2DOSA

Structural basis for the recognition of lys48-linked polyubiquitin chain by the josephin domain of ataxin-3, a putative deubiquitinating enzyme
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ataxin-3
publication title Mode of substrate recognition by the Josephin domain of ataxin-3, which has an endo-type deubiquitinase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 37
structure length 171
sequence length 171
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2dosA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2dosA01
1NS1A 2FKXA 4X64O 2AGAA 3RT3C 4LF6O 4DUYO 1XMQO 2JRIA 4LFBO 4B3TO 1XNQO 4DV1O 3R66A 3J81N 4B3MO 5BY1A 4DR3O 4A5UB 4DR7O 5LMNO 2DOSA 4DR5O 1X59A 2LW7A 5FLXN 2F4VO 1N36O 4LF7O 4X65O 4JYAO 1N34O 4LF9O 4B3SO 2UXCO 4JI3O 4GKKO 2ZM6O 4OPAA 4B3RO 2N74A 1IBLO 4OPHA 5H5NA 1HNWO 4JV5O 2UUAO 1N32O 1FJGO 3J80N 4DV6O 4DR1O 1KUQA 4JI8O 4K0KO 1F7YA 1YZBA 4DV3O 1IBKO 4NXMO 2ZKOA 2UUBO 4JI2O 4DR4O 4LF4O 4DR2O 1I94O 4DUZO 1IBMO 1FYJA 2DJVA 3OTOO 1HNZO 4DR6O 5LMUO 4YY3O 1XEQA 4DV4O 5A2QN 4JI4O 3T1HO 4YHHO 4X66O 2UXBO 5IT9N 1R6TA 1DK1A 1XNRO 3M8AA 4DV5O 2Z0AA 3T1YO 4AQYO 2E5LO 3F5TA 2VQFO 1HR0O 4LFCO 1R1BA 5BR8O 1A32A 4DV2O 4JI7O 5LL6Y 1N33O 5BXZA 3J7AU 1J5EO 4LF5O 2UXDO 4NXNO 4X62O 1AILA 1AB3A 4KHPO 2UU9O 1D2DA 2HHHO 4JI0O 4JI6O 3JAMN 4OX9O 4GKJO 3O65A 4JI1O 1G1XB 2VQEO 4JI5O 2UUCO 3SDLA 1FKAO 4LF8O 5IWAO 4LFAO 4DV7O 1XMOO 1HNXO 4DV0O
chains in the Genus database with same CATH superfamily
3OMNB 2NNUA 3ABKB 2CH7A 2XAJA 2P5OA 5KUKA 3RVYA 4ZI7A 3B4SA 3RT3C 1K33A 1BGOA 1QDQA 4FLVA 1KMIZ 3BA9A 3C90A 3JAWB 1F4NA 3HKBA 3SPGA 3K0DA 4AXMA 4LNUA 4GT1A 1AECA 1AJQA 3JD2A 2YJCA 2OCHA 5KO3A 2OP3A 3CCQV 2UZJA 4DYLA 3CCUV 3APQA 2EILC 2E3CA 3BBAA 1Y74A 4FJCC 2LO1A 2GUZA 4W5CA 1ZUQA 2PZSA 3OF8A 2MK3A 4FIPC 3BCNA 3RVXA 2ODMA 3E35A 5IYZB 1HNZO 1Z2GA 3TGUH 3DTUB 3ZHVA 3JSNA 4P2ZA 1DF0A 1OCRB 3M7MX 1HUCB 4KLBA 1H2NA 1Q5OA 4YJ3B 2UU9B 3ZX6A 4ZOLA 4MVRA 4O4JA 2VS0A 4LP8A 1H8EG 1Z5WA 2K9PA 5FPOA 3TETA 1CEZA 3OR6C 3PHUA 4UB8Z 5CHTA 2Y69C 3S3WA 2VQEB 3AG1C 1R1BA 5EBMC 2IBZH 4MSWC 2WWWA 3EFFK 1FFXA 3JCZA 1SESA 1XMQB 2OCCC 4FJCA 5A9GA 4UB6Z 2ARHA 2L35A 2RJZA 1SA0B 4OW0A 3ZMTA 3JASA 4NTWA 5H2FZ 4J11A 1P7BA 3ZHTA 4FIPA 4A5UA 1OCZC 4WFFA 4HZ3A 2Q9LA 4TV8A 3CBKA 1AJNA 1KD1W 4GX0A 1ZX3A 4LF9B 2XU5A 2YIBD 1G4YB 3U0ZA 2XASA 1N32B 2Q8VA 1BQIA 3H89A 1QHTA 2FT2A 4GX2A 1WA8B 2LJ2A 3I56V 1H38A 5EF4A 2HD5A 1H2SB 3G6EV 4JI2B 1VQ8V 3PDFA 2EIKB 1WN7A 4CS2A 4TUYA 2EX3A 4XR7A 1VQOV 2DOSA 3IHPA 4JI4B 2QTOA 5FLXN 4O4HA 3SJAC 2F4VO 1P49A 3CX5F 2PI5A 3HHIA 4JV5B 2JVDA 1B04A 3BABA 1IBLO 3A0BZ 4I4TA 3JYCA 1V54B 1GECE 2AUXA 4RQFA 2DW4A 2Q6AA 4FM0A 4MTXA 4K0KO 1GTOA 4LWSA 1TVKA 4NXMO 4JTCB 2R9OA 3M99B 3LSUA 1QR8A 5GONB 1SERA 1S5LZ 5B3SB 4DK0A 2HVJC 3GVMA 4YY3O 1K97A 4LF5B 3OQCA 3SPIA 4FK5C 2UXBO 1EWMA 4I05A 2FRQA 2ITDC 2JEXA 3QG5A 1DK1A 4NTYA 4JI0B 3ETGA 2KG7A 1PD3A 2HP8A 3WFVA 3F75A 4JYYA 1EF7A 2Y0PA 3K9AA 2CAZC 3F5VA 3H6SA 4BW5A 4LFCO 5CA1B 3H8BA 1AI5A 1GRJA 1XKGA 3RYFA 2QKCA 2QE7G 4J42A 5BXZA 5J2TB 1M93A 3I5DA 5KX5B 4EKWA 4IUMA 2P0RA 1Y66A 4ASUG 1AB3A 4ZTBA 1THEA 3ASOC 3V6CA 4HWYA 1HWYA 2AHZA 3RVZA 2E00A 4B3MB 4AHCA 2QR4A 2WLIA 1NR1A 1YJWV 1Y08A 2AUZA 1GN6A 4PI3A 2GTAA 1RM1C 4B3SB 4JI3B 1XREA 1F2CA 1AJPA 3CJHB 5CMUA 3NHEA 2PADA 3MORA 1OCOB 5D5PA 1ME3A 1F2AA 1KYOF 1ZLZA 4R7CA 2UUBB 3B21A 2Y5BA 3HPLC 2B1NA 1NL6A 3BFRA 3P3NA 3K08A 1S76D 5FPWA 4BPVA 4DUZB 4UCVA 2AYNA 1QQCA 3K0GA 4MTOA 4B3TO 4MVQA 1MEGA 4DV1O 4DR6B 3D6SA 3ETDA 2DWDC 5LMNO 3APOA 4DR7O 2EINC 1EN6A 2LW7A 3N2GA 4X1YA 4YHHB 2AYOA 3BA8A 5CA0B 1GCBA 4QRXA 1XNRB 3O9OA 1BMFG 4B3RO 2YI8A 4OPHA 2BDLA 1NH2D 3L73H 5B1BC 2EJ7A 1FXKC 2IPPB 3ERVA 1AU3A 3K04A 5KMGA 2E03A 1G8MA 2PF4E 4PA7A 4TT3G 2VQFB 4MSXA 1SS3A 3CMAV 3L70H 3G80A 4O2BB 4LF4O 3ZMVA 1HW7A 1Q82W 2YUAA 3BB7A 1M6DA 3CE2A 2OTLV 1NB5A 2HVKC 2KSDA 3ZN0A 3DC5A 3E22A 4RWUA 1XEQA 4DV4O 4UVAA 2B1GA 4FM2A 3KKUA 4WCEV 3PNRA 3EHBB 3UCSC 3ZJZA 4NKGB 4BQVA 1TUBA 4DRXB 5ITZB 2AXTZ 1N0NA 4NR1A 4ZBMA 3CBJA 1EWOA 4YVAA 4GUAA 3E86A 1VJVA 2YJ2A 1WPXA 5JQGA 4DV2O 2MW2B 5LP6C 1CS8A 1AI4A 1WNSA 1GN4A 2FQ9A 2OIGA 1NT2B 1SETA 2UXDO 5EYPA 1FXKA 4QRVA 4PP2E 2BE3A 1IVSA 1R3IC 1X9YA 5GW7A 3JD0A 3H1IH 2LFRA 3QT4A 5JZEA 1PCIA 1ENVA 2JGUA 1NQCA 4BOQA 1PNKA 3H1HH 3WXGA 1GO3F 3CWBH 3O65A 4RKXA 1W0JG 4UUJC 3L74H 1GLOA 1VEWA 1Q6KA 3ZHUA 1R73A 1XBLA 4I55A 4RAIA 4PDMA 4MZOA 5EBLC 3H1KH 1S72V 2G6DA 4DUYO 3JAKA 2DYSC 4JI8B 1QCEA 2GV9A 2YI9A 4JZGA 3RYHB 2ZINA 4YJ2A 1YCIA 3DC6A 1ZIVA 3AG3C 3CEIA 3C3SA 3S3XA 3R66A 5LP6A 3LSQA 4Q6GA 3CCMV 3AG2B 3SPJA 4LC1A 5EC1C 5LGNA 3TNXA 4UXNA 2V4DA 2PY5A 3ZMZA 4MVOA 2CTQA 5JVDA 3BCCH 5H5NA 2R9FA 1BE3H 3E8FA 3T1YB 1FJGO 4O4IB 2WLNA 3PHWA 4BS5A 2IJKA 4X1KA 1KUQA 1Y76B 1KHQA 1WP7A 2YEVB 1MHWA 5H6RA 1K7DA 4J7ZA 1T5EA 3T2MA 4UFZA 4MTFA 3VQXA 2R9MA 3ZRWB 4ZHQB 1PPOA 3JD1A 2EZOA 5J2UA 4Z1VA 5LHGA 4ZIBA 1V9PA 4FVMA 5EZYB 2M7WA 3RGBA 2AS8A 3M8AA 4JASA 2HHHB 1AP5A 2RN9A 3A2FA 3BPFA 1I7FA 1H2LA 1M57B 1PADA 1Q8IA 3OEEG 1SNKA 1AI7A 4F6RA 2ZCEA 1JOYA 4PA4A 2GFOA 2CDYA 5JJJB 2AZ0A 1Z5VA 1N8RW 2WLHA 1DKIA 5BR8O 2QWOB 3RVVA 2UXNA 2Y4UA 2JQGR 3T1CA 4N23A 4BS6A 4TV9A 5EGWA 1QU7A 5LOVB 3IUTA 1M90W 1AILA 1AYUA 1BQZA 2D3OW 1NH2B 1PPDA 1DF5A 4I9QA 2PBHA 3GWKC 2JGDB 2NR5A 3P5VA 5B66Z 3UKMA 3DXRB 4LF7B 3UT5B 4JYAB 1N34B 2YICA 4GKKB 4W5BA 1QBZA 1PNMA 2UUAB 4LFAO 2W0XA 5KHIA 5C8YA 4DV0O 1O0EA 2AW9A 3HHAA 1P7GA 4X64O 3IFUA 1K4DC 1K4CC 3HKDA 3N3GA 5KAFZ 2IU3A 3X2QC 1IBKB 3HR0A 4LF6O 2H3OA 2LP7A 4DR2B 2GDSA 4FLZA 3WG7C 3QO7A 1W2BU 3J81N 4X1IB 3JD4A 3OAAG 4PI2A 3IV2A 4HNAA 3H7DA 4FFBB 3RYCA 2XTAA 4FZ1A 1F23A 5CB4B 1M56B 2PGGA 1XOUA 5JWPA 3S3QA 3ZCCA 3ABLC 4AQYB 4DR1O 2A7WA 2E76B 2BSKA 3OFNG 3HKEB 4U3JA 5LBQA 4JI7B 3D36C 3LDCA 3RNVA 1GKFA 5BMVA 5EBWC 1NVPD 1VQ7V 1SQXH 4WFEA 4GLXA 3V6EA 5A2QN 3T1HO 1X4TA 1WLEA 1IXBA 3FAVA 1CP9A 2X0LA 1N4CA 4UCRA 3N27A 1G6UA 3ASNB 1VSNA 5LGTA 1NTMH 4PP1A 1CV8A 3FB6C 4P30A 3CC4V 4GKJB 4IHJB 2RMKB 3AG4C 3JATB 4JPRA 3W30A 3STLC 1MSDA 2X7RB 4LF8B 3N2KB 1N33O 5J9PC 3SPCA 2XAGA 4J41A 4IL6Z 2DC8A 3BRCA 1SRYA 4CDEB 4M0WA 4I7ZB 2DMXA 5EIBC 3R65A 2B1IA 4JYCA 1MS6A 1VQLV 4GUNA 5IDJA 3HB3B 3NR7A 3F5WC 5IYBO 3D36A 3PRMA 3CSXA 4OX9O 5F2VO 4QGPA 3FD9A 2AVWA 4OEMA 3TXQA 3L9DA 2P7UA 2EJRA 4N79A 4CC5A 1JJ2U 2VWJA 5IWAO 4O2AB 2VHFA 4TQDA 2QM8A 1L1FA 1PM9A 3OR7C 2YJBA 1YIJV 4FLTA 4ZI7B 2KQXA 1AYWA 2JRIA 4LFBO 2YIAA 1BS3A 4EB6A 2D2CB 3ABMC 3H1LH 3K24A 1IDSA 3STZC 2P90A 1YEWA 4C7UA 5LMUB 4IIJB 4X88A 1K34A 1IWDA 2XAFA 2YJ9A 1JJOA 2UXCO 2ZDIC 3ABKC 4JV5O 3GCBA 3QO8A 4XZXA 1ZL8A 1YHQV 4W4LA 4K35A 4PHZA 2GUZB 1UFIA 3DGEA 2DZYA 1I94O 2BOBC 2HFEC 3QF7A 1AR4A 1CJLA 2Q0AA 2NQIA 4MI7A 5IYDO 1J5EB 3P3PA 1QR9A 3PHXA 4BIUA 1ZWIC 2YC0A 3OISA 1J95A 5K1XA 4JI6B 3F7YC 4X20B 1H2KA 2CB5A 2DCAA 2BTQA 3D3IA 5IE9A 3G6BA 4PDVA 3ZIAG 1JR9A 4JI1B 2Q5ZA 1ZCMA 2XOKG 3E9SA 2UUCB 5JH7A 2LFSA 2N05A 3FB5C 1XI1A 1AU2A 4DV7B 2B1MA 1OCRC 1YXBA 2ZDIA 5L3EA 3E89A 4U7OA 4R6ZA 4P6EA 3PRPA 2F66C 3A8TA 2IH1C 4G28B 4MVZA 4KHPO 3TXSA 3JAWA 2BCCH 4DR3B 5JH3A 1IZ3A 2R70A 4X6HA 4TV8B 3CP1A 4X65B 1G1XB 4RQEA 3L75H 1NVPB 3BOWA 2DN9A 3OT7A 4DV6B 2XT9A 2CTPA 1CXZB 2IU0A 4K3AA 1OHHG 2BOCC 4JZ2A 5LHHA 2NQDB 4FLUA 1NQTA 2ZQMA 3K5OA 2CTRA 5IYZA 2JS3A 1S5HC 1XNQO 5J94A 4H13B 4YV8A 3ABTA 4DR5O 1FXHA 5IYCO 1QLEB 1KKCA 2C2AA 1JMKC 4YJ3A 1GAXA 2DC6A 2ZM6O 4GX1A 3H01A 2FTDA 2E74B 4IYHA 3KG2A 5CBGA 5JJNB 2O57A 1BZKA 2FL4A 2LGQA 9PAPA 2YIDA 4RUFA 2EIKC 2ZXWB 4K8ZA 1PKXA 1VQMV 1KFUL 2O6XA 4AILC 4KXRA 2ZIOA 3K5NA 4YIPA 4MW8A 3BPMA 1LUVA 3PW3A 1BL8A 1S0VA 2B9ZA 5IJ9B 2VHSA 3CB2A 4NXNB 2WA4A 1URFA 4X66O 3FYIB 3E83A 1V54C 2VRZA 5CHVA 5IY5B 1SA0A 1PPNA 4JGSA 1PNLA 1H2GA 2E02A 2KG7B 3QTCA 2HWKA 5L3GA 5B3SC 1HR0O 3MHHC 2WPDG 4MZSA 2G8EA 4I0XA 1S3JA 1K5SA 2W6IG 2R72A 4E2LA 5KHGA 1WA8A 3MTVA 4WBNB 3RYIB 1SKVA 3CD6V 4IGGA 1VARA 1Q43A 1Q6IA 5LYJA 3I06A 3L71H 4WFBV 4YYSA 2AZ2A 3A0HZ 1WP8A 3CCVV 5B1OA 4REZA 5F02A 3MHSC 2WLIB 4JI5O 4MW3A 3SJQC 1SZTA 4H33A 4BWAA 2WA3A 2G38A 1B3QA 1KQSU 3ETQA 5E6JA 4OVZB 3W7XA 4KUMA 3E8HA 4K7CA 3SYQA 3ZEDA 2P4VA 3OD4A 1L8DA 4B7EA 3MHHA 1HNZB 4X6IA 2DC9A 2IJHA 4ZKIA 3JALB 3HKCB 1N36O 3N2GB 3U11A 5GTIZ 2PYJA 4FK5A 1TGOA 1OCOC 1SQQH 4U7NA 4CH6A 2JTCA 5IJ0A 1GMYA 4IT5A 5FL7G 3RBZA 2Q68A 2NQAA 2A79B 2BU3A 2K1EA 1OCCB 1YJNV 1I08A 3K58A 3AK2A 1NKDA 5CA1A 3E1ZB 4BOUA 3MHSA 3FFQA 3A0RA 3SYCA 1GM7A 1V55B 5KX5A 1MNGA 3KCXA 3CS5A 4L8JA 3CYOA 1LNQA 3F7VC 2Z84A 4G2KA 4DMYA 1LR1A 3L72H 4B7KA 4DV5B 1Q81W 1M5IA 4D7SA 2BTOA 4UVBA 3JD3A 1Q86W 2CTWA 3RVWA 2R9RB 2HXZA 3WXFA 3CRCA 3WB2A 2DYRB 2E5LO 4PA6A 3CXHF 1BT8A 1F4MA 2GHUA 2RQ6A 2DQ3A 5LL6Y 4X8AA 1FD9A 3CJHA 2DCDA 1R3LC 1YTFD 1BHBA 1P4RA 4ICGA 3WB0A 3ML0A 3Q4HB 5GTHZ 1VMGA 1UPGA 4X62O 2ACTA 2A9HA 2OTJV 1THZA 2P67A 4JTDB 1JQ0A 4WF9V 2F4VB 5CA0A 1YF2A 4H0LB 3LFYA 3ABUA 3B09A 1Q3EA 3QJ3A 2PYLA 1IBLB 1PP9H 2UXXA 2ZD9A 1GN2A 4UCTA 4PDLA 3D3QA 4K0KB 4O4LB 2PI4A 2DCCA 1EWLA 3JAKB 4NXMB 3D8CA 4GX5A 4O2BA 3GB7C 2DE0X 1WPBA 1A6RA 6PADA 4YY3B 3G67A 1YJ9V 4QRGA 1RSOB 3IEJA 3CXCU 2YIBA 4I9WA 4D6TH 2UXBB 2HR3A 2ZE5A 3ZHQA 5JA7A 4DRXA 5ITZA 5JVDB 3N4CA 3ZNHA 1BSMA 3FX7A 1NB3A 1F7YA 2QSAA 2QM4A 1FH0A 1ZAUA 3G71V 1JPXA 2XU3A 2H8PC 4LFCB 1XL4A 1K9MW 3GWOA 1IX9A 4JAUA 2JEUA 3LSSA 2FE8A 3T4DA 1XUQA 1IBMO 3AG2C 1L0NH 4B08A 1DGSA 1Q7YW 3K57A 1O9HA 3QO5A 2X6BA 8PCHA 3TK1A 2P22C 3WXEA 2QA4V 1TUEB 2WBFX 1VQNV 1STFE 2Q0OC 5LA6B 4MVMA 4F6RB 2WLLB 3CH2X 3C9EA 2FTKA 3OM3B 1NR7A 4BOZA 1PV0A 3RYHA 2RNBA 5K1PA 3B79A 1YK7A 2EIJB 2QM7A 3BWKA 1M57C 2HEPA 4B3TB 4DV1B 1AI6A 5JCOC 3SYOA 1Q6HA 1NBMG 4DR7B 5LMNB 2HHNA 3CRMA 5H9CA 1PXVA 4FM1A 5L3BA 2BDZA 4NVPA 3CCSV 1VQPV 5B1NA 2EBOA 1NZ6A 1XMOO 1HNXO 1S77D 2XAQA 1MZEA 4QNHB 3SYAA 1YVWA 2AGAA 2YEVA 3OGIB 2IH3C 1K92A 4LF4B 2ATOA 2OZ2A 3UQ8A 4H44B 1VP7A 1KU9A 1KP2A 1SQPH 1MZFA 4YYVA 3ZRWA 4ZHQA 4DV4B 2DC7A 1DEUA 5EZYA 2Y4TA 3UM7A 2ZR2A 2VWKA 2AU1A 5FNVA 2N74A 3CC7V 1HNWO 3JARB 4DV3B 3QVNA 2YXLA 3MP2A 4PD4F 3KFQA 4DV2B 4I50B 1Y6XA 2G8JA 4UVCA 1MMMA 3P5UA 1TL9A 1ROPA 4HYOA 3FB8C 2EIMB 1NLJA 4X6JA 5BMVB 1M56C 5LOVA 2UXDB 2HH5A 3KX1A 2Q7GA 3WB1A 1YDXA 2C0YA 2F93B 1U9XA 4LCUC 5HFLA 4PADA 3KCYA 3CCRV 2JGDA 4HXDB 3KWZA 1JVMA 2DWEC 3DXRA 2WLKA 5HFMA 1I5XA 4DO2A 3P5XA 4Z1MG 1OJHA 4LR3A 3K79A 1A32A 1VQ5V 5CBHA 4DUYB 1U5IA 1BY8A 4RF1A 1U96A 4QPKA 3ASNC 3ZS8C 2LGWA 2BTWA 2UU9O 4G54A 4OXSA 3ZBHA 1PL4A 1Y4MA 4LH6A 3CHXA 4XDKA 5DECA 4X1IA 1W59A 1B6QA 4FFBA 1Y67A 3OGCC 5E1AC 2VQEO 3B8NA 5CB4A 2IJJA 5KA5A 3DF0A 1VF7A 3JCUZ 1VQ6V 1K5QA 3QSDA 3K3WA 1FJGB 1NS1A 4GZRB 1MIRA 3I3TA 1U9QX 1EWPA 5DN6G 3OW2U 2Q67A 3IMAA 4X89A 1RPOA 4CH3A 1XMQO 1JFFB 3PN1A 2JJ2G 1F2BA 4JTAB 4XDJA 2F1GA 2DQ0A 1UJWB 1PPJH 4UV9A 4LF9O 2ZE7A 5H6QA 1PIPA 1N32O 2P4KA 1S5JA 4J10A 4IHJA 2CH7B 2QDOA 1YZBA 3TRKA 3CCJV 4CDDB 4K8XA 4P16A 3JATA 2ZIMA 2ITCC 4JI2O 4BSQA 5BR8B 3OTOB 3N2KA 4IP3A 4JAVA 2WSSG 1NTKH 5BZBA 2Z3YA 3HKBB 5CA3A 4LNUB 4JI4O 3KSEA 3SJCC 4J7JA 4J80A 4BW9A 1U9VA 2OYQA 4R8CA 3BC3A 4DK1A 4LBEC 3TJTA 1US6A 2Y48A 1SP4B 1I5YA 2LW1A 3W7UA 1DTOA 1AU0A 3MDSA 4J9YB 2H7JA 1VIBA 1Y74B 5LGUA 3F5TA 1ITOA 4PA3A 5PADA 3LNNA 3TCUA 1VF5B 5TISZ 4LFAB 1AR5A 2NQGA 4DV0B 2EULA 4X64B 5B1AB 4LF5O 4LF6B 4UCSA 3ZMSA 5LXTA 2Y0IA 3LDEA 4ZOLB 4JI0O 4RO2A 1M4UA 1CTEA 1L0LH 4O4JB 5EZQA 4IIJA 4DW0A 5CVMA 2ZR3A 1HDJA 2CK3G 1XHZA 3P32A 1MEMA 1VQ9V 3CMEV 4QE9A 4D8IA 1KBHA 4ABMA 2DCBA 4D8EA 1FKAO 1PE6A 1KKDA 1Y4HA 2JK5C 1R6KA 4QPJA 4DR1B 1GM9A 1TA8A 3C3TA 4H37A 1FFXB 1F51A 2EILB 1QNMA 3W7TA 4I07A 3O1GA 4YIOA 1YITV 3K06A 4QBBA 3JASB 1E1QG 2YS8A 4B3MO 4A5UB 5EK0A 3T1HB 4ZUXU 2YXYA 3BAAA 1MA1A 2ADPA 3LXSA 4B3SO 4JI3O 3SYPA 1FXVA 4X20A 4U3FH 2HJDA 1PVJA 3BY4A 3J80N 1OV9A 2ETNA 1FS0G 1YSCA 3B2EE 1SF9A 4DR4B 2ADQB 2UUBO 1YT7A 4QE7A 1H2MA 1VQKV 4DUZO 2Y69B 1N33B 3VQYA 1Q90D 4TUYB 3AG1B 4DR6O 2DZZA 4CZWA 1QLEC 5KHKA 1S4VA 4J7KA 4MT8A 1TLOA 4GCZA 4O4HB 4YHHO 3U8EA 3FB7C 5KHHA 5L3DA 3IAYA 1XNRO 2F95B 4DV5O 1R6NA 1XILA 4I4TB 2OCCB 2ZXWC 3PBHA 4OX9B 1XL6A 3AK3A 2ZNIA 4LWSB 2FYUH 1TVKB 2VQFO 1OCZB 1XDCA 4OGQB 2YSUB 1Q6UA 2YXHA 1KHPA 5IWAB 4I0XB 2PUSA 2WAMA 4RNAA 4FLXA 2OWOA 3I55V 5IY5C 2QEXV 3ZRVA 4LFBB 1QVGU 5LYJB 4Q8HA 3S3RA 1JX9A 3H8CA 1AP6A 3RW0A 3AG7A 2QWQB 1EN4A 1YVBA 2ARYA 4PDRA 2RDCA 2UXCB 3CC2V 2FMLA 2J7QC 4FZ0A 4P9PA 3ZMUA 2X6AA 3RYFB 2HLDG 2IW5A 2G7YA 2M6YA 1FAFA 4XUIA 2A3QA 1M9NA 5DM6V 1UKFA 2R6NA 4CH4A 1KP3A 4KL1A 3OVZA 1AIMA 5CVNB 1I94B 4P6GA 4UV8A 1SQBH 3O0UA 4D7TA 1BGYH 5IJ9A 1IURA 1AROP 1WB7A 3OTFA 1COWG 3OUFA 3T4ZA 3PJSK 3RN4A 1GN3A 2B5UA 1W0KG 2YDEA 4FMTA 3DSQA 2GBOA 1NI8A 2ZT9B 1N0JA 5IJ0B 1ZTEA 1CVZA 2DJFB 3OEHG 4JI8O 4J9ZB 2P86A 2FO5A 5GONA 3M99A 2R9CA 1CB5A 2Q73A 4WFGA 1WB8A 3FYEB 2DJVA 4I5SA 4PJ0Z 2J7QA 4BOPA 4WBNA 3RYIA 1KC8W 3ETEA 4X1YB 2IM9A 2JQFR 5JJEB 4XDLA 4KHPB 2CGOA 4BR6A 2NLJC 1XQ8A 1OCCC 4FPPA 3T1YO 3ASOB 2XNDG 4CDCB 5KMGB 1K73W 2CGNA 2F1MA 3ZUAA 2N04A 3N3KA 1V55C 3KWBX 5EC2C 3MTNA 5J2TA 4L87A 1RM1B 2XHBA 2XU1A 4I04A 3J7AU 5KHJA 4CDFB 2IBIA 3E22B 4OVZA 2OT5A 1AU4A 4CBCA 3AEIA 2HJFC 2HHHO 2QWNB 1KECA 3JAMN 2WLJA 2GTSA 1TUBB 1XNQB 2DYRC 2QWPB 4WFAV 1D5AA 1RPRA 4DR5B 3JALA 3IOQA 3K9SA 3HKCA 3ZHSA 1I0HA 2KKWA 2L6LA 1YI2V 4XBFA 4MS2A 2Q7HA 2F43G 2ZM6B 1BP4A 1H8HG 2EINB 3K03A 3IFXA 4PELA 3VBBA 5JQGB 4EEQA 1BHAA 4YYQA 1GH6A 4LH7A 1R3JC 1CPYA 2PTMA 4MTGA 1NPZA 4MM3B 1VQ4V 3BY6A 2F7DA 1KXRA 1D5NA 5B1BB 1PBHA 5EYPB 1FXKB 3BVOA 1AYVA 4TSFG 1JQPA 2W0FC 3SR2C 1EN5A 1GK9A 1R3KC 1MABG 2FRAA 4DMXA 4PA9A 2P6JA 4FFKA 1CSBB 3ZN1A 4WA6A 4X66B 4LF7O 2V7QG 3OMAB 1N34O 4JYAO 2GHYA 4GKKO 4OPAA 3CPWU 4I55B 3E8BA 2JJ1G 4RUEA 2UUAO 1MG1A 2XU4A 4MVSA 2HKOA 3OE7G 1MSWD 4F6EA 4DV3O 1IBKO 3E8GA 2ZE8A 1K3EA 1HR0B 4YJ2B 5C93A 3THOA 4HAMA 4DR2O 3RWRD 1IXMA 1OZ0A 5K16A 3CH3X 1XHXA 3SJBC 5LP6B 4CC6A 4Z2WA 4R3DA 4Q8GA 3Q4HA 5IT9N 4F4LA 4CS4A 5B5EZ 4HBNA 4D8BA 2YJ8A 3W31A 2CE4A 1P84F 4AQYO 1LUWA 4X1KB 2JIZG 1K8AW 4N21A 3E2EA 3OVXA 4GYCB 1DLBA 3VOUA 4JI5B 3MJ5A 1DF4A 2WLMA 4JI7O 3AI8A 1HP8A 1GM8A 1U97A 3H1JH 5CN0A 4FLWA 2JDIG 4O4LA 4IYIA 4UCOA 4FLYA 2QJ1A 2ATKC 3B8MA 4TWKA 3B40A 5J2UB 2DYSB 2V1DA 1JA8A 2PREA 3FKSG 3NXSA 5EZSA 4YYWA 1JCHA 3K5MA 4P9OA 3ZHRA 3LUTB 4GKJO 1RSOA 3AG3B 3LDDA 4DXWA 2LQTA 1YALA 3K59A 2ZE6A 1N36B 4CS3A 3VQVA 3BHPA 2QWRB 3UO2A 2EZPA 4LF8O 3H9VA 4AXLA 2FKXA 2EIJC 4QH6A 3W7SA 4RF0A 1E1RG 2DJGB 5EIBD 3K8UA 4TV9B 2QTSA 5AG2A 1KB9F 2OULA 4TOIA 5BY1A 1U9WA 2Y6EA 4BAYA 4YXWG 4DW1A 2CIOA 3SPHA 1EM1A 3PSEA 4B3RB 3LNMB 1ME4A 4O4IA 4JAAA 2Q4PA 3CCEV 2RCVA 5FNVB 1Y76A 5C8YB 1EZVH 3AK1A 3G4SV 1QXPA 3HKDB 1AR1B 1B06A 2E5LB 5LA6A 4PI0A 2WLLA 4NYKA 2ZKOA 5L3CA 4AI8A 1QVFU 1NU1H 5CBFA 3BEHA 5KA6A 1FYJA 2R9NA 1QLNA 1RP3B 3OTOO 3EVKA 2QKSA 1SQGA 5LMUO 4YYUA 4JF3A 2FYEA 1GMGA 4HNAB 4X62B 1YTFB 3RYCB 4CH5A 2OIEA 3CRRA 2Z0AA 3HWNA 1NTZH 4EFBA 1BQ0A 1QOLA 1PL0A 5JCOA 5L3FA 3P30A 5KLVH 1WJZA 4NB5A 3CRAA 3EXAA 3K5LA 1SQFA 2BSKB 4BOSA 2XUMA 2EIMC 1ZSPA 4U3JB 2XAHA 3SGIA 7PCKA 1EZJA 3IC7A 2X6CA 4N4ZA 4R50A 1J5EO 3BPZA 1M1KW 3PT2A 4BIZA 3FAVB 5LHIA 3VQWA 1NJIW 2QGNA 4X9QA 5D5QA 2NN4A 4OELA 1D2DA 3X2QB 1BCCH 4JI6O 2BTWB 2ILMA 1YK8A 2Q69A 1EFRG 3WG7B 3OUSA 3KKYA 3UT5A 1F29A 1FFTB 4JI1O 1ORQC 2UUCO 3JARA 1SZXA 1KFXL 4DV7O 2KB1A 1RFYA 3HD3A 3WU2Z 4G27B 4KP4A 1MDWA 2GSMB 3ABLB 1EBOA 1SC5B 4NTXA 4I50A 2F23A 4KFMA 5DEDA 1IBMB 2W6JG 3C0RA 2IJIA 5E79Z 4RY2A 2JS5A 4DR3O 4YYRA 2R9IA 1ICFA 1X59A 4TQFA 4WURA 4JYBA 4EFEA 4X65O 2H94A 1TAEA 1VF6C 2CUGA 3KW9A 3IC9A 4DV6O 1E79G 3OMIB 3QNEA 3HKEA 3KZIZ 2AIMA 4QIWF 3IGAC 2E75B 1K3BB 4DR4O 1CPJA 2Q7EA 2E01A 2QKAA 3AG4B 3W7WA 1TU6A 4EB6B 4E4EA 1WAZA 2FUDA 1QMYA 3ZRSA 3UO3A 1ATKA 4MVUA 3RFRA 2ZNJA 4WFHA 3CRQA 4PV1B 1R6TA 3ZRXA 3CCLV 5FPRA 4CZZA 2A0LA 5KAIZ 3OF9A 1ZL8B 3TMPA 2HG5C 3MD0A 2AHYA 2PNSA 1FPOA 2A06H 3MAQA 1PPPA 1SQVH 1XMOB 3B77A 1HNXB 1O9GA 1POPA 2R9AA 1VF6A 3P5WA 4N8WA 4NXNO 3USVA 3K9MA 3ICXA 3IJ4A 1CQDA 1JFFA 4QJFB 5LXTB 3JSLA 1AVMA 5KUMA 4W4KA 5CVOB 2BTQB 4UCUA 2Z5UA 3ABMB 5A24A 2P06A 4W4UA 2FB5A 4Q20A 4PT5A 3U10A 3SDLA 5JH7B 1MOFA 5B1AC 1HNWB 4BIOA 2P7TC 4O2AA
chains in the Genus database with same CATH topology
1NS1A 2FKXA 3IFUA 4X64O 4RF0A 4MM3B 2AGAA 3RT3C 5E6JA 4OVZB 4LF6O 4DUYO 1UKFA 3B21A 1XMQO 2JRIA 4LFBO 4B3TO 3C0RA 1XNQO 4DV1O 3R66A 3J81N 4B3MO 5BY1A 4DR3O 4A5UB 4DR7O 5LMNO 2DOSA 4DR5O 1X59A 2LW7A 5FLXN 2F4VO 1N36O 4LF7O 3PSEA 4WURA 4X65O 4JYAO 1N34O 4LF9O 4B3SO 2UXCO 5KO3A 4JI3O 4GKKO 2ZM6O 4OPAA 4B3RO 2JTCA 2UZJA 2N74A 1IBLO 4OPHA 5H5NA 1HNWO 4JV5O 2UUAO 1N32O 1PVJA 1FJGO 3J80N 3BY4A 4DV6O 4DR1O 3PHWA 4XZXA 3BBAA 2BU3A 1KUQA 4JI8O 3ZNHA 4K0KO 1F7YA 1YZBA 3TRKA 4DV3O 1IBKO 3MP2A 4P16A 4NXMO 2ZKOA 2UUBO 4JI2O 4DR4O 4BOUA 4LF4O 4DR2O 4IP3A 1I94O 2FE8A 4DUZO 1IBMO 1FYJA 3RNVA 2DJVA 3OTOO 3BB7A 1HNZO 4DR6O 2J7QA 5LMUO 4BOPA 4YY3O 4MI7A 1XEQA 4DV4O 3OQCA 5A2QN 4R3DA 4JI4O 3T1HO 3PHXA 2Z84A 4YHHO 4X66O 2UXBO 5IT9N 1R6TA 1DK1A 1XNRO 3M8AA 4DV5O 4D8BA 2Z0AA 3W31A 3T1YO 4AQYO 4HXDB 3TMPA 3PHUA 2E5LO 3F5TA 2HWKA 3E9SA 3MJ5A 2VQFO 1HR0O 3W30A 4GUAA 4LFCO 4BOSA 1R1BA 1DKIA 5BR8O 1A32A 4DV2O 4JI7O 5LL6Y 1N33O 5BXZA 3J7AU 3MTVA 4RNAA 4BOZA 4RF1A 1J5EO 4LF5O 2UXDO 3PRPA 3PT2A 4NXNO 4IUMA 4M0WA 4OVZA 4X62O 1AILA 1AB3A 4ZTBA 2BTWA 4KHPO 2UU9O 1D2DA 5EZSA 2HHHO 4JI0O 4JI6O 3JAMN 2BTWB 4OW0A 5JZEA 4BOQA 5EZQA 3PRMA 4A5UA 4OX9O 4GKJO 3O65A 4RKXA 4REZA 4JI1O 1G1XB 4D8IA 2VQEO 4JI5O 2UUCO 4PT5A 4D8EA 3SDLA 2J7QC 1FKAO 4LF8O 5IWAO 4LFAO 4DV7O 1XMOO 1HNXO 4DV0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS1 A;  2FKX A;  4X64 O;  2AGA A;  3RT3 C;  4LF6 O;  4DUY O;  1XMQ O;  2JRI A;  4LFB O;  4B3T O;  1XNQ O;  4DV1 O;  3R66 A;  3J81 N;  4B3M O;  5BY1 A;  4DR3 O;  4A5U B;  4DR7 O;  5LMN O;  2DOS A;  4DR5 O;  1X59 A;  2LW7 A;  5FLX N;  2F4V O;  1N36 O;  4LF7 O;  4X65 O;  4JYA O;  1N34 O;  4LF9 O;  4B3S O;  2UXC O;  4JI3 O;  4GKK O;  2ZM6 O;  4OPA A;  4B3R O;  2N74 A;  1IBL O;  4OPH A;  5H5N A;  1HNW O;  4JV5 O;  2UUA O;  1N32 O;  1FJG O;  3J80 N;  4DV6 O;  4DR1 O;  1KUQ A;  4JI8 O;  4K0K O;  1F7Y A;  1YZB A;  4DV3 O;  1IBK O;  4NXM O;  2ZKO A;  2UUB O;  4JI2 O;  4DR4 O;  4LF4 O;  4DR2 O;  1I94 O;  4DUZ O;  1IBM O;  1FYJ A;  2DJV A;  3OTO O;  1HNZ O;  4DR6 O;  5LMU O;  4YY3 O;  1XEQ A;  4DV4 O;  5A2Q N;  4JI4 O;  3T1H O;  4YHH O;  4X66 O;  2UXB O;  5IT9 N;  1R6T A;  1DK1 A;  1XNR O;  3M8A A;  4DV5 O;  2Z0A A;  3T1Y O;  4AQY O;  2E5L O;  3F5T A;  2VQF O;  1HR0 O;  4LFC O;  1R1B A;  5BR8 O;  1A32 A;  4DV2 O;  4JI7 O;  5LL6 Y;  1N33 O;  5BXZ A;  3J7A U;  1J5E O;  4LF5 O;  2UXD O;  4NXN O;  4X62 O;  1AIL A;  1AB3 A;  4KHP O;  2UU9 O;  1D2D A;  2HHH O;  4JI0 O;  4JI6 O;  3JAM N;  4OX9 O;  4GKJ O;  3O65 A;  4JI1 O;  1G1X B;  2VQE O;  4JI5 O;  2UUC O;  3SDL A;  1FKA O;  4LF8 O;  5IWA O;  4LFA O;  4DV7 O;  1XMO O;  1HNX O;  4DV0 O; 
#chains in the Genus database with same CATH topology
 3OMN B;  2NNU A;  3ABK B;  2CH7 A;  2XAJ A;  2P5O A;  5KUK A;  3RVY A;  4ZI7 A;  3B4S A;  3RT3 C;  1K33 A;  1BGO A;  1QDQ A;  4FLV A;  1KMI Z;  3BA9 A;  3C90 A;  3JAW B;  1F4N A;  3HKB A;  3SPG A;  3K0D A;  4AXM A;  4LNU A;  4GT1 A;  1AEC A;  1AJQ A;  3JD2 A;  2YJC A;  2OCH A;  5KO3 A;  2OP3 A;  3CCQ V;  2UZJ A;  4DYL A;  3CCU V;  3APQ A;  2EIL C;  2E3C A;  3BBA A;  1Y74 A;  4FJC C;  2LO1 A;  2GUZ A;  4W5C A;  1ZUQ A;  2PZS A;  3OF8 A;  2MK3 A;  4FIP C;  3BCN A;  3RVX A;  2ODM A;  3E35 A;  5IYZ B;  1HNZ O;  1Z2G A;  3TGU H;  3DTU B;  3ZHV A;  3JSN A;  4P2Z A;  1DF0 A;  1OCR B;  3M7M X;  1HUC B;  4KLB A;  1H2N A;  1Q5O A;  4YJ3 B;  2UU9 B;  3ZX6 A;  4ZOL A;  4MVR A;  4O4J A;  2VS0 A;  4LP8 A;  1H8E G;  1Z5W A;  2K9P A;  5FPO A;  3TET A;  1CEZ A;  3OR6 C;  3PHU A;  4UB8 Z;  5CHT A;  2Y69 C;  3S3W A;  2VQE B;  3AG1 C;  1R1B A;  5EBM C;  2IBZ H;  4MSW C;  2WWW A;  3EFF K;  1FFX A;  3JCZ A;  1SES A;  1XMQ B;  2OCC C;  4FJC A;  5A9G A;  4UB6 Z;  2ARH A;  2L35 A;  2RJZ A;  1SA0 B;  4OW0 A;  3ZMT A;  3JAS A;  4NTW A;  5H2F Z;  4J11 A;  1P7B A;  3ZHT A;  4FIP A;  4A5U A;  1OCZ C;  4WFF A;  4HZ3 A;  2Q9L A;  4TV8 A;  3CBK A;  1AJN A;  1KD1 W;  4GX0 A;  1ZX3 A;  4LF9 B;  2XU5 A;  2YIB D;  1G4Y B;  3U0Z A;  2XAS A;  1N32 B;  2Q8V A;  1BQI A;  3H89 A;  1QHT A;  2FT2 A;  4GX2 A;  1WA8 B;  2LJ2 A;  3I56 V;  1H38 A;  5EF4 A;  2HD5 A;  1H2S B;  3G6E V;  4JI2 B;  1VQ8 V;  3PDF A;  2EIK B;  1WN7 A;  4CS2 A;  4TUY A;  2EX3 A;  4XR7 A;  1VQO V;  2DOS A;  3IHP A;  4JI4 B;  2QTO A;  5FLX N;  4O4H A;  3SJA C;  2F4V O;  1P49 A;  3CX5 F;  2PI5 A;  3HHI A;  4JV5 B;  2JVD A;  1B04 A;  3BAB A;  1IBL O;  3A0B Z;  4I4T A;  3JYC A;  1V54 B;  1GEC E;  2AUX A;  4RQF A;  2DW4 A;  2Q6A A;  4FM0 A;  4MTX A;  4K0K O;  1GTO A;  4LWS A;  1TVK A;  4NXM O;  4JTC B;  2R9O A;  3M99 B;  3LSU A;  1QR8 A;  5GON B;  1SER A;  1S5L Z;  5B3S B;  4DK0 A;  2HVJ C;  3GVM A;  4YY3 O;  1K97 A;  4LF5 B;  3OQC A;  3SPI A;  4FK5 C;  2UXB O;  1EWM A;  4I05 A;  2FRQ A;  2ITD C;  2JEX A;  3QG5 A;  1DK1 A;  4NTY A;  4JI0 B;  3ETG A;  2KG7 A;  1PD3 A;  2HP8 A;  3WFV A;  3F75 A;  4JYY A;  1EF7 A;  2Y0P A;  3K9A A;  2CAZ C;  3F5V A;  3H6S A;  4BW5 A;  4LFC O;  5CA1 B;  3H8B A;  1AI5 A;  1GRJ A;  1XKG A;  3RYF A;  2QKC A;  2QE7 G;  4J42 A;  5BXZ A;  5J2T B;  1M93 A;  3I5D A;  5KX5 B;  4EKW A;  4IUM A;  2P0R A;  1Y66 A;  4ASU G;  1AB3 A;  4ZTB A;  1THE A;  3ASO C;  3V6C A;  4HWY A;  1HWY A;  2AHZ A;  3RVZ A;  2E00 A;  4B3M B;  4AHC A;  2QR4 A;  2WLI A;  1NR1 A;  1YJW V;  1Y08 A;  2AUZ A;  1GN6 A;  4PI3 A;  2GTA A;  1RM1 C;  4B3S B;  4JI3 B;  1XRE A;  1F2C A;  1AJP A;  3CJH B;  5CMU A;  3NHE A;  2PAD A;  3MOR A;  1OCO B;  5D5P A;  1ME3 A;  1F2A A;  1KYO F;  1ZLZ A;  4R7C A;  2UUB B;  3B21 A;  2Y5B A;  3HPL C;  2B1N A;  1NL6 A;  3BFR A;  3P3N A;  3K08 A;  1S76 D;  5FPW A;  4BPV A;  4DUZ B;  4UCV A;  2AYN A;  1QQC A;  3K0G A;  4MTO A;  4B3T O;  4MVQ A;  1MEG A;  4DV1 O;  4DR6 B;  3D6S A;  3ETD A;  2DWD C;  5LMN O;  3APO A;  4DR7 O;  2EIN C;  1EN6 A;  2LW7 A;  3N2G A;  4X1Y A;  4YHH B;  2AYO A;  3BA8 A;  5CA0 B;  1GCB A;  4QRX A;  1XNR B;  3O9O A;  1BMF G;  4B3R O;  2YI8 A;  4OPH A;  2BDL A;  1NH2 D;  3L73 H;  5B1B C;  2EJ7 A;  1FXK C;  2IPP B;  3ERV A;  1AU3 A;  3K04 A;  5KMG A;  2E03 A;  1G8M A;  2PF4 E;  4PA7 A;  4TT3 G;  2VQF B;  4MSX A;  1SS3 A;  3CMA V;  3L70 H;  3G80 A;  4O2B B;  4LF4 O;  3ZMV A;  1HW7 A;  1Q82 W;  2YUA A;  3BB7 A;  1M6D A;  3CE2 A;  2OTL V;  1NB5 A;  2HVK C;  2KSD A;  3ZN0 A;  3DC5 A;  3E22 A;  4RWU A;  1XEQ A;  4DV4 O;  4UVA A;  2B1G A;  4FM2 A;  3KKU A;  4WCE V;  3PNR A;  3EHB B;  3UCS C;  3ZJZ A;  4NKG B;  4BQV A;  1TUB A;  4DRX B;  5ITZ B;  2AXT Z;  1N0N A;  4NR1 A;  4ZBM A;  3CBJ A;  1EWO A;  4YVA A;  4GUA A;  3E86 A;  1VJV A;  2YJ2 A;  1WPX A;  5JQG A;  4DV2 O;  2MW2 B;  5LP6 C;  1CS8 A;  1AI4 A;  1WNS A;  1GN4 A;  2FQ9 A;  2OIG A;  1NT2 B;  1SET A;  2UXD O;  5EYP A;  1FXK A;  4QRV A;  4PP2 E;  2BE3 A;  1IVS A;  1R3I C;  1X9Y A;  5GW7 A;  3JD0 A;  3H1I H;  2LFR A;  3QT4 A;  5JZE A;  1PCI A;  1ENV A;  2JGU A;  1NQC A;  4BOQ A;  1PNK A;  3H1H H;  3WXG A;  1GO3 F;  3CWB H;  3O65 A;  4RKX A;  1W0J G;  4UUJ C;  3L74 H;  1GLO A;  1VEW A;  1Q6K A;  3ZHU A;  1R73 A;  1XBL A;  4I55 A;  4RAI A;  4PDM A;  4MZO A;  5EBL C;  3H1K H;  1S72 V;  2G6D A;  4DUY O;  3JAK A;  2DYS C;  4JI8 B;  1QCE A;  2GV9 A;  2YI9 A;  4JZG A;  3RYH B;  2ZIN A;  4YJ2 A;  1YCI A;  3DC6 A;  1ZIV A;  3AG3 C;  3CEI A;  3C3S A;  3S3X A;  3R66 A;  5LP6 A;  3LSQ A;  4Q6G A;  3CCM V;  3AG2 B;  3SPJ A;  4LC1 A;  5EC1 C;  5LGN A;  3TNX A;  4UXN A;  2V4D A;  2PY5 A;  3ZMZ A;  4MVO A;  2CTQ A;  5JVD A;  3BCC H;  5H5N A;  2R9F A;  1BE3 H;  3E8F A;  3T1Y B;  1FJG O;  4O4I B;  2WLN A;  3PHW A;  4BS5 A;  2IJK A;  4X1K A;  1KUQ A;  1Y76 B;  1KHQ A;  1WP7 A;  2YEV B;  1MHW A;  5H6R A;  1K7D A;  4J7Z A;  1T5E A;  3T2M A;  4UFZ A;  4MTF A;  3VQX A;  2R9M A;  3ZRW B;  4ZHQ B;  1PPO A;  3JD1 A;  2EZO A;  5J2U A;  4Z1V A;  5LHG A;  4ZIB A;  1V9P A;  4FVM A;  5EZY B;  2M7W A;  3RGB A;  2AS8 A;  3M8A A;  4JAS A;  2HHH B;  1AP5 A;  2RN9 A;  3A2F A;  3BPF A;  1I7F A;  1H2L A;  1M57 B;  1PAD A;  1Q8I A;  3OEE G;  1SNK A;  1AI7 A;  4F6R A;  2ZCE A;  1JOY A;  4PA4 A;  2GFO A;  2CDY A;  5JJJ B;  2AZ0 A;  1Z5V A;  1N8R W;  2WLH A;  1DKI A;  5BR8 O;  2QWO B;  3RVV A;  2UXN A;  2Y4U A;  2JQG R;  3T1C A;  4N23 A;  4BS6 A;  4TV9 A;  5EGW A;  1QU7 A;  5LOV B;  3IUT A;  1M90 W;  1AIL A;  1AYU A;  1BQZ A;  2D3O W;  1NH2 B;  1PPD A;  1DF5 A;  4I9Q A;  2PBH A;  3GWK C;  2JGD B;  2NR5 A;  3P5V A;  5B66 Z;  3UKM A;  3DXR B;  4LF7 B;  3UT5 B;  4JYA B;  1N34 B;  2YIC A;  4GKK B;  4W5B A;  1QBZ A;  1PNM A;  2UUA B;  4LFA O;  2W0X A;  5KHI A;  5C8Y A;  4DV0 O;  1O0E A;  2AW9 A;  3HHA A;  1P7G A;  4X64 O;  3IFU A;  1K4D C;  1K4C C;  3HKD A;  3N3G A;  5KAF Z;  2IU3 A;  3X2Q C;  1IBK B;  3HR0 A;  4LF6 O;  2H3O A;  2LP7 A;  4DR2 B;  2GDS A;  4FLZ A;  3WG7 C;  3QO7 A;  1W2B U;  3J81 N;  4X1I B;  3JD4 A;  3OAA G;  4PI2 A;  3IV2 A;  4HNA A;  3H7D A;  4FFB B;  3RYC A;  2XTA A;  4FZ1 A;  1F23 A;  5CB4 B;  1M56 B;  2PGG A;  1XOU A;  5JWP A;  3S3Q A;  3ZCC A;  3ABL C;  4AQY B;  4DR1 O;  2A7W A;  2E76 B;  2BSK A;  3OFN G;  3HKE B;  4U3J A;  5LBQ A;  4JI7 B;  3D36 C;  3LDC A;  3RNV A;  1GKF A;  5BMV A;  5EBW C;  1NVP D;  1VQ7 V;  1SQX H;  4WFE A;  4GLX A;  3V6E A;  5A2Q N;  3T1H O;  1X4T A;  1WLE A;  1IXB A;  3FAV A;  1CP9 A;  2X0L A;  1N4C A;  4UCR A;  3N27 A;  1G6U A;  3ASN B;  1VSN A;  5LGT A;  1NTM H;  4PP1 A;  1CV8 A;  3FB6 C;  4P30 A;  3CC4 V;  4GKJ B;  4IHJ B;  2RMK B;  3AG4 C;  3JAT B;  4JPR A;  3W30 A;  3STL C;  1MSD A;  2X7R B;  4LF8 B;  3N2K B;  1N33 O;  5J9P C;  3SPC A;  2XAG A;  4J41 A;  4IL6 Z;  2DC8 A;  3BRC A;  1SRY A;  4CDE B;  4M0W A;  4I7Z B;  2DMX A;  5EIB C;  3R65 A;  2B1I A;  4JYC A;  1MS6 A;  1VQL V;  4GUN A;  5IDJ A;  3HB3 B;  3NR7 A;  3F5W C;  5IYB O;  3D36 A;  3PRM A;  3CSX A;  4OX9 O;  5F2V O;  4QGP A;  3FD9 A;  2AVW A;  4OEM A;  3TXQ A;  3L9D A;  2P7U A;  2EJR A;  4N79 A;  4CC5 A;  1JJ2 U;  2VWJ A;  5IWA O;  4O2A B;  2VHF A;  4TQD A;  2QM8 A;  1L1F A;  1PM9 A;  3OR7 C;  2YJB A;  1YIJ V;  4FLT A;  4ZI7 B;  2KQX A;  1AYW A;  2JRI A;  4LFB O;  2YIA A;  1BS3 A;  4EB6 A;  2D2C B;  3ABM C;  3H1L H;  3K24 A;  1IDS A;  3STZ C;  2P90 A;  1YEW A;  4C7U A;  5LMU B;  4IIJ B;  4X88 A;  1K34 A;  1IWD A;  2XAF A;  2YJ9 A;  1JJO A;  2UXC O;  2ZDI C;  3ABK C;  4JV5 O;  3GCB A;  3QO8 A;  4XZX A;  1ZL8 A;  1YHQ V;  4W4L A;  4K35 A;  4PHZ A;  2GUZ B;  1UFI A;  3DGE A;  2DZY A;  1I94 O;  2BOB C;  2HFE C;  3QF7 A;  1AR4 A;  1CJL A;  2Q0A A;  2NQI A;  4MI7 A;  5IYD O;  1J5E B;  3P3P A;  1QR9 A;  3PHX A;  4BIU A;  1ZWI C;  2YC0 A;  3OIS A;  1J95 A;  5K1X A;  4JI6 B;  3F7Y C;  4X20 B;  1H2K A;  2CB5 A;  2DCA A;  2BTQ A;  3D3I A;  5IE9 A;  3G6B A;  4PDV A;  3ZIA G;  1JR9 A;  4JI1 B;  2Q5Z A;  1ZCM A;  2XOK G;  3E9S A;  2UUC B;  5JH7 A;  2LFS A;  2N05 A;  3FB5 C;  1XI1 A;  1AU2 A;  4DV7 B;  2B1M A;  1OCR C;  1YXB A;  2ZDI A;  5L3E A;  3E89 A;  4U7O A;  4R6Z A;  4P6E A;  3PRP A;  2F66 C;  3A8T A;  2IH1 C;  4G28 B;  4MVZ A;  4KHP O;  3TXS A;  3JAW A;  2BCC H;  4DR3 B;  5JH3 A;  1IZ3 A;  2R70 A;  4X6H A;  4TV8 B;  3CP1 A;  4X65 B;  1G1X B;  4RQE A;  3L75 H;  1NVP B;  3BOW A;  2DN9 A;  3OT7 A;  4DV6 B;  2XT9 A;  2CTP A;  1CXZ B;  2IU0 A;  4K3A A;  1OHH G;  2BOC C;  4JZ2 A;  5LHH A;  2NQD B;  4FLU A;  1NQT A;  2ZQM A;  3K5O A;  2CTR A;  5IYZ A;  2JS3 A;  1S5H C;  1XNQ O;  5J94 A;  4H13 B;  4YV8 A;  3ABT A;  4DR5 O;  1FXH A;  5IYC O;  1QLE B;  1KKC A;  2C2A A;  1JMK C;  4YJ3 A;  1GAX A;  2DC6 A;  2ZM6 O;  4GX1 A;  3H01 A;  2FTD A;  2E74 B;  4IYH A;  3KG2 A;  5CBG A;  5JJN B;  2O57 A;  1BZK A;  2FL4 A;  2LGQ A;  9PAP A;  2YID A;  4RUF A;  2EIK C;  2ZXW B;  4K8Z A;  1PKX A;  1VQM V;  1KFU L;  2O6X A;  4AIL C;  4KXR A;  2ZIO A;  3K5N A;  4YIP A;  4MW8 A;  3BPM A;  1LUV A;  3PW3 A;  1BL8 A;  1S0V A;  2B9Z A;  5IJ9 B;  2VHS A;  3CB2 A;  4NXN B;  2WA4 A;  1URF A;  4X66 O;  3FYI B;  3E83 A;  1V54 C;  2VRZ A;  5CHV A;  5IY5 B;  1SA0 A;  1PPN A;  4JGS A;  1PNL A;  1H2G A;  2E02 A;  2KG7 B;  3QTC A;  2HWK A;  5L3G A;  5B3S C;  1HR0 O;  3MHH C;  2WPD G;  4MZS A;  2G8E A;  4I0X A;  1S3J A;  1K5S A;  2W6I G;  2R72 A;  4E2L A;  5KHG A;  1WA8 A;  3MTV A;  4WBN B;  3RYI B;  1SKV A;  3CD6 V;  4IGG A;  1VAR A;  1Q43 A;  1Q6I A;  5LYJ A;  3I06 A;  3L71 H;  4WFB V;  4YYS A;  2AZ2 A;  3A0H Z;  1WP8 A;  3CCV V;  5B1O A;  4REZ A;  5F02 A;  3MHS C;  2WLI B;  4JI5 O;  4MW3 A;  3SJQ C;  1SZT A;  4H33 A;  4BWA A;  2WA3 A;  2G38 A;  1B3Q A;  1KQS U;  3ETQ A;  5E6J A;  4OVZ B;  3W7X A;  4KUM A;  3E8H A;  4K7C A;  3SYQ A;  3ZED A;  2P4V A;  3OD4 A;  1L8D A;  4B7E A;  3MHH A;  1HNZ B;  4X6I A;  2DC9 A;  2IJH A;  4ZKI A;  3JAL B;  3HKC B;  1N36 O;  3N2G B;  3U11 A;  5GTI Z;  2PYJ A;  4FK5 A;  1TGO A;  1OCO C;  1SQQ H;  4U7N A;  4CH6 A;  2JTC A;  5IJ0 A;  1GMY A;  4IT5 A;  5FL7 G;  3RBZ A;  2Q68 A;  2NQA A;  2A79 B;  2BU3 A;  2K1E A;  1OCC B;  1YJN V;  1I08 A;  3K58 A;  3AK2 A;  1NKD A;  5CA1 A;  3E1Z B;  4BOU A;  3MHS A;  3FFQ A;  3A0R A;  3SYC A;  1GM7 A;  1V55 B;  5KX5 A;  1MNG A;  3KCX A;  3CS5 A;  4L8J A;  3CYO A;  1LNQ A;  3F7V C;  2Z84 A;  4G2K A;  4DMY A;  1LR1 A;  3L72 H;  4B7K A;  4DV5 B;  1Q81 W;  1M5I A;  4D7S A;  2BTO A;  4UVB A;  3JD3 A;  1Q86 W;  2CTW A;  3RVW A;  2R9R B;  2HXZ A;  3WXF A;  3CRC A;  3WB2 A;  2DYR B;  2E5L O;  4PA6 A;  3CXH F;  1BT8 A;  1F4M A;  2GHU A;  2RQ6 A;  2DQ3 A;  5LL6 Y;  4X8A A;  1FD9 A;  3CJH A;  2DCD A;  1R3L C;  1YTF D;  1BHB A;  1P4R A;  4ICG A;  3WB0 A;  3ML0 A;  3Q4H B;  5GTH Z;  1VMG A;  1UPG A;  4X62 O;  2ACT A;  2A9H A;  2OTJ V;  1THZ A;  2P67 A;  4JTD B;  1JQ0 A;  4WF9 V;  2F4V B;  5CA0 A;  1YF2 A;  4H0L B;  3LFY A;  3ABU A;  3B09 A;  1Q3E A;  3QJ3 A;  2PYL A;  1IBL B;  1PP9 H;  2UXX A;  2ZD9 A;  1GN2 A;  4UCT A;  4PDL A;  3D3Q A;  4K0K B;  4O4L B;  2PI4 A;  2DCC A;  1EWL A;  3JAK B;  4NXM B;  3D8C A;  4GX5 A;  4O2B A;  3GB7 C;  2DE0 X;  1WPB A;  1A6R A;  6PAD A;  4YY3 B;  3G67 A;  1YJ9 V;  4QRG A;  1RSO B;  3IEJ A;  3CXC U;  2YIB A;  4I9W A;  4D6T H;  2UXB B;  2HR3 A;  2ZE5 A;  3ZHQ A;  5JA7 A;  4DRX A;  5ITZ A;  5JVD B;  3N4C A;  3ZNH A;  1BSM A;  3FX7 A;  1NB3 A;  1F7Y A;  2QSA A;  2QM4 A;  1FH0 A;  1ZAU A;  3G71 V;  1JPX A;  2XU3 A;  2H8P C;  4LFC B;  1XL4 A;  1K9M W;  3GWO A;  1IX9 A;  4JAU A;  2JEU A;  3LSS A;  2FE8 A;  3T4D A;  1XUQ A;  1IBM O;  3AG2 C;  1L0N H;  4B08 A;  1DGS A;  1Q7Y W;  3K57 A;  1O9H A;  3QO5 A;  2X6B A;  8PCH A;  3TK1 A;  2P22 C;  3WXE A;  2QA4 V;  1TUE B;  2WBF X;  1VQN V;  1STF E;  2Q0O C;  5LA6 B;  4MVM A;  4F6R B;  2WLL B;  3CH2 X;  3C9E A;  2FTK A;  3OM3 B;  1NR7 A;  4BOZ A;  1PV0 A;  3RYH A;  2RNB A;  5K1P A;  3B79 A;  1YK7 A;  2EIJ B;  2QM7 A;  3BWK A;  1M57 C;  2HEP A;  4B3T B;  4DV1 B;  1AI6 A;  5JCO C;  3SYO A;  1Q6H A;  1NBM G;  4DR7 B;  5LMN B;  2HHN A;  3CRM A;  5H9C A;  1PXV A;  4FM1 A;  5L3B A;  2BDZ A;  4NVP A;  3CCS V;  1VQP V;  5B1N A;  2EBO A;  1NZ6 A;  1XMO O;  1HNX O;  1S77 D;  2XAQ A;  1MZE A;  4QNH B;  3SYA A;  1YVW A;  2AGA A;  2YEV A;  3OGI B;  2IH3 C;  1K92 A;  4LF4 B;  2ATO A;  2OZ2 A;  3UQ8 A;  4H44 B;  1VP7 A;  1KU9 A;  1KP2 A;  1SQP H;  1MZF A;  4YYV A;  3ZRW A;  4ZHQ A;  4DV4 B;  2DC7 A;  1DEU A;  5EZY A;  2Y4T A;  3UM7 A;  2ZR2 A;  2VWK A;  2AU1 A;  5FNV A;  2N74 A;  3CC7 V;  1HNW O;  3JAR B;  4DV3 B;  3QVN A;  2YXL A;  3MP2 A;  4PD4 F;  3KFQ A;  4DV2 B;  4I50 B;  1Y6X A;  2G8J A;  4UVC A;  1MMM A;  3P5U A;  1TL9 A;  1ROP A;  4HYO A;  3FB8 C;  2EIM B;  1NLJ A;  4X6J A;  5BMV B;  1M56 C;  5LOV A;  2UXD B;  2HH5 A;  3KX1 A;  2Q7G A;  3WB1 A;  1YDX A;  2C0Y A;  2F93 B;  1U9X A;  4LCU C;  5HFL A;  4PAD A;  3KCY A;  3CCR V;  2JGD A;  4HXD B;  3KWZ A;  1JVM A;  2DWE C;  3DXR A;  2WLK A;  5HFM A;  1I5X A;  4DO2 A;  3P5X A;  4Z1M G;  1OJH A;  4LR3 A;  3K79 A;  1A32 A;  1VQ5 V;  5CBH A;  4DUY B;  1U5I A;  1BY8 A;  4RF1 A;  1U96 A;  4QPK A;  3ASN C;  3ZS8 C;  2LGW A;  2BTW A;  2UU9 O;  4G54 A;  4OXS A;  3ZBH A;  1PL4 A;  1Y4M A;  4LH6 A;  3CHX A;  4XDK A;  5DEC A;  4X1I A;  1W59 A;  1B6Q A;  4FFB A;  1Y67 A;  3OGC C;  5E1A C;  2VQE O;  3B8N A;  5CB4 A;  2IJJ A;  5KA5 A;  3DF0 A;  1VF7 A;  3JCU Z;  1VQ6 V;  1K5Q A;  3QSD A;  3K3W A;  1FJG B;  1NS1 A;  4GZR B;  1MIR A;  3I3T A;  1U9Q X;  1EWP A;  5DN6 G;  3OW2 U;  2Q67 A;  3IMA A;  4X89 A;  1RPO A;  4CH3 A;  1XMQ O;  1JFF B;  3PN1 A;  2JJ2 G;  1F2B A;  4JTA B;  4XDJ A;  2F1G A;  2DQ0 A;  1UJW B;  1PPJ H;  4UV9 A;  4LF9 O;  2ZE7 A;  5H6Q A;  1PIP A;  1N32 O;  2P4K A;  1S5J A;  4J10 A;  4IHJ A;  2CH7 B;  2QDO A;  1YZB A;  3TRK A;  3CCJ V;  4CDD B;  4K8X A;  4P16 A;  3JAT A;  2ZIM A;  2ITC C;  4JI2 O;  4BSQ A;  5BR8 B;  3OTO B;  3N2K A;  4IP3 A;  4JAV A;  2WSS G;  1NTK H;  5BZB A;  2Z3Y A;  3HKB B;  5CA3 A;  4LNU B;  4JI4 O;  3KSE A;  3SJC C;  4J7J A;  4J80 A;  4BW9 A;  1U9V A;  2OYQ A;  4R8C A;  3BC3 A;  4DK1 A;  4LBE C;  3TJT A;  1US6 A;  2Y48 A;  1SP4 B;  1I5Y A;  2LW1 A;  3W7U A;  1DTO A;  1AU0 A;  3MDS A;  4J9Y B;  2H7J A;  1VIB A;  1Y74 B;  5LGU A;  3F5T A;  1ITO A;  4PA3 A;  5PAD A;  3LNN A;  3TCU A;  1VF5 B;  5TIS Z;  4LFA B;  1AR5 A;  2NQG A;  4DV0 B;  2EUL A;  4X64 B;  5B1A B;  4LF5 O;  4LF6 B;  4UCS A;  3ZMS A;  5LXT A;  2Y0I A;  3LDE A;  4ZOL B;  4JI0 O;  4RO2 A;  1M4U A;  1CTE A;  1L0L H;  4O4J B;  5EZQ A;  4IIJ A;  4DW0 A;  5CVM A;  2ZR3 A;  1HDJ A;  2CK3 G;  1XHZ A;  3P32 A;  1MEM A;  1VQ9 V;  3CME V;  4QE9 A;  4D8I A;  1KBH A;  4ABM A;  2DCB A;  4D8E A;  1FKA O;  1PE6 A;  1KKD A;  1Y4H A;  2JK5 C;  1R6K A;  4QPJ A;  4DR1 B;  1GM9 A;  1TA8 A;  3C3T A;  4H37 A;  1FFX B;  1F51 A;  2EIL B;  1QNM A;  3W7T A;  4I07 A;  3O1G A;  4YIO A;  1YIT V;  3K06 A;  4QBB A;  3JAS B;  1E1Q G;  2YS8 A;  4B3M O;  4A5U B;  5EK0 A;  3T1H B;  4ZUX U;  2YXY A;  3BAA A;  1MA1 A;  2ADP A;  3LXS A;  4B3S O;  4JI3 O;  3SYP A;  1FXV A;  4X20 A;  4U3F H;  2HJD A;  1PVJ A;  3BY4 A;  3J80 N;  1OV9 A;  2ETN A;  1FS0 G;  1YSC A;  3B2E E;  1SF9 A;  4DR4 B;  2ADQ B;  2UUB O;  1YT7 A;  4QE7 A;  1H2M A;  1VQK V;  4DUZ O;  2Y69 B;  1N33 B;  3VQY A;  1Q90 D;  4TUY B;  3AG1 B;  4DR6 O;  2DZZ A;  4CZW A;  1QLE C;  5KHK A;  1S4V A;  4J7K A;  4MT8 A;  1TLO A;  4GCZ A;  4O4H B;  4YHH O;  3U8E A;  3FB7 C;  5KHH A;  5L3D A;  3IAY A;  1XNR O;  2F95 B;  4DV5 O;  1R6N A;  1XIL A;  4I4T B;  2OCC B;  2ZXW C;  3PBH A;  4OX9 B;  1XL6 A;  3AK3 A;  2ZNI A;  4LWS B;  2FYU H;  1TVK B;  2VQF O;  1OCZ B;  1XDC A;  4OGQ B;  2YSU B;  1Q6U A;  2YXH A;  1KHP A;  5IWA B;  4I0X B;  2PUS A;  2WAM A;  4RNA A;  4FLX A;  2OWO A;  3I55 V;  5IY5 C;  2QEX V;  3ZRV A;  4LFB B;  1QVG U;  5LYJ B;  4Q8H A;  3S3R A;  1JX9 A;  3H8C A;  1AP6 A;  3RW0 A;  3AG7 A;  2QWQ B;  1EN4 A;  1YVB A;  2ARY A;  4PDR A;  2RDC A;  2UXC B;  3CC2 V;  2FML A;  2J7Q C;  4FZ0 A;  4P9P A;  3ZMU A;  2X6A A;  3RYF B;  2HLD G;  2IW5 A;  2G7Y A;  2M6Y A;  1FAF A;  4XUI A;  2A3Q A;  1M9N A;  5DM6 V;  1UKF A;  2R6N A;  4CH4 A;  1KP3 A;  4KL1 A;  3OVZ A;  1AIM A;  5CVN B;  1I94 B;  4P6G A;  4UV8 A;  1SQB H;  3O0U A;  4D7T A;  1BGY H;  5IJ9 A;  1IUR A;  1ARO P;  1WB7 A;  3OTF A;  1COW G;  3OUF A;  3T4Z A;  3PJS K;  3RN4 A;  1GN3 A;  2B5U A;  1W0K G;  2YDE A;  4FMT A;  3DSQ A;  2GBO A;  1NI8 A;  2ZT9 B;  1N0J A;  5IJ0 B;  1ZTE A;  1CVZ A;  2DJF B;  3OEH G;  4JI8 O;  4J9Z B;  2P86 A;  2FO5 A;  5GON A;  3M99 A;  2R9C A;  1CB5 A;  2Q73 A;  4WFG A;  1WB8 A;  3FYE B;  2DJV A;  4I5S A;  4PJ0 Z;  2J7Q A;  4BOP A;  4WBN A;  3RYI A;  1KC8 W;  3ETE A;  4X1Y B;  2IM9 A;  2JQF R;  5JJE B;  4XDL A;  4KHP B;  2CGO A;  4BR6 A;  2NLJ C;  1XQ8 A;  1OCC C;  4FPP A;  3T1Y O;  3ASO B;  2XND G;  4CDC B;  5KMG B;  1K73 W;  2CGN A;  2F1M A;  3ZUA A;  2N04 A;  3N3K A;  1V55 C;  3KWB X;  5EC2 C;  3MTN A;  5J2T A;  4L87 A;  1RM1 B;  2XHB A;  2XU1 A;  4I04 A;  3J7A U;  5KHJ A;  4CDF B;  2IBI A;  3E22 B;  4OVZ A;  2OT5 A;  1AU4 A;  4CBC A;  3AEI A;  2HJF C;  2HHH O;  2QWN B;  1KEC A;  3JAM N;  2WLJ A;  2GTS A;  1TUB B;  1XNQ B;  2DYR C;  2QWP B;  4WFA V;  1D5A A;  1RPR A;  4DR5 B;  3JAL A;  3IOQ A;  3K9S A;  3HKC A;  3ZHS A;  1I0H A;  2KKW A;  2L6L A;  1YI2 V;  4XBF A;  4MS2 A;  2Q7H A;  2F43 G;  2ZM6 B;  1BP4 A;  1H8H G;  2EIN B;  3K03 A;  3IFX A;  4PEL A;  3VBB A;  5JQG B;  4EEQ A;  1BHA A;  4YYQ A;  1GH6 A;  4LH7 A;  1R3J C;  1CPY A;  2PTM A;  4MTG A;  1NPZ A;  4MM3 B;  1VQ4 V;  3BY6 A;  2F7D A;  1KXR A;  1D5N A;  5B1B B;  1PBH A;  5EYP B;  1FXK B;  3BVO A;  1AYV A;  4TSF G;  1JQP A;  2W0F C;  3SR2 C;  1EN5 A;  1GK9 A;  1R3K C;  1MAB G;  2FRA A;  4DMX A;  4PA9 A;  2P6J A;  4FFK A;  1CSB B;  3ZN1 A;  4WA6 A;  4X66 B;  4LF7 O;  2V7Q G;  3OMA B;  1N34 O;  4JYA O;  2GHY A;  4GKK O;  4OPA A;  3CPW U;  4I55 B;  3E8B A;  2JJ1 G;  4RUE A;  2UUA O;  1MG1 A;  2XU4 A;  4MVS A;  2HKO A;  3OE7 G;  1MSW D;  4F6E A;  4DV3 O;  1IBK O;  3E8G A;  2ZE8 A;  1K3E A;  1HR0 B;  4YJ2 B;  5C93 A;  3THO A;  4HAM A;  4DR2 O;  3RWR D;  1IXM A;  1OZ0 A;  5K16 A;  3CH3 X;  1XHX A;  3SJB C;  5LP6 B;  4CC6 A;  4Z2W A;  4R3D A;  4Q8G A;  3Q4H A;  5IT9 N;  4F4L A;  4CS4 A;  5B5E Z;  4HBN A;  4D8B A;  2YJ8 A;  3W31 A;  2CE4 A;  1P84 F;  4AQY O;  1LUW A;  4X1K B;  2JIZ G;  1K8A W;  4N21 A;  3E2E A;  3OVX A;  4GYC B;  1DLB A;  3VOU A;  4JI5 B;  3MJ5 A;  1DF4 A;  2WLM A;  4JI7 O;  3AI8 A;  1HP8 A;  1GM8 A;  1U97 A;  3H1J H;  5CN0 A;  4FLW A;  2JDI G;  4O4L A;  4IYI A;  4UCO A;  4FLY A;  2QJ1 A;  2ATK C;  3B8M A;  4TWK A;  3B40 A;  5J2U B;  2DYS B;  2V1D A;  1JA8 A;  2PRE A;  3FKS G;  3NXS A;  5EZS A;  4YYW A;  1JCH A;  3K5M A;  4P9O A;  3ZHR A;  3LUT B;  4GKJ O;  1RSO A;  3AG3 B;  3LDD A;  4DXW A;  2LQT A;  1YAL A;  3K59 A;  2ZE6 A;  1N36 B;  4CS3 A;  3VQV A;  3BHP A;  2QWR B;  3UO2 A;  2EZP A;  4LF8 O;  3H9V A;  4AXL A;  2FKX A;  2EIJ C;  4QH6 A;  3W7S A;  4RF0 A;  1E1R G;  2DJG B;  5EIB D;  3K8U A;  4TV9 B;  2QTS A;  5AG2 A;  1KB9 F;  2OUL A;  4TOI A;  5BY1 A;  1U9W A;  2Y6E A;  4BAY A;  4YXW G;  4DW1 A;  2CIO A;  3SPH A;  1EM1 A;  3PSE A;  4B3R B;  3LNM B;  1ME4 A;  4O4I A;  4JAA A;  2Q4P A;  3CCE V;  2RCV A;  5FNV B;  1Y76 A;  5C8Y B;  1EZV H;  3AK1 A;  3G4S V;  1QXP A;  3HKD B;  1AR1 B;  1B06 A;  2E5L B;  5LA6 A;  4PI0 A;  2WLL A;  4NYK A;  2ZKO A;  5L3C A;  4AI8 A;  1QVF U;  1NU1 H;  5CBF A;  3BEH A;  5KA6 A;  1FYJ A;  2R9N A;  1QLN A;  1RP3 B;  3OTO O;  3EVK A;  2QKS A;  1SQG A;  5LMU O;  4YYU A;  4JF3 A;  2FYE A;  1GMG A;  4HNA B;  4X62 B;  1YTF B;  3RYC B;  4CH5 A;  2OIE A;  3CRR A;  2Z0A A;  3HWN A;  1NTZ H;  4EFB A;  1BQ0 A;  1QOL A;  1PL0 A;  5JCO A;  5L3F A;  3P30 A;  5KLV H;  1WJZ A;  4NB5 A;  3CRA A;  3EXA A;  3K5L A;  1SQF A;  2BSK B;  4BOS A;  2XUM A;  2EIM C;  1ZSP A;  4U3J B;  2XAH A;  3SGI A;  7PCK A;  1EZJ A;  3IC7 A;  2X6C A;  4N4Z A;  4R50 A;  1J5E O;  3BPZ A;  1M1K W;  3PT2 A;  4BIZ A;  3FAV B;  5LHI A;  3VQW A;  1NJI W;  2QGN A;  4X9Q A;  5D5Q A;  2NN4 A;  4OEL A;  1D2D A;  3X2Q B;  1BCC H;  4JI6 O;  2BTW B;  2ILM A;  1YK8 A;  2Q69 A;  1EFR G;  3WG7 B;  3OUS A;  3KKY A;  3UT5 A;  1F29 A;  1FFT B;  4JI1 O;  1ORQ C;  2UUC O;  3JAR A;  1SZX A;  1KFX L;  4DV7 O;  2KB1 A;  1RFY A;  3HD3 A;  3WU2 Z;  4G27 B;  4KP4 A;  1MDW A;  2GSM B;  3ABL B;  1EBO A;  1SC5 B;  4NTX A;  4I50 A;  2F23 A;  4KFM A;  5DED A;  1IBM B;  2W6J G;  3C0R A;  2IJI A;  5E79 Z;  4RY2 A;  2JS5 A;  4DR3 O;  4YYR A;  2R9I A;  1ICF A;  1X59 A;  4TQF A;  4WUR A;  4JYB A;  4EFE A;  4X65 O;  2H94 A;  1TAE A;  1VF6 C;  2CUG A;  3KW9 A;  3IC9 A;  4DV6 O;  1E79 G;  3OMI B;  3QNE A;  3HKE A;  3KZI Z;  2AIM A;  4QIW F;  3IGA C;  2E75 B;  1K3B B;  4DR4 O;  1CPJ A;  2Q7E A;  2E01 A;  2QKA A;  3AG4 B;  3W7W A;  1TU6 A;  4EB6 B;  4E4E A;  1WAZ A;  2FUD A;  1QMY A;  3ZRS A;  3UO3 A;  1ATK A;  4MVU A;  3RFR A;  2ZNJ A;  4WFH A;  3CRQ A;  4PV1 B;  1R6T A;  3ZRX A;  3CCL V;  5FPR A;  4CZZ A;  2A0L A;  5KAI Z;  3OF9 A;  1ZL8 B;  3TMP A;  2HG5 C;  3MD0 A;  2AHY A;  2PNS A;  1FPO A;  2A06 H;  3MAQ A;  1PPP A;  1SQV H;  1XMO B;  3B77 A;  1HNX B;  1O9G A;  1POP A;  2R9A A;  1VF6 A;  3P5W A;  4N8W A;  4NXN O;  3USV A;  3K9M A;  3ICX A;  3IJ4 A;  1CQD A;  1JFF A;  4QJF B;  5LXT B;  3JSL A;  1AVM A;  5KUM A;  4W4K A;  5CVO B;  2BTQ B;  4UCU A;  2Z5U A;  3ABM B;  5A24 A;  2P06 A;  4W4U A;  2FB5 A;  4Q20 A;  4PT5 A;  3U10 A;  3SDL A;  5JH7 B;  1MOF A;  5B1A C;  1HNW B;  4BIO A;  2P7T C;  4O2A A; 
#chains in the Genus database with same CATH homology
 1NS1 A;  2FKX A;  3IFU A;  4X64 O;  4RF0 A;  4MM3 B;  2AGA A;  3RT3 C;  5E6J A;  4OVZ B;  4LF6 O;  4DUY O;  1UKF A;  3B21 A;  1XMQ O;  2JRI A;  4LFB O;  4B3T O;  3C0R A;  1XNQ O;  4DV1 O;  3R66 A;  3J81 N;  4B3M O;  5BY1 A;  4DR3 O;  4A5U B;  4DR7 O;  5LMN O;  2DOS A;  4DR5 O;  1X59 A;  2LW7 A;  5FLX N;  2F4V O;  1N36 O;  4LF7 O;  3PSE A;  4WUR A;  4X65 O;  4JYA O;  1N34 O;  4LF9 O;  4B3S O;  2UXC O;  5KO3 A;  4JI3 O;  4GKK O;  2ZM6 O;  4OPA A;  4B3R O;  2JTC A;  2UZJ A;  2N74 A;  1IBL O;  4OPH A;  5H5N A;  1HNW O;  4JV5 O;  2UUA O;  1N32 O;  1PVJ A;  1FJG O;  3J80 N;  3BY4 A;  4DV6 O;  4DR1 O;  3PHW A;  4XZX A;  3BBA A;  2BU3 A;  1KUQ A;  4JI8 O;  3ZNH A;  4K0K O;  1F7Y A;  1YZB A;  3TRK A;  4DV3 O;  1IBK O;  3MP2 A;  4P16 A;  4NXM O;  2ZKO A;  2UUB O;  4JI2 O;  4DR4 O;  4BOU A;  4LF4 O;  4DR2 O;  4IP3 A;  1I94 O;  2FE8 A;  4DUZ O;  1IBM O;  1FYJ A;  3RNV A;  2DJV A;  3OTO O;  3BB7 A;  1HNZ O;  4DR6 O;  2J7Q A;  5LMU O;  4BOP A;  4YY3 O;  4MI7 A;  1XEQ A;  4DV4 O;  3OQC A;  5A2Q N;  4R3D A;  4JI4 O;  3T1H O;  3PHX A;  2Z84 A;  4YHH O;  4X66 O;  2UXB O;  5IT9 N;  1R6T A;  1DK1 A;  1XNR O;  3M8A A;  4DV5 O;  4D8B A;  2Z0A A;  3W31 A;  3T1Y O;  4AQY O;  4HXD B;  3TMP A;  3PHU A;  2E5L O;  3F5T A;  2HWK A;  3E9S A;  3MJ5 A;  2VQF O;  1HR0 O;  3W30 A;  4GUA A;  4LFC O;  4BOS A;  1R1B A;  1DKI A;  5BR8 O;  1A32 A;  4DV2 O;  4JI7 O;  5LL6 Y;  1N33 O;  5BXZ A;  3J7A U;  3MTV A;  4RNA A;  4BOZ A;  4RF1 A;  1J5E O;  4LF5 O;  2UXD O;  3PRP A;  3PT2 A;  4NXN O;  4IUM A;  4M0W A;  4OVZ A;  4X62 O;  1AIL A;  1AB3 A;  4ZTB A;  2BTW A;  4KHP O;  2UU9 O;  1D2D A;  5EZS A;  2HHH O;  4JI0 O;  4JI6 O;  3JAM N;  2BTW B;  4OW0 A;  5JZE A;  4BOQ A;  5EZQ A;  3PRM A;  4A5U A;  4OX9 O;  4GKJ O;  3O65 A;  4RKX A;  4REZ A;  4JI1 O;  1G1X B;  4D8I A;  2VQE O;  4JI5 O;  2UUC O;  4PT5 A;  4D8E A;  3SDL A;  2J7Q C;  1FKA O;  4LF8 O;  5IWA O;  4LFA O;  4DV7 O;  1XMO O;  1HNX O;  4DV0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...