2R6NA

Crystal structure of a pyrrolopyrimidine inhibitor in complex with human cathepsin k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Novel scaffold for cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r6nA00
1AYUA 3P5VA 2DC6A 4W4UA 1THEA 1U9WA 1PBHA 1NL6A 1JQPA 1ZIVA 3MORA 3PNRA 1GMYA 4BSQA 4N79A 2DZZA 3HD3A 1AYWA 4QBBA 2AS8A 2XU1A 4Q8GA 5CVMA 1AU2A 1BY8A 3IUTA 2GHUA 2Y5BA 2YJCA 1EWOA 2DC7A 1CPJA 7PCKA 5JA7A 3USVA 2E00A 1F2BA 1K3BB 3IOQA 1KXRA 3V6CA 2FTDA 5CVOB 3LXSA 2O6XA 3P5XA 2DCBA 1PE6A 1ME4A 1M6DA 1U9XA 1FH0A 2ATOA 3BWKA 4YYVA 4K7CA 2H7JA 4W5CA 4X6JA 4MZOA 3IHPA 2IBIA 1PPPA 4MSXA 3BPMA 4YYQA 2CIOA 1IWDA 2ACTA 3MHSA 1GLOA 3OISA 4CDEB 1Q6KA 2DCAA 4PP1A 1CQDA 1EWMA 1S4VA 1PPDA 4I05A 1PPOA 3QT4A 2GFOA 4HWYA 1ATKA 2HH5A 3WXEA 1HUCB 1YALA 1X9YA 3S3QA 2R9OA 3S3RA 3N3KA 3PW3A 4XR7A 2ARYA 2HHNA 4BS6A 5CHVA 1GCBA 2G6DA 1DF0A 2VHSA 3D6SA 3U8EA 3TNXA 5EF4A 4KLBA 1TU6A 2B1NA 1CV8A 1KFUL 1YK8A 3AI8A 3I06A 1BQIA 2JQFR 2CB5A 3LFYA 4Q8HA 4YV8A 4PP2E 4YVAA 3ERVA 4I04A 2NQAA 1XKGA 3CH3X 8PCHA 2F1GA 1MDWA 3KX1A 1TLOA 3NHEA 3H6SA 1MEGA 1QXPA 1STFE 3P5UA 1Y08A 4I07A 2BDLA 2AU1A 2DCCA 2PBHA 1VSNA 2Y6EA 4FIPA 1SP4B 3HHIA 4ZUXU 4DMXA 1ZCMA 2P7UA 4CDDB 1NB5A 2YJ8A 1CSBB 1EF7A 3IV2A 4XUIA 2FQ9A 2IPPB 4MZSA 4CZWA 2FT2A 4PI3A 1PIPA 2PNSA 3O0UA 1POPA 1EWLA 3KSEA 5CVNB 3QSDA 3V6EA 2G7YA 2YJBA 4P6EA 2NQDB 1NB3A 3BC3A 1TL9A 3OVZA 1QMYA 2FRQA 4YYWA 1PPNA 3M99A 3F75A 5J94A 4DMYA 3DF0A 1ITOA 1GECE 3IMAA 3ZUAA 2JQGR 4WA6A 1CJLA 3K9MA 2P0RA 3K8UA 2G8JA 4BPVA 1KFXL 3HWNA 3QJ3A 4OELA 2DJFB 2DC9A 2F7DA 2HD5A 5PADA 2FYEA 4P6GA 1BP4A 2E03A 3KFQA 3H8BA 3B79A 2B1MA 2R6NA 3RVWA 5A24A 1AU3A 3E1ZB 2OP3A 2DJGB 2WBFX 2E01A 2AYOA 1Y4HA 3P5WA 1YK7A 3KWZA 2VHFA 4BS5A 4QRXA 1QOLA 3H89A 1EWPA 1NQCA 1AYVA 2DC8A 1AU4A 3KKUA 3CBJA 2NQIA 1KHQA 5CHTA 4YYSA 4CDFB 1BGOA 1ME3A 4W5BA 2YJ9A 3BPFA 3WXGA 2PADA 4AXLA 5FPWA 3IEJA 2NQGA 1KHPA 1CS8A 1YVBA 2OULA 1MHWA 3OF8A 3OF9A 1QDQA 4YYRA 4X6IA 1NLJA 3CBKA 4RY2A 3GCBA 1U5IA 2YJ2A 2DZYA 1MS6A 2E02A 4QH6A 2XU3A 4QRVA 1MEMA 4FJCA 2FRAA 1U9QX 3I3TA 3OVXA 3K24A 2OZ2A 1AU0A 1F2CA 4N8WA 2DCDA 4BQVA 3F5VA 5JH3A 2FO5A 1CB5A 2AUXA 1F29A 2C0YA 1PADA 4N4ZA 2R9FA 1CTEA 1AECA 1YT7A 4AXMA 4FK5A 3WXFA 2XU5A 1F2AA 9PAPA 3N4CA 2R9CA 1SNKA 3PBHA 2BDZA 2FUDA 3O1GA 4YYUA 2AVWA 4G54A 3RVXA 3BOWA 2R9MA 3H8CA 5F02A 3CH2X 1U9VA 3BCNA 2AUZA 3MHHA 1O0EA 2PREA 1NPZA 2AIMA 1MIRA 4X6HA 4PADA 1AIMA 3H7DA 2G8EA 2R9NA 3RVVA 2P86A 5EGWA 4QRGA 1ICFA 2HXZA 1CVZA 6PADA 4CDCB 1VJVA 1DEUA 2XU4A 3KWBX 1PCIA 3N3GA 4OEMA 3HHAA 1PXVA 3C9EA 5K16A 2AYNA 3KW9A 3PDFA 3MTNA 1A6RA
chains in the Genus database with same CATH superfamily
1AYUA 3P5VA 2DC6A 4W4UA 1THEA 1U9WA 1PBHA 1NL6A 1JQPA 1ZIVA 5EZSA 3MORA 3PNRA 1GMYA 4BSQA 4N79A 2DZZA 4PT5A 3HD3A 1AYWA 4QBBA 2AS8A 2XU1A 4Q8GA 5CVMA 5E6JA 1AU2A 3B21A 1BY8A 3IUTA 2GHUA 2Y5BA 2YJCA 1EWOA 3RNVA 2DC7A 1CPJA 7PCKA 5JA7A 3USVA 2E00A 1F2BA 1K3BB 3IOQA 1KXRA 3V6CA 4RF0A 2FTDA 5CVOB 3LXSA 2O6XA 4IUMA 4D8IA 3P5XA 2DCBA 1PE6A 1ME4A 1M6DA 1U9XA 4D8EA 1FH0A 2Z84A 2ATOA 3PHWA 3BWKA 4YYVA 4K7CA 2H7JA 4D8BA 3C0RA 4W5CA 4X6JA 4MZOA 3IHPA 2IBIA 1PPPA 4MSXA 3BPMA 4YYQA 2CIOA 1IWDA 1DKIA 2ACTA 3MHSA 1GLOA 4HXDB 3OISA 4CDEB 1Q6KA 2DCAA 4PP1A 4OVZB 1CQDA 1EWMA 1S4VA 1PPDA 4I05A 1PPOA 3QT4A 2GFOA 4HWYA 1ATKA 2HH5A 3WXEA 3PHUA 1HUCB 4BOZA 1YALA 1X9YA 4BOSA 3S3QA 2R9OA 3S3RA 3N3KA 3PW3A 4XR7A 4ZTBA 2ARYA 2HHNA 4BS6A 5CHVA 1GCBA 2G6DA 1DF0A 2VHSA 3D6SA 3U8EA 3TMPA 3TNXA 5EF4A 4KLBA 1TU6A 2B1NA 1CV8A 1KFUL 1YK8A 3AI8A 3I06A 1BQIA 2JQFR 2CB5A 3LFYA 4Q8HA 1YZBA 4YV8A 2JRIA 4PP2E 4YVAA 3ERVA 2FE8A 4I04A 2NQAA 1XKGA 2J7QC 3CH3X 8PCHA 2F1GA 1MDWA 4P16A 3KX1A 1TLOA 3NHEA 3H6SA 1MEGA 1QXPA 1STFE 3P5UA 3PT2A 1Y08A 4I07A 2BDLA 4RNAA 2AU1A 2DCCA 2PBHA 3MJ5A 1VSNA 2Y6EA 4FIPA 1SP4B 3HHIA 4ZUXU 4DMXA 1ZCMA 2P7UA 4CDDB 1NB5A 2YJ8A 4A5UA 1CSBB 1EF7A 3IV2A 4XUIA 3W31A 5JZEA 2FQ9A 2IPPB 4MZSA 4CZWA 2FT2A 4PI3A 4REZA 1PIPA 2PNSA 3O0UA 1POPA 1EWLA 3KSEA 5CVNB 3QSDA 3TRKA 3V6EA 2G7YA 2YJBA 4P6EA 2NQDB 1NB3A 3BC3A 1TL9A 5KO3A 2AGAA 2BTWB 4IP3A 3OVZA 1QMYA 2FRQA 4YYWA 1PPNA 3M99A 3F75A 3PSEA 5J94A 4DMYA 3DF0A 1ITOA 1GECE 3IMAA 3ZUAA 2JQGR 4WA6A 1CJLA 3K9MA 2P0RA 3K8UA 2G8JA 4BPVA 1KFXL 3HWNA 3QJ3A 4OELA 2DJFB 2DC9A 2F7DA 2HD5A 5PADA 2FYEA 4P6GA 1BP4A 2E03A 3KFQA 3H8BA 3B79A 2B1MA 3BBAA 2R6NA 3IFUA 3RVWA 5A24A 1AU3A 3E1ZB 2OP3A 2DJGB 2WBFX 2E01A 2AYOA 1Y4HA 3P5WA 1YK7A 3KWZA 4BOUA 2VHFA 4BS5A 4QRXA 1QOLA 3H89A 1EWPA 1NQCA 1AYVA 2DC8A 3O65A 1AU4A 4BOQA 3KKUA 3CBJA 2NQIA 2BTWA 1KHQA 5CHTA 4YYSA 4CDFB 1BGOA 1ME3A 4W5BA 2YJ9A 3BPFA 3WXGA 2PADA 4AXLA 5FPWA 3IEJA 2NQGA 4OW0A 1KHPA 1CS8A 4OVZA 3MTVA 1YVBA 2OULA 1MHWA 3OF8A 3OF9A 1QDQA 4YYRA 4X6IA 1NLJA 3CBKA 4RY2A 3GCBA 1U5IA 2YJ2A 2DZYA 2DOSA 4MI7A 4R3DA 1MS6A 3PRMA 2E02A 4QH6A 2XU3A 4QRVA 1MEMA 4FJCA 3OQCA 4WURA 2FRAA 1U9QX 3I3TA 3OVXA 3K24A 2OZ2A 1AU0A 1F2CA 4M0WA 4N8WA 2DCDA 4BQVA 3F5VA 5JH3A 2FO5A 1CB5A 2AUXA 3ZNHA 3MP2A 1F29A 2C0YA 1PADA 4N4ZA 2R9FA 1CTEA 1AECA 2BU3A 1YT7A 4AXMA 4FK5A 3WXFA 2XU5A 1F2AA 4RF1A 9PAPA 3N4CA 2R9CA 1SNKA 3PBHA 2JTCA 2BDZA 2FUDA 3O1GA 4YYUA 2AVWA 4G54A 3RVXA 3PHXA 3BOWA 4GUAA 2R9MA 3E9SA 3H8CA 5F02A 3CH2X 1U9VA 3BCNA 2AUZA 2UZJA 3PRPA 3MHHA 3BY4A 1PVJA 1O0EA 2J7QA 2PREA 1NPZA 2AIMA 1MIRA 4BOPA 4X6HA 5EZQA 4PADA 2HWKA 1AIMA 3BB7A 4RKXA 3H7DA 2G8EA 2R9NA 3RVVA 2P86A 4XZXA 5EGWA 4MM3B 4QRGA 1ICFA 2HXZA 1CVZA 6PADA 4CDCB 1VJVA 1DEUA 2XU4A 3KWBX 3W30A 1PCIA 1UKFA 3N3GA 4OEMA 3HHAA 1PXVA 3C9EA 5K16A 2AYNA 3KW9A 3PDFA 3MTNA 1A6RA
chains in the Genus database with same CATH topology
1AYUA 3P5VA 2DC6A 4W4UA 1THEA 1U9WA 1PBHA 1NL6A 1JQPA 1ZIVA 3MORA 3PNRA 1GMYA 4BSQA 4N79A 2DZZA 3HD3A 1AYWA 4QBBA 2AS8A 2XU1A 4Q8GA 5CVMA 1AU2A 1BY8A 3IUTA 2GHUA 2Y5BA 2YJCA 1EWOA 2DC7A 1CPJA 7PCKA 5JA7A 3USVA 2E00A 1F2BA 1K3BB 3IOQA 1KXRA 3V6CA 2FTDA 5CVOB 3LXSA 2O6XA 3P5XA 2DCBA 1PE6A 1ME4A 1M6DA 1U9XA 1FH0A 2ATOA 3BWKA 4NV7A 4YYVA 4K7CA 2H7JA 4W5CA 4X6JA 4MZOA 3IHPA 2IBIA 1PPPA 4MSXA 3BPMA 4YYQA 2CIOA 1IWDA 2ACTA 3MHSA 1GLOA 3OISA 4CDEB 1Q6KA 2DCAA 4PP1A 1CQDA 1EWMA 1S4VA 1PPDA 4I05A 1PPOA 3QT4A 2GFOA 4HWYA 1ATKA 2HH5A 1W6FA 3WXEA 1HUCB 1YALA 1X9YA 3S3QA 2R9OA 1W5RA 3S3RA 3N3KA 3PW3A 4XR7A 2ARYA 2HHNA 4BS6A 5CHVA 1GCBA 2G6DA 1DF0A 2VHSA 3D6SA 2VFBA 3U8EA 3TNXA 5EF4A 4KLBA 1TU6A 2B1NA 1CV8A 1KFUL 1YK8A 3AI8A 3I06A 1BQIA 2JQFR 2CB5A 3LFYA 4Q8HA 4YV8A 4PP2E 4YVAA 3ERVA 4I04A 2NQAA 1XKGA 3CH3X 8PCHA 2F1GA 1MDWA 3KX1A 1TLOA 3NHEA 3H6SA 1MEGA 1QXPA 1STFE 3P5UA 1Y08A 4I07A 2BDLA 2AU1A 2DCCA 2PBHA 1VSNA 2Y6EA 4FIPA 1SP4B 1W4TA 3HHIA 4ZUXU 4DMXA 1ZCMA 2P7UA 4CDDB 1NB5A 2YJ8A 1GX3A 1CSBB 1EF7A 3IV2A 4XUIA 2BSZA 2FQ9A 2IPPB 4MZSA 4CZWA 2FT2A 4PI3A 1PIPA 2PNSA 3O0UA 1POPA 1EWLA 3KSEA 5CVNB 3QSDA 3V6EA 2G7YA 2YJBA 4P6EA 2NQDB 1NB3A 4B55A 3BC3A 1TL9A 3OVZA 1QMYA 2FRQA 4YYWA 1PPNA 2VFCA 3M99A 3F75A 5J94A 4DMYA 3DF0A 1ITOA 1GECE 3IMAA 3ZUAA 2JQGR 4WA6A 1CJLA 3K9MA 2P0RA 3K8UA 2G8JA 4BPVA 1KFXL 3HWNA 3QJ3A 4OELA 2DJFB 2DC9A 2F7DA 2HD5A 5PADA 2FYEA 4P6GA 1BP4A 2E03A 3KFQA 3H8BA 3B79A 2B1MA 2R6NA 3RVWA 5A24A 1AU3A 3LTWA 3E1ZB 2OP3A 2DJGB 2WBFX 2E01A 2AYOA 1Y4HA 4BGFA 3P5WA 1YK7A 3KWZA 2VHFA 4BS5A 4QRXA 1QOLA 3H89A 1EWPA 1NQCA 1AYVA 2DC8A 1AU4A 3KKUA 3CBJA 2NQIA 1KHQA 5CHTA 4YYSA 4CDFB 1BGOA 1ME3A 4W5BA 2YJ9A 3BPFA 3WXGA 2PADA 4AXLA 5FPWA 3IEJA 2NQGA 1KHPA 1CS8A 1YVBA 2OULA 1MHWA 3OF8A 3OF9A 1QDQA 4YYRA 4X6IA 1NLJA 3CBKA 4RY2A 3GCBA 1U5IA 2YJ2A 2DZYA 1MS6A 2E02A 4QH6A 4C5PA 2XU3A 4QRVA 1MEMA 4FJCA 2FRAA 1U9QX 3I3TA 3OVXA 3K24A 2OZ2A 1AU0A 1F2CA 4N8WA 2DCDA 4BQVA 3F5VA 5JH3A 2FO5A 1CB5A 2AUXA 1F29A 2C0YA 1PADA 4N4ZA 2R9FA 1CTEA 1AECA 1YT7A 4AXMA 4FK5A 3WXFA 2XU5A 1F2AA 9PAPA 3N4CA 2R9CA 1SNKA 3PBHA 2BDZA 2FUDA 3O1GA 4YYUA 2AVWA 4G54A 1E2TA 3RVXA 3BOWA 2R9MA 3D9WA 3H8CA 5F02A 3CH2X 1U9VA 3BCNA 2AUZA 4NV8A 3MHHA 1O0EA 2PREA 1NPZA 2AIMA 1MIRA 4X6HA 4PADA 1AIMA 3H7DA 2G8EA 2R9NA 3RVVA 2P86A 5EGWA 4QRGA 1ICFA 2HXZA 1CVZA 4GUZA 6PADA 4CDCB 1VJVA 1DEUA 2XU4A 3KWBX 1PCIA 3N3GA 4OEMA 3HHAA 1PXVA 3C9EA 5K16A 2AYNA 3KW9A 3PDFA 3MTNA 1A6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYU A;  3P5V A;  2DC6 A;  4W4U A;  1THE A;  1U9W A;  1PBH A;  1NL6 A;  1JQP A;  1ZIV A;  3MOR A;  3PNR A;  1GMY A;  4BSQ A;  4N79 A;  2DZZ A;  3HD3 A;  1AYW A;  4QBB A;  2AS8 A;  2XU1 A;  4Q8G A;  5CVM A;  1AU2 A;  1BY8 A;  3IUT A;  2GHU A;  2Y5B A;  2YJC A;  1EWO A;  2DC7 A;  1CPJ A;  7PCK A;  5JA7 A;  3USV A;  2E00 A;  1F2B A;  1K3B B;  3IOQ A;  1KXR A;  3V6C A;  2FTD A;  5CVO B;  3LXS A;  2O6X A;  3P5X A;  2DCB A;  1PE6 A;  1ME4 A;  1M6D A;  1U9X A;  1FH0 A;  2ATO A;  3BWK A;  4YYV A;  4K7C A;  2H7J A;  4W5C A;  4X6J A;  4MZO A;  3IHP A;  2IBI A;  1PPP A;  4MSX A;  3BPM A;  4YYQ A;  2CIO A;  1IWD A;  2ACT A;  3MHS A;  1GLO A;  3OIS A;  4CDE B;  1Q6K A;  2DCA A;  4PP1 A;  1CQD A;  1EWM A;  1S4V A;  1PPD A;  4I05 A;  1PPO A;  3QT4 A;  2GFO A;  4HWY A;  1ATK A;  2HH5 A;  3WXE A;  1HUC B;  1YAL A;  1X9Y A;  3S3Q A;  2R9O A;  3S3R A;  3N3K A;  3PW3 A;  4XR7 A;  2ARY A;  2HHN A;  4BS6 A;  5CHV A;  1GCB A;  2G6D A;  1DF0 A;  2VHS A;  3D6S A;  3U8E A;  3TNX A;  5EF4 A;  4KLB A;  1TU6 A;  2B1N A;  1CV8 A;  1KFU L;  1YK8 A;  3AI8 A;  3I06 A;  1BQI A;  2JQF R;  2CB5 A;  3LFY A;  4Q8H A;  4YV8 A;  4PP2 E;  4YVA A;  3ERV A;  4I04 A;  2NQA A;  1XKG A;  3CH3 X;  8PCH A;  2F1G A;  1MDW A;  3KX1 A;  1TLO A;  3NHE A;  3H6S A;  1MEG A;  1QXP A;  1STF E;  3P5U A;  1Y08 A;  4I07 A;  2BDL A;  2AU1 A;  2DCC A;  2PBH A;  1VSN A;  2Y6E A;  4FIP A;  1SP4 B;  3HHI A;  4ZUX U;  4DMX A;  1ZCM A;  2P7U A;  4CDD B;  1NB5 A;  2YJ8 A;  1CSB B;  1EF7 A;  3IV2 A;  4XUI A;  2FQ9 A;  2IPP B;  4MZS A;  4CZW A;  2FT2 A;  4PI3 A;  1PIP A;  2PNS A;  3O0U A;  1POP A;  1EWL A;  3KSE A;  5CVN B;  3QSD A;  3V6E A;  2G7Y A;  2YJB A;  4P6E A;  2NQD B;  1NB3 A;  3BC3 A;  1TL9 A;  3OVZ A;  1QMY A;  2FRQ A;  4YYW A;  1PPN A;  3M99 A;  3F75 A;  5J94 A;  4DMY A;  3DF0 A;  1ITO A;  1GEC E;  3IMA A;  3ZUA A;  2JQG R;  4WA6 A;  1CJL A;  3K9M A;  2P0R A;  3K8U A;  2G8J A;  4BPV A;  1KFX L;  3HWN A;  3QJ3 A;  4OEL A;  2DJF B;  2DC9 A;  2F7D A;  2HD5 A;  5PAD A;  2FYE A;  4P6G A;  1BP4 A;  2E03 A;  3KFQ A;  3H8B A;  3B79 A;  2B1M A;  2R6N A;  3RVW A;  5A24 A;  1AU3 A;  3E1Z B;  2OP3 A;  2DJG B;  2WBF X;  2E01 A;  2AYO A;  1Y4H A;  3P5W A;  1YK7 A;  3KWZ A;  2VHF A;  4BS5 A;  4QRX A;  1QOL A;  3H89 A;  1EWP A;  1NQC A;  1AYV A;  2DC8 A;  1AU4 A;  3KKU A;  3CBJ A;  2NQI A;  1KHQ A;  5CHT A;  4YYS A;  4CDF B;  1BGO A;  1ME3 A;  4W5B A;  2YJ9 A;  3BPF A;  3WXG A;  2PAD A;  4AXL A;  5FPW A;  3IEJ A;  2NQG A;  1KHP A;  1CS8 A;  1YVB A;  2OUL A;  1MHW A;  3OF8 A;  3OF9 A;  1QDQ A;  4YYR A;  4X6I A;  1NLJ A;  3CBK A;  4RY2 A;  3GCB A;  1U5I A;  2YJ2 A;  2DZY A;  1MS6 A;  2E02 A;  4QH6 A;  2XU3 A;  4QRV A;  1MEM A;  4FJC A;  2FRA A;  1U9Q X;  3I3T A;  3OVX A;  3K24 A;  2OZ2 A;  1AU0 A;  1F2C A;  4N8W A;  2DCD A;  4BQV A;  3F5V A;  5JH3 A;  2FO5 A;  1CB5 A;  2AUX A;  1F29 A;  2C0Y A;  1PAD A;  4N4Z A;  2R9F A;  1CTE A;  1AEC A;  1YT7 A;  4AXM A;  4FK5 A;  3WXF A;  2XU5 A;  1F2A A;  9PAP A;  3N4C A;  2R9C A;  1SNK A;  3PBH A;  2BDZ A;  2FUD A;  3O1G A;  4YYU A;  2AVW A;  4G54 A;  3RVX A;  3BOW A;  2R9M A;  3H8C A;  5F02 A;  3CH2 X;  1U9V A;  3BCN A;  2AUZ A;  3MHH A;  1O0E A;  2PRE A;  1NPZ A;  2AIM A;  1MIR A;  4X6H A;  4PAD A;  1AIM A;  3H7D A;  2G8E A;  2R9N A;  3RVV A;  2P86 A;  5EGW A;  4QRG A;  1ICF A;  2HXZ A;  1CVZ A;  6PAD A;  4CDC B;  1VJV A;  1DEU A;  2XU4 A;  3KWB X;  1PCI A;  3N3G A;  4OEM A;  3HHA A;  1PXV A;  3C9E A;  5K16 A;  2AYN A;  3KW9 A;  3PDF A;  3MTN A;  1A6R A; 
#chains in the Genus database with same CATH topology
 1AYU A;  3P5V A;  2DC6 A;  4W4U A;  1THE A;  1U9W A;  1PBH A;  1NL6 A;  1JQP A;  1ZIV A;  5EZS A;  3MOR A;  3PNR A;  1GMY A;  4BSQ A;  4N79 A;  2DZZ A;  4PT5 A;  3HD3 A;  1AYW A;  4QBB A;  2AS8 A;  2XU1 A;  4Q8G A;  5CVM A;  5E6J A;  1AU2 A;  3B21 A;  1BY8 A;  3IUT A;  2GHU A;  2Y5B A;  2YJC A;  1EWO A;  3RNV A;  2DC7 A;  1CPJ A;  7PCK A;  5JA7 A;  3USV A;  2E00 A;  1F2B A;  1K3B B;  3IOQ A;  1KXR A;  3V6C A;  4RF0 A;  2FTD A;  5CVO B;  3LXS A;  2O6X A;  4IUM A;  4D8I A;  3P5X A;  2DCB A;  1PE6 A;  1ME4 A;  1M6D A;  1U9X A;  4D8E A;  1FH0 A;  2Z84 A;  2ATO A;  3PHW A;  3BWK A;  4YYV A;  4K7C A;  2H7J A;  4D8B A;  3C0R A;  4W5C A;  4X6J A;  4MZO A;  3IHP A;  2IBI A;  1PPP A;  4MSX A;  3BPM A;  4YYQ A;  2CIO A;  1IWD A;  1DKI A;  2ACT A;  3MHS A;  1GLO A;  4HXD B;  3OIS A;  4CDE B;  1Q6K A;  2DCA A;  4PP1 A;  4OVZ B;  1CQD A;  1EWM A;  1S4V A;  1PPD A;  4I05 A;  1PPO A;  3QT4 A;  2GFO A;  4HWY A;  1ATK A;  2HH5 A;  3WXE A;  3PHU A;  1HUC B;  4BOZ A;  1YAL A;  1X9Y A;  4BOS A;  3S3Q A;  2R9O A;  3S3R A;  3N3K A;  3PW3 A;  4XR7 A;  4ZTB A;  2ARY A;  2HHN A;  4BS6 A;  5CHV A;  1GCB A;  2G6D A;  1DF0 A;  2VHS A;  3D6S A;  3U8E A;  3TMP A;  3TNX A;  5EF4 A;  4KLB A;  1TU6 A;  2B1N A;  1CV8 A;  1KFU L;  1YK8 A;  3AI8 A;  3I06 A;  1BQI A;  2JQF R;  2CB5 A;  3LFY A;  4Q8H A;  1YZB A;  4YV8 A;  2JRI A;  4PP2 E;  4YVA A;  3ERV A;  2FE8 A;  4I04 A;  2NQA A;  1XKG A;  2J7Q C;  3CH3 X;  8PCH A;  2F1G A;  1MDW A;  4P16 A;  3KX1 A;  1TLO A;  3NHE A;  3H6S A;  1MEG A;  1QXP A;  1STF E;  3P5U A;  3PT2 A;  1Y08 A;  4I07 A;  2BDL A;  4RNA A;  2AU1 A;  2DCC A;  2PBH A;  3MJ5 A;  1VSN A;  2Y6E A;  4FIP A;  1SP4 B;  3HHI A;  4ZUX U;  4DMX A;  1ZCM A;  2P7U A;  4CDD B;  1NB5 A;  2YJ8 A;  4A5U A;  1CSB B;  1EF7 A;  3IV2 A;  4XUI A;  3W31 A;  5JZE A;  2FQ9 A;  2IPP B;  4MZS A;  4CZW A;  2FT2 A;  4PI3 A;  4REZ A;  1PIP A;  2PNS A;  3O0U A;  1POP A;  1EWL A;  3KSE A;  5CVN B;  3QSD A;  3TRK A;  3V6E A;  2G7Y A;  2YJB A;  4P6E A;  2NQD B;  1NB3 A;  3BC3 A;  1TL9 A;  5KO3 A;  2AGA A;  2BTW B;  4IP3 A;  3OVZ A;  1QMY A;  2FRQ A;  4YYW A;  1PPN A;  3M99 A;  3F75 A;  3PSE A;  5J94 A;  4DMY A;  3DF0 A;  1ITO A;  1GEC E;  3IMA A;  3ZUA A;  2JQG R;  4WA6 A;  1CJL A;  3K9M A;  2P0R A;  3K8U A;  2G8J A;  4BPV A;  1KFX L;  3HWN A;  3QJ3 A;  4OEL A;  2DJF B;  2DC9 A;  2F7D A;  2HD5 A;  5PAD A;  2FYE A;  4P6G A;  1BP4 A;  2E03 A;  3KFQ A;  3H8B A;  3B79 A;  2B1M A;  3BBA A;  2R6N A;  3IFU A;  3RVW A;  5A24 A;  1AU3 A;  3E1Z B;  2OP3 A;  2DJG B;  2WBF X;  2E01 A;  2AYO A;  1Y4H A;  3P5W A;  1YK7 A;  3KWZ A;  4BOU A;  2VHF A;  4BS5 A;  4QRX A;  1QOL A;  3H89 A;  1EWP A;  1NQC A;  1AYV A;  2DC8 A;  3O65 A;  1AU4 A;  4BOQ A;  3KKU A;  3CBJ A;  2NQI A;  2BTW A;  1KHQ A;  5CHT A;  4YYS A;  4CDF B;  1BGO A;  1ME3 A;  4W5B A;  2YJ9 A;  3BPF A;  3WXG A;  2PAD A;  4AXL A;  5FPW A;  3IEJ A;  2NQG A;  4OW0 A;  1KHP A;  1CS8 A;  4OVZ A;  3MTV A;  1YVB A;  2OUL A;  1MHW A;  3OF8 A;  3OF9 A;  1QDQ A;  4YYR A;  4X6I A;  1NLJ A;  3CBK A;  4RY2 A;  3GCB A;  1U5I A;  2YJ2 A;  2DZY A;  2DOS A;  4MI7 A;  4R3D A;  1MS6 A;  3PRM A;  2E02 A;  4QH6 A;  2XU3 A;  4QRV A;  1MEM A;  4FJC A;  3OQC A;  4WUR A;  2FRA A;  1U9Q X;  3I3T A;  3OVX A;  3K24 A;  2OZ2 A;  1AU0 A;  1F2C A;  4M0W A;  4N8W A;  2DCD A;  4BQV A;  3F5V A;  5JH3 A;  2FO5 A;  1CB5 A;  2AUX A;  3ZNH A;  3MP2 A;  1F29 A;  2C0Y A;  1PAD A;  4N4Z A;  2R9F A;  1CTE A;  1AEC A;  2BU3 A;  1YT7 A;  4AXM A;  4FK5 A;  3WXF A;  2XU5 A;  1F2A A;  4RF1 A;  9PAP A;  3N4C A;  2R9C A;  1SNK A;  3PBH A;  2JTC A;  2BDZ A;  2FUD A;  3O1G A;  4YYU A;  2AVW A;  4G54 A;  3RVX A;  3PHX A;  3BOW A;  4GUA A;  2R9M A;  3E9S A;  3H8C A;  5F02 A;  3CH2 X;  1U9V A;  3BCN A;  2AUZ A;  2UZJ A;  3PRP A;  3MHH A;  3BY4 A;  1PVJ A;  1O0E A;  2J7Q A;  2PRE A;  1NPZ A;  2AIM A;  1MIR A;  4BOP A;  4X6H A;  5EZQ A;  4PAD A;  2HWK A;  1AIM A;  3BB7 A;  4RKX A;  3H7D A;  2G8E A;  2R9N A;  3RVV A;  2P86 A;  4XZX A;  5EGW A;  4MM3 B;  4QRG A;  1ICF A;  2HXZ A;  1CVZ A;  6PAD A;  4CDC B;  1VJV A;  1DEU A;  2XU4 A;  3KWB X;  3W30 A;  1PCI A;  1UKF A;  3N3G A;  4OEM A;  3HHA A;  1PXV A;  3C9E A;  5K16 A;  2AYN A;  3KW9 A;  3PDF A;  3MTN A;  1A6R A; 
#chains in the Genus database with same CATH homology
 1AYU A;  3P5V A;  2DC6 A;  4W4U A;  1THE A;  1U9W A;  1PBH A;  1NL6 A;  1JQP A;  1ZIV A;  3MOR A;  3PNR A;  1GMY A;  4BSQ A;  4N79 A;  2DZZ A;  3HD3 A;  1AYW A;  4QBB A;  2AS8 A;  2XU1 A;  4Q8G A;  5CVM A;  1AU2 A;  1BY8 A;  3IUT A;  2GHU A;  2Y5B A;  2YJC A;  1EWO A;  2DC7 A;  1CPJ A;  7PCK A;  5JA7 A;  3USV A;  2E00 A;  1F2B A;  1K3B B;  3IOQ A;  1KXR A;  3V6C A;  2FTD A;  5CVO B;  3LXS A;  2O6X A;  3P5X A;  2DCB A;  1PE6 A;  1ME4 A;  1M6D A;  1U9X A;  1FH0 A;  2ATO A;  3BWK A;  4NV7 A;  4YYV A;  4K7C A;  2H7J A;  4W5C A;  4X6J A;  4MZO A;  3IHP A;  2IBI A;  1PPP A;  4MSX A;  3BPM A;  4YYQ A;  2CIO A;  1IWD A;  2ACT A;  3MHS A;  1GLO A;  3OIS A;  4CDE B;  1Q6K A;  2DCA A;  4PP1 A;  1CQD A;  1EWM A;  1S4V A;  1PPD A;  4I05 A;  1PPO A;  3QT4 A;  2GFO A;  4HWY A;  1ATK A;  2HH5 A;  1W6F A;  3WXE A;  1HUC B;  1YAL A;  1X9Y A;  3S3Q A;  2R9O A;  1W5R A;  3S3R A;  3N3K A;  3PW3 A;  4XR7 A;  2ARY A;  2HHN A;  4BS6 A;  5CHV A;  1GCB A;  2G6D A;  1DF0 A;  2VHS A;  3D6S A;  2VFB A;  3U8E A;  3TNX A;  5EF4 A;  4KLB A;  1TU6 A;  2B1N A;  1CV8 A;  1KFU L;  1YK8 A;  3AI8 A;  3I06 A;  1BQI A;  2JQF R;  2CB5 A;  3LFY A;  4Q8H A;  4YV8 A;  4PP2 E;  4YVA A;  3ERV A;  4I04 A;  2NQA A;  1XKG A;  3CH3 X;  8PCH A;  2F1G A;  1MDW A;  3KX1 A;  1TLO A;  3NHE A;  3H6S A;  1MEG A;  1QXP A;  1STF E;  3P5U A;  1Y08 A;  4I07 A;  2BDL A;  2AU1 A;  2DCC A;  2PBH A;  1VSN A;  2Y6E A;  4FIP A;  1SP4 B;  1W4T A;  3HHI A;  4ZUX U;  4DMX A;  1ZCM A;  2P7U A;  4CDD B;  1NB5 A;  2YJ8 A;  1GX3 A;  1CSB B;  1EF7 A;  3IV2 A;  4XUI A;  2BSZ A;  2FQ9 A;  2IPP B;  4MZS A;  4CZW A;  2FT2 A;  4PI3 A;  1PIP A;  2PNS A;  3O0U A;  1POP A;  1EWL A;  3KSE A;  5CVN B;  3QSD A;  3V6E A;  2G7Y A;  2YJB A;  4P6E A;  2NQD B;  1NB3 A;  4B55 A;  3BC3 A;  1TL9 A;  3OVZ A;  1QMY A;  2FRQ A;  4YYW A;  1PPN A;  2VFC A;  3M99 A;  3F75 A;  5J94 A;  4DMY A;  3DF0 A;  1ITO A;  1GEC E;  3IMA A;  3ZUA A;  2JQG R;  4WA6 A;  1CJL A;  3K9M A;  2P0R A;  3K8U A;  2G8J A;  4BPV A;  1KFX L;  3HWN A;  3QJ3 A;  4OEL A;  2DJF B;  2DC9 A;  2F7D A;  2HD5 A;  5PAD A;  2FYE A;  4P6G A;  1BP4 A;  2E03 A;  3KFQ A;  3H8B A;  3B79 A;  2B1M A;  2R6N A;  3RVW A;  5A24 A;  1AU3 A;  3LTW A;  3E1Z B;  2OP3 A;  2DJG B;  2WBF X;  2E01 A;  2AYO A;  1Y4H A;  4BGF A;  3P5W A;  1YK7 A;  3KWZ A;  2VHF A;  4BS5 A;  4QRX A;  1QOL A;  3H89 A;  1EWP A;  1NQC A;  1AYV A;  2DC8 A;  1AU4 A;  3KKU A;  3CBJ A;  2NQI A;  1KHQ A;  5CHT A;  4YYS A;  4CDF B;  1BGO A;  1ME3 A;  4W5B A;  2YJ9 A;  3BPF A;  3WXG A;  2PAD A;  4AXL A;  5FPW A;  3IEJ A;  2NQG A;  1KHP A;  1CS8 A;  1YVB A;  2OUL A;  1MHW A;  3OF8 A;  3OF9 A;  1QDQ A;  4YYR A;  4X6I A;  1NLJ A;  3CBK A;  4RY2 A;  3GCB A;  1U5I A;  2YJ2 A;  2DZY A;  1MS6 A;  2E02 A;  4QH6 A;  4C5P A;  2XU3 A;  4QRV A;  1MEM A;  4FJC A;  2FRA A;  1U9Q X;  3I3T A;  3OVX A;  3K24 A;  2OZ2 A;  1AU0 A;  1F2C A;  4N8W A;  2DCD A;  4BQV A;  3F5V A;  5JH3 A;  2FO5 A;  1CB5 A;  2AUX A;  1F29 A;  2C0Y A;  1PAD A;  4N4Z A;  2R9F A;  1CTE A;  1AEC A;  1YT7 A;  4AXM A;  4FK5 A;  3WXF A;  2XU5 A;  1F2A A;  9PAP A;  3N4C A;  2R9C A;  1SNK A;  3PBH A;  2BDZ A;  2FUD A;  3O1G A;  4YYU A;  2AVW A;  4G54 A;  1E2T A;  3RVX A;  3BOW A;  2R9M A;  3D9W A;  3H8C A;  5F02 A;  3CH2 X;  1U9V A;  3BCN A;  2AUZ A;  4NV8 A;  3MHH A;  1O0E A;  2PRE A;  1NPZ A;  2AIM A;  1MIR A;  4X6H A;  4PAD A;  1AIM A;  3H7D A;  2G8E A;  2R9N A;  3RVV A;  2P86 A;  5EGW A;  4QRG A;  1ICF A;  2HXZ A;  1CVZ A;  4GUZ A;  6PAD A;  4CDC B;  1VJV A;  1DEU A;  2XU4 A;  3KWB X;  1PCI A;  3N3G A;  4OEM A;  3HHA A;  1PXV A;  3C9E A;  5K16 A;  2AYN A;  3KW9 A;  3PDF A;  3MTN A;  1A6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...