2OZ2A 3PW3A 1YVBA 3C0RA 1KHPA 1YK8A 2G7YA 1U5IA 1GECE 2UZJA 2NQGA 5E6JA 1EWOA 1AU4A 2FRAA 2YJ2A 4R3DA 4HXDB 1PE6A 2JRIA 4W4UA 3F75A 1MEGA 3MTNA 4N8WA 3WXEA 3M99A 3HD3A 3NHEA 2DCCA 1MS6A 1KFXL 3PHUA 3P5XA 1GLOA 3PHXA 1PCIA 2F1GA 1BP4A 1DEUA 2Z84A 3QSDA 1CB5A 5JH3A 3N3KA 3AI8A 4WURA 4RF1A 2R9OA 3V6EA 1STFE 4MZSA 1IWDA 2ACTA 3KFQA 4AXMA 3BOWA 4A5UA 2O6XA 4QRVA 4N79A 3KWZA 2PREA 3MTVA 3S3QA 1U9VA 2GFOA 4P16A 2FO5A 1PPOA 1BQIA 1GMYA 4OEMA 3IMAA 4X6JA 2FQ9A 2PADA 4XUIA 2BDZA 3OISA 2AS8A 5FPWA 2HD5A 4P6GA 4YYUA 2C0YA 2FT2A 1ME3A 4RKXA 2BU3A 1AIMA 1PVJA 3P5VA 3W31A 9PAPA 1O0EA 2DC8A 4MZOA 5EZQA 4Q8HA 3DF0A 3O1GA 1X9YA 4Q8GA 4X6HA 5JZEA 3QT4A 3LFYA 5A24A 1AYWA 3ZUAA 4PADA 4K7CA 1CTEA 3I06A 4FIPA 5KO3A 2AVWA 4PP2E 4BS5A 4G54A 1MIRA 1A6RA 3O65A 3TMPA 2XU5A 3B79A 3U8EA 1TL9A 1ICFA 2DCBA 3KW9A 4MM3B 5CHTA 1S4VA 1F29A 1CJLA 1EWLA 1PADA 3IFUA 4I05A 2FTDA 4PI3A 3H8CA 4P6EA 3MP2A 4DMXA 4IP3A 1BY8A 2DZZA 3HHAA 2OULA 2AYOA 1CV8A 2R9NA 4OW0A 3QJ3A 3PNRA 3E9SA 1F2CA 4PT5A 5CHVA 3BBAA 2G8EA 3BPMA 1CSBB 4BPVA 1ZIVA 2AUZA 1PPDA 4XZXA 3KSEA 1M6DA 3CH3X 3LXSA 3PRMA 3H7DA 2FE8A 2DJFB 3F5VA 3K24A 1KFUL 1AYVA 1NLJA 3O0UA 2DC6A 3RVXA 1THEA 2DC9A 4BQVA 2DJGB 1YT7A 2G6DA 2R9FA 4BOSA 2PBHA 1F2AA 1VJVA 3W30A 8PCHA 3PHWA 1EF7A 1F2BA 2VHSA 3BPFA 2YJ8A 1DF0A 2JQGR 3P5UA 3V6CA 1MHWA 3N3GA 1U9XA 2F7DA 2J7QC 1CQDA 2B1MA 2E01A 1YZBA 2R9CA 1JQPA 3IV2A 3MORA 4IUMA 1POPA 1YALA 1PBHA 1PXVA
chains in the Genus database with same CATH topology
4X6IA 2VFCA 1NB3A 4CDCB 5PADA 4YYVA 2FUDA 2NQIA 2E00A 2NQDB 3S3RA 2H7JA 3D6SA 2HHNA 3HWNA 4YYRA 3IHPA 3HHIA 3IOQA 1QXPA 1AECA 2VFBA 2IPPB 3BCNA 2CIOA 2FRQA 4CDFB 2E02A 3WXFA 3CBKA 4GUZA 2VHFA 6PADA 1FH0A 2Y6EA 2NQAA 1HUCB 4W5BA 3WXGA 2ATOA 4B55A 1NB5A 1BGOA 1Q6KA 2YJCA 3OF8A 1ATKA 2P7UA 2E03A 1AU3A 2AU1A 3CBJA 1AU2A 2BDLA 1EWMA 1TU6A 1ITOA 5EGWA 3P5WA 4NV7A 3TNXA 2GHUA 2ARYA 2R9MA 3I3TA 2R6NA 4CZWA 3BC3A 1PIPA 1QMYA 2XU1A 5K16A 2AUXA 4QRGA 1PPPA 4RY2A 3H6SA 5CVNB 3OVZA 5F02A 4FJCA 5CVOB 2HH5A 4CDDB 4OELA 2OP3A 3H89A 3H8BA 1ZCMA 1AU0A 1QOLA 3N4CA 4I07A 1K3BB 2B1NA 2XU3A 2JQFR 4I04A 1YK7A 1XKGA 4XR7A 2G8JA 1Y4HA 2YJ9A 4FK5A 2AYNA 3PDFA 5J94A 4ZUXU 4YV8A 3D9WA 1TLOA 4YYSA 4W5CA 3KX1A 2FYEA 5JA7A 4C5PA 4AXLA 2DCDA 3OVXA 4QRXA 3USVA 3C9EA 4BS6A 5EF4A 3E1ZB 3KKUA 1W4TA 4PP1A 1SP4B 2HXZA 1AYUA 3PBHA 3BWKA 1ME4A 1CS8A 2DC7A 1MEMA 3K9MA 1SNKA 3CH2X 5CVMA 4QH6A 4WA6A 1PPNA 4BSQA 1CVZA 2Y5BA 2DZYA 1KXRA 7PCKA 1CPJA 2DCAA 1MDWA 2CB5A 2AIMA 2PNSA 3GCBA 1KHQA 1NL6A 1U9WA 3IEJA 4HWYA 2IBIA 4YYWA 2YJBA 1EWPA 2XU4A 1Y08A 3ERVA 3OF9A 2WBFX 3RVWA 4KLBA 4CDEB 4QBBA 1U9QX 4N4ZA 3K8UA 1GCBA 3IUTA 4YVAA 4DMYA 1NPZA 2P86A 3KWBX 4MSXA 1VSNA 2P0RA 3MHHA 3MHSA 2BSZA 1QDQA 4YYQA 1NQCA 3RVVA 2OZ2A 3PW3A 1YVBA 1W5RA 1KHPA 1YK8A 2G7YA 1U5IA 1GECE 2NQGA 1EWOA 1AU4A 2FRAA 2YJ2A 1PE6A 4W4UA 3F75A 1MEGA 3MTNA 4N8WA 3WXEA 3M99A 3HD3A 3NHEA 2DCCA 1MS6A 1KFXL 3P5XA 1GLOA 1PCIA 1W6FA 2F1GA 1BP4A 1DEUA 3QSDA 1CB5A 5JH3A 3N3KA 3AI8A 2R9OA 3V6EA 1STFE 4NV8A 4MZSA 1IWDA 2ACTA 3KFQA 4AXMA 3BOWA 2O6XA 4QRVA 4N79A 3KWZA 2PREA 1GX3A 3S3QA 1U9VA 2GFOA 2FO5A 1PPOA 1BQIA 1GMYA 4OEMA 4BGFA 3IMAA 4X6JA 2FQ9A 2PADA 5FPWA 2BDZA 3OISA 2AS8A 4XUIA 2HD5A 4P6GA 4YYUA 2C0YA 2FT2A 1ME3A 1AIMA 3P5VA 9PAPA 1O0EA 2DC8A 4MZOA 4Q8HA 4Q8GA 3DF0A 1X9YA 3O1GA 4X6HA 3QT4A 3LFYA 5A24A 1AYWA 3ZUAA 4PADA 4K7CA 1CTEA 3I06A 4FIPA 2AVWA 4PP2E 4BS5A 4G54A 1MIRA 1A6RA 1E2TA 2XU5A 3B79A 3U8EA 1TL9A 1ICFA 2DCBA 3KW9A 5CHTA 1S4VA 1F29A 1CJLA 1EWLA 1PADA 4I05A 2FTDA 4PI3A 3H8CA 4P6EA 4DMXA 1BY8A 2DZZA 3HHAA 2OULA 2AYOA 1CV8A 2R9NA 3QJ3A 3PNRA 1F2CA 5CHVA 3LTWA 2G8EA 3BPMA 1CSBB 4BPVA 1ZIVA 2AUZA 1PPDA 3KSEA 1M6DA 3CH3X 3LXSA 3H7DA 2DJFB 3F5VA 3K24A 1KFUL 1AYVA 1NLJA 3O0UA 2DC6A 3RVXA 1THEA 2DC9A 4BQVA 2DJGB 1YT7A 2G6DA 2R9FA 2PBHA 1F2AA 1VJVA 8PCHA 1EF7A 1F2BA 2VHSA 3BPFA 2YJ8A 1DF0A 2JQGR 3P5UA 3V6CA 1MHWA 3N3GA 1U9XA 2F7DA 1CQDA 2B1MA 2E01A 2R9CA 1JQPA 3IV2A 3MORA 1POPA 1YALA 1PBHA 1PXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6I A;  1NB3 A;  4CDC B;  5PAD A;  4YYV A;  2FUD A;  2NQI A;  2E00 A;  2NQD B;  3S3R A;  2H7J A;  3D6S A;  2HHN A;  3HWN A;  4YYR A;  3IHP A;  3HHI A;  3IOQ A;  1QXP A;  1AEC A;  2IPP B;  3BCN A;  2CIO A;  2FRQ A;  4CDF B;  2E02 A;  3WXF A;  3CBK A;  2VHF A;  6PAD A;  1FH0 A;  2Y6E A;  2NQA A;  1HUC B;  4W5B A;  3WXG A;  2ATO A;  1NB5 A;  1BGO A;  1Q6K A;  2YJC A;  3OF8 A;  1ATK A;  2P7U A;  2E03 A;  1AU3 A;  2AU1 A;  3CBJ A;  1AU2 A;  2BDL A;  1EWM A;  1TU6 A;  1ITO A;  5EGW A;  3P5W A;  3TNX A;  2GHU A;  2ARY A;  2R9M A;  3I3T A;  2R6N A;  4CZW A;  3BC3 A;  1PIP A;  1QMY A;  2XU1 A;  5K16 A;  2AUX A;  4QRG A;  1PPP A;  4RY2 A;  3H6S A;  5CVN B;  3OVZ A;  5F02 A;  4FJC A;  5CVO B;  2HH5 A;  4CDD B;  4OEL A;  2OP3 A;  3H89 A;  3H8B A;  1ZCM A;  1AU0 A;  1QOL A;  3N4C A;  1K3B B;  2B1N A;  2XU3 A;  4I07 A;  2JQF R;  4I04 A;  1YK7 A;  1XKG A;  4XR7 A;  2G8J A;  1Y4H A;  2YJ9 A;  4FK5 A;  2AYN A;  3PDF A;  5J94 A;  4ZUX U;  4YV8 A;  1TLO A;  4YYS A;  4W5C A;  3KX1 A;  2FYE A;  5JA7 A;  4AXL A;  2DCD A;  3OVX A;  4QRX A;  3USV A;  3C9E A;  4BS6 A;  5EF4 A;  3E1Z B;  3KKU A;  4PP1 A;  1SP4 B;  2HXZ A;  1AYU A;  3PBH A;  3BWK A;  1ME4 A;  1CS8 A;  2DC7 A;  1MEM A;  3K9M A;  1SNK A;  3CH2 X;  5CVM A;  4QH6 A;  4WA6 A;  1PPN A;  4BSQ A;  1CVZ A;  2Y5B A;  2DZY A;  1KXR A;  7PCK A;  1CPJ A;  2DCA A;  1MDW A;  2CB5 A;  2AIM A;  2PNS A;  3GCB A;  1KHQ A;  1NL6 A;  1U9W A;  3IEJ A;  4HWY A;  2IBI A;  4YYW A;  2YJB A;  1EWP A;  2XU4 A;  1Y08 A;  3ERV A;  3OF9 A;  2WBF X;  3RVW A;  4KLB A;  4CDE B;  4QBB A;  1U9Q X;  4N4Z A;  3K8U A;  1GCB A;  3IUT A;  4YVA A;  4DMY A;  1NPZ A;  2P86 A;  3KWB X;  4MSX A;  1VSN A;  2P0R A;  3MHH A;  3MHS A;  1QDQ A;  4YYQ A;  3RVV A;  1NQC A;  2OZ2 A;  3PW3 A;  1YVB A;  1KHP A;  1YK8 A;  2G7Y A;  1U5I A;  1GEC E;  2NQG A;  1EWO A;  1AU4 A;  2FRA A;  2YJ2 A;  1PE6 A;  4W4U A;  3F75 A;  1MEG A;  3MTN A;  4N8W A;  3WXE A;  3M99 A;  3HD3 A;  3NHE A;  2DCC A;  1MS6 A;  1KFX L;  3P5X A;  1GLO A;  1PCI A;  2F1G A;  1BP4 A;  1DEU A;  3QSD A;  1CB5 A;  5JH3 A;  3N3K A;  3AI8 A;  2R9O A;  3V6E A;  1STF E;  4MZS A;  1IWD A;  2ACT A;  3KFQ A;  4AXM A;  3BOW A;  2O6X A;  4QRV A;  4N79 A;  3KWZ A;  2PRE A;  3S3Q A;  1U9V A;  2GFO A;  2FO5 A;  1PPO A;  1BQI A;  1GMY A;  4OEM A;  3IMA A;  4X6J A;  2FQ9 A;  2PAD A;  5FPW A;  2BDZ A;  3OIS A;  2AS8 A;  4XUI A;  2HD5 A;  4P6G A;  4YYU A;  2C0Y A;  2FT2 A;  1ME3 A;  1AIM A;  3P5V A;  9PAP A;  1O0E A;  2DC8 A;  4MZO A;  4Q8H A;  4Q8G A;  3DF0 A;  1X9Y A;  3O1G A;  4X6H A;  3QT4 A;  3LFY A;  5A24 A;  1AYW A;  3ZUA A;  4PAD A;  4K7C A;  1CTE A;  3I06 A;  4FIP A;  2AVW A;  4PP2 E;  4BS5 A;  4G54 A;  1MIR A;  1A6R A;  2XU5 A;  3B79 A;  3U8E A;  1TL9 A;  1ICF A;  2DCB A;  3KW9 A;  5CHT A;  1S4V A;  1F29 A;  1CJL A;  1EWL A;  1PAD A;  4I05 A;  2FTD A;  4PI3 A;  3H8C A;  4P6E A;  4DMX A;  1BY8 A;  2DZZ A;  3HHA A;  2OUL A;  2AYO A;  1CV8 A;  2R9N A;  3QJ3 A;  3PNR A;  1F2C A;  5CHV A;  2G8E A;  3BPM A;  1CSB B;  4BPV A;  1ZIV A;  2AUZ A;  1PPD A;  3KSE A;  1M6D A;  3CH3 X;  3LXS A;  3H7D A;  2DJF B;  3F5V A;  3K24 A;  1KFU L;  1AYV A;  1NLJ A;  3O0U A;  2DC6 A;  3RVX A;  1THE A;  2DC9 A;  4BQV A;  2DJG B;  1YT7 A;  2G6D A;  2R9F A;  2PBH A;  1F2A A;  1VJV A;  8PCH A;  1EF7 A;  1F2B A;  2VHS A;  3BPF A;  2YJ8 A;  1DF0 A;  2JQG R;  3P5U A;  3V6C A;  1MHW A;  3N3G A;  1U9X A;  2F7D A;  1CQD A;  2B1M A;  2E01 A;  2R9C A;  1JQP A;  3IV2 A;  3MOR A;  1POP A;  1YAL A;  1PBH A;  1PXV A; 
#chains in the Genus database with same CATH topology
 4MI7 A;  4X6I A;  1NB3 A;  4CDC B;  3BB7 A;  5PAD A;  4YYV A;  2FUD A;  2NQI A;  2E00 A;  2NQD B;  3S3R A;  2H7J A;  3D6S A;  3MJ5 A;  2HHN A;  3HWN A;  2DOS A;  4YYR A;  3IHP A;  3HHI A;  3IOQ A;  1QXP A;  1AEC A;  2AGA A;  2IPP B;  3BCN A;  3PT2 A;  2CIO A;  2FRQ A;  4CDF B;  2E02 A;  3WXF A;  3CBK A;  4BOZ A;  2VHF A;  6PAD A;  1FH0 A;  2Y6E A;  2NQA A;  1HUC B;  4W5B A;  3WXG A;  2ATO A;  1NB5 A;  1BGO A;  1Q6K A;  2YJC A;  3OF8 A;  1ATK A;  2P7U A;  2E03 A;  1AU3 A;  2AU1 A;  3CBJ A;  4REZ A;  1AU2 A;  2BDL A;  1EWM A;  1TU6 A;  1ITO A;  5EGW A;  3P5W A;  3BY4 A;  3TNX A;  2GHU A;  2ARY A;  4D8B A;  2R9M A;  3I3T A;  2R6N A;  4CZW A;  3BC3 A;  1PIP A;  3B21 A;  1QMY A;  2XU1 A;  4M0W A;  5K16 A;  2AUX A;  4QRG A;  1PPP A;  4RY2 A;  3H6S A;  5CVN B;  3OVZ A;  5F02 A;  4FJC A;  5CVO B;  2HH5 A;  4CDD B;  4OVZ A;  4OEL A;  2OP3 A;  3H89 A;  3H8B A;  1ZCM A;  1DKI A;  1AU0 A;  1QOL A;  3N4C A;  1K3B B;  2B1N A;  2XU3 A;  4I07 A;  2JQF R;  4I04 A;  3ZNH A;  1YK7 A;  1XKG A;  4XR7 A;  4D8I A;  2G8J A;  1Y4H A;  2YJ9 A;  4FK5 A;  2AYN A;  3PDF A;  5J94 A;  4ZUX U;  4YV8 A;  2J7Q A;  1TLO A;  2JTC A;  4W5C A;  4YYS A;  3KX1 A;  2FYE A;  5JA7 A;  4AXL A;  2DCD A;  3OVX A;  4GUA A;  4QRX A;  4ZTB A;  3USV A;  3C9E A;  4BS6 A;  5EF4 A;  3E1Z B;  3KKU A;  4BOU A;  4PP1 A;  1SP4 B;  2HXZ A;  1AYU A;  3PBH A;  3BWK A;  4OVZ B;  1ME4 A;  5EZS A;  1CS8 A;  3PRP A;  4BOP A;  2DC7 A;  1MEM A;  3OQC A;  3K9M A;  3PSE A;  1SNK A;  3CH2 X;  5CVM A;  4QH6 A;  4WA6 A;  1PPN A;  4BSQ A;  1CVZ A;  3RNV A;  2Y5B A;  2DZY A;  1KXR A;  7PCK A;  1CPJ A;  4D8E A;  2DCA A;  1MDW A;  2HWK A;  2CB5 A;  4RF0 A;  2AIM A;  2PNS A;  3GCB A;  1KHQ A;  1NL6 A;  1UKF A;  1U9W A;  3IEJ A;  4HWY A;  2IBI A;  3TRK A;  4YYW A;  2YJB A;  1EWP A;  2XU4 A;  1Y08 A;  3ERV A;  3OF9 A;  2WBF X;  3RVW A;  4KLB A;  4CDE B;  4BOQ A;  4QBB A;  1U9Q X;  4N4Z A;  4RNA A;  3K8U A;  1GCB A;  2BTW A;  3IUT A;  4YVA A;  4DMY A;  1NPZ A;  2P86 A;  3KWB X;  4MSX A;  1VSN A;  2P0R A;  3MHH A;  3MHS A;  1QDQ A;  2BTW B;  4YYQ A;  1NQC A;  3RVV A;  2OZ2 A;  3PW3 A;  1YVB A;  3C0R A;  1KHP A;  1YK8 A;  2G7Y A;  1U5I A;  1GEC E;  2UZJ A;  2NQG A;  5E6J A;  1EWO A;  1AU4 A;  2FRA A;  2YJ2 A;  4R3D A;  4HXD B;  1PE6 A;  2JRI A;  4W4U A;  3F75 A;  1MEG A;  3MTN A;  4N8W A;  3WXE A;  3M99 A;  3HD3 A;  3NHE A;  2DCC A;  1MS6 A;  1KFX L;  3PHU A;  3P5X A;  1GLO A;  3PHX A;  1PCI A;  2F1G A;  1BP4 A;  1DEU A;  2Z84 A;  3QSD A;  1CB5 A;  5JH3 A;  3N3K A;  3AI8 A;  4WUR A;  4RF1 A;  2R9O A;  3V6E A;  1STF E;  4MZS A;  1IWD A;  2ACT A;  3KFQ A;  4AXM A;  3BOW A;  4A5U A;  2O6X A;  4QRV A;  4N79 A;  3KWZ A;  2PRE A;  3MTV A;  3S3Q A;  1U9V A;  2GFO A;  4P16 A;  2FO5 A;  1PPO A;  1BQI A;  1GMY A;  4OEM A;  3IMA A;  4X6J A;  2FQ9 A;  2PAD A;  4XUI A;  2BDZ A;  3OIS A;  2AS8 A;  5FPW A;  2HD5 A;  4P6G A;  4YYU A;  2C0Y A;  2FT2 A;  1ME3 A;  4RKX A;  2BU3 A;  1AIM A;  1PVJ A;  3P5V A;  3W31 A;  9PAP A;  1O0E A;  2DC8 A;  4MZO A;  5EZQ A;  4Q8H A;  3DF0 A;  3O1G A;  1X9Y A;  4Q8G A;  4X6H A;  5JZE A;  3QT4 A;  3LFY A;  5A24 A;  1AYW A;  3ZUA A;  4PAD A;  4K7C A;  1CTE A;  3I06 A;  4FIP A;  5KO3 A;  2AVW A;  4PP2 E;  4BS5 A;  4G54 A;  1MIR A;  1A6R A;  3O65 A;  3TMP A;  2XU5 A;  3B79 A;  3U8E A;  1TL9 A;  1ICF A;  2DCB A;  3KW9 A;  4MM3 B;  5CHT A;  1S4V A;  1F29 A;  1CJL A;  1EWL A;  1PAD A;  3IFU A;  4I05 A;  2FTD A;  4PI3 A;  3H8C A;  4P6E A;  3MP2 A;  4DMX A;  4IP3 A;  1BY8 A;  2DZZ A;  3HHA A;  2OUL A;  2AYO A;  1CV8 A;  2R9N A;  4OW0 A;  3QJ3 A;  3PNR A;  3E9S A;  1F2C A;  4PT5 A;  5CHV A;  3BBA A;  2G8E A;  3BPM A;  1CSB B;  4BPV A;  1ZIV A;  2AUZ A;  1PPD A;  4XZX A;  3KSE A;  1M6D A;  3CH3 X;  3LXS A;  3PRM A;  3H7D A;  2FE8 A;  2DJF B;  3F5V A;  3K24 A;  1KFU L;  1AYV A;  1NLJ A;  3O0U A;  2DC6 A;  3RVX A;  1THE A;  2DC9 A;  4BQV A;  2DJG B;  1YT7 A;  2G6D A;  2R9F A;  4BOS A;  2PBH A;  1F2A A;  1VJV A;  3W30 A;  8PCH A;  3PHW A;  1EF7 A;  1F2B A;  2VHS A;  3BPF A;  2YJ8 A;  1DF0 A;  2JQG R;  3P5U A;  3V6C A;  1MHW A;  3N3G A;  1U9X A;  2F7D A;  2J7Q C;  1CQD A;  2B1M A;  2E01 A;  1YZB A;  2R9C A;  1JQP A;  3IV2 A;  3MOR A;  4IUM A;  1POP A;  1YAL A;  1PBH A;  1PXV A; 
#chains in the Genus database with same CATH homology
 4X6I A;  2VFC A;  1NB3 A;  4CDC B;  5PAD A;  4YYV A;  2FUD A;  2NQI A;  2E00 A;  2NQD B;  3S3R A;  2H7J A;  3D6S A;  2HHN A;  3HWN A;  4YYR A;  3IHP A;  3HHI A;  3IOQ A;  1QXP A;  1AEC A;  2VFB A;  2IPP B;  3BCN A;  2CIO A;  2FRQ A;  4CDF B;  2E02 A;  3WXF A;  3CBK A;  4GUZ A;  2VHF A;  6PAD A;  1FH0 A;  2Y6E A;  2NQA A;  1HUC B;  4W5B A;  3WXG A;  2ATO A;  4B55 A;  1NB5 A;  1BGO A;  1Q6K A;  2YJC A;  3OF8 A;  1ATK A;  2P7U A;  2E03 A;  1AU3 A;  2AU1 A;  3CBJ A;  1AU2 A;  2BDL A;  1EWM A;  1TU6 A;  1ITO A;  5EGW A;  3P5W A;  4NV7 A;  3TNX A;  2GHU A;  2ARY A;  2R9M A;  3I3T A;  2R6N A;  4CZW A;  3BC3 A;  1PIP A;  1QMY A;  2XU1 A;  5K16 A;  2AUX A;  4QRG A;  1PPP A;  4RY2 A;  3H6S A;  5CVN B;  3OVZ A;  5F02 A;  4FJC A;  5CVO B;  2HH5 A;  4CDD B;  4OEL A;  2OP3 A;  3H89 A;  3H8B A;  1ZCM A;  1AU0 A;  1QOL A;  3N4C A;  4I07 A;  1K3B B;  2B1N A;  2XU3 A;  2JQF R;  4I04 A;  1YK7 A;  1XKG A;  4XR7 A;  2G8J A;  1Y4H A;  2YJ9 A;  4FK5 A;  2AYN A;  3PDF A;  5J94 A;  4ZUX U;  4YV8 A;  3D9W A;  1TLO A;  4YYS A;  4W5C A;  3KX1 A;  2FYE A;  5JA7 A;  4C5P A;  4AXL A;  2DCD A;  3OVX A;  4QRX A;  3USV A;  3C9E A;  4BS6 A;  5EF4 A;  3E1Z B;  3KKU A;  1W4T A;  4PP1 A;  1SP4 B;  2HXZ A;  1AYU A;  3PBH A;  3BWK A;  1ME4 A;  1CS8 A;  2DC7 A;  1MEM A;  3K9M A;  1SNK A;  3CH2 X;  5CVM A;  4QH6 A;  4WA6 A;  1PPN A;  4BSQ A;  1CVZ A;  2Y5B A;  2DZY A;  1KXR A;  7PCK A;  1CPJ A;  2DCA A;  1MDW A;  2CB5 A;  2AIM A;  2PNS A;  3GCB A;  1KHQ A;  1NL6 A;  1U9W A;  3IEJ A;  4HWY A;  2IBI A;  4YYW A;  2YJB A;  1EWP A;  2XU4 A;  1Y08 A;  3ERV A;  3OF9 A;  2WBF X;  3RVW A;  4KLB A;  4CDE B;  4QBB A;  1U9Q X;  4N4Z A;  3K8U A;  1GCB A;  3IUT A;  4YVA A;  4DMY A;  1NPZ A;  2P86 A;  3KWB X;  4MSX A;  1VSN A;  2P0R A;  3MHH A;  3MHS A;  2BSZ A;  1QDQ A;  4YYQ A;  1NQC A;  3RVV A;  2OZ2 A;  3PW3 A;  1YVB A;  1W5R A;  1KHP A;  1YK8 A;  2G7Y A;  1U5I A;  1GEC E;  2NQG A;  1EWO A;  1AU4 A;  2FRA A;  2YJ2 A;  1PE6 A;  4W4U A;  3F75 A;  1MEG A;  3MTN A;  4N8W A;  3WXE A;  3M99 A;  3HD3 A;  3NHE A;  2DCC A;  1MS6 A;  1KFX L;  3P5X A;  1GLO A;  1PCI A;  1W6F A;  2F1G A;  1BP4 A;  1DEU A;  3QSD A;  1CB5 A;  5JH3 A;  3N3K A;  3AI8 A;  2R9O A;  3V6E A;  1STF E;  4NV8 A;  4MZS A;  1IWD A;  2ACT A;  3KFQ A;  4AXM A;  3BOW A;  2O6X A;  4QRV A;  4N79 A;  3KWZ A;  2PRE A;  1GX3 A;  3S3Q A;  1U9V A;  2GFO A;  2FO5 A;  1PPO A;  1BQI A;  1GMY A;  4OEM A;  4BGF A;  3IMA A;  4X6J A;  2FQ9 A;  2PAD A;  5FPW A;  2BDZ A;  3OIS A;  2AS8 A;  4XUI A;  2HD5 A;  4P6G A;  4YYU A;  2C0Y A;  2FT2 A;  1ME3 A;  1AIM A;  3P5V A;  9PAP A;  1O0E A;  2DC8 A;  4MZO A;  4Q8H A;  4Q8G A;  3DF0 A;  1X9Y A;  3O1G A;  4X6H A;  3QT4 A;  3LFY A;  5A24 A;  1AYW A;  3ZUA A;  4PAD A;  4K7C A;  1CTE A;  3I06 A;  4FIP A;  2AVW A;  4PP2 E;  4BS5 A;  4G54 A;  1MIR A;  1A6R A;  1E2T A;  2XU5 A;  3B79 A;  3U8E A;  1TL9 A;  1ICF A;  2DCB A;  3KW9 A;  5CHT A;  1S4V A;  1F29 A;  1CJL A;  1EWL A;  1PAD A;  4I05 A;  2FTD A;  4PI3 A;  3H8C A;  4P6E A;  4DMX A;  1BY8 A;  2DZZ A;  3HHA A;  2OUL A;  2AYO A;  1CV8 A;  2R9N A;  3QJ3 A;  3PNR A;  1F2C A;  5CHV A;  3LTW A;  2G8E A;  3BPM A;  1CSB B;  4BPV A;  1ZIV A;  2AUZ A;  1PPD A;  3KSE A;  1M6D A;  3CH3 X;  3LXS A;  3H7D A;  2DJF B;  3F5V A;  3K24 A;  1KFU L;  1AYV A;  1NLJ A;  3O0U A;  2DC6 A;  3RVX A;  1THE A;  2DC9 A;  4BQV A;  2DJG B;  1YT7 A;  2G6D A;  2R9F A;  2PBH A;  1F2A A;  1VJV A;  8PCH A;  1EF7 A;  1F2B A;  2VHS A;  3BPF A;  2YJ8 A;  1DF0 A;  2JQG R;  3P5U A;  3V6C A;  1MHW A;  3N3G A;  1U9X A;  2F7D A;  1CQD A;  2B1M A;  2E01 A;  2R9C A;  1JQP A;  3IV2 A;  3MOR A;  1POP A;  1YAL A;  1PBH A;  1PXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...