2R6NA

Crystal structure of a pyrrolopyrimidine inhibitor in complex with human cathepsin k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Novel scaffold for cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r6nA00
3PBHA 1YALA 3WXEA 2XU4A 2F7DA 2C0YA 5EGWA 3U8EA 1PE6A 1AU0A 2R9CA 1U9XA 2AUZA 2FO5A 5J94A 1NB5A 2R6NA 1ZIVA 3F75A 1BGOA 2E00A 1GECE 1EWLA 1S4VA 4CZWA 4BSQA 5CHVA 4W4UA 2GFOA 1U9QX 2FYEA 3N4CA 3F5VA 1F2BA 3OF8A 3H89A 4YYRA 4W5CA 7PCKA 2DCBA 4BQVA 1POPA 1U9WA 4PADA 1F2AA 2AU1A 4N4ZA 1BP4A 4X6JA 3KW9A 2Y5BA 2P0RA 2FRAA 1VSNA 2B1NA 2DC9A 1EWMA 1PPNA 3LFYA 2F1GA 1YK8A 1JQPA 1NLJA 3K24A 4YV8A 2YJ8A 1PCIA 2XU1A 3CBJA 4I04A 1AU2A 4G54A 2ACTA 5CVMA 1QXPA 3N3GA 4CDCB 2DC8A 4I07A 3HHAA 1AIMA 2CB5A 4PP1A 1CTEA 1SP4B 1CQDA 3PDFA 1KFXL 2DJGB 4P6EA 1EWPA 3I06A 2YJBA 4XUIA 3RVVA 2G8EA 3BOWA 3C9EA 4FJCA 4DMXA 4BS5A 1FH0A 3IMAA 4AXMA 4AXLA 1PBHA 4MSXA 5CHTA 1ME4A 1CS8A 3H6SA 3K8UA 1SNKA 1QOLA 3KWBX 3K9MA 3HWNA 1ATKA 2ARYA 4Q8GA 4RY2A 5EF4A 2DCCA 4YVAA 2FRQA 3BPFA 1KHPA 2ATOA 4FK5A 1M6DA 1MHWA 1U5IA 1YVBA 3KWZA 1NQCA 1TU6A 4CDEB 3I3TA 3CH2X 3N3KA 4QH6A 2DCAA 2OZ2A 2E03A 1NL6A 1TLOA 2BDLA 1AYVA 1TL9A 2G7YA 2G8JA 1AU4A 2R9NA 4DMYA 4QRVA 1CPJA 1Y4HA 4W5BA 2AS8A 2HH5A 3TNXA 2DZYA 3MHSA 2NQDB 1AYUA 3KSEA 4CDFB 1VJVA 4YYVA 3HD3A 3OISA 3S3QA 1ME3A 3NHEA 2DC7A 1KXRA 1F2CA 3KKUA 2FT2A 3E1ZB 1MDWA 4HWYA 2NQAA 3OF9A 3QJ3A 1GLOA 3OVZA 3RVXA 4KLBA 2R9OA 1QDQA 1K3BB 2B1MA 2DJFB 3QSDA 3KFQA 5FPWA 4I05A 3H7DA 1CVZA 2FTDA 1DF0A 3BC3A 2E02A 4K7CA 3MORA 6PADA 3H8BA 4FIPA 3KX1A 1AYWA 4P6GA 3P5UA 2OULA 3CH3X 1EWOA 3P5WA 3ERVA 2O6XA 2BDZA 2VHSA 2AUXA 1Y08A 1PXVA 4QRXA 2H7JA 2HXZA 4PP2E 2JQGR 2YJCA 2AIMA 2IPPB 3PNRA 1X9YA 3DF0A 4X6HA 2HHNA 3V6EA 2DC6A 1EF7A 4XR7A 3IUTA 3V6CA 1O0EA 3CBKA 1YK7A 2CIOA 2PADA 1KFUL 3BCNA 3QT4A 5A24A 2PBHA 5PADA 1MS6A 5F02A 2HD5A 3IV2A 1BY8A 3MHHA 2P7UA 1YT7A 3AI8A 2AVWA 2WBFX 2Y6EA 1GCBA 1ZCMA 2E01A 2PNSA 1PPOA 2NQGA 2FQ9A 1U9VA 1Q6KA 4QRGA 1F29A 4WA6A 1GMYA 4BS6A 3O1GA 4PI3A 4Q8HA 1DEUA 1PADA 2JQFR 5CVOB 3P5VA 4OELA 2R9FA 1A6RA 3WXGA 2XU5A 3LXSA 2R9MA 3P5XA 4N79A 5JH3A 8PCHA 4OEMA 5JA7A 3D6SA 1AU3A 3IOQA 4N8WA 3ZUAA 1THEA 4QBBA 2GHUA 3S3RA 1KHQA 9PAPA 1STFE 1AECA 2VHFA 3H8CA 3BWKA 4BPVA 1QMYA 2YJ2A 4YYQA 4YYUA 5K16A 2NQIA 3RVWA 1CSBB 5CVNB 1IWDA 3USVA 2P86A 2DZZA 3HHIA 4CDDB 3O0UA 2IBIA 1ITOA 2AYNA 3M99A 1CV8A 3IHPA 4YYSA 1PPPA 1CB5A 4ZUXU 4MZSA 2PREA 4MZOA 1PPDA 3GCBA 1MIRA 2G6DA 1NPZA 2XU3A 3B79A 1ICFA 1CJLA 1MEGA 2YJ9A 1NB3A 4YYWA 2DCDA 3WXFA 1BQIA 3PW3A 3BPMA 1HUCB 3OVXA 1MEMA 3MTNA 2AYOA 2OP3A 4X6IA 3IEJA 1PIPA 2FUDA 1XKGA
chains in the Genus database with same CATH superfamily
3PBHA 1YALA 3WXEA 2XU4A 2F7DA 4RF1A 2C0YA 5EGWA 3U8EA 1PE6A 1AU0A 2R9CA 1U9XA 3TRKA 2AUZA 2FO5A 5J94A 1NB5A 2R6NA 1ZIVA 3F75A 1BGOA 2E00A 1GECE 1EWLA 1S4VA 4CZWA 3PHUA 4BSQA 4HXDB 5CHVA 4OVZB 4W4UA 2GFOA 4ZTBA 1U9QX 2FYEA 3N4CA 3F5VA 1F2BA 3OF8A 3H89A 4D8BA 4YYRA 4W5CA 4BOPA 7PCKA 2DCBA 1DKIA 4BQVA 1POPA 1U9WA 4PADA 4R3DA 1F2AA 2AU1A 4N4ZA 1BP4A 4X6JA 3KW9A 2Y5BA 1UKFA 2FRAA 2P0RA 1VSNA 2B1NA 2DC9A 1EWMA 1PPNA 3BB7A 3PRMA 4MM3B 3LFYA 2F1GA 1YK8A 1JQPA 2BTWA 3B21A 1NLJA 3K24A 4YV8A 2YJ8A 1PCIA 2XU1A 3CBJA 4RF0A 4I04A 1AU2A 4G54A 2ACTA 5CVMA 1QXPA 3N3GA 4CDCB 2DC8A 4I07A 3HHAA 1AIMA 2CB5A 1CTEA 4PP1A 1SP4B 1CQDA 3PDFA 1KFXL 2JRIA 2DJGB 4WURA 1EWPA 4P6EA 3I06A 2YJBA 4XUIA 3RVVA 2G8EA 3BOWA 3C9EA 4FJCA 4DMXA 4BS5A 4PT5A 1FH0A 3OQCA 3IMAA 4AXMA 4AXLA 2JTCA 1PBHA 4MSXA 5CHTA 1ME4A 1YZBA 1CS8A 3H6SA 3K8UA 1SNKA 3PHWA 1QOLA 3KWBX 3K9MA 3HWNA 1ATKA 2ARYA 4Q8GA 4RY2A 5EF4A 2DCCA 4YVAA 2FRQA 3BPFA 1KHPA 2ATOA 4FK5A 4BOUA 1M6DA 3W31A 1MHWA 3E9SA 3MJ5A 1U5IA 1YVBA 5EZQA 4BOSA 2Z84A 3KWZA 1NQCA 1TU6A 4CDEB 3I3TA 3CH2X 3N3KA 4QH6A 2DCAA 2OZ2A 2E03A 1NL6A 1TLOA 3ZNHA 2BDLA 4D8EA 1AYVA 1TL9A 2G7YA 4BOQA 2G8JA 1AU4A 2HWKA 2R9NA 4M0WA 4QRVA 4DMYA 1CPJA 1Y4HA 4W5BA 2AS8A 2HH5A 3TNXA 2DZYA 3MHSA 4RNAA 2NQDB 1AYUA 3KSEA 4CDFB 1VJVA 4YYVA 3HD3A 3OISA 3S3QA 5JZEA 1ME3A 3NHEA 2DC7A 1KXRA 1F2CA 3KKUA 2FT2A 3E1ZB 1MDWA 3PSEA 4HWYA 2NQAA 3OF9A 3QJ3A 3O65A 1GLOA 3OVZA 3RVXA 4KLBA 3MP2A 4IUMA 2R9OA 1QDQA 1K3BB 2B1MA 2DJFB 3QSDA 3KFQA 5FPWA 4I05A 3H7DA 1CVZA 4A5UA 3IFUA 2FTDA 1DF0A 2J7QA 3BC3A 2E02A 3W30A 4K7CA 3MORA 4XZXA 6PADA 3H8BA 4FIPA 3KX1A 1AYWA 4P6GA 3P5UA 2OULA 3CH3X 1EWOA 3P5WA 2BU3A 4REZA 2BTWB 3ERVA 2O6XA 2BDZA 4D8IA 2VHSA 2AUXA 1Y08A 1PXVA 4QRXA 2H7JA 2HXZA 4PP2E 2JQGR 4OVZA 2YJCA 2J7QC 2AIMA 2IPPB 3PNRA 3TMPA 1X9YA 3DF0A 4X6HA 2HHNA 3V6EA 2DC6A 1EF7A 2DOSA 3BY4A 4XR7A 3IUTA 3V6CA 1O0EA 3CBKA 1YK7A 2CIOA 2FE8A 2PADA 1KFUL 3BBAA 3BCNA 3QT4A 5A24A 4OW0A 2PBHA 5PADA 1MS6A 3C0RA 5F02A 2HD5A 3IV2A 1BY8A 3MHHA 2P7UA 1YT7A 3AI8A 2AVWA 2WBFX 2Y6EA 1GCBA 1ZCMA 2E01A 2PNSA 1PPOA 2NQGA 2FQ9A 1U9VA 1Q6KA 4QRGA 5KO3A 1F29A 4WA6A 1GMYA 4BS6A 3O1GA 4PI3A 4Q8HA 1DEUA 1PADA 2JQFR 5CVOB 3P5VA 4OELA 3PT2A 2R9FA 1A6RA 3WXGA 2XU5A 3LXSA 2R9MA 3P5XA 4N79A 5JH3A 8PCHA 4OEMA 5JA7A 3D6SA 1AU3A 3IOQA 4N8WA 4GUAA 3ZUAA 1THEA 4QBBA 2GHUA 3S3RA 1KHQA 9PAPA 1STFE 1AECA 2VHFA 3H8CA 3BWKA 5E6JA 4BPVA 1QMYA 2YJ2A 4YYQA 3PHXA 4YYUA 4IP3A 3MTVA 5K16A 2NQIA 3RVWA 1CSBB 5CVNB 4BOZA 1IWDA 3USVA 2P86A 2DZZA 3HHIA 4CDDB 3O0UA 2IBIA 4RKXA 1ITOA 2AGAA 2AYNA 3M99A 1CV8A 3IHPA 4YYSA 5EZSA 1PPPA 1CB5A 4ZUXU 4MZSA 1PVJA 2PREA 4MZOA 1PPDA 3GCBA 3PRPA 1MIRA 2G6DA 1NPZA 4P16A 2XU3A 4MI7A 3B79A 1ICFA 1CJLA 1MEGA 2YJ9A 1NB3A 4YYWA 2DCDA 2UZJA 3WXFA 1BQIA 3PW3A 3BPMA 1HUCB 3OVXA 1MEMA 3MTNA 3RNVA 2AYOA 2OP3A 4X6IA 3IEJA 1PIPA 2FUDA 1XKGA
chains in the Genus database with same CATH topology
3PBHA 1YALA 3WXEA 2XU4A 2F7DA 2C0YA 5EGWA 3U8EA 1PE6A 1AU0A 2R9CA 1U9XA 2AUZA 2FO5A 5J94A 1NB5A 2R6NA 1ZIVA 3F75A 1BGOA 2E00A 1GECE 1EWLA 1S4VA 4CZWA 4BSQA 5CHVA 4W4UA 2GFOA 1U9QX 2FYEA 4NV7A 3N4CA 3F5VA 1F2BA 3OF8A 3H89A 4YYRA 4W5CA 7PCKA 2DCBA 4BQVA 1POPA 1U9WA 4PADA 1F2AA 1W5RA 2AU1A 4N4ZA 1BP4A 4X6JA 3KW9A 2Y5BA 2P0RA 2FRAA 1VSNA 2B1NA 2DC9A 1EWMA 1PPNA 3LFYA 2F1GA 1YK8A 1JQPA 1NLJA 3K24A 4YV8A 2YJ8A 1PCIA 2XU1A 3CBJA 4I04A 1AU2A 4G54A 2ACTA 5CVMA 1QXPA 3N3GA 4CDCB 2DC8A 4I07A 3HHAA 1AIMA 2CB5A 1CTEA 4PP1A 1SP4B 1CQDA 3PDFA 1KFXL 2DJGB 1EWPA 4P6EA 3I06A 2YJBA 4XUIA 3RVVA 2G8EA 3BOWA 3C9EA 4FJCA 4GUZA 4DMXA 4BS5A 1FH0A 3IMAA 4AXMA 4AXLA 1PBHA 2VFCA 4MSXA 5CHTA 1ME4A 1CS8A 3H6SA 3K8UA 1SNKA 1QOLA 3KWBX 1E2TA 3K9MA 3HWNA 1ATKA 2ARYA 4Q8GA 2BSZA 4RY2A 5EF4A 2DCCA 4YVAA 1W6FA 2FRQA 3BPFA 1KHPA 2ATOA 4FK5A 1M6DA 1MHWA 1U5IA 3LTWA 1YVBA 3KWZA 1NQCA 1TU6A 4CDEB 3I3TA 3CH2X 3N3KA 4QH6A 2DCAA 2OZ2A 2E03A 1NL6A 1TLOA 2BDLA 1AYVA 1TL9A 2G7YA 2G8JA 1AU4A 2R9NA 4DMYA 4QRVA 1CPJA 1Y4HA 4C5PA 4W5BA 2AS8A 2HH5A 3TNXA 2DZYA 3MHSA 2NQDB 1AYUA 3KSEA 4CDFB 1VJVA 4B55A 4YYVA 3HD3A 3OISA 3S3QA 1ME3A 3NHEA 2DC7A 1KXRA 1F2CA 3KKUA 2FT2A 3E1ZB 1MDWA 4HWYA 2NQAA 3OF9A 3QJ3A 1GLOA 3OVZA 3RVXA 4KLBA 1GX3A 2R9OA 1QDQA 1K3BB 2B1MA 2DJFB 3QSDA 3KFQA 5FPWA 4I05A 3H7DA 1CVZA 2FTDA 1DF0A 3BC3A 2E02A 4K7CA 3MORA 6PADA 3H8BA 4FIPA 3KX1A 1AYWA 4P6GA 3P5UA 2OULA 3CH3X 1EWOA 3P5WA 3ERVA 2O6XA 2BDZA 2VHSA 2AUXA 1Y08A 1PXVA 4QRXA 2H7JA 2HXZA 4PP2E 2JQGR 2YJCA 2AIMA 2IPPB 3PNRA 4NV8A 1X9YA 3DF0A 4X6HA 2HHNA 3V6EA 2DC6A 1EF7A 4XR7A 3IUTA 3V6CA 1O0EA 3CBKA 1YK7A 2CIOA 2PADA 1KFUL 3BCNA 3QT4A 5A24A 2PBHA 5PADA 1MS6A 5F02A 2HD5A 3IV2A 1BY8A 3MHHA 2P7UA 1YT7A 3AI8A 2AVWA 2WBFX 2Y6EA 1GCBA 1ZCMA 2VFBA 2E01A 2PNSA 1PPOA 2NQGA 2FQ9A 1U9VA 1Q6KA 4QRGA 1F29A 4WA6A 1GMYA 4BS6A 3O1GA 4PI3A 4Q8HA 1DEUA 1PADA 2JQFR 5CVOB 3P5VA 4OELA 4BGFA 2R9FA 1A6RA 3WXGA 2XU5A 3LXSA 2R9MA 3P5XA 4N79A 5JH3A 8PCHA 4OEMA 5JA7A 3D6SA 1AU3A 3IOQA 4N8WA 3ZUAA 1THEA 4QBBA 2GHUA 1W4TA 3S3RA 1KHQA 9PAPA 1STFE 1AECA 2VHFA 3H8CA 3BWKA 4BPVA 1QMYA 2YJ2A 4YYQA 4YYUA 5K16A 2NQIA 3RVWA 1CSBB 5CVNB 1IWDA 3USVA 2P86A 2DZZA 3HHIA 4CDDB 3O0UA 2IBIA 1ITOA 3D9WA 2AYNA 3M99A 1CV8A 3IHPA 4YYSA 1PPPA 1CB5A 4ZUXU 4MZSA 2PREA 4MZOA 1PPDA 3GCBA 1MIRA 2G6DA 1NPZA 2XU3A 3B79A 1ICFA 1CJLA 1MEGA 2YJ9A 1NB3A 4YYWA 2DCDA 3WXFA 1BQIA 3PW3A 3BPMA 1HUCB 3OVXA 1MEMA 3MTNA 2AYOA 2OP3A 4X6IA 3IEJA 1PIPA 2FUDA 1XKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBH A;  1YAL A;  3WXE A;  2XU4 A;  2F7D A;  2C0Y A;  5EGW A;  3U8E A;  1PE6 A;  1AU0 A;  2R9C A;  1U9X A;  2AUZ A;  2FO5 A;  5J94 A;  1NB5 A;  2R6N A;  1ZIV A;  3F75 A;  1BGO A;  2E00 A;  1GEC E;  1EWL A;  1S4V A;  4CZW A;  4BSQ A;  5CHV A;  4W4U A;  2GFO A;  1U9Q X;  2FYE A;  3N4C A;  3F5V A;  1F2B A;  3OF8 A;  3H89 A;  4YYR A;  4W5C A;  7PCK A;  2DCB A;  4BQV A;  1POP A;  1U9W A;  4PAD A;  1F2A A;  2AU1 A;  4N4Z A;  1BP4 A;  4X6J A;  3KW9 A;  2Y5B A;  2P0R A;  2FRA A;  1VSN A;  2B1N A;  2DC9 A;  1EWM A;  1PPN A;  3LFY A;  2F1G A;  1YK8 A;  1JQP A;  1NLJ A;  3K24 A;  4YV8 A;  2YJ8 A;  1PCI A;  2XU1 A;  3CBJ A;  4I04 A;  1AU2 A;  4G54 A;  2ACT A;  5CVM A;  1QXP A;  3N3G A;  4CDC B;  2DC8 A;  4I07 A;  3HHA A;  1AIM A;  2CB5 A;  4PP1 A;  1CTE A;  1SP4 B;  1CQD A;  3PDF A;  1KFX L;  2DJG B;  4P6E A;  1EWP A;  3I06 A;  2YJB A;  4XUI A;  3RVV A;  2G8E A;  3BOW A;  3C9E A;  4FJC A;  4DMX A;  4BS5 A;  1FH0 A;  3IMA A;  4AXM A;  4AXL A;  1PBH A;  4MSX A;  5CHT A;  1ME4 A;  1CS8 A;  3H6S A;  3K8U A;  1SNK A;  1QOL A;  3KWB X;  3K9M A;  3HWN A;  1ATK A;  2ARY A;  4Q8G A;  4RY2 A;  5EF4 A;  2DCC A;  4YVA A;  2FRQ A;  3BPF A;  1KHP A;  2ATO A;  4FK5 A;  1M6D A;  1MHW A;  1U5I A;  1YVB A;  3KWZ A;  1NQC A;  1TU6 A;  4CDE B;  3I3T A;  3CH2 X;  3N3K A;  4QH6 A;  2DCA A;  2OZ2 A;  2E03 A;  1NL6 A;  1TLO A;  2BDL A;  1AYV A;  1TL9 A;  2G7Y A;  2G8J A;  1AU4 A;  2R9N A;  4DMY A;  4QRV A;  1CPJ A;  1Y4H A;  4W5B A;  2AS8 A;  2HH5 A;  3TNX A;  2DZY A;  3MHS A;  2NQD B;  1AYU A;  3KSE A;  4CDF B;  1VJV A;  4YYV A;  3HD3 A;  3OIS A;  3S3Q A;  1ME3 A;  3NHE A;  2DC7 A;  1KXR A;  1F2C A;  3KKU A;  2FT2 A;  3E1Z B;  1MDW A;  4HWY A;  2NQA A;  3OF9 A;  3QJ3 A;  1GLO A;  3OVZ A;  3RVX A;  4KLB A;  2R9O A;  1QDQ A;  1K3B B;  2B1M A;  2DJF B;  3QSD A;  3KFQ A;  5FPW A;  4I05 A;  3H7D A;  1CVZ A;  2FTD A;  1DF0 A;  3BC3 A;  2E02 A;  4K7C A;  3MOR A;  6PAD A;  3H8B A;  4FIP A;  3KX1 A;  1AYW A;  4P6G A;  3P5U A;  2OUL A;  3CH3 X;  1EWO A;  3P5W A;  3ERV A;  2O6X A;  2BDZ A;  2VHS A;  2AUX A;  1Y08 A;  1PXV A;  4QRX A;  2H7J A;  2HXZ A;  4PP2 E;  2JQG R;  2YJC A;  2AIM A;  2IPP B;  3PNR A;  1X9Y A;  3DF0 A;  4X6H A;  2HHN A;  3V6E A;  2DC6 A;  1EF7 A;  4XR7 A;  3IUT A;  3V6C A;  1O0E A;  3CBK A;  1YK7 A;  2CIO A;  2PAD A;  1KFU L;  3BCN A;  3QT4 A;  5A24 A;  2PBH A;  5PAD A;  1MS6 A;  5F02 A;  2HD5 A;  3IV2 A;  1BY8 A;  3MHH A;  2P7U A;  1YT7 A;  3AI8 A;  2AVW A;  2WBF X;  2Y6E A;  1GCB A;  1ZCM A;  2E01 A;  2PNS A;  1PPO A;  2NQG A;  2FQ9 A;  1U9V A;  1Q6K A;  4QRG A;  1F29 A;  4WA6 A;  1GMY A;  4BS6 A;  3O1G A;  4PI3 A;  4Q8H A;  1DEU A;  1PAD A;  2JQF R;  5CVO B;  3P5V A;  4OEL A;  2R9F A;  1A6R A;  3WXG A;  2XU5 A;  3LXS A;  2R9M A;  3P5X A;  4N79 A;  5JH3 A;  8PCH A;  4OEM A;  5JA7 A;  3D6S A;  1AU3 A;  3IOQ A;  4N8W A;  3ZUA A;  1THE A;  4QBB A;  2GHU A;  3S3R A;  1KHQ A;  9PAP A;  1STF E;  1AEC A;  2VHF A;  3H8C A;  3BWK A;  4BPV A;  1QMY A;  2YJ2 A;  4YYQ A;  4YYU A;  5K16 A;  2NQI A;  3RVW A;  1CSB B;  5CVN B;  1IWD A;  3USV A;  2P86 A;  2DZZ A;  3HHI A;  4CDD B;  3O0U A;  2IBI A;  1ITO A;  2AYN A;  3M99 A;  1CV8 A;  3IHP A;  4YYS A;  1PPP A;  1CB5 A;  4ZUX U;  4MZS A;  2PRE A;  4MZO A;  1PPD A;  3GCB A;  1MIR A;  2G6D A;  1NPZ A;  2XU3 A;  3B79 A;  1ICF A;  1CJL A;  1MEG A;  2YJ9 A;  1NB3 A;  4YYW A;  2DCD A;  3WXF A;  1BQI A;  3PW3 A;  3BPM A;  1HUC B;  3OVX A;  1MEM A;  3MTN A;  2AYO A;  2OP3 A;  4X6I A;  3IEJ A;  1PIP A;  2FUD A;  1XKG A; 
#chains in the Genus database with same CATH topology
 3PBH A;  1YAL A;  3WXE A;  2XU4 A;  2F7D A;  4RF1 A;  2C0Y A;  5EGW A;  3U8E A;  1PE6 A;  1AU0 A;  2R9C A;  1U9X A;  3TRK A;  2AUZ A;  2FO5 A;  5J94 A;  1NB5 A;  2R6N A;  1ZIV A;  3F75 A;  1BGO A;  2E00 A;  1GEC E;  1EWL A;  1S4V A;  4CZW A;  3PHU A;  4BSQ A;  4HXD B;  5CHV A;  4OVZ B;  4W4U A;  2GFO A;  4ZTB A;  1U9Q X;  2FYE A;  3N4C A;  3F5V A;  1F2B A;  3OF8 A;  3H89 A;  4D8B A;  4YYR A;  4W5C A;  4BOP A;  7PCK A;  2DCB A;  1DKI A;  4BQV A;  1POP A;  1U9W A;  4PAD A;  4R3D A;  1F2A A;  2AU1 A;  4N4Z A;  1BP4 A;  4X6J A;  3KW9 A;  2Y5B A;  1UKF A;  2FRA A;  2P0R A;  1VSN A;  2B1N A;  2DC9 A;  1EWM A;  1PPN A;  3BB7 A;  3PRM A;  4MM3 B;  3LFY A;  2F1G A;  1YK8 A;  1JQP A;  2BTW A;  3B21 A;  1NLJ A;  3K24 A;  4YV8 A;  2YJ8 A;  1PCI A;  2XU1 A;  3CBJ A;  4RF0 A;  4I04 A;  1AU2 A;  4G54 A;  2ACT A;  5CVM A;  1QXP A;  3N3G A;  4CDC B;  2DC8 A;  4I07 A;  3HHA A;  1AIM A;  2CB5 A;  1CTE A;  4PP1 A;  1SP4 B;  1CQD A;  3PDF A;  1KFX L;  2JRI A;  2DJG B;  4WUR A;  1EWP A;  4P6E A;  3I06 A;  2YJB A;  4XUI A;  3RVV A;  2G8E A;  3BOW A;  3C9E A;  4FJC A;  4DMX A;  4BS5 A;  4PT5 A;  1FH0 A;  3OQC A;  3IMA A;  4AXM A;  4AXL A;  2JTC A;  1PBH A;  4MSX A;  5CHT A;  1ME4 A;  1YZB A;  1CS8 A;  3H6S A;  3K8U A;  1SNK A;  3PHW A;  1QOL A;  3KWB X;  3K9M A;  3HWN A;  1ATK A;  2ARY A;  4Q8G A;  4RY2 A;  5EF4 A;  2DCC A;  4YVA A;  2FRQ A;  3BPF A;  1KHP A;  2ATO A;  4FK5 A;  4BOU A;  1M6D A;  3W31 A;  1MHW A;  3E9S A;  3MJ5 A;  1U5I A;  1YVB A;  5EZQ A;  4BOS A;  2Z84 A;  3KWZ A;  1NQC A;  1TU6 A;  4CDE B;  3I3T A;  3CH2 X;  3N3K A;  4QH6 A;  2DCA A;  2OZ2 A;  2E03 A;  1NL6 A;  1TLO A;  3ZNH A;  2BDL A;  4D8E A;  1AYV A;  1TL9 A;  2G7Y A;  4BOQ A;  2G8J A;  1AU4 A;  2HWK A;  2R9N A;  4M0W A;  4QRV A;  4DMY A;  1CPJ A;  1Y4H A;  4W5B A;  2AS8 A;  2HH5 A;  3TNX A;  2DZY A;  3MHS A;  4RNA A;  2NQD B;  1AYU A;  3KSE A;  4CDF B;  1VJV A;  4YYV A;  3HD3 A;  3OIS A;  3S3Q A;  5JZE A;  1ME3 A;  3NHE A;  2DC7 A;  1KXR A;  1F2C A;  3KKU A;  2FT2 A;  3E1Z B;  1MDW A;  3PSE A;  4HWY A;  2NQA A;  3OF9 A;  3QJ3 A;  3O65 A;  1GLO A;  3OVZ A;  3RVX A;  4KLB A;  3MP2 A;  4IUM A;  2R9O A;  1QDQ A;  1K3B B;  2B1M A;  2DJF B;  3QSD A;  3KFQ A;  5FPW A;  4I05 A;  3H7D A;  1CVZ A;  4A5U A;  3IFU A;  2FTD A;  1DF0 A;  2J7Q A;  3BC3 A;  2E02 A;  3W30 A;  4K7C A;  3MOR A;  4XZX A;  6PAD A;  3H8B A;  4FIP A;  3KX1 A;  1AYW A;  4P6G A;  3P5U A;  2OUL A;  3CH3 X;  1EWO A;  3P5W A;  2BU3 A;  4REZ A;  2BTW B;  3ERV A;  2O6X A;  2BDZ A;  4D8I A;  2VHS A;  2AUX A;  1Y08 A;  1PXV A;  4QRX A;  2H7J A;  2HXZ A;  4PP2 E;  2JQG R;  4OVZ A;  2YJC A;  2J7Q C;  2AIM A;  2IPP B;  3PNR A;  3TMP A;  1X9Y A;  3DF0 A;  4X6H A;  2HHN A;  3V6E A;  2DC6 A;  1EF7 A;  2DOS A;  3BY4 A;  4XR7 A;  3IUT A;  3V6C A;  1O0E A;  3CBK A;  1YK7 A;  2CIO A;  2FE8 A;  2PAD A;  1KFU L;  3BBA A;  3BCN A;  3QT4 A;  5A24 A;  4OW0 A;  2PBH A;  5PAD A;  1MS6 A;  3C0R A;  5F02 A;  2HD5 A;  3IV2 A;  1BY8 A;  3MHH A;  2P7U A;  1YT7 A;  3AI8 A;  2AVW A;  2WBF X;  2Y6E A;  1GCB A;  1ZCM A;  2E01 A;  2PNS A;  1PPO A;  2NQG A;  2FQ9 A;  1U9V A;  1Q6K A;  4QRG A;  5KO3 A;  1F29 A;  4WA6 A;  1GMY A;  4BS6 A;  3O1G A;  4PI3 A;  4Q8H A;  1DEU A;  1PAD A;  2JQF R;  5CVO B;  3P5V A;  4OEL A;  3PT2 A;  2R9F A;  1A6R A;  3WXG A;  2XU5 A;  3LXS A;  2R9M A;  3P5X A;  4N79 A;  5JH3 A;  8PCH A;  4OEM A;  5JA7 A;  3D6S A;  1AU3 A;  3IOQ A;  4N8W A;  4GUA A;  3ZUA A;  1THE A;  4QBB A;  2GHU A;  3S3R A;  1KHQ A;  9PAP A;  1STF E;  1AEC A;  2VHF A;  3H8C A;  3BWK A;  5E6J A;  4BPV A;  1QMY A;  2YJ2 A;  4YYQ A;  3PHX A;  4YYU A;  4IP3 A;  3MTV A;  5K16 A;  2NQI A;  3RVW A;  1CSB B;  5CVN B;  4BOZ A;  1IWD A;  3USV A;  2P86 A;  2DZZ A;  3HHI A;  4CDD B;  3O0U A;  2IBI A;  4RKX A;  1ITO A;  2AGA A;  2AYN A;  3M99 A;  1CV8 A;  3IHP A;  4YYS A;  5EZS A;  1PPP A;  1CB5 A;  4ZUX U;  4MZS A;  1PVJ A;  2PRE A;  4MZO A;  1PPD A;  3GCB A;  3PRP A;  1MIR A;  2G6D A;  1NPZ A;  4P16 A;  2XU3 A;  4MI7 A;  3B79 A;  1ICF A;  1CJL A;  1MEG A;  2YJ9 A;  1NB3 A;  4YYW A;  2DCD A;  2UZJ A;  3WXF A;  1BQI A;  3PW3 A;  3BPM A;  1HUC B;  3OVX A;  1MEM A;  3MTN A;  3RNV A;  2AYO A;  2OP3 A;  4X6I A;  3IEJ A;  1PIP A;  2FUD A;  1XKG A; 
#chains in the Genus database with same CATH homology
 3PBH A;  1YAL A;  3WXE A;  2XU4 A;  2F7D A;  2C0Y A;  5EGW A;  3U8E A;  1PE6 A;  1AU0 A;  2R9C A;  1U9X A;  2AUZ A;  2FO5 A;  5J94 A;  1NB5 A;  2R6N A;  1ZIV A;  3F75 A;  1BGO A;  2E00 A;  1GEC E;  1EWL A;  1S4V A;  4CZW A;  4BSQ A;  5CHV A;  4W4U A;  2GFO A;  1U9Q X;  2FYE A;  4NV7 A;  3N4C A;  3F5V A;  1F2B A;  3OF8 A;  3H89 A;  4YYR A;  4W5C A;  7PCK A;  2DCB A;  4BQV A;  1POP A;  1U9W A;  4PAD A;  1F2A A;  1W5R A;  2AU1 A;  4N4Z A;  1BP4 A;  4X6J A;  3KW9 A;  2Y5B A;  2P0R A;  2FRA A;  1VSN A;  2B1N A;  2DC9 A;  1EWM A;  1PPN A;  3LFY A;  2F1G A;  1YK8 A;  1JQP A;  1NLJ A;  3K24 A;  4YV8 A;  2YJ8 A;  1PCI A;  2XU1 A;  3CBJ A;  4I04 A;  1AU2 A;  4G54 A;  2ACT A;  5CVM A;  1QXP A;  3N3G A;  4CDC B;  2DC8 A;  4I07 A;  3HHA A;  1AIM A;  2CB5 A;  1CTE A;  4PP1 A;  1SP4 B;  1CQD A;  3PDF A;  1KFX L;  2DJG B;  1EWP A;  4P6E A;  3I06 A;  2YJB A;  4XUI A;  3RVV A;  2G8E A;  3BOW A;  3C9E A;  4FJC A;  4GUZ A;  4DMX A;  4BS5 A;  1FH0 A;  3IMA A;  4AXM A;  4AXL A;  1PBH A;  2VFC A;  4MSX A;  5CHT A;  1ME4 A;  1CS8 A;  3H6S A;  3K8U A;  1SNK A;  1QOL A;  3KWB X;  1E2T A;  3K9M A;  3HWN A;  1ATK A;  2ARY A;  4Q8G A;  2BSZ A;  4RY2 A;  5EF4 A;  2DCC A;  4YVA A;  1W6F A;  2FRQ A;  3BPF A;  1KHP A;  2ATO A;  4FK5 A;  1M6D A;  1MHW A;  1U5I A;  3LTW A;  1YVB A;  3KWZ A;  1NQC A;  1TU6 A;  4CDE B;  3I3T A;  3CH2 X;  3N3K A;  4QH6 A;  2DCA A;  2OZ2 A;  2E03 A;  1NL6 A;  1TLO A;  2BDL A;  1AYV A;  1TL9 A;  2G7Y A;  2G8J A;  1AU4 A;  2R9N A;  4DMY A;  4QRV A;  1CPJ A;  1Y4H A;  4C5P A;  4W5B A;  2AS8 A;  2HH5 A;  3TNX A;  2DZY A;  3MHS A;  2NQD B;  1AYU A;  3KSE A;  4CDF B;  1VJV A;  4B55 A;  4YYV A;  3HD3 A;  3OIS A;  3S3Q A;  1ME3 A;  3NHE A;  2DC7 A;  1KXR A;  1F2C A;  3KKU A;  2FT2 A;  3E1Z B;  1MDW A;  4HWY A;  2NQA A;  3OF9 A;  3QJ3 A;  1GLO A;  3OVZ A;  3RVX A;  4KLB A;  1GX3 A;  2R9O A;  1QDQ A;  1K3B B;  2B1M A;  2DJF B;  3QSD A;  3KFQ A;  5FPW A;  4I05 A;  3H7D A;  1CVZ A;  2FTD A;  1DF0 A;  3BC3 A;  2E02 A;  4K7C A;  3MOR A;  6PAD A;  3H8B A;  4FIP A;  3KX1 A;  1AYW A;  4P6G A;  3P5U A;  2OUL A;  3CH3 X;  1EWO A;  3P5W A;  3ERV A;  2O6X A;  2BDZ A;  2VHS A;  2AUX A;  1Y08 A;  1PXV A;  4QRX A;  2H7J A;  2HXZ A;  4PP2 E;  2JQG R;  2YJC A;  2AIM A;  2IPP B;  3PNR A;  4NV8 A;  1X9Y A;  3DF0 A;  4X6H A;  2HHN A;  3V6E A;  2DC6 A;  1EF7 A;  4XR7 A;  3IUT A;  3V6C A;  1O0E A;  3CBK A;  1YK7 A;  2CIO A;  2PAD A;  1KFU L;  3BCN A;  3QT4 A;  5A24 A;  2PBH A;  5PAD A;  1MS6 A;  5F02 A;  2HD5 A;  3IV2 A;  1BY8 A;  3MHH A;  2P7U A;  1YT7 A;  3AI8 A;  2AVW A;  2WBF X;  2Y6E A;  1GCB A;  1ZCM A;  2VFB A;  2E01 A;  2PNS A;  1PPO A;  2NQG A;  2FQ9 A;  1U9V A;  1Q6K A;  4QRG A;  1F29 A;  4WA6 A;  1GMY A;  4BS6 A;  3O1G A;  4PI3 A;  4Q8H A;  1DEU A;  1PAD A;  2JQF R;  5CVO B;  3P5V A;  4OEL A;  4BGF A;  2R9F A;  1A6R A;  3WXG A;  2XU5 A;  3LXS A;  2R9M A;  3P5X A;  4N79 A;  5JH3 A;  8PCH A;  4OEM A;  5JA7 A;  3D6S A;  1AU3 A;  3IOQ A;  4N8W A;  3ZUA A;  1THE A;  4QBB A;  2GHU A;  1W4T A;  3S3R A;  1KHQ A;  9PAP A;  1STF E;  1AEC A;  2VHF A;  3H8C A;  3BWK A;  4BPV A;  1QMY A;  2YJ2 A;  4YYQ A;  4YYU A;  5K16 A;  2NQI A;  3RVW A;  1CSB B;  5CVN B;  1IWD A;  3USV A;  2P86 A;  2DZZ A;  3HHI A;  4CDD B;  3O0U A;  2IBI A;  1ITO A;  3D9W A;  2AYN A;  3M99 A;  1CV8 A;  3IHP A;  4YYS A;  1PPP A;  1CB5 A;  4ZUX U;  4MZS A;  2PRE A;  4MZO A;  1PPD A;  3GCB A;  1MIR A;  2G6D A;  1NPZ A;  2XU3 A;  3B79 A;  1ICF A;  1CJL A;  1MEG A;  2YJ9 A;  1NB3 A;  4YYW A;  2DCD A;  3WXF A;  1BQI A;  3PW3 A;  3BPM A;  1HUC B;  3OVX A;  1MEM A;  3MTN A;  2AYO A;  2OP3 A;  4X6I A;  3IEJ A;  1PIP A;  2FUD A;  1XKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...