2R6NA

Crystal structure of a pyrrolopyrimidine inhibitor in complex with human cathepsin k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
b'RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Novel scaffold for cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r6nA00
4N8WA 3KX1A 2YJ2A 3KWBX 4FIPA 3E1ZB 1GMYA 2FO5A 1AU2A 1F2CA 3BWKA 4W5CA 1PBHA 2DCAA 2AVWA 3D6SA 5K16A 1AU0A 3H7DA 3WXGA 2R9NA 3O0UA 1CQDA 1GLOA 3N4CA 2NQDB 4QBBA 3KWZA 2PBHA 3H89A 1QXPA 3BC3A 2DC7A 1PPPA 1F2BA 3LFYA 1Y08A 1BY8A 3S3RA 4YYQA 1VJVA 1KFXL 1U9QX 3PBHA 1PIPA 2ATOA 3MHHA 2FT2A 1DEUA 4PI3A 2G6DA 4G54A 1CS8A 1PCIA 3KSEA 1KXRA 4XUIA 5CHVA 2OULA 3MORA 4OELA 1ME4A 1MDWA 4CDFB 1FH0A 5FPWA 1BGOA 2OP3A 3CBKA 4QRVA 1AECA 2AYNA 1PXVA 3K9MA 3MTNA 2OZ2A 1ATKA 1ICFA 3HHIA 4BS5A 1CVZA 2Y6EA 1ZIVA 2CB5A 1EWMA 1ITOA 1MIRA 1EF7A 1Q6KA 2YJ9A 3IHPA 4QRXA 4YVAA 4MZSA 1YVBA 3N3KA 3DF0A 3TNXA 1CJLA 2DCCA 2H7JA 3BCNA 1X9YA 1EWLA 4YYVA 4W4UA 4FJCA 3CH3X 4I04A 1AYUA 2AU1A 2AS8A 1AYWA 3AI8A 2DZZA 4FK5A 3GCBA 3RVVA 3PW3A 4MSXA 4CZWA 4ZUXU 3OVXA 8PCHA 4QH6A 1EWOA 3OVZA 1YT7A 3BOWA 2AUXA 4DMYA 2DCDA 4CDEB 2AUZA 1CSBB 4PP2E 5JA7A 3PNRA 1XKGA 2JQFR 2G7YA 2E03A 2YJ8A 1GCBA 4MZOA 3OISA 4OEMA 2F1GA 1MHWA 1PADA 2G8EA 2YJBA 3HHAA 4XR7A 4I05A 3WXEA 3WXFA 9PAPA 1HUCB 1S4VA 1THEA 4Q8HA 4P6GA 1KHQA 2DZYA 1SP4B 1IWDA 2B1NA 2R9FA 3HWNA 3IEJA 3P5UA 1DF0A 4W5BA 3OF9A 2FYEA 5PADA 4WA6A 1NL6A 2E01A 1QMYA 3M99A 2E00A 1GECE 3CBJA 4N4ZA 2JQGR 1U9XA 1AYVA 2VHFA 4Q8GA 4YYRA 1TLOA 4X6HA 3RVXA 4PP1A 1YALA 4RY2A 2P0RA 2P7UA 2HXZA 4BS6A 4YYWA 4YYUA 2IBIA 7PCKA 1AU3A 3P5VA 3KW9A 1CB5A 2XU5A 3P5WA 2NQGA 3BPFA 4K7CA 5F02A 4P6EA 3QJ3A 2FRQA 2DC6A 2DC9A 3CH2X 1MS6A 1NQCA 3ZUAA 2VHSA 3IV2A 3K8UA 3NHEA 4N79A 3V6CA 1AU4A 2XU1A 3BPMA 4YV8A 3H8BA 3H6SA 2DJGB 2HH5A 4YYSA 3C9EA 3N3GA 4AXLA 1K3BB 1ME3A 2FRAA 2FUDA 2BDLA 3QSDA 6PADA 2R9MA 1NLJA 1U5IA 1PE6A 4KLBA 2DJFB 2C0YA 4BPVA 2ACTA 2ARYA 2DCBA 1ZCMA 1KHPA 2NQAA 1QOLA 3O1GA 5JH3A 3OF8A 3KKUA 5J94A 2GHUA 3P5XA 4QRGA 2WBFX 1CTEA 2YJCA 5EF4A 1NB5A 2B1MA 1PPOA 1TL9A 1U9WA 3KFQA 2R6NA 5A24A 2CIOA 2O6XA 3V6EA 5CVNB 2AIMA 3RVWA 1QDQA 2AYOA 2E02A 3USVA 1U9VA 2FTDA 1F29A 1Y4HA 3IOQA 4DMXA 3ERVA 5CHTA 3I06A 2HHNA 1NPZA 1POPA 4HWYA 5CVMA 2XU3A 1MEMA 1SNKA 2BDZA 2DC8A 1STFE 2R9OA 3IMAA 1BP4A 3LXSA 4I07A 3PDFA 4AXMA 4CDDB 3HD3A 1BQIA 1JQPA 1MEGA 1YK7A 3MHSA 2NQIA 3QT4A 2PNSA 3S3QA 1A6RA 3IUTA 1O0EA 2IPPB 2FQ9A 4X6JA 1KFUL 3H8CA 4X6IA 1NB3A 4CDCB 3K24A 1VSNA 2Y5BA 3I3TA 2PREA 1CPJA 1PPDA 2HD5A 2XU4A 2PADA 1EWPA 2P86A 3U8EA 5EGWA 1F2AA 1M6DA 2F7DA 2R9CA 3B79A 4BQVA 2GFOA 5CVOB 3F75A 1PPNA 1AIMA 2G8JA 1CV8A 1TU6A 1YK8A 4BSQA 3F5VA 4PADA
chains in the Genus database with same CATH superfamily
4N8WA 3KX1A 2YJ2A 3KWBX 4FIPA 4BOPA 3E1ZB 1GMYA 2FO5A 1AU2A 3PHXA 1F2CA 4A5UA 5KO3A 3BWKA 4OVZA 4W5CA 1PBHA 2DCAA 2BU3A 2UZJA 2AVWA 3D6SA 2J7QC 5K16A 1AU0A 3H7DA 3WXGA 4D8EA 2R9NA 4PADA 3PRPA 3O0UA 1CQDA 1GLOA 3N4CA 2NQDB 4QBBA 2JRIA 5JZEA 3KWZA 2PBHA 3H89A 1QXPA 3BC3A 2DC7A 1PPPA 1F2BA 3LFYA 1Y08A 1BY8A 3S3RA 4YYQA 4HXDB 1VJVA 1KFXL 4IUMA 4GUAA 1U9QX 3PBHA 1PIPA 2ATOA 3MHHA 2FT2A 1DEUA 4PI3A 2G6DA 4G54A 1CS8A 1PCIA 3KSEA 3PHUA 1KXRA 4MM3B 5E6JA 5EZSA 4XUIA 5CHVA 4RF0A 2OULA 3BB7A 3MORA 4OELA 1ME4A 3TRKA 1YZBA 1MDWA 4CDFB 4M0WA 1FH0A 4BOUA 5FPWA 1BGOA 2OP3A 3CBKA 3BY4A 4QRVA 1AECA 2AYNA 4BOSA 1PXVA 3K9MA 3MTNA 2OZ2A 1ATKA 3MJ5A 1ICFA 4MI7A 3HHIA 4BS5A 1CVZA 4D8BA 2Y6EA 1ZIVA 2CB5A 3OQCA 1EWMA 1ITOA 1MIRA 1EF7A 1Q6KA 4OW0A 2YJ9A 3IHPA 4QRXA 4YVAA 4MZSA 1YVBA 3N3KA 3DF0A 3TNXA 1CJLA 2DCCA 2H7JA 3BCNA 1X9YA 1EWLA 4YYVA 4W4UA 4FJCA 3CH3X 4I04A 1AYUA 2AU1A 2AS8A 1AYWA 1PVJA 3AI8A 2DZZA 4FK5A 3GCBA 3RVVA 3PW3A 4R3DA 4MSXA 4CZWA 4ZUXU 3OVXA 8PCHA 4QH6A 1EWOA 3OVZA 1YT7A 3BOWA 2AUXA 4DMYA 2DCDA 4CDEB 2AUZA 1CSBB 4PP2E 3W30A 3PNRA 5JA7A 1XKGA 2JQFR 2G7YA 2E03A 2YJ8A 1GCBA 1DKIA 4MZOA 3OISA 4OEMA 2F1GA 1MHWA 2J7QA 1PADA 2G8EA 2YJBA 3HHAA 4RNAA 4XR7A 4I05A 3WXEA 3RNVA 3WXFA 9PAPA 1HUCB 1S4VA 1THEA 4Q8HA 4P6GA 1KHQA 2DZYA 1UKFA 1SP4B 1IWDA 2B1NA 2R9FA 3HWNA 3IEJA 3P5UA 1DF0A 4IP3A 4W5BA 3OF9A 2FYEA 5PADA 4WA6A 1NL6A 2E01A 1QMYA 3M99A 2E00A 1GECE 3CBJA 4N4ZA 2JQGR 1U9XA 3PT2A 1AYVA 2VHFA 3PRMA 4Q8GA 4YYRA 1TLOA 2AGAA 4X6HA 3RVXA 4PP1A 1YALA 4RY2A 2P0RA 2P7UA 2HXZA 4BS6A 4OVZB 4YYWA 4YYUA 2IBIA 4D8IA 1AU3A 3P5VA 7PCKA 4ZTBA 3KW9A 1CB5A 2XU5A 3P5WA 2NQGA 3BPFA 4K7CA 4XZXA 5F02A 4P6EA 3QJ3A 2FRQA 2DC6A 2DC9A 3CH2X 1MS6A 1NQCA 3ZUAA 2VHSA 3IV2A 4P16A 3K8UA 3NHEA 4N79A 3V6CA 1AU4A 2XU1A 3TMPA 3BPMA 3IFUA 3O65A 4YV8A 3H8BA 3H6SA 3C0RA 2DJGB 2HH5A 4YYSA 3C9EA 3N3GA 4AXLA 1K3BB 1ME3A 3MP2A 2FRAA 2FUDA 3ZNHA 2BDLA 3QSDA 6PADA 2R9MA 3B21A 1NLJA 1U5IA 1PE6A 4KLBA 2DJFB 2C0YA 2BTWB 4BPVA 4REZA 2ACTA 2ARYA 2DCBA 1ZCMA 3PHWA 1KHPA 2NQAA 1QOLA 3O1GA 5JH3A 3OF8A 3KKUA 3W31A 5J94A 2GHUA 2HWKA 3P5XA 4QRGA 2WBFX 1CTEA 2YJCA 5EF4A 2JTCA 4WURA 1NB5A 2B1MA 1PPOA 1TL9A 1U9WA 3KFQA 2R6NA 5A24A 2CIOA 2O6XA 3V6EA 5CVNB 2AIMA 3RVWA 1QDQA 2AYOA 2E02A 3USVA 1U9VA 2FTDA 1F29A 1Y4HA 3IOQA 4DMXA 3ERVA 5CHTA 3I06A 2HHNA 1NPZA 1POPA 4HWYA 5CVMA 2XU3A 1MEMA 4BOZA 1SNKA 2BDZA 2DC8A 1STFE 2R9OA 3IMAA 1BP4A 3LXSA 4I07A 3PDFA 4AXMA 4CDDB 3PSEA 3HD3A 1BQIA 1JQPA 2BTWA 1MEGA 1YK7A 3MHSA 2NQIA 3QT4A 2PNSA 3S3QA 1A6RA 3IUTA 1O0EA 2IPPB 2DOSA 2FQ9A 4X6JA 3MTVA 1KFUL 4X6IA 1NB3A 4CDCB 3K24A 1VSNA 2Y5BA 3I3TA 2PREA 1CPJA 2FE8A 1PPDA 5EZQA 4RKXA 2HD5A 2XU4A 2PADA 3BBAA 1EWPA 2P86A 4BOQA 3U8EA 5EGWA 1F2AA 1M6DA 2F7DA 2R9CA 3B79A 3E9SA 4RF1A 4BQVA 2GFOA 5CVOB 2Z84A 3F75A 1PPNA 1AIMA 2G8JA 4PT5A 1CV8A 1TU6A 1YK8A 4BSQA 3F5VA 3H8CA
chains in the Genus database with same CATH topology
4N8WA 3KX1A 2YJ2A 3KWBX 4FIPA 3E1ZB 1GMYA 1W6FA 2FO5A 1AU2A 1F2CA 3BWKA 4W5CA 1PBHA 2DCAA 2AVWA 3D6SA 5K16A 1AU0A 3H7DA 3WXGA 2R9NA 4PADA 3O0UA 1CQDA 1GLOA 3N4CA 2NQDB 4QBBA 3KWZA 2PBHA 3H89A 1QXPA 3BC3A 2DC7A 1PPPA 1F2BA 3LFYA 1Y08A 1BY8A 3S3RA 4YYQA 1VJVA 1KFXL 1U9QX 3PBHA 1PIPA 2ATOA 3MHHA 1GX3A 2FT2A 1DEUA 4PI3A 2G6DA 4G54A 1CS8A 1PCIA 3KSEA 1KXRA 4XUIA 5CHVA 2OULA 3MORA 1E2TA 4OELA 1ME4A 1MDWA 4CDFB 2BSZA 1FH0A 5FPWA 1BGOA 2OP3A 3CBKA 4QRVA 1AECA 2AYNA 1PXVA 3K9MA 3MTNA 2OZ2A 1ATKA 1ICFA 3HHIA 4BS5A 1CVZA 1W5RA 2Y6EA 1ZIVA 2CB5A 4GUZA 1ITOA 1EWMA 1MIRA 1EF7A 1Q6KA 2YJ9A 3IHPA 4QRXA 4YVAA 4MZSA 1YVBA 3N3KA 3DF0A 3TNXA 1CJLA 2DCCA 2H7JA 3BCNA 1X9YA 1EWLA 4YYVA 4W4UA 4FJCA 4BGFA 3CH3X 4I04A 1AYUA 2AU1A 2AS8A 1AYWA 3AI8A 2DZZA 4FK5A 3GCBA 3RVVA 3PW3A 4MSXA 4CZWA 4ZUXU 3OVXA 8PCHA 4QH6A 1EWOA 3OVZA 1YT7A 3BOWA 1W4TA 2AUXA 4DMYA 2DCDA 4CDEB 2AUZA 1CSBB 4PP2E 5JA7A 3PNRA 1XKGA 2JQFR 2G7YA 2E03A 2YJ8A 1GCBA 3LTWA 4MZOA 3OISA 4OEMA 2F1GA 1MHWA 1PADA 2G8EA 2YJBA 3HHAA 4XR7A 4I05A 3WXEA 3WXFA 9PAPA 1HUCB 1S4VA 1THEA 4Q8HA 4P6GA 1KHQA 2DZYA 1SP4B 1IWDA 2B1NA 2R9FA 3HWNA 3IEJA 3P5UA 1DF0A 4W5BA 3OF9A 2FYEA 5PADA 4WA6A 1NL6A 2E01A 1QMYA 3M99A 2E00A 1GECE 3CBJA 4N4ZA 2JQGR 4C5PA 1U9XA 1AYVA 2VHFA 4Q8GA 4YYRA 1TLOA 4X6HA 3RVXA 4PP1A 1YALA 4RY2A 2P0RA 2P7UA 2HXZA 4BS6A 4YYWA 4YYUA 2IBIA 4NV8A 7PCKA 1AU3A 3P5VA 3KW9A 1CB5A 2XU5A 3P5WA 2NQGA 3BPFA 4K7CA 5F02A 4P6EA 3QJ3A 2FRQA 2DC6A 2DC9A 3CH2X 1MS6A 1NQCA 3ZUAA 2VHSA 3IV2A 3K8UA 3NHEA 4N79A 3V6CA 1AU4A 2XU1A 3BPMA 2VFBA 4YV8A 3H8BA 3H6SA 2DJGB 2HH5A 4YYSA 3C9EA 3N3GA 4AXLA 1K3BB 1ME3A 2FRAA 2FUDA 2BDLA 3QSDA 6PADA 2R9MA 1NLJA 1U5IA 4B55A 1PE6A 4KLBA 2DJFB 2C0YA 4BPVA 2ACTA 2ARYA 2DCBA 1ZCMA 1KHPA 2NQAA 1QOLA 3O1GA 5JH3A 3OF8A 3KKUA 5J94A 2GHUA 3P5XA 4QRGA 2WBFX 1CTEA 2YJCA 5EF4A 1NB5A 2B1MA 1PPOA 1TL9A 1U9WA 3KFQA 2R6NA 5A24A 2CIOA 2O6XA 3V6EA 5CVNB 2AIMA 3RVWA 1QDQA 2AYOA 2E02A 3USVA 1U9VA 2FTDA 1F29A 1Y4HA 3IOQA 4DMXA 3ERVA 5CHTA 3I06A 2HHNA 1NPZA 1POPA 4HWYA 5CVMA 2XU3A 1MEMA 1SNKA 2BDZA 2DC8A 1STFE 2R9OA 3IMAA 1BP4A 3LXSA 4I07A 3PDFA 4AXMA 4CDDB 3HD3A 1BQIA 1JQPA 1MEGA 1YK7A 3MHSA 2NQIA 3QT4A 2PNSA 3S3QA 1A6RA 3IUTA 1O0EA 2IPPB 2FQ9A 4X6JA 1KFUL 4X6IA 1NB3A 4CDCB 3K24A 1VSNA 2Y5BA 3I3TA 2PREA 1CPJA 3D9WA 1PPDA 2HD5A 2VFCA 2PADA 2XU4A 1EWPA 2P86A 3U8EA 5EGWA 1F2AA 1M6DA 2F7DA 2R9CA 3B79A 4BQVA 2GFOA 5CVOB 3F75A 1PPNA 1AIMA 2G8JA 1CV8A 1TU6A 1YK8A 4BSQA 3F5VA 4NV7A 3H8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8W A;  3KX1 A;  2YJ2 A;  3KWB X;  4FIP A;  3E1Z B;  1GMY A;  2FO5 A;  1AU2 A;  1F2C A;  3BWK A;  4W5C A;  1PBH A;  2DCA A;  2AVW A;  3D6S A;  5K16 A;  1AU0 A;  3H7D A;  3WXG A;  2R9N A;  3O0U A;  1CQD A;  1GLO A;  3N4C A;  2NQD B;  4QBB A;  3KWZ A;  2PBH A;  3H89 A;  1QXP A;  3BC3 A;  2DC7 A;  1PPP A;  1F2B A;  3LFY A;  1Y08 A;  1BY8 A;  3S3R A;  4YYQ A;  1VJV A;  1KFX L;  1U9Q X;  3PBH A;  1PIP A;  2ATO A;  3MHH A;  2FT2 A;  1DEU A;  4PI3 A;  2G6D A;  4G54 A;  1CS8 A;  1PCI A;  3KSE A;  1KXR A;  4XUI A;  5CHV A;  2OUL A;  3MOR A;  4OEL A;  1ME4 A;  1MDW A;  4CDF B;  1FH0 A;  5FPW A;  1BGO A;  2OP3 A;  3CBK A;  4QRV A;  1AEC A;  2AYN A;  1PXV A;  3K9M A;  3MTN A;  2OZ2 A;  1ATK A;  1ICF A;  3HHI A;  4BS5 A;  1CVZ A;  2Y6E A;  1ZIV A;  2CB5 A;  1EWM A;  1ITO A;  1MIR A;  1EF7 A;  1Q6K A;  2YJ9 A;  3IHP A;  4QRX A;  4YVA A;  4MZS A;  1YVB A;  3N3K A;  3DF0 A;  3TNX A;  1CJL A;  2DCC A;  2H7J A;  3BCN A;  1X9Y A;  1EWL A;  4YYV A;  4W4U A;  4FJC A;  3CH3 X;  4I04 A;  1AYU A;  2AU1 A;  2AS8 A;  1AYW A;  3AI8 A;  2DZZ A;  4FK5 A;  3GCB A;  3RVV A;  3PW3 A;  4MSX A;  4CZW A;  4ZUX U;  3OVX A;  8PCH A;  4QH6 A;  1EWO A;  3OVZ A;  1YT7 A;  3BOW A;  2AUX A;  4DMY A;  2DCD A;  4CDE B;  2AUZ A;  1CSB B;  4PP2 E;  5JA7 A;  3PNR A;  1XKG A;  2JQF R;  2G7Y A;  2E03 A;  2YJ8 A;  1GCB A;  4MZO A;  3OIS A;  4OEM A;  2F1G A;  1MHW A;  1PAD A;  2G8E A;  2YJB A;  3HHA A;  4XR7 A;  4I05 A;  3WXE A;  3WXF A;  9PAP A;  1HUC B;  1S4V A;  1THE A;  4Q8H A;  4P6G A;  1KHQ A;  2DZY A;  1SP4 B;  1IWD A;  2B1N A;  2R9F A;  3HWN A;  3IEJ A;  3P5U A;  1DF0 A;  4W5B A;  3OF9 A;  2FYE A;  5PAD A;  4WA6 A;  1NL6 A;  2E01 A;  1QMY A;  3M99 A;  2E00 A;  1GEC E;  3CBJ A;  4N4Z A;  2JQG R;  1U9X A;  1AYV A;  2VHF A;  4Q8G A;  4YYR A;  1TLO A;  4X6H A;  3RVX A;  4PP1 A;  1YAL A;  4RY2 A;  2P0R A;  2P7U A;  2HXZ A;  4BS6 A;  4YYW A;  4YYU A;  2IBI A;  7PCK A;  1AU3 A;  3P5V A;  3KW9 A;  1CB5 A;  2XU5 A;  3P5W A;  2NQG A;  3BPF A;  4K7C A;  5F02 A;  4P6E A;  3QJ3 A;  2FRQ A;  2DC6 A;  2DC9 A;  3CH2 X;  1MS6 A;  1NQC A;  3ZUA A;  2VHS A;  3IV2 A;  3K8U A;  3NHE A;  4N79 A;  3V6C A;  1AU4 A;  2XU1 A;  3BPM A;  4YV8 A;  3H8B A;  3H6S A;  2DJG B;  2HH5 A;  4YYS A;  3C9E A;  3N3G A;  4AXL A;  1K3B B;  1ME3 A;  2FRA A;  2FUD A;  2BDL A;  3QSD A;  6PAD A;  2R9M A;  1NLJ A;  1U5I A;  1PE6 A;  4KLB A;  2DJF B;  2C0Y A;  4BPV A;  2ACT A;  2ARY A;  2DCB A;  1ZCM A;  1KHP A;  2NQA A;  1QOL A;  3O1G A;  5JH3 A;  3OF8 A;  3KKU A;  5J94 A;  2GHU A;  3P5X A;  4QRG A;  2WBF X;  1CTE A;  2YJC A;  5EF4 A;  1NB5 A;  2B1M A;  1PPO A;  1TL9 A;  1U9W A;  3KFQ A;  2R6N A;  5A24 A;  2CIO A;  2O6X A;  3V6E A;  5CVN B;  2AIM A;  3RVW A;  1QDQ A;  2AYO A;  2E02 A;  3USV A;  1U9V A;  2FTD A;  1F29 A;  1Y4H A;  3IOQ A;  4DMX A;  3ERV A;  5CHT A;  3I06 A;  2HHN A;  1NPZ A;  1POP A;  4HWY A;  5CVM A;  2XU3 A;  1MEM A;  1SNK A;  2BDZ A;  2DC8 A;  1STF E;  2R9O A;  3IMA A;  1BP4 A;  3LXS A;  4I07 A;  3PDF A;  4AXM A;  4CDD B;  3HD3 A;  1BQI A;  1JQP A;  1MEG A;  1YK7 A;  3MHS A;  2NQI A;  3QT4 A;  2PNS A;  3S3Q A;  1A6R A;  3IUT A;  1O0E A;  2IPP B;  2FQ9 A;  4X6J A;  1KFU L;  3H8C A;  4X6I A;  1NB3 A;  4CDC B;  3K24 A;  1VSN A;  2Y5B A;  3I3T A;  2PRE A;  1CPJ A;  1PPD A;  2HD5 A;  2XU4 A;  2PAD A;  1EWP A;  2P86 A;  3U8E A;  5EGW A;  1F2A A;  1M6D A;  2F7D A;  2R9C A;  3B79 A;  4BQV A;  2GFO A;  5CVO B;  3F75 A;  1PPN A;  1AIM A;  2G8J A;  1CV8 A;  1TU6 A;  1YK8 A;  4BSQ A;  3F5V A;  4PAD A; 
#chains in the Genus database with same CATH topology
 4N8W A;  3KX1 A;  2YJ2 A;  3KWB X;  4FIP A;  4BOP A;  3E1Z B;  1GMY A;  2FO5 A;  1AU2 A;  3PHX A;  1F2C A;  4A5U A;  5KO3 A;  3BWK A;  4OVZ A;  4W5C A;  1PBH A;  2DCA A;  2BU3 A;  2UZJ A;  2AVW A;  3D6S A;  2J7Q C;  5K16 A;  1AU0 A;  3H7D A;  3WXG A;  4D8E A;  2R9N A;  4PAD A;  3PRP A;  3O0U A;  1CQD A;  1GLO A;  3N4C A;  2NQD B;  4QBB A;  2JRI A;  5JZE A;  3KWZ A;  2PBH A;  3H89 A;  1QXP A;  3BC3 A;  2DC7 A;  1PPP A;  1F2B A;  3LFY A;  1Y08 A;  1BY8 A;  3S3R A;  4YYQ A;  4HXD B;  1VJV A;  1KFX L;  4IUM A;  4GUA A;  1U9Q X;  3PBH A;  1PIP A;  2ATO A;  3MHH A;  2FT2 A;  1DEU A;  4PI3 A;  2G6D A;  4G54 A;  1CS8 A;  1PCI A;  3KSE A;  3PHU A;  1KXR A;  4MM3 B;  5E6J A;  5EZS A;  4XUI A;  5CHV A;  4RF0 A;  2OUL A;  3BB7 A;  3MOR A;  4OEL A;  1ME4 A;  3TRK A;  1YZB A;  1MDW A;  4CDF B;  4M0W A;  1FH0 A;  4BOU A;  5FPW A;  1BGO A;  2OP3 A;  3CBK A;  3BY4 A;  4QRV A;  1AEC A;  2AYN A;  4BOS A;  1PXV A;  3K9M A;  3MTN A;  2OZ2 A;  1ATK A;  3MJ5 A;  1ICF A;  4MI7 A;  3HHI A;  4BS5 A;  1CVZ A;  4D8B A;  2Y6E A;  1ZIV A;  2CB5 A;  3OQC A;  1EWM A;  1ITO A;  1MIR A;  1EF7 A;  1Q6K A;  4OW0 A;  2YJ9 A;  3IHP A;  4QRX A;  4YVA A;  4MZS A;  1YVB A;  3N3K A;  3DF0 A;  3TNX A;  1CJL A;  2DCC A;  2H7J A;  3BCN A;  1X9Y A;  1EWL A;  4YYV A;  4W4U A;  4FJC A;  3CH3 X;  4I04 A;  1AYU A;  2AU1 A;  2AS8 A;  1AYW A;  1PVJ A;  3AI8 A;  2DZZ A;  4FK5 A;  3GCB A;  3RVV A;  3PW3 A;  4R3D A;  4MSX A;  4CZW A;  4ZUX U;  3OVX A;  8PCH A;  4QH6 A;  1EWO A;  3OVZ A;  1YT7 A;  3BOW A;  2AUX A;  4DMY A;  2DCD A;  4CDE B;  2AUZ A;  1CSB B;  4PP2 E;  3W30 A;  3PNR A;  5JA7 A;  1XKG A;  2JQF R;  2G7Y A;  2E03 A;  2YJ8 A;  1GCB A;  1DKI A;  4MZO A;  3OIS A;  4OEM A;  2F1G A;  1MHW A;  2J7Q A;  1PAD A;  2G8E A;  2YJB A;  3HHA A;  4RNA A;  4XR7 A;  4I05 A;  3WXE A;  3RNV A;  3WXF A;  9PAP A;  1HUC B;  1S4V A;  1THE A;  4Q8H A;  4P6G A;  1KHQ A;  2DZY A;  1UKF A;  1SP4 B;  1IWD A;  2B1N A;  2R9F A;  3HWN A;  3IEJ A;  3P5U A;  1DF0 A;  4IP3 A;  4W5B A;  3OF9 A;  2FYE A;  5PAD A;  4WA6 A;  1NL6 A;  2E01 A;  1QMY A;  3M99 A;  2E00 A;  1GEC E;  3CBJ A;  4N4Z A;  2JQG R;  1U9X A;  3PT2 A;  1AYV A;  2VHF A;  3PRM A;  4Q8G A;  4YYR A;  1TLO A;  2AGA A;  4X6H A;  3RVX A;  4PP1 A;  1YAL A;  4RY2 A;  2P0R A;  2P7U A;  2HXZ A;  4BS6 A;  4OVZ B;  4YYW A;  4YYU A;  2IBI A;  4D8I A;  1AU3 A;  3P5V A;  7PCK A;  4ZTB A;  3KW9 A;  1CB5 A;  2XU5 A;  3P5W A;  2NQG A;  3BPF A;  4K7C A;  4XZX A;  5F02 A;  4P6E A;  3QJ3 A;  2FRQ A;  2DC6 A;  2DC9 A;  3CH2 X;  1MS6 A;  1NQC A;  3ZUA A;  2VHS A;  3IV2 A;  4P16 A;  3K8U A;  3NHE A;  4N79 A;  3V6C A;  1AU4 A;  2XU1 A;  3TMP A;  3BPM A;  3IFU A;  3O65 A;  4YV8 A;  3H8B A;  3H6S A;  3C0R A;  2DJG B;  2HH5 A;  4YYS A;  3C9E A;  3N3G A;  4AXL A;  1K3B B;  1ME3 A;  3MP2 A;  2FRA A;  2FUD A;  3ZNH A;  2BDL A;  3QSD A;  6PAD A;  2R9M A;  3B21 A;  1NLJ A;  1U5I A;  1PE6 A;  4KLB A;  2DJF B;  2C0Y A;  2BTW B;  4BPV A;  4REZ A;  2ACT A;  2ARY A;  2DCB A;  1ZCM A;  3PHW A;  1KHP A;  2NQA A;  1QOL A;  3O1G A;  5JH3 A;  3OF8 A;  3KKU A;  3W31 A;  5J94 A;  2GHU A;  2HWK A;  3P5X A;  4QRG A;  2WBF X;  1CTE A;  2YJC A;  5EF4 A;  2JTC A;  4WUR A;  1NB5 A;  2B1M A;  1PPO A;  1TL9 A;  1U9W A;  3KFQ A;  2R6N A;  5A24 A;  2CIO A;  2O6X A;  3V6E A;  5CVN B;  2AIM A;  3RVW A;  1QDQ A;  2AYO A;  2E02 A;  3USV A;  1U9V A;  2FTD A;  1F29 A;  1Y4H A;  3IOQ A;  4DMX A;  3ERV A;  5CHT A;  3I06 A;  2HHN A;  1NPZ A;  1POP A;  4HWY A;  5CVM A;  2XU3 A;  1MEM A;  4BOZ A;  1SNK A;  2BDZ A;  2DC8 A;  1STF E;  2R9O A;  3IMA A;  1BP4 A;  3LXS A;  4I07 A;  3PDF A;  4AXM A;  4CDD B;  3PSE A;  3HD3 A;  1BQI A;  1JQP A;  2BTW A;  1MEG A;  1YK7 A;  3MHS A;  2NQI A;  3QT4 A;  2PNS A;  3S3Q A;  1A6R A;  3IUT A;  1O0E A;  2IPP B;  2DOS A;  2FQ9 A;  4X6J A;  3MTV A;  1KFU L;  4X6I A;  1NB3 A;  4CDC B;  3K24 A;  1VSN A;  2Y5B A;  3I3T A;  2PRE A;  1CPJ A;  2FE8 A;  1PPD A;  5EZQ A;  4RKX A;  2HD5 A;  2XU4 A;  2PAD A;  3BBA A;  1EWP A;  2P86 A;  4BOQ A;  3U8E A;  5EGW A;  1F2A A;  1M6D A;  2F7D A;  2R9C A;  3B79 A;  3E9S A;  4RF1 A;  4BQV A;  2GFO A;  5CVO B;  2Z84 A;  3F75 A;  1PPN A;  1AIM A;  2G8J A;  4PT5 A;  1CV8 A;  1TU6 A;  1YK8 A;  4BSQ A;  3F5V A;  3H8C A; 
#chains in the Genus database with same CATH homology
 4N8W A;  3KX1 A;  2YJ2 A;  3KWB X;  4FIP A;  3E1Z B;  1GMY A;  1W6F A;  2FO5 A;  1AU2 A;  1F2C A;  3BWK A;  4W5C A;  1PBH A;  2DCA A;  2AVW A;  3D6S A;  5K16 A;  1AU0 A;  3H7D A;  3WXG A;  2R9N A;  4PAD A;  3O0U A;  1CQD A;  1GLO A;  3N4C A;  2NQD B;  4QBB A;  3KWZ A;  2PBH A;  3H89 A;  1QXP A;  3BC3 A;  2DC7 A;  1PPP A;  1F2B A;  3LFY A;  1Y08 A;  1BY8 A;  3S3R A;  4YYQ A;  1VJV A;  1KFX L;  1U9Q X;  3PBH A;  1PIP A;  2ATO A;  3MHH A;  1GX3 A;  2FT2 A;  1DEU A;  4PI3 A;  2G6D A;  4G54 A;  1CS8 A;  1PCI A;  3KSE A;  1KXR A;  4XUI A;  5CHV A;  2OUL A;  3MOR A;  1E2T A;  4OEL A;  1ME4 A;  1MDW A;  4CDF B;  2BSZ A;  1FH0 A;  5FPW A;  1BGO A;  2OP3 A;  3CBK A;  4QRV A;  1AEC A;  2AYN A;  1PXV A;  3K9M A;  3MTN A;  2OZ2 A;  1ATK A;  1ICF A;  3HHI A;  4BS5 A;  1CVZ A;  1W5R A;  2Y6E A;  1ZIV A;  2CB5 A;  4GUZ A;  1ITO A;  1EWM A;  1MIR A;  1EF7 A;  1Q6K A;  2YJ9 A;  3IHP A;  4QRX A;  4YVA A;  4MZS A;  1YVB A;  3N3K A;  3DF0 A;  3TNX A;  1CJL A;  2DCC A;  2H7J A;  3BCN A;  1X9Y A;  1EWL A;  4YYV A;  4W4U A;  4FJC A;  4BGF A;  3CH3 X;  4I04 A;  1AYU A;  2AU1 A;  2AS8 A;  1AYW A;  3AI8 A;  2DZZ A;  4FK5 A;  3GCB A;  3RVV A;  3PW3 A;  4MSX A;  4CZW A;  4ZUX U;  3OVX A;  8PCH A;  4QH6 A;  1EWO A;  3OVZ A;  1YT7 A;  3BOW A;  1W4T A;  2AUX A;  4DMY A;  2DCD A;  4CDE B;  2AUZ A;  1CSB B;  4PP2 E;  5JA7 A;  3PNR A;  1XKG A;  2JQF R;  2G7Y A;  2E03 A;  2YJ8 A;  1GCB A;  3LTW A;  4MZO A;  3OIS A;  4OEM A;  2F1G A;  1MHW A;  1PAD A;  2G8E A;  2YJB A;  3HHA A;  4XR7 A;  4I05 A;  3WXE A;  3WXF A;  9PAP A;  1HUC B;  1S4V A;  1THE A;  4Q8H A;  4P6G A;  1KHQ A;  2DZY A;  1SP4 B;  1IWD A;  2B1N A;  2R9F A;  3HWN A;  3IEJ A;  3P5U A;  1DF0 A;  4W5B A;  3OF9 A;  2FYE A;  5PAD A;  4WA6 A;  1NL6 A;  2E01 A;  1QMY A;  3M99 A;  2E00 A;  1GEC E;  3CBJ A;  4N4Z A;  2JQG R;  4C5P A;  1U9X A;  1AYV A;  2VHF A;  4Q8G A;  4YYR A;  1TLO A;  4X6H A;  3RVX A;  4PP1 A;  1YAL A;  4RY2 A;  2P0R A;  2P7U A;  2HXZ A;  4BS6 A;  4YYW A;  4YYU A;  2IBI A;  4NV8 A;  7PCK A;  1AU3 A;  3P5V A;  3KW9 A;  1CB5 A;  2XU5 A;  3P5W A;  2NQG A;  3BPF A;  4K7C A;  5F02 A;  4P6E A;  3QJ3 A;  2FRQ A;  2DC6 A;  2DC9 A;  3CH2 X;  1MS6 A;  1NQC A;  3ZUA A;  2VHS A;  3IV2 A;  3K8U A;  3NHE A;  4N79 A;  3V6C A;  1AU4 A;  2XU1 A;  3BPM A;  2VFB A;  4YV8 A;  3H8B A;  3H6S A;  2DJG B;  2HH5 A;  4YYS A;  3C9E A;  3N3G A;  4AXL A;  1K3B B;  1ME3 A;  2FRA A;  2FUD A;  2BDL A;  3QSD A;  6PAD A;  2R9M A;  1NLJ A;  1U5I A;  4B55 A;  1PE6 A;  4KLB A;  2DJF B;  2C0Y A;  4BPV A;  2ACT A;  2ARY A;  2DCB A;  1ZCM A;  1KHP A;  2NQA A;  1QOL A;  3O1G A;  5JH3 A;  3OF8 A;  3KKU A;  5J94 A;  2GHU A;  3P5X A;  4QRG A;  2WBF X;  1CTE A;  2YJC A;  5EF4 A;  1NB5 A;  2B1M A;  1PPO A;  1TL9 A;  1U9W A;  3KFQ A;  2R6N A;  5A24 A;  2CIO A;  2O6X A;  3V6E A;  5CVN B;  2AIM A;  3RVW A;  1QDQ A;  2AYO A;  2E02 A;  3USV A;  1U9V A;  2FTD A;  1F29 A;  1Y4H A;  3IOQ A;  4DMX A;  3ERV A;  5CHT A;  3I06 A;  2HHN A;  1NPZ A;  1POP A;  4HWY A;  5CVM A;  2XU3 A;  1MEM A;  1SNK A;  2BDZ A;  2DC8 A;  1STF E;  2R9O A;  3IMA A;  1BP4 A;  3LXS A;  4I07 A;  3PDF A;  4AXM A;  4CDD B;  3HD3 A;  1BQI A;  1JQP A;  1MEG A;  1YK7 A;  3MHS A;  2NQI A;  3QT4 A;  2PNS A;  3S3Q A;  1A6R A;  3IUT A;  1O0E A;  2IPP B;  2FQ9 A;  4X6J A;  1KFU L;  4X6I A;  1NB3 A;  4CDC B;  3K24 A;  1VSN A;  2Y5B A;  3I3T A;  2PRE A;  1CPJ A;  3D9W A;  1PPD A;  2HD5 A;  2VFC A;  2PAD A;  2XU4 A;  1EWP A;  2P86 A;  3U8E A;  5EGW A;  1F2A A;  1M6D A;  2F7D A;  2R9C A;  3B79 A;  4BQV A;  2GFO A;  5CVO B;  3F75 A;  1PPN A;  1AIM A;  2G8J A;  1CV8 A;  1TU6 A;  1YK8 A;  4BSQ A;  3F5V A;  4NV7 A;  3H8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...