2R6NA

Crystal structure of a pyrrolopyrimidine inhibitor in complex with human cathepsin k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
216
Chain Sequence
RAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel scaffold for cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 67
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r6nA00
3WXEA 3GCBA 2VHFA 1BP4A 5A24A 5JH3A 3HWNA 4FK5A 1NQCA 3ZUAA 2AIMA 1X9YA 2OULA 3O1GA 3NHEA 3PBHA 5CHTA 4P6GA 1F29A 1Y08A 2XU5A 1BGOA 1TL9A 3V6EA 2AUXA 1AYUA 2YJBA 1IWDA 2VHSA 4YVAA 1CJLA 1PPOA 2DCDA 4QH6A 2DJGB 3KW9A 5J94A 1CS8A 3IUTA 4MZSA 2NQAA 2XU4A 5EF4A 3RVXA 1ME3A 2FO5A 1YK7A 2IBIA 1AECA 2DC7A 3CBKA 3OISA 2E03A 3N3GA 5CVNB 1MEGA 2B1NA 2G6DA 1GLOA 5K16A 3MHHA 3N4CA 3D6SA 1ICFA 1PADA 1HUCB 3B79A 2AVWA 3P5XA 3QT4A 4OELA 4BS6A 1CB5A 1SNKA 2AYNA 2Y5BA 1CSBB 2G8JA 1S4VA 1BQIA 3I3TA 1ZIVA 1QXPA 3PNRA 2AUZA 1CQDA 3CBJA 2G7YA 4I07A 3IHPA 2FT2A 3AI8A 4BQVA 4QRGA 3KKUA 1F2BA 2DC6A 4CZWA 1MS6A 1TU6A 1YK8A 4FIPA 1EWLA 4QBBA 3USVA 2Y6EA 3HHAA 3I06A 1U9XA 4W5BA 4CDDB 2PBHA 3PW3A 2HH5A 4N4ZA 3KX1A 1CV8A 3S3QA 2R9CA 1POPA 4CDFB 1Y4HA 3HD3A 1KHPA 1DF0A 4OEMA 1YALA 1QMYA 1ATKA 2FTDA 3V6CA 2B1MA 1YVBA 2JQGR 3BOWA 1KXRA 4XR7A 3OF9A 2R9NA 1GMYA 3IEJA 2H7JA 4I04A 3CH3X 1F2CA 4KLBA 2E00A 4YYWA 4W5CA 4PADA 1PIPA 1ME4A 4W4UA 2HHNA 2FRQA 1U9WA 1MDWA 2GHUA 3P5WA 2PADA 1F2AA 2DZYA 2PREA 1NPZA 3P5VA 2ATOA 1MEMA 4BPVA 1AU3A 1ITOA 5PADA 2G8EA 2CB5A 3IV2A 3KSEA 1CPJA 1VSNA 3HHIA 4DMYA 2XU1A 3CH2X 5CHVA 1NB5A 3H6SA 2JQFR 1U5IA 2YJCA 1AU4A 4Q8HA 3OF8A 3E1ZB 1GECE 1YT7A 2DCCA 2AS8A 3MTNA 5CVMA 3MORA 4WA6A 2NQIA 3OVXA 2IPPB 4YYSA 4RY2A 1XKGA 4CDEB 1STFE 3LXSA 4XUIA 1TLOA 4AXMA 4YYQA 2O6XA 3H8CA 1ZCMA 4FJCA 3F5VA 2WBFX 5CVOB 4YYRA 2YJ9A 3LFYA 2R9OA 1PPNA 3DF0A 4MSXA 1EF7A 2OP3A 5F02A 3H8BA 3RVWA 4DMXA 2DCBA 3QJ3A 4N8WA 4CDCB 1AYWA 1PXVA 2FUDA 2FYEA 2NQDB 3IMAA 2OZ2A 1MIRA 2F1GA 1GCBA 3IOQA 2DZZA 2F7DA 2P7UA 4P6EA 4YYVA 3H7DA 1A6RA 3S3RA 3QSDA 7PCKA 1PCIA 3KWZA 2DCAA 1AU2A 3F75A 2HXZA 1JQPA 2AYOA 2YJ2A 4ZUXU 4PP1A 2FQ9A 4BSQA 2YJ8A 4K7CA 1K3BB 1FH0A 1CVZA 2C0YA 3O0UA 1NB3A 3KFQA 4YV8A 4QRVA 3U8EA 2ARYA 3P5UA 4X6JA 2E01A 5EGWA 3RVVA 1BY8A 2XU3A 1SP4B 3KWBX 2DJFB 1U9QX 2PNSA 2NQGA 1AU0A 2ACTA 3PDFA 1DEUA 3BWKA 3C9EA 4AXLA 1QOLA 2P86A 1MHWA 2P0RA 1Q6KA 6PADA 4X6IA 3BCNA 1KHQA 1PPDA 3BPFA 3N3KA 4I05A 3K9MA 4PI3A 2DC9A 4Q8GA 2E02A 1KFUL 1NLJA 1EWOA 3WXFA 2CIOA 1KFXL 2R9FA 3BC3A 3WXGA 2FRAA 2BDZA 4PP2E 4BS5A 1QDQA 3H89A 5FPWA 1AYVA 2R9MA 3OVZA 3MHSA 1O0EA 1PPPA 3M99A 4MZOA 4X6HA 1AIMA 1THEA 3K24A 3BPMA 2HD5A 1PE6A 1VJVA 3K8UA 4QRXA 9PAPA 8PCHA 1CTEA 4YYUA 2R6NA 2DC8A 3ERVA 2BDLA 1U9VA 2GFOA 4N79A 1EWMA 1NL6A 1EWPA 2AU1A 3TNXA 1PBHA 1M6DA 5JA7A 4HWYA 4G54A
chains in the Genus database with same CATH superfamily
3WXEA 3GCBA 2VHFA 1BP4A 5A24A 4WURA 3PHXA 5JH3A 3HWNA 4FK5A 1NQCA 3ZUAA 2AIMA 3TRKA 1X9YA 2OULA 3MP2A 3O1GA 3NHEA 3PBHA 5CHTA 4P6GA 1F29A 1Y08A 2BTWA 2XU5A 1BGOA 1TL9A 3V6EA 2AUXA 1AYUA 2YJBA 1IWDA 2VHSA 3IFUA 4YVAA 1CJLA 1PPOA 4A5UA 4PT5A 2DCDA 4QH6A 2DJGB 3PSEA 3KW9A 5J94A 4IP3A 1CS8A 3IUTA 4MZSA 2NQAA 2XU4A 5EF4A 3RVXA 1ME3A 2FO5A 1YK7A 4IUMA 2IBIA 1AECA 2DC7A 3TMPA 4OVZA 3CBKA 3OISA 2E03A 3N3GA 5CVNB 1MEGA 1DKIA 2B1NA 1PVJA 2DOSA 2G6DA 1GLOA 5K16A 1YZBA 3MHHA 3N4CA 3D6SA 2FE8A 1ICFA 1PADA 1HUCB 3B79A 2AVWA 3P5XA 3QT4A 4OELA 4BS6A 1CB5A 1SNKA 2AYNA 2Y5BA 1CSBB 2G8JA 4R3DA 1S4VA 1BQIA 5KO3A 3I3TA 1ZIVA 1QXPA 3PNRA 4BOUA 2AUZA 1CQDA 3CBJA 2G7YA 4I07A 3IHPA 2FT2A 3AI8A 4BQVA 4QRGA 3KKUA 1F2BA 2DC6A 4CZWA 1MS6A 1TU6A 1YK8A 4FIPA 1EWLA 4QBBA 2J7QC 3USVA 4BOPA 2Y6EA 3HHAA 3I06A 1U9XA 4W5BA 4CDDB 2PBHA 3PW3A 3ZNHA 2HH5A 4N4ZA 3KX1A 1CV8A 5E6JA 2AGAA 3S3QA 2R9CA 1POPA 4RKXA 4CDFB 1Y4HA 3HD3A 1KHPA 1DF0A 4OEMA 1YALA 3W31A 4RF0A 1QMYA 1ATKA 2FTDA 3V6CA 2B1MA 1YVBA 2JQGR 3BOWA 1KXRA 4D8EA 4MI7A 4XR7A 3OF9A 4OW0A 2R9NA 1GMYA 3IEJA 2H7JA 4I04A 4ZTBA 3CH3X 1F2CA 4KLBA 2Z84A 2E00A 4YYWA 4W5CA 3BB7A 4PADA 4BOQA 1PIPA 1ME4A 4W4UA 3RNVA 2HHNA 2FRQA 1U9WA 1MDWA 3OQCA 2GHUA 4RF1A 3P5WA 2PADA 1F2AA 2DZYA 5EZQA 2PREA 1NPZA 2HWKA 3P5VA 2ATOA 1MEMA 4BPVA 1AU3A 1ITOA 5PADA 2G8EA 2CB5A 3IV2A 3KSEA 1CPJA 4BOZA 1VSNA 3HHIA 4DMYA 2XU1A 3CH2X 5CHVA 1NB5A 3H6SA 2JQFR 1U5IA 2YJCA 1AU4A 4Q8HA 3BY4A 4MM3B 2JRIA 3OF8A 3E1ZB 1GECE 1YT7A 2DCCA 2AS8A 3MTNA 3PRMA 5CVMA 4OVZB 3MORA 4WA6A 2NQIA 3OVXA 5JZEA 2IPPB 4YYSA 3BBAA 4RY2A 1XKGA 4CDEB 1STFE 4D8IA 3B21A 3LXSA 4XUIA 1TLOA 4AXMA 4YYQA 2O6XA 3H8CA 1ZCMA 4FJCA 3PT2A 4P16A 3F5VA 2WBFX 5CVOB 4BOSA 4YYRA 2YJ9A 3LFYA 2R9OA 1PPNA 3DF0A 2BTWB 4RNAA 4MSXA 1EF7A 2OP3A 5F02A 3H8BA 3RVWA 4DMXA 2DCBA 3QJ3A 4N8WA 4CDCB 3W30A 1AYWA 1PXVA 2FUDA 2FYEA 2NQDB 3IMAA 2OZ2A 1MIRA 2F1GA 1GCBA 3IOQA 2DZZA 2F7DA 2P7UA 4P6EA 4YYVA 3H7DA 1A6RA 3PHUA 3S3RA 3QSDA 7PCKA 1PCIA 3KWZA 4D8BA 2DCAA 1AU2A 3F75A 2HXZA 1JQPA 2AYOA 2YJ2A 4ZUXU 4PP1A 2FQ9A 4BSQA 2YJ8A 3O65A 4K7CA 1K3BB 1FH0A 1CVZA 2C0YA 3O0UA 4M0WA 3PHWA 1NB3A 3KFQA 4YV8A 4QRVA 3U8EA 2ARYA 3P5UA 3MJ5A 4X6JA 2E01A 5EGWA 3RVVA 1BY8A 2BU3A 2XU3A 1SP4B 3KWBX 2DJFB 1U9QX 2PNSA 2NQGA 1AU0A 2ACTA 3PDFA 1DEUA 3BWKA 3C9EA 4AXLA 1QOLA 2P86A 1MHWA 2P0RA 1Q6KA 6PADA 4X6IA 3BCNA 1KHQA 1PPDA 3BPFA 3N3KA 2J7QA 4I05A 4XZXA 3K9MA 3C0RA 4PI3A 2DC9A 4Q8GA 2E02A 1KFUL 1NLJA 1EWOA 3WXFA 2CIOA 1KFXL 2R9FA 3BC3A 3WXGA 2FRAA 2BDZA 4PP2E 4BS5A 1QDQA 1UKFA 4HXDB 3H89A 5FPWA 1AYVA 2R9MA 3OVZA 3MHSA 4GUAA 1O0EA 3MTVA 1PPPA 3M99A 3PRPA 4MZOA 3E9SA 4X6HA 1AIMA 2UZJA 1THEA 3K24A 3BPMA 2HD5A 1PE6A 1VJVA 3K8UA 4QRXA 9PAPA 8PCHA 1CTEA 4YYUA 4REZA 2R6NA 2DC8A 3ERVA 2BDLA 1U9VA 2GFOA 2JTCA 5EZSA 4N79A 1EWMA 1NL6A 1EWPA 2AU1A 3TNXA 1PBHA 1M6DA 5JA7A 4HWYA 4G54A
chains in the Genus database with same CATH topology
3WXEA 3GCBA 2VHFA 1BP4A 5A24A 5JH3A 3HWNA 4FK5A 1NQCA 3ZUAA 2AIMA 1X9YA 2OULA 3O1GA 3NHEA 3PBHA 5CHTA 4P6GA 1F29A 1Y08A 2XU5A 1BGOA 1TL9A 3V6EA 1W6FA 1AYUA 2AUXA 2YJBA 1IWDA 2VHSA 4YVAA 1CJLA 1PPOA 2DCDA 4QH6A 2DJGB 3KW9A 5J94A 1CS8A 3IUTA 4MZSA 2NQAA 2XU4A 5EF4A 3RVXA 1ME3A 2FO5A 1YK7A 2IBIA 2VFCA 1AECA 2DC7A 3CBKA 3OISA 2E03A 3N3GA 5CVNB 1MEGA 2B1NA 2G6DA 1GLOA 5K16A 3MHHA 3N4CA 3D6SA 1ICFA 1PADA 1HUCB 3B79A 2AVWA 3P5XA 3QT4A 4OELA 4BS6A 1CB5A 1SNKA 2AYNA 2Y5BA 1CSBB 2G8JA 2VFBA 1S4VA 1BQIA 3I3TA 1ZIVA 1QXPA 3PNRA 2AUZA 1CQDA 3CBJA 2G7YA 4I07A 3IHPA 2FT2A 3AI8A 4BQVA 4C5PA 4QRGA 3KKUA 1F2BA 2DC6A 4CZWA 1MS6A 1TU6A 1YK8A 4GUZA 4FIPA 1EWLA 4QBBA 3USVA 2Y6EA 3HHAA 3I06A 1U9XA 4W5BA 4CDDB 2PBHA 3PW3A 2HH5A 4N4ZA 3KX1A 1CV8A 3S3QA 2R9CA 1POPA 4CDFB 1Y4HA 3HD3A 1KHPA 1DF0A 4OEMA 1YALA 1QMYA 1ATKA 2FTDA 3V6CA 2B1MA 1YVBA 2JQGR 3BOWA 1KXRA 4XR7A 3OF9A 4NV7A 2R9NA 1GMYA 3IEJA 2H7JA 4I04A 3CH3X 1F2CA 4KLBA 2E00A 4YYWA 4W5CA 4PADA 1PIPA 1ME4A 4W4UA 2HHNA 2FRQA 1U9WA 1MDWA 2GHUA 3P5WA 2PADA 1F2AA 2DZYA 2PREA 1NPZA 3P5VA 2ATOA 1MEMA 4BPVA 1AU3A 1ITOA 5PADA 2G8EA 2CB5A 3IV2A 3KSEA 1CPJA 1VSNA 3HHIA 4DMYA 2XU1A 3CH2X 5CHVA 1NB5A 3H6SA 2JQFR 1U5IA 2YJCA 1AU4A 4Q8HA 3OF8A 3E1ZB 1GECE 1YT7A 2DCCA 2AS8A 3MTNA 5CVMA 1W4TA 3MORA 4WA6A 2NQIA 3D9WA 3OVXA 2IPPB 4YYSA 4RY2A 4B55A 1XKGA 4CDEB 1STFE 3LXSA 4XUIA 1TLOA 4NV8A 4AXMA 4YYQA 2O6XA 3H8CA 1ZCMA 4FJCA 3F5VA 2WBFX 5CVOB 4YYRA 2YJ9A 3LFYA 2R9OA 1PPNA 3DF0A 4MSXA 1EF7A 2OP3A 5F02A 1W5RA 3H8BA 3RVWA 4DMXA 2DCBA 3QJ3A 4N8WA 4CDCB 1AYWA 2BSZA 1PXVA 2FUDA 2FYEA 2NQDB 3IMAA 2OZ2A 1MIRA 2F1GA 1GCBA 3IOQA 2DZZA 2F7DA 2P7UA 4P6EA 4YYVA 3H7DA 1A6RA 3S3RA 1E2TA 3QSDA 7PCKA 1PCIA 3KWZA 2DCAA 1AU2A 3F75A 2HXZA 1JQPA 2AYOA 2YJ2A 4ZUXU 4PP1A 2FQ9A 4BSQA 2YJ8A 1GX3A 4K7CA 1K3BB 1FH0A 1CVZA 2C0YA 3O0UA 1NB3A 3KFQA 4YV8A 4QRVA 3U8EA 2ARYA 3P5UA 4X6JA 2E01A 5EGWA 3RVVA 1BY8A 2XU3A 1SP4B 3KWBX 2DJFB 1U9QX 2PNSA 2NQGA 1AU0A 2ACTA 3PDFA 1DEUA 3BWKA 3C9EA 4AXLA 1QOLA 2P86A 1MHWA 2P0RA 1Q6KA 6PADA 4X6IA 3BCNA 1KHQA 3LTWA 1PPDA 3BPFA 3N3KA 4I05A 3K9MA 4PI3A 2DC9A 4Q8GA 2E02A 1KFUL 1NLJA 1EWOA 3WXFA 2CIOA 1KFXL 2R9FA 3BC3A 3WXGA 2FRAA 2BDZA 4PP2E 4BS5A 1QDQA 3H89A 5FPWA 1AYVA 2R9MA 3OVZA 3MHSA 1O0EA 1PPPA 3M99A 4MZOA 4X6HA 1AIMA 1THEA 3K24A 3BPMA 2HD5A 1PE6A 1VJVA 3K8UA 4QRXA 9PAPA 8PCHA 1CTEA 4YYUA 2R6NA 2DC8A 3ERVA 2BDLA 1U9VA 2GFOA 4N79A 1EWMA 1NL6A 1EWPA 2AU1A 3TNXA 4BGFA 1PBHA 1M6DA 5JA7A 4HWYA 4G54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WXE A;  3GCB A;  2VHF A;  1BP4 A;  5A24 A;  5JH3 A;  3HWN A;  4FK5 A;  1NQC A;  3ZUA A;  2AIM A;  1X9Y A;  2OUL A;  3O1G A;  3NHE A;  3PBH A;  5CHT A;  4P6G A;  1F29 A;  1Y08 A;  2XU5 A;  1BGO A;  1TL9 A;  3V6E A;  2AUX A;  1AYU A;  2YJB A;  1IWD A;  2VHS A;  4YVA A;  1CJL A;  1PPO A;  2DCD A;  4QH6 A;  2DJG B;  3KW9 A;  5J94 A;  1CS8 A;  3IUT A;  4MZS A;  2NQA A;  2XU4 A;  5EF4 A;  3RVX A;  1ME3 A;  2FO5 A;  1YK7 A;  2IBI A;  1AEC A;  2DC7 A;  3CBK A;  3OIS A;  2E03 A;  3N3G A;  5CVN B;  1MEG A;  2B1N A;  2G6D A;  1GLO A;  5K16 A;  3MHH A;  3N4C A;  3D6S A;  1ICF A;  1PAD A;  1HUC B;  3B79 A;  2AVW A;  3P5X A;  3QT4 A;  4OEL A;  4BS6 A;  1CB5 A;  1SNK A;  2AYN A;  2Y5B A;  1CSB B;  2G8J A;  1S4V A;  1BQI A;  3I3T A;  1ZIV A;  1QXP A;  3PNR A;  2AUZ A;  1CQD A;  3CBJ A;  2G7Y A;  4I07 A;  3IHP A;  2FT2 A;  3AI8 A;  4BQV A;  4QRG A;  3KKU A;  1F2B A;  2DC6 A;  4CZW A;  1MS6 A;  1TU6 A;  1YK8 A;  4FIP A;  1EWL A;  4QBB A;  3USV A;  2Y6E A;  3HHA A;  3I06 A;  1U9X A;  4W5B A;  4CDD B;  2PBH A;  3PW3 A;  2HH5 A;  4N4Z A;  3KX1 A;  1CV8 A;  3S3Q A;  2R9C A;  1POP A;  4CDF B;  1Y4H A;  3HD3 A;  1KHP A;  1DF0 A;  4OEM A;  1YAL A;  1QMY A;  1ATK A;  2FTD A;  3V6C A;  2B1M A;  1YVB A;  2JQG R;  3BOW A;  1KXR A;  4XR7 A;  3OF9 A;  2R9N A;  1GMY A;  3IEJ A;  2H7J A;  4I04 A;  3CH3 X;  1F2C A;  4KLB A;  2E00 A;  4YYW A;  4W5C A;  4PAD A;  1PIP A;  1ME4 A;  4W4U A;  2HHN A;  2FRQ A;  1U9W A;  1MDW A;  2GHU A;  3P5W A;  2PAD A;  1F2A A;  2DZY A;  2PRE A;  1NPZ A;  3P5V A;  2ATO A;  1MEM A;  4BPV A;  1AU3 A;  1ITO A;  5PAD A;  2G8E A;  2CB5 A;  3IV2 A;  3KSE A;  1CPJ A;  1VSN A;  3HHI A;  4DMY A;  2XU1 A;  3CH2 X;  5CHV A;  1NB5 A;  3H6S A;  2JQF R;  1U5I A;  2YJC A;  1AU4 A;  4Q8H A;  3OF8 A;  3E1Z B;  1GEC E;  1YT7 A;  2DCC A;  2AS8 A;  3MTN A;  5CVM A;  3MOR A;  4WA6 A;  2NQI A;  3OVX A;  2IPP B;  4YYS A;  4RY2 A;  1XKG A;  4CDE B;  1STF E;  3LXS A;  4XUI A;  1TLO A;  4AXM A;  4YYQ A;  2O6X A;  3H8C A;  1ZCM A;  4FJC A;  3F5V A;  2WBF X;  5CVO B;  4YYR A;  2YJ9 A;  3LFY A;  2R9O A;  1PPN A;  3DF0 A;  4MSX A;  1EF7 A;  2OP3 A;  5F02 A;  3H8B A;  3RVW A;  4DMX A;  2DCB A;  3QJ3 A;  4N8W A;  4CDC B;  1AYW A;  1PXV A;  2FUD A;  2FYE A;  2NQD B;  3IMA A;  2OZ2 A;  1MIR A;  2F1G A;  1GCB A;  3IOQ A;  2DZZ A;  2F7D A;  2P7U A;  4P6E A;  4YYV A;  3H7D A;  1A6R A;  3S3R A;  3QSD A;  7PCK A;  1PCI A;  3KWZ A;  2DCA A;  1AU2 A;  3F75 A;  2HXZ A;  1JQP A;  2AYO A;  2YJ2 A;  4ZUX U;  4PP1 A;  2FQ9 A;  4BSQ A;  2YJ8 A;  4K7C A;  1K3B B;  1FH0 A;  1CVZ A;  2C0Y A;  3O0U A;  1NB3 A;  3KFQ A;  4YV8 A;  4QRV A;  3U8E A;  2ARY A;  3P5U A;  4X6J A;  2E01 A;  5EGW A;  3RVV A;  1BY8 A;  2XU3 A;  1SP4 B;  3KWB X;  2DJF B;  1U9Q X;  2PNS A;  2NQG A;  1AU0 A;  2ACT A;  3PDF A;  1DEU A;  3BWK A;  3C9E A;  4AXL A;  1QOL A;  2P86 A;  1MHW A;  2P0R A;  1Q6K A;  6PAD A;  4X6I A;  3BCN A;  1KHQ A;  1PPD A;  3BPF A;  3N3K A;  4I05 A;  3K9M A;  4PI3 A;  2DC9 A;  4Q8G A;  2E02 A;  1KFU L;  1NLJ A;  1EWO A;  3WXF A;  2CIO A;  1KFX L;  2R9F A;  3BC3 A;  3WXG A;  2FRA A;  2BDZ A;  4PP2 E;  4BS5 A;  1QDQ A;  3H89 A;  5FPW A;  1AYV A;  2R9M A;  3OVZ A;  3MHS A;  1O0E A;  1PPP A;  3M99 A;  4MZO A;  4X6H A;  1AIM A;  1THE A;  3K24 A;  3BPM A;  2HD5 A;  1PE6 A;  1VJV A;  3K8U A;  4QRX A;  9PAP A;  8PCH A;  1CTE A;  4YYU A;  2R6N A;  2DC8 A;  3ERV A;  2BDL A;  1U9V A;  2GFO A;  4N79 A;  1EWM A;  1NL6 A;  1EWP A;  2AU1 A;  3TNX A;  1PBH A;  1M6D A;  5JA7 A;  4HWY A;  4G54 A; 
#chains in the Genus database with same CATH topology
 3WXE A;  3GCB A;  2VHF A;  1BP4 A;  5A24 A;  4WUR A;  3PHX A;  5JH3 A;  3HWN A;  4FK5 A;  1NQC A;  3ZUA A;  2AIM A;  3TRK A;  1X9Y A;  2OUL A;  3MP2 A;  3O1G A;  3NHE A;  3PBH A;  5CHT A;  4P6G A;  1F29 A;  1Y08 A;  2BTW A;  2XU5 A;  1BGO A;  1TL9 A;  3V6E A;  2AUX A;  1AYU A;  2YJB A;  1IWD A;  2VHS A;  3IFU A;  4YVA A;  1CJL A;  1PPO A;  4A5U A;  4PT5 A;  2DCD A;  4QH6 A;  2DJG B;  3PSE A;  3KW9 A;  5J94 A;  4IP3 A;  1CS8 A;  3IUT A;  4MZS A;  2NQA A;  2XU4 A;  5EF4 A;  3RVX A;  1ME3 A;  2FO5 A;  1YK7 A;  4IUM A;  2IBI A;  1AEC A;  2DC7 A;  3TMP A;  4OVZ A;  3CBK A;  3OIS A;  2E03 A;  3N3G A;  5CVN B;  1MEG A;  1DKI A;  2B1N A;  1PVJ A;  2DOS A;  2G6D A;  1GLO A;  5K16 A;  1YZB A;  3MHH A;  3N4C A;  3D6S A;  2FE8 A;  1ICF A;  1PAD A;  1HUC B;  3B79 A;  2AVW A;  3P5X A;  3QT4 A;  4OEL A;  4BS6 A;  1CB5 A;  1SNK A;  2AYN A;  2Y5B A;  1CSB B;  2G8J A;  4R3D A;  1S4V A;  1BQI A;  5KO3 A;  3I3T A;  1ZIV A;  1QXP A;  3PNR A;  4BOU A;  2AUZ A;  1CQD A;  3CBJ A;  2G7Y A;  4I07 A;  3IHP A;  2FT2 A;  3AI8 A;  4BQV A;  4QRG A;  3KKU A;  1F2B A;  2DC6 A;  4CZW A;  1MS6 A;  1TU6 A;  1YK8 A;  4FIP A;  1EWL A;  4QBB A;  2J7Q C;  3USV A;  4BOP A;  2Y6E A;  3HHA A;  3I06 A;  1U9X A;  4W5B A;  4CDD B;  2PBH A;  3PW3 A;  3ZNH A;  2HH5 A;  4N4Z A;  3KX1 A;  1CV8 A;  5E6J A;  2AGA A;  3S3Q A;  2R9C A;  1POP A;  4RKX A;  4CDF B;  1Y4H A;  3HD3 A;  1KHP A;  1DF0 A;  4OEM A;  1YAL A;  3W31 A;  4RF0 A;  1QMY A;  1ATK A;  2FTD A;  3V6C A;  2B1M A;  1YVB A;  2JQG R;  3BOW A;  1KXR A;  4D8E A;  4MI7 A;  4XR7 A;  3OF9 A;  4OW0 A;  2R9N A;  1GMY A;  3IEJ A;  2H7J A;  4I04 A;  4ZTB A;  3CH3 X;  1F2C A;  4KLB A;  2Z84 A;  2E00 A;  4YYW A;  4W5C A;  3BB7 A;  4PAD A;  4BOQ A;  1PIP A;  1ME4 A;  4W4U A;  3RNV A;  2HHN A;  2FRQ A;  1U9W A;  1MDW A;  3OQC A;  2GHU A;  4RF1 A;  3P5W A;  2PAD A;  1F2A A;  2DZY A;  5EZQ A;  2PRE A;  1NPZ A;  2HWK A;  3P5V A;  2ATO A;  1MEM A;  4BPV A;  1AU3 A;  1ITO A;  5PAD A;  2G8E A;  2CB5 A;  3IV2 A;  3KSE A;  1CPJ A;  4BOZ A;  1VSN A;  3HHI A;  4DMY A;  2XU1 A;  3CH2 X;  5CHV A;  1NB5 A;  3H6S A;  2JQF R;  1U5I A;  2YJC A;  1AU4 A;  4Q8H A;  3BY4 A;  4MM3 B;  2JRI A;  3OF8 A;  3E1Z B;  1GEC E;  1YT7 A;  2DCC A;  2AS8 A;  3MTN A;  3PRM A;  5CVM A;  4OVZ B;  3MOR A;  4WA6 A;  2NQI A;  3OVX A;  5JZE A;  2IPP B;  4YYS A;  3BBA A;  4RY2 A;  1XKG A;  4CDE B;  1STF E;  4D8I A;  3B21 A;  3LXS A;  4XUI A;  1TLO A;  4AXM A;  4YYQ A;  2O6X A;  3H8C A;  1ZCM A;  4FJC A;  3PT2 A;  4P16 A;  3F5V A;  2WBF X;  5CVO B;  4BOS A;  4YYR A;  2YJ9 A;  3LFY A;  2R9O A;  1PPN A;  3DF0 A;  2BTW B;  4RNA A;  4MSX A;  1EF7 A;  2OP3 A;  5F02 A;  3H8B A;  3RVW A;  4DMX A;  2DCB A;  3QJ3 A;  4N8W A;  4CDC B;  3W30 A;  1AYW A;  1PXV A;  2FUD A;  2FYE A;  2NQD B;  3IMA A;  2OZ2 A;  1MIR A;  2F1G A;  1GCB A;  3IOQ A;  2DZZ A;  2F7D A;  2P7U A;  4P6E A;  4YYV A;  3H7D A;  1A6R A;  3PHU A;  3S3R A;  3QSD A;  7PCK A;  1PCI A;  3KWZ A;  4D8B A;  2DCA A;  1AU2 A;  3F75 A;  2HXZ A;  1JQP A;  2AYO A;  2YJ2 A;  4ZUX U;  4PP1 A;  2FQ9 A;  4BSQ A;  2YJ8 A;  3O65 A;  4K7C A;  1K3B B;  1FH0 A;  1CVZ A;  2C0Y A;  3O0U A;  4M0W A;  3PHW A;  1NB3 A;  3KFQ A;  4YV8 A;  4QRV A;  3U8E A;  2ARY A;  3P5U A;  3MJ5 A;  4X6J A;  2E01 A;  5EGW A;  3RVV A;  1BY8 A;  2BU3 A;  2XU3 A;  1SP4 B;  3KWB X;  2DJF B;  1U9Q X;  2PNS A;  2NQG A;  1AU0 A;  2ACT A;  3PDF A;  1DEU A;  3BWK A;  3C9E A;  4AXL A;  1QOL A;  2P86 A;  1MHW A;  2P0R A;  1Q6K A;  6PAD A;  4X6I A;  3BCN A;  1KHQ A;  1PPD A;  3BPF A;  3N3K A;  2J7Q A;  4I05 A;  4XZX A;  3K9M A;  3C0R A;  4PI3 A;  2DC9 A;  4Q8G A;  2E02 A;  1KFU L;  1NLJ A;  1EWO A;  3WXF A;  2CIO A;  1KFX L;  2R9F A;  3BC3 A;  3WXG A;  2FRA A;  2BDZ A;  4PP2 E;  4BS5 A;  1QDQ A;  1UKF A;  4HXD B;  3H89 A;  5FPW A;  1AYV A;  2R9M A;  3OVZ A;  3MHS A;  4GUA A;  1O0E A;  3MTV A;  1PPP A;  3M99 A;  3PRP A;  4MZO A;  3E9S A;  4X6H A;  1AIM A;  2UZJ A;  1THE A;  3K24 A;  3BPM A;  2HD5 A;  1PE6 A;  1VJV A;  3K8U A;  4QRX A;  9PAP A;  8PCH A;  1CTE A;  4YYU A;  4REZ A;  2R6N A;  2DC8 A;  3ERV A;  2BDL A;  1U9V A;  2GFO A;  2JTC A;  5EZS A;  4N79 A;  1EWM A;  1NL6 A;  1EWP A;  2AU1 A;  3TNX A;  1PBH A;  1M6D A;  5JA7 A;  4HWY A;  4G54 A; 
#chains in the Genus database with same CATH homology
 3WXE A;  3GCB A;  2VHF A;  1BP4 A;  5A24 A;  5JH3 A;  3HWN A;  4FK5 A;  1NQC A;  3ZUA A;  2AIM A;  1X9Y A;  2OUL A;  3O1G A;  3NHE A;  3PBH A;  5CHT A;  4P6G A;  1F29 A;  1Y08 A;  2XU5 A;  1BGO A;  1TL9 A;  3V6E A;  1W6F A;  1AYU A;  2AUX A;  2YJB A;  1IWD A;  2VHS A;  4YVA A;  1CJL A;  1PPO A;  2DCD A;  4QH6 A;  2DJG B;  3KW9 A;  5J94 A;  1CS8 A;  3IUT A;  4MZS A;  2NQA A;  2XU4 A;  5EF4 A;  3RVX A;  1ME3 A;  2FO5 A;  1YK7 A;  2IBI A;  2VFC A;  1AEC A;  2DC7 A;  3CBK A;  3OIS A;  2E03 A;  3N3G A;  5CVN B;  1MEG A;  2B1N A;  2G6D A;  1GLO A;  5K16 A;  3MHH A;  3N4C A;  3D6S A;  1ICF A;  1PAD A;  1HUC B;  3B79 A;  2AVW A;  3P5X A;  3QT4 A;  4OEL A;  4BS6 A;  1CB5 A;  1SNK A;  2AYN A;  2Y5B A;  1CSB B;  2G8J A;  2VFB A;  1S4V A;  1BQI A;  3I3T A;  1ZIV A;  1QXP A;  3PNR A;  2AUZ A;  1CQD A;  3CBJ A;  2G7Y A;  4I07 A;  3IHP A;  2FT2 A;  3AI8 A;  4BQV A;  4C5P A;  4QRG A;  3KKU A;  1F2B A;  2DC6 A;  4CZW A;  1MS6 A;  1TU6 A;  1YK8 A;  4GUZ A;  4FIP A;  1EWL A;  4QBB A;  3USV A;  2Y6E A;  3HHA A;  3I06 A;  1U9X A;  4W5B A;  4CDD B;  2PBH A;  3PW3 A;  2HH5 A;  4N4Z A;  3KX1 A;  1CV8 A;  3S3Q A;  2R9C A;  1POP A;  4CDF B;  1Y4H A;  3HD3 A;  1KHP A;  1DF0 A;  4OEM A;  1YAL A;  1QMY A;  1ATK A;  2FTD A;  3V6C A;  2B1M A;  1YVB A;  2JQG R;  3BOW A;  1KXR A;  4XR7 A;  3OF9 A;  4NV7 A;  2R9N A;  1GMY A;  3IEJ A;  2H7J A;  4I04 A;  3CH3 X;  1F2C A;  4KLB A;  2E00 A;  4YYW A;  4W5C A;  4PAD A;  1PIP A;  1ME4 A;  4W4U A;  2HHN A;  2FRQ A;  1U9W A;  1MDW A;  2GHU A;  3P5W A;  2PAD A;  1F2A A;  2DZY A;  2PRE A;  1NPZ A;  3P5V A;  2ATO A;  1MEM A;  4BPV A;  1AU3 A;  1ITO A;  5PAD A;  2G8E A;  2CB5 A;  3IV2 A;  3KSE A;  1CPJ A;  1VSN A;  3HHI A;  4DMY A;  2XU1 A;  3CH2 X;  5CHV A;  1NB5 A;  3H6S A;  2JQF R;  1U5I A;  2YJC A;  1AU4 A;  4Q8H A;  3OF8 A;  3E1Z B;  1GEC E;  1YT7 A;  2DCC A;  2AS8 A;  3MTN A;  5CVM A;  1W4T A;  3MOR A;  4WA6 A;  2NQI A;  3D9W A;  3OVX A;  2IPP B;  4YYS A;  4RY2 A;  4B55 A;  1XKG A;  4CDE B;  1STF E;  3LXS A;  4XUI A;  1TLO A;  4NV8 A;  4AXM A;  4YYQ A;  2O6X A;  3H8C A;  1ZCM A;  4FJC A;  3F5V A;  2WBF X;  5CVO B;  4YYR A;  2YJ9 A;  3LFY A;  2R9O A;  1PPN A;  3DF0 A;  4MSX A;  1EF7 A;  2OP3 A;  5F02 A;  1W5R A;  3H8B A;  3RVW A;  4DMX A;  2DCB A;  3QJ3 A;  4N8W A;  4CDC B;  1AYW A;  2BSZ A;  1PXV A;  2FUD A;  2FYE A;  2NQD B;  3IMA A;  2OZ2 A;  1MIR A;  2F1G A;  1GCB A;  3IOQ A;  2DZZ A;  2F7D A;  2P7U A;  4P6E A;  4YYV A;  3H7D A;  1A6R A;  3S3R A;  1E2T A;  3QSD A;  7PCK A;  1PCI A;  3KWZ A;  2DCA A;  1AU2 A;  3F75 A;  2HXZ A;  1JQP A;  2AYO A;  2YJ2 A;  4ZUX U;  4PP1 A;  2FQ9 A;  4BSQ A;  2YJ8 A;  1GX3 A;  4K7C A;  1K3B B;  1FH0 A;  1CVZ A;  2C0Y A;  3O0U A;  1NB3 A;  3KFQ A;  4YV8 A;  4QRV A;  3U8E A;  2ARY A;  3P5U A;  4X6J A;  2E01 A;  5EGW A;  3RVV A;  1BY8 A;  2XU3 A;  1SP4 B;  3KWB X;  2DJF B;  1U9Q X;  2PNS A;  2NQG A;  1AU0 A;  2ACT A;  3PDF A;  1DEU A;  3BWK A;  3C9E A;  4AXL A;  1QOL A;  2P86 A;  1MHW A;  2P0R A;  1Q6K A;  6PAD A;  4X6I A;  3BCN A;  1KHQ A;  3LTW A;  1PPD A;  3BPF A;  3N3K A;  4I05 A;  3K9M A;  4PI3 A;  2DC9 A;  4Q8G A;  2E02 A;  1KFU L;  1NLJ A;  1EWO A;  3WXF A;  2CIO A;  1KFX L;  2R9F A;  3BC3 A;  3WXG A;  2FRA A;  2BDZ A;  4PP2 E;  4BS5 A;  1QDQ A;  3H89 A;  5FPW A;  1AYV A;  2R9M A;  3OVZ A;  3MHS A;  1O0E A;  1PPP A;  3M99 A;  4MZO A;  4X6H A;  1AIM A;  1THE A;  3K24 A;  3BPM A;  2HD5 A;  1PE6 A;  1VJV A;  3K8U A;  4QRX A;  9PAP A;  8PCH A;  1CTE A;  4YYU A;  2R6N A;  2DC8 A;  3ERV A;  2BDL A;  1U9V A;  2GFO A;  4N79 A;  1EWM A;  1NL6 A;  1EWP A;  2AU1 A;  3TNX A;  4BGF A;  1PBH A;  1M6D A;  5JA7 A;  4HWY A;  4G54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...