2DOSA

Structural basis for the recognition of lys48-linked polyubiquitin chain by the josephin domain of ataxin-3, a putative deubiquitinating enzyme
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ataxin-3
publication title Mode of substrate recognition by the Josephin domain of ataxin-3, which has an endo-type deubiquitinase activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 171
sequence length 171
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2dosA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2dosA01
1HNZO 4JI7O 4B3TO 4DUZO 1R1BA 4NXNO 1G1XB 5IWAO 1AB3A 3JAMN 4AQYO 5FLXN 4LFCO 4DV1O 1IBMO 4OX9O 4GKJO 4LFBO 2FKXA 1XMQO 4JI8O 1XNQO 1YZBA 3O65A 4DR2O 1N32O 4GKKO 4KHPO 4JYAO 1N36O 5A2QN 2UXDO 5BR8O 4DV2O 2F4VO 2AGAA 4A5UB 4DR6O 4JI6O 4DR7O 4LFAO 1FYJA 2HHHO 3J81N 2UUBO 2JRIA 1FJGO 1J5EO 5IT9N 1HNXO 2E5LO 1X59A 4LF6O 4X62O 1FKAO 2VQEO 2LW7A 3SDLA 2N74A 4B3MO 4NXMO 4X66O 4DR3O 3T1YO 4OPAA 4YHHO 4DV7O 3OTOO 4DV5O 4JI2O 4DUYO 4JI0O 3J80N 2VQFO 2Z0AA 1F7YA 1HR0O 2UUAO 4LF7O 3T1HO 1IBLO 1N34O 4DV4O 3R66A 4LF9O 4JI5O 4DV6O 4B3SO 2UXCO 4OPHA 1IBKO 1I94O 4B3RO 1R6TA 2UXBO 1HNWO 2UU9O 4YY3O 4X65O 4DR5O 5BXZA 3M8AA 4JI1O 2DJVA 4JI3O 2ZM6O 3J7AU 4LF5O 1N33O 5LMUO 4JV5O 2UUCO 4JI4O 4LF8O 1AILA 4DR1O 1NS1A 5LL6Y 1DK1A 4LF4O 1XMOO 1D2DA 1KUQA 3F5TA 4DR4O 5LMNO 1XNRO 4X64O 5H5NA 1XEQA 5BY1A 1A32A 4DV3O 2DOSA 4DV0O 2ZKOA 3RT3C 4K0KO
chains in the Genus database with same CATH superfamily
5EBWC 1GN6A 3QSDA 2OTLV 3H01A 2FQ9A 4IIJB 2R72A 3LSQA 4PA9A 1MNGA 1JCHA 4YJ2B 1B3QA 4OGQB 4JI1B 1EN4A 1ZX3A 1VF7A 2GUZA 3AG3C 4X89A 3JD1A 1PE6A 1MOFA 3H7DA 2WSSG 1K3EA 3S3RA 3HWNA 4LC1A 1GMGA 3IJ4A 1EN5A 2DC7A 1I08A 3W31A 4PT5A 3JATA 2HHHO 3JASA 2GBOA 2WPDG 3ABMC 3P5VA 1QHTA 2YEVB 3ETQA 4TT3G 4H13B 4NR1A 5CHVA 1N33B 1RFYA 2LJ2A 1ICFA 4GT1A 3HR0A 3PHWA 5JCOA 3CBJA 3DGEA 4X64B 3HD3A 4LNUB 2E75B 1VQKV 1F7YA 4LF7O 2R9OA 1ITOA 5A24A 1Q6KA 3CRQA 4L8JA 1R6KA 1ROPA 3RYCB 4OVZA 2FL4A 4J10A 4EFBA 2EIMC 4X1YA 3AG1B 3CC7V 1IZ3A 1Y76A 3IC7A 4ZIBA 2F66C 4FLUA 1R6NA 2PI4A 5B1OA 2E01A 2Z5UA 4MI7A 3ETEA 1BCCH 3BOWA 3BAAA 4EFEA 4JV5O 3K5OA 1TUEB 2JGUA 2Y4TA 2DYSB 1YITV 3SR2C 4H44B 3CE2A 5BR8B 3HHAA 3TXSA 4UVBA 3PSEA 3K59A 4DR4O 1F2CA 3MTNA 1QLEB 1H2SB 4DV3O 4ICGA 2EBOA 3VQYA 3I06A 1M9NA 3LDEA 2FE8A 5J2TB 1J5EB 4TV9A 2WLNA 3IHPA 3KWZA 3OF9A 1SZXA 1US6A 2P67A 2WLIB 2KG7A 1AB3A 3D3QA 1Q8IA 5H6QA 4B3MB 5B1AB 4LFBO 3I3TA 1X4TA 2OT5A 3TJTA 1AJQA 1MA1A 3CS5A 3E86A 4DV7B 1GM8A 3FB5C 2DWDC 3D8CA 1NJIW 1E1RG 1S4VA 5LP6C 2DJFB 1ZAUA 2CB5A 2N05A 1V54C 3C90A 4DW0A 4U7OA 2F93B 3ZRVA 3V6EA 5LA6A 4QGPA 4DR6O 3SPHA 3LXSA 4B3RB 1BS3A 3P3NA 1FYJA 3KKYA 5GTIZ 3ASOB 1AYVA 4J41A 3MTVA 1LUVA 2UUBO 1XDCA 3UQ8A 5DM6V 1U9WA 2E5LO 1XILA 5FNVA 3FAVB 2YC0A 4ZUXU 5JQGA 1HUCB 2LW7A 1DEUA 2DMXA 1DF0A 3LSUA 3I55V 3ETGA 5K16A 4NXMO 1KXRA 3T1YO 5J2UB 2P86A 3FX7A 3BPFA 1K34A 1F4NA 2HR3A 3RYHB 3K04A 3T1HO 2JS3A 4E2LA 2VS0A 4K8ZA 5EYPB 1PPDA 2EILC 3CMAV 4JI7B 5IE9A 4JI5O 3RYIA 4GUAA 1I94O 4J42A 2UU9O 4QH6A 4CZZA 3L74H 2X0LA 2YJ2A 2YDEA 1PP9H 4UCOA 2XNDG 4P6GA 1Q90D 2BSKA 2VQEB 3K9SA 1KHQA 5K1XA 1EWPA 3BWKA 4I0XA 2Q7EA 1YI2V 2O6XA 5JVDA 3CCSV 1H2GA 2XU5A 1YK7A 3D3IA 3SYOA 2DJGB 2ZNJA 2QTOA 4JF3A 4DV0O 1THZA 2ZR2A 1SQXH 1NTMH 3MORA 1WLEA 4IIJA 2HFEC 2IH1C 1VP7A 4YJ2A 4CC5A 4HYOA 3MHHC 4U3FH 1BZKA 4Q8HA 2WAMA 5FLXN 1IXMA 2PY5A 1IBMO 1GKFA 3USVA 4PI2A 2J7QC 2ILMA 4ZOLB 4DR2O 2PI5A 1TU6A 1OCZB 4CBCA 4RUFA 2QM8A 1EWMA 3OEHG 2F95B 2XAJA 3P5UA 2ZDIC 1VQLV 3HKBB 4JI6O 2P22C 5LBQA 2OYQA 4WFGA 1HNWB 2EIJB 2DCBA 2PNSA 3STZC 4DR5B 1VF5B 4TWKA 4PI0A 3OVXA 2ZE7A 2KSDA 3SYPA 4LF6O 1K5QA 3RBZA 2HH5A 3OR7C 2ZT9B 4AQYB 1FAFA 4G28B 2WLLB 2YSUB 4BAYA 1N8RW 1OCOC 5LYJB 3LUTB 4KP4A 2H94A 4IUMA 4PADA 5EBLC 2UUAO 1PPJH 1D5AA 3OMNB 4W4UA 1W0KG 1AJPA 3V6CA 4B3TB 1SF9A 2IJHA 4J9ZB 3S3WA 3WB1A 1Y4MA 3CWBH 1PCIA 3I56V 2ZIOA 3PHXA 4FLYA 2G6DA 3OGIB 1XHZA 2YI8A 2JDIG 4JI3O 5KHGA 2ZM6O 1G8MA 4AXLA 4IGGA 1XNQB 3K0GA 3QO5A 2JJ1G 1I5XA 1JA8A 2KKWA 3D36C 5LL6Y 3C3SA 2EILB 4CDCB 4NYKA 1YSCA 1Y74B 4N8WA 5IY5C 1SERA 1QVGU 4F6RA 3ZUAA 2YI9A 3A8TA 4DYLA 4DR7B 3UT5B 3H1KH 5J2TA 4OEMA 3H1LH 1WP7A 2LFSA 1CXZB 3BFRA 4JZGA 3CD6V 1DKIA 3N3KA 4O4HA 2Q67A 3BA8A 4JAAA 2WLIA 2JEXA 2JVDA 4MZOA 3FFQA 3JALA 4WFEA 1ZUQA 3FKSG 4LFCO 1AYWA 3C3TA 3UCSC 2HG5C 3OM3B 3E22B 4X66B 4GKJO 3DF0A 4JI8O 4ZHQB 3O65A 1GAXA 2RQ6A 1AU3A 5CB4B 4ZKIA 2AGAA 4DMXA 3SPIA 3VOUA 2G38A 1R3LC 2XU4A 4WCEV 7PCKA 2XAFA 3FAVA 4D6TH 3TXQA 1X59A 2ZXWC 4RQFA 4CDEB 3WXFA 1KP3A 3QF7A 1IURA 2R70A 4MSXA 4CS3A 3RYHA 3CRMA 4PP1A 1B04A 1ZL8B 4YJ3A 4JI0O 1R3KC 2Y48A 1N34O 4LF9O 1Y67A 5LHGA 3X2QB 2FRAA 1JFFB 1F23A 3E8BA 3AK1A 3ICXA 4D7SA 1OCOB 4BOSA 1DGSA 2Q9LA 4PDRA 1OV9A 3DC5A 4HXDB 4WFAV 4PA3A 1EZJA 4JYAB 1DK1A 3JAKB 2AW9A 4QNHB 2CH7B 4N23A 2PGGA 3A0HZ 1XOUA 3JD3A 4PDMA 1PBHA 3SGIA 2BTWA 1FJGB 5FPOA 1J95A 1CVZA 3RVXA 3RVVA 2A9HA 3N4CA 1S5JA 2A06H 3RNVA 1IBKB 5HFLA 2XOKG 1YVWA 2NN4A 4N79A 1R3JC 2DCAA 3NR7A 3AG4B 3ZRXA 4ZOLA 1XL6A 5CA0B 1PV0A 3ZN0A 4DV5B 2LGQA 1CTEA 3N2KA 3CSXA 5A2QN 5E1AC 3HKBA 2HHNA 3RVWA 1F2AA 2B5UA 1GMYA 5IYCO 1K8AW 4HZ3A 1B6QA 3ZHRA 1I0HA 5KHHA 3IOQA 3U10A 2YIBA 4IYHA 1BHBA 2W0XA 1K73W 2AIMA 1HP8A 2LO1A 1BGOA 3A0RA 2WLLA 4BIZA 1H2NA 1GH6A 2RNBA 4MTOA 3PNRA 1MG1A 1OCRC 4DR1B 1FS0G 4DR3O 1XMOB 3SJCC 1RM1C 1YXBA 2EULA 3Q4HB 1VQOV 5CBFA 4GKKB 2GTAA 1RPOA 4D8IA 1CP9A 3AEIA 2OULA 2QWNB 1NQCA 4O4LB 2ZXWB 2P7TC 1NB5A 4ASUG 3OAAG 1ZLZA 3H8BA 3ZS8C 3HKDA 3SYQA 2CK3G 4D7TA 4E4EA 3K8UA 1BMFG 2F1MA 2XHBA 3OTFA 4MVZA 4NTYA 5KX5B 1N33O 5CVOB 5ITZB 2ITCC 2ARHA 4MTXA 4RAIA 2YIBD 4H37A 1MSDA 1E1QG 1LNQA 3UO2A 3BPMA 4P6EA 3UT5A 1D2DA 5EZQA 1EM1A 3W7WA 4FIPC 3CH3X 2BTQB 3GB7C 4X64O 4LFAB 4GX2A 2LQTA 3N27A 4JAVA 5CA1B 1A32A 1HDJA 2DOSA 3M99B 1ZWIC 2LP7A 4DRXB 1Y08A 2NLJC 3L9DA 3RWRD 1FXVA 2Q0OC 3ABTA 4R6ZA 1Y6XA 2FO5A 2IJJA 2Q0AA 2OCCC 3QT4A 4YY3B 2N04A 2DQ3A 4JYBA 4ZHQA 4GX1A 5CN0A 5LXTA 3L70H 1V55C 5LHIA 1OCCC 4J7ZA 2Q7HA 4L87A 1KC8W 2Q7GA 1U9VA 3WFVA 1KHPA 5BR8O 2AVWA 3STLC 3SPGA 3KX1A 1PADA 1KECA 3ABUA 3WB0A 3KFQA 1L0LH 4X20B 3ZHQA 2BTOA 3KCXA 1FXKA 4UB8Z 4X8AA 1AIMA 1N0JA 3LNMB 2A79B 1J5EO 1YJWV 4MVMA 3K03A 1ZSPA 1FKAO 2F1GA 3TNXA 1JJOA 1PIPA 3WG7B 3OE7G 4B3MO 3CJHB 2UXXA 2QWPB 2Y0IA 1ZL8A 4DV7O 1XI1A 2XAGA 5JH7B 3RYFB 4LBEC 3NXSA 3MHSA 2Q4PA 3S3QA 1S72V 1P4RA 1JFFA 1NB3A 1Y66A 2IM9A 2JS5A 1HNZB 3DTUB 4B3RO 3O9OA 3HPLC 1SQGA 1RSOA 2P0RA 4FM0A 1VMGA 5IJ0B 4OX9B 4O4IA 1NR1A 3J7AU 5CVMA 1ATKA 3OW2U 1WB8A 2DYRB 3QNEA 1N32B 1VQ8V 1VF6C 2CH7A 1YEWA 2F43G 4BW5A 2A0LA 4PP2E 3W7TA 2X6AA 1TUBA 3VQVA 4QJFB 2DE0X 3BC3A 1P7GA 5B1BC 2Y69B 2OWOA 3FD9A 1JPXA 3GVMA 4JI7O 1HNXB 3HKCB 4CC6A 4WFHA 2RCVA 3R65A 4PDVA 4CS2A 3CRRA 2QDOA 1RP3B 1BP4A 5EIBD 4LF5B 1BL8A 5E79Z 3HKEA 3B4SA 4XR7A 2PYLA 4X1KA 5EBMC 1VSNA 3FB6C 1NVPB 2AHZA 3ASNC 4I5SA 4UV8A 1M56C 1RPRA 2EIKB 3SJQC 4ABMA 2F4VO 5JZEA 1E79G 5LMNB 3CC2V 3VQXA 2QWOB 5IDJA 1WNSA 4MVQA 2UXBB 1KFUL 5D5PA 5LOVB 1VQ7V 1AROP 1JOYA 4YIOA 3B2EE 2K9PA 1V55B 4O2AB 4GYCB 3CMEV 2QWRB 3K79A 1NTKH 3DC6A 4NB5A 4TQDA 4NTXA 1O0EA 1MIRA 6PADA 4UCVA 2CTQA 2O57A 1Q5OA 5JA7A 1BHAA 1SA0B 1FD9A 1CQDA 4AHCA 4O4LA 4G54A 1S5LZ 1SQVH 2B1GA 4FJCA 3AG3B 4IHJB 4JYYA 1Z5WA 1BE3H 3LDDA 1QLNA 2PADA 4FMTA 2QR4A 3ZRWA 4F6EA 3PRMA 3C0RA 5K1PA 2GTSA 1NZ6A 4O4JB 2HHHB 1HNWO 1EFRG 2AYOA 4MM3B 4DR5O 4WF9V 5ITZA 2DJVA 4HNAA 4JTAB 5KHKA 1SQQH 1KKDA 4TSFG 4W4LA 3SJAC 4EEQA 4AXMA 1JMKC 3B79A 3ABMB 1NS1A 2YIDA 1N36B 1MEMA 2R9NA 1QR8A 2CUGA 2DWEC 2V7QG 5IJ9B 2L6LA 4FLXA 2BTQA 1WB7A 2ATOA 1V9PA 5CA1A 4K3AA 4RWUA 1XNRO 3H1HH 3BRCA 4DRXA 1QDQA 1I7FA 4DK0A 2QEXV 1VJVA 1F51A 3FB8C 3DXRB 1COWG 3K3WA 2ZR3A 5H6RA 3G6EV 3BB7A 2CTPA 3FB7C 4FK5C 4B3TO 4NXNO 2FRQA 2ZE6A 4FM1A 1MHWA 3APOA 5GONA 1VQ9V 1Y4HA 4H0LB 1DTOA 1XNQO 3K57A 1TAEA 4JI2B 2EIMB 1U9QX 4DXWA 3JD4A 4XDJA 3TK1A 3TMPA 1NR7A 4HWYA 3FYEB 3SYCA 2WA3A 4X20A 1POPA 4UCRA 4DV6B 3G4SV 5LGTA 4WURA 4DR7O 2AUXA 3GWOA 2JEUA 4X65B 3AG7A 2QM4A 1Q6IA 4F4LA 4DMYA 2Q68A 4J7KA 3OR6C 5FPRA 1Q7YW 4FFBB 3CPWU 4OW0A 5IT9N 3H8CA 1Q6HA 4Z1VA 3GWKC 3ZNHA 4YV8A 4P30A 4JI4B 3ABKC 3K58A 2IH3C 4LFBB 4X66O 5KUKA 5AG2A 3ZMZA 4CDFB 4R3DA 4JTDB 3B21A 2MK3A 2YEVA 2ACTA 5DN6G 3S3XA 4DUZB 1YCIA 3P32A 2OZ2A 2QTSA 5LP6B 1YHQV 3CCMV 1V54B 1UPGA 3M8AA 1TLOA 1YALA 4BQVA 4W5BA 4JTCB 2QKAA 5B3SC 1QVFU 4WA6A 4LNUA 1F29A 1H38A 1G4YB 4LR3A 3RW0A 1L1FA 3JSLA 4BR6A 2K1EA 3OD4A 4R50A 3RYCA 5KA6A 2Q5ZA 1KUQA 4YYSA 2ZINA 4MT8A 4Q8GA 4MTGA 2JJ2G 3O1GA 5L3DA 1MDWA 3HKCA 2VHFA 2IBZH 4JGSA 1IXBA 4FLWA 4X62B 1G1XB 3P3PA 2UU9B 2JGDB 3KG2A 4TUYB 2HD5A 2PBHA 4I9QA 1MEGA 5JCOC 4X1IB 3MDSA 4P2ZA 4KXRA 1K4DC 1UKFA 3ZIAG 4RNAA 2DW4A 1PL4A 4M0WA 4BPVA 4JYAO 4LWSB 4H33A 2HKOA 1VARA 4UV9A 4DV2O 1KKCA 3F5WC 3JAWB 4B7KA 4B3SB 4WFFA 3B8NA 4UXNA 3KWBX 4O2AA 4YYQA 4K7CA 1FJGO 1SKVA 1PPNA 4QRXA 1BGYH 3VQWA 4RO2A 5LMUB 2B1IA 1GN2A 3B40A 4GLXA 1K9MW 1IBMB 1SA0A 4OPAA 1CV8A 2DC9A 1S0VA 4J9YB 1GN4A 2A7WA 3TGUH 3CH2X 2QSAA 4DV5O 5JWPA 5IYZB 5L3GA 4G2KA 2QM7A 2GV9A 1UJWB 3R66A 5KMGB 3PRPA 4CH6A 1AECA 5E6JA 1NVPD 1SP4B 1MABG 2IPPB 5CHTA 3ZRSA 3F7YC 5J2UA 4PA7A 3CCLV 4MVUA 2YJ8A 2QKCA 4DW1A 1PVJA 2ADQB 4GX5A 3H1JH 4LF6B 1YT7A 2RDCA 5LGNA 2P7UA 2E76B 3BCNA 1VQNV 4DR1O 5EYPA 2X6CA 3ZMUA 1K33A 4JPRA 4BWAA 1XMOO 3K5MA 2GUZB 2XAQA 4FM2A 1W59A 2UUAB 4UUJC 1XEQA 4P9OA 3K0DA 3MAQA 3RT3C 2RMKB 1CB5A 1KP2A 2KQXA 5LGUA 1GO3F 1FH0A 2R9MA 1FXHA 3G71V 2WLHA 2AZ0A 1KBHA 3JATB 4JI3B 3THOA 4R7CA 1IX9A 3JASB 1K5SA 1IWDA 4FVMA 1H8EG 4XUIA 1Q3EA 4DUYB 1JX9A 1HR0B 3U8EA 4J11A 4X88A 4I4TB 3ZMSA 3BY6A 3N2GB 2XU1A 1QR9A 3CC4V 4K8XA 2HP8A 1PPPA 4BOUA 4FFBA 5CBHA 4KL1A 5JJEB 9PAPA 4KUMA 5IY5B 5DECA 1ME4A 2E3CA 4LF8B 4OVZB 4QRGA 1MZFA 4MS2A 4U3JB 5EC2C 2DC6A 2N74A 4LF4B 3ETDA 1STFE 4JI8B 3OF8A 1K7DA 1NH2B 1K4CC 3T1CA 3L75H 2GDSA 4I55B 1BQZA 3WB2A 5A9GA 4K0KB 2BU3A 5LP6A 3QO8A 4I50B 3OMAB 1YJNV 2DZZA 5LYJA 1NKDA 4JI1O 1AI7A 2UZJA 2H8PC 1QU7A 1XMQB 3U0ZA 1KFXL 5KO3A 1NT2B 3U11A 3OEEG 4TV9B 1KMIZ 5EGWA 1AILA 3JARB 4RQEA 3CXCU 2XU3A 1U96A 3RVZA 4BOZA 2CDYA 2KG7B 1M57C 2UXDB 4WFBV 4ZBMA 3LDCA 3PW3A 3TETA 4XDLA 1PNLA 1M1KW 3WXGA 3AG2C 2WLJA 2AUZA 1AI5A 1N34B 1NLJA 2VHSA 2ZQMA 2H3OA 4P9PA 2JGDA 1HNZO 1B06A 2M6YA 5JH3A 2P6JA 3OUFA 4TUYA 1W0JG 1EBOA 4JASA 3PBHA 2LW1A 3F75A 3A0BZ 4X1IA 2CGNA 2OP3A 1WN7A 1Y74A 3H1IH 4OX9O 1LR1A 4YHHB 4UVAA 3RGBA 2ZNIA 1HW7A 2P4KA 4AILC 4UFZA 3CRAA 1TVKB 3K5LA 1AI4A 5C8YB 1N32O 5F02A 1URFA 3E8GA 3BABA 1ME3A 3UKMA 1IBLB 1WJZA 1XREA 5JQGB 4FZ1A 2VWKA 2Y0PA 4DV4B 1U9XA 1HWYA 4Q20A 3TCUA 5EZYB 3CCJV 4A5UB 2GHYA 3BY4A 1FFXB 2AZ2A 2QKSA 4I9WA 2OTJV 2NR5A 3OVZA 3E22A 4U7NA 2DYSC 1AYUA 1GTOA 1T5EA 1VQ5V 4DO2A 1K92A 1HNXO 3AI8A 4X6JA 2UUCB 3KSEA 3P5XA 3RYIB 2XASA 5EF4A 4C7UA 5BMVB 4G27B 4WBNB 3CCUV 5CB4A 2FMLA 3E2EA 1SNKA 1L8DA 3UO3A 4LP8A 4W5CA 4GX0A 1YIJV 4FZ0A 5IYZA 5B1NA 4REZA 3SYAA 1WPXA 3K9AA 5KMGA 1GM9A 2J7QA 8PCHA 4PI3A 1DF5A 1TGOA 5B1AC 4ZTBA 1WP8A 3RN4A 4YYRA 1M5IA 3W7XA 5IWAB 1VIBA 2FTDA 2UXBO 2ZDIA 2DN9A 3JCUZ 5B5EZ 4DV1B 1YDXA 4YIPA 1KYOF 2RN9A 4YYVA 2DCDA 2C2AA 1KU9A 1GK9A 5EK0A 4KHPB 4CH3A 2EX3A 3ASOC 2WLKA 1QNMA 4DR3B 1R73A 4BS5A 5CMUA 4OELA 1SS3A 3E9SA 3MJ5A 1BSMA 1P7BA 4BIUA 1BQIA 1OCRB 5F2VO 1SZTA 4BIOA 2YXYA 1LUWA 1RM1B 4BOPA 1XL4A 1K3BB 2QWQB 4J80A 1JVMA 2QGNA 2D2CB 1H2LA 1M57B 3JAKA 3CCEV 3T2MA 1KQSU 4MSWC 1SESA 3CCQV 5J9PC 1ZCMA 2A3QA 1SQPH 1A6RA 1PXVA 3HB3B 4ZI7B 2NQGA 2QE7G 3AG2B 1PKXA 3OTOB 5CA3A 4I4TA 1PM9A 2HVKC 4PA6A 2VQFB 1GLOA 1N36O 1QOLA 2AXTZ 2YIAA 3N2GA 2BOBC 5EC1C 1GN3A 2HVJC 3LNNA 3B77A 3D36A 1WAZA 2ATKC 4I07A 3BBAA 2UXCB 2R9RB 3CX5F 2EINC 3IMAA 1I5YA 3KZIZ 3E35A 2DZYA 3CB2A 4TOIA 5CA0A 2YUAA 3IC9A 5FPWA 3BA9A 4YYUA 4U3JA 2FUDA 2VQEO 4B7EA 3SDLA 5C93A 1WA8B 1FPOA 3MD0A 1AR4A 4I55A 5GW7A 3FYIB 2PF4E 2GSMB 4JI2O 2OCCB 1XHXA 4PDLA 3EVKA 3J80N 2Z0AA 1QMYA 4I50A 3DSQA 4CS4A 1OJHA 2E02A 4EKWA 2JQFR 2WLMA 2DC8A 4DV6O 1OCCB 2F23A 1MSWD 1AP6A 1EF7A 4F6RB 3M7MX 1OCZC 4X65O 3C9EA 3OQCA 4IT5A 1H2MA 1U5IA 3Q4HA 3JARA 4O4HB 4JI4O 3JCZA 3QVNA 1AU4A 2F7DA 3CHXA 4Z1MG 2Q6AA 2EIJC 3JALB 4IYIA 3N3GA 1MS6A 2BE3A 3F5TA 2VRZA 5GTHZ 5KHJA 1Z5VA 1NH2D 3CXHF 2IBIA 3ABLC 3PJSK 5KX5A 1ZIVA 4DUZO 5TISZ 4MVSA 4GZRB 2H7JA 3IUTA 3ML0A 3JAMN 4AQYO 1YJ9V 2NQDB 5KAFZ 1TVKA 3A2FA 2E00A 2YJBA 4KLBA 5C8YA 2NQIA 4X6IA 4I04A 2AHYA 2WBFX 3M99A 1O9HA 1DF4A 1EWOA 4LF7B 5EZYA 4A5UA 1FFXA 1O9GA 3ZMTA 3APQA 3ZHUA 2W6IG 2UXNA 3I5DA 1M93A 2BDZA 1DLBA 4W4KA 1JQ0A 3ZBHA 5L3BA 3ZCCA 4MTFA 4DK1A 1R3IC 4KFMA 2VWJA 1GRJA 3BVOA 2LGWA 4YJ3B 2JRIA 2Y5BA 1SETA 1EN6A 1H8HG 1CEZA 1QXPA 4LCUC 5BMVA 4WBNA 3H89A 2Y6EA 4X62O 4JV5B 5J94A 1PNKA 1NQTA 5B1BB 2EZPA 4CH4A 2B9ZA 4OXSA 5BZBA 3CP1A 1S5HC 1TA8A 2AYNA 2XAHA 3ZJZA 4FFKA 2EINB 3JD2A 2R9AA 3RFRA 1KB9F 4DR4B 3VBBA 4DV3B 2ETNA 4PV1B 2F4VB 2R9IA 1X9YA 1H2KA 1M4UA 4B3SO 2P5OA 4OPHA 2OCHA 2OIEA 3WU2Z 3P30A 3CJHA 1AU0A 3ASNB 1M56B 3PHUA 3ZHVA 2BTWB 1Q43A 3O0UA 4TQFA 5JH7A 3CRCA 3RYFA 4NVPA 5LMUO 3QTCA 4J7JA 1CPJA 1CSBB 4JYCA 4HAMA 3B09A 3CYOA 2CIOA 2IJIA 2X6BA 1OHHG 2QA4V 2R9FA 1FXKC 4DR6B 1PPOA 2CAZC 4RKXA 1GECE 3W30A 5KAIZ 5CBGA 5IJ0A 3IEJA 2D3OW 3N2KB 2UUBB 3EFFK 3UM7A 1M6DA 1QBZA 3E8FA 2Y4UA 3EHBB 2E5LB 1VQMV 1MZEA 4D8BA 1NBMG 3ZEDA 1XKGA 1NTZH 5L3FA 4UCTA 4JZ2A 4ZI7A 4NXMB 3PT2A 3BEHA 3T1YB 2HXZA 4QPKA 3MHSC 3OMIB 3X2QC 1P84F 4TV8B 5EIBC 3ABLB 2GFOA 3E83A 1Q6UA 3T1HB 4YYWA 1YK8A 4EB6B 4JI5B 1XNRB 3QO7A 4RF0A 4BSQA 1I94B 2B1MA 2ZD9A 3L71H 3J81N 4FIPA 1KD1W 2G8EA 2PREA 4IP3A 2P06A 4NXNB 2JQGR 1YTFB 1THEA 1PNMA 2X7RB 3HHIA 2ARYA 1WA8A 4FLZA 3T4ZA 4NKGB 2JTCA 1AR1B 3BPZA 3HKDB 3GCBA 1BQ0A 2YICA 1GM7A 4LH7A 1NPZA 4N21A 5H9CA 2ZCEA 3H6SA 1AVMA 4FPPA 1ENVA 2FT2A 4PJ0Z 5LOVA 4DUYO 1Z2GA 2JK5C 3W7UA 1HR0O 4DV0B 3IFXA 2Z84A 4UB6Z 3TRKA 2P4VA 3H9VA 3AG4C 5LHHA 1YVBA 2B1NA 2KB1A 4PELA 3P5WA 1IBKO 4X6HA 2XUMA 2GHUA 4O2BB 2WA4A 3KCYA 4K35A 3F7VC 1NL6A 4DR2B 2OIGA 1YF2A 4LF8O 1AI6A 4IHJA 1AJNA 1ZTEA 2CTRA 4LF4O 4I7ZB 2W6JG 2ODMA 3CCVV 1CJLA 5B66Z 3E89A 3SPCA 4O4JA 1SRYA 3ZN1A 4JI6B 3ZMVA 3ABKB 5LXTB 4CDDB 1EWLA 5H5NA 3JSNA 3PN1A 1QCEA 1K97A 1N0NA 2CE4A 5HFMA 2WWWA 4K0KO 3SJBC 4YXWG 2Q69A 4PD4F 2DCCA 2AU1A 5EZSA 1JJ2U 2Q73A 5DEDA 5IJ9A 2C0YA 3ZHTA 2R6NA 1FXKB 3OFNG 2G7YA 4QE7A 4N4ZA 1XMQO 3D6SA 1VQPV 4FJCC 3DXRA 4GKKO 1EZVH 1UFIA 3K24A 4P16A 1G6UA 2FYUH 2UXDO 1IDSA 3JD0A 1VF6A 5B3SB 5L3CA 4HBNA 2M7WA 5KUMA 1GCBA 4IL6Z 1Q81W 4MVOA 1IVSA 2QJ1A 2EJRA 3G67A 2NQAA 2L35A 2ZM6B 4I05A 1L0NH 4UCUA 4XDKA 4BW9A 5CVNB 4D8EA 1AU2A 4JAUA 2XTAA 4RUEA 1CPYA 1RSOB 3JYCA 3QJ3A 1PD3A 1XBLA 1OZ0A 4YHHO 3LSSA 2JIZG 3K08A 1F2BA 1PL0A 4O4IB 2PTMA 1VQ6V 1XQ8A 4LFAO 2HLDG 4PHZA 1IBLO 1VEWA 3OUSA 4DV4O 1Q82W 2EJ7A 5KHIA 4DV2B 4AI8A 1F4MA 3F5VA 3OGCC 4RY2A 1XUQA 3G6BA 1R6TA 4LFCB 1TUBB 4GCZA 4YY3O 5BXZA 2IW5A 4Q6GA 4X1YB 4GKJB 3ZHSA 1Y76B 5KA5A 4CZWA 2Q8VA 2G8JA 1NU1H 4QRVA 2LFRA 2UUCO 3W7SA 1U97A 5H2FZ 4QIWF 3MP2A 2YS8A 2BOCC 4BOQA 2W0FC 3KKUA 3HKEB 3G80A 4QPJA 2E74B 4MZSA 2YJ9A 4X1KB 5BY1A 5KLVH 4Z2WA 3L72H 3EXAA 3WG7C 5D5QA 3PDFA 1S76D 3T4DA 3CBKA 2PYJA 3AK2A 3WXEA 2IJKA 1R1BA 1AR5A 5L3EA 5IWAO 3LFYA 2ADPA 3SPJA 4DV1O 2ITDC 1Q86W 2HEPA 3OT7A 2HJFC 2RJZA 2FKXA 4TV8A 1N4CA 1YZBA 3BHPA 2V4DA 4R8CA 1QQCA 4EB6A 4JI0B 4KHPO 2BCCH 3ERVA 2ZE8A 1TL9A 2FTKA 4LF9B 3BCCH 4MW8A 3L73H 1P49A 2EZOA 1JR9A 1MMMA 3IAYA 2DYRC 5LA6B 3K5NA 3IGAC 1M90W 2PUSA 5JJNB 4XZXA 2HJDA 3OISA 1S3JA 1SQBH 2YXHA 2R9CA 4BS6A 4LWSA 1NI8A 4GUNA 2ZIMA 3ZRWB 1BY8A 3NHEA 4FK5A 2V1DA 4X9QA 3E1ZB 5FNVB 1VQ4V 1S77D 3AG1C 3JAWA 2Y69C 1SQFA 2MW2B 3QG5A 2NNUA 4FLVA 4XBFA 4HNAB 3E8HA 3IV2A 1FFTB 3OTOO 5IYBO 4FLTA 2FYEA 2YJCA 2VQFO 4UCSA 1WPBA 3CCRV 3K06A 4LH6A 2AS8A 4NTWA 4MVRA 3AK3A 2HWKA 1BT8A 4O2BA 2UXCO 5PADA 3CEIA 1D5NA 2ZE5A 2BDLA 4QBBA 3B8MA 3K9MA 5JJJB 1QLEC 4MW3A 4CH5A 4B08A 4PA4A 3MHHA 2FB5A 2EIKC 5IYDO 4LF5O 2Z3YA 2XT9A 1ORQC 2IU0A 2DQ0A 2CTWA 2BSKB 2P90A 2IU3A 2E03A 5FL7G 2YXLA 3IFUA 4UVCA 4YVAA 1YTFD 4QE9A 4RF1A 2PZSA 5GONB 4I0XB 5LMNO 1JQPA 5JVDB 3KW9A 1W2BU 3ZX6A 2ZKOA 1CS8A 2CGOA 1SC5B 3RVYA 1AP5A
chains in the Genus database with same CATH topology
4BOPA 1HNZO 4JI7O 4B3TO 4DUZO 3BB7A 3RNVA 1R1BA 4NXNO 1G1XB 4D8BA 5IWAO 5EZSA 1AB3A 3JAMN 4AQYO 5FLXN 4LFCO 4DV1O 1IBMO 4OX9O 4GKJO 4LFBO 3PT2A 2FKXA 1XMQO 4JI8O 1UKFA 1XNQO 1YZBA 2J7QC 3O65A 4DR2O 4RNAA 1N32O 4GKKO 4KHPO 4M0WA 4JYAO 4P16A 1N36O 3TMPA 5A2QN 2UXDO 4A5UA 5BR8O 4DV2O 2F4VO 2AGAA 5JZEA 4A5UB 3BY4A 3BBAA 4DR6O 4RF0A 4JI6O 4WURA 4DR7O 3W31A 4LFAO 4PT5A 1FYJA 4BOUA 2HHHO 3J81N 3MTVA 2UUBO 2JRIA 4IP3A 1FJGO 1J5EO 4OW0A 4XZXA 5IT9N 1HNXO 2E5LO 1X59A 4D8EA 4LF6O 4X62O 3ZNHA 1FKAO 2VQEO 2JTCA 4OVZB 2LW7A 3SDLA 2N74A 4B3MO 3PHWA 4NXMO 4X66O 4DR3O 3T1YO 4OPAA 4YHHO 4DV7O 4R3DA 3OTOO 4DV5O 4JI2O 4IUMA 4DUYO 4REZA 4D8IA 3B21A 4JI0O 3J80N 2VQFO 2Z0AA 1F7YA 1HR0O 2UUAO 4LF7O 3T1HO 1IBLO 2J7QA 1N34O 4DV4O 2Z84A 3R66A 4LF9O 3TRKA 2BU3A 3PRPA 4ZTBA 4JI5O 4OVZA 2HWKA 4DV6O 4B3SO 2UXCO 5E6JA 4OPHA 1IBKO 4GUAA 1I94O 4B3RO 3C0RA 3PRMA 1R6TA 2UXBO 1HNWO 2UU9O 4YY3O 4X65O 4MM3B 4DR5O 3PHXA 5BXZA 3M8AA 4BOSA 3OQCA 4JI1O 2DJVA 2UZJA 3PHUA 2BTWB 4JI3O 2ZM6O 1PVJA 4MI7A 3J7AU 4LF5O 5KO3A 4HXDB 1N33O 5LMUO 4JV5O 2UUCO 4JI4O 4LF8O 1AILA 4DR1O 1NS1A 3IFUA 5LL6Y 1DK1A 4BOZA 4LF4O 4RF1A 3MP2A 1XMOO 1D2DA 5EZQA 1KUQA 3F5TA 3E9SA 3PSEA 4BOQA 3MJ5A 4DR4O 5LMNO 1XNRO 4RKXA 4X64O 3W30A 5H5NA 1XEQA 5BY1A 1A32A 4DV3O 2DOSA 4DV0O 2ZKOA 2BTWA 1DKIA 3RT3C 2FE8A 4K0KO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ O;  4JI7 O;  4B3T O;  4DUZ O;  1R1B A;  4NXN O;  1G1X B;  5IWA O;  1AB3 A;  3JAM N;  4AQY O;  5FLX N;  4LFC O;  4DV1 O;  1IBM O;  4OX9 O;  4GKJ O;  4LFB O;  2FKX A;  1XMQ O;  4JI8 O;  1XNQ O;  1YZB A;  3O65 A;  4DR2 O;  1N32 O;  4GKK O;  4KHP O;  4JYA O;  1N36 O;  5A2Q N;  2UXD O;  5BR8 O;  4DV2 O;  2F4V O;  2AGA A;  4A5U B;  4DR6 O;  4JI6 O;  4DR7 O;  4LFA O;  1FYJ A;  2HHH O;  3J81 N;  2UUB O;  2JRI A;  1FJG O;  1J5E O;  5IT9 N;  1HNX O;  2E5L O;  1X59 A;  4LF6 O;  4X62 O;  1FKA O;  2VQE O;  2LW7 A;  3SDL A;  2N74 A;  4B3M O;  4NXM O;  4X66 O;  4DR3 O;  3T1Y O;  4OPA A;  4YHH O;  4DV7 O;  3OTO O;  4DV5 O;  4JI2 O;  4DUY O;  4JI0 O;  3J80 N;  2VQF O;  2Z0A A;  1F7Y A;  1HR0 O;  2UUA O;  4LF7 O;  3T1H O;  1IBL O;  1N34 O;  4DV4 O;  3R66 A;  4LF9 O;  4JI5 O;  4DV6 O;  4B3S O;  2UXC O;  4OPH A;  1IBK O;  1I94 O;  4B3R O;  1R6T A;  2UXB O;  1HNW O;  2UU9 O;  4YY3 O;  4X65 O;  4DR5 O;  5BXZ A;  3M8A A;  4JI1 O;  2DJV A;  4JI3 O;  2ZM6 O;  3J7A U;  4LF5 O;  1N33 O;  5LMU O;  4JV5 O;  2UUC O;  4JI4 O;  4LF8 O;  1AIL A;  4DR1 O;  1NS1 A;  5LL6 Y;  1DK1 A;  4LF4 O;  1XMO O;  1D2D A;  1KUQ A;  3F5T A;  4DR4 O;  5LMN O;  1XNR O;  4X64 O;  5H5N A;  1XEQ A;  5BY1 A;  1A32 A;  4DV3 O;  2DOS A;  4DV0 O;  2ZKO A;  3RT3 C;  4K0K O; 
#chains in the Genus database with same CATH topology
 5EBW C;  1GN6 A;  3QSD A;  2OTL V;  3H01 A;  2FQ9 A;  4IIJ B;  2R72 A;  3LSQ A;  4PA9 A;  1MNG A;  1JCH A;  4YJ2 B;  1B3Q A;  4OGQ B;  4JI1 B;  1EN4 A;  1ZX3 A;  1VF7 A;  2GUZ A;  3AG3 C;  4X89 A;  3JD1 A;  1PE6 A;  1MOF A;  3H7D A;  2WSS G;  1K3E A;  3S3R A;  3HWN A;  4LC1 A;  1GMG A;  3IJ4 A;  1EN5 A;  2DC7 A;  1I08 A;  3W31 A;  4PT5 A;  3JAT A;  2HHH O;  3JAS A;  2GBO A;  2WPD G;  3ABM C;  3P5V A;  1QHT A;  2YEV B;  3ETQ A;  4TT3 G;  4H13 B;  4NR1 A;  5CHV A;  1N33 B;  1RFY A;  2LJ2 A;  1ICF A;  4GT1 A;  3HR0 A;  3PHW A;  5JCO A;  3CBJ A;  3DGE A;  4X64 B;  3HD3 A;  4LNU B;  2E75 B;  1VQK V;  1F7Y A;  4LF7 O;  2R9O A;  1ITO A;  5A24 A;  1Q6K A;  3CRQ A;  4L8J A;  1R6K A;  1ROP A;  3RYC B;  4OVZ A;  2FL4 A;  4J10 A;  4EFB A;  2EIM C;  4X1Y A;  3AG1 B;  3CC7 V;  1IZ3 A;  1Y76 A;  3IC7 A;  4ZIB A;  2F66 C;  4FLU A;  1R6N A;  2PI4 A;  5B1O A;  2E01 A;  2Z5U A;  4MI7 A;  3ETE A;  1BCC H;  3BOW A;  3BAA A;  4EFE A;  4JV5 O;  3K5O A;  1TUE B;  2JGU A;  2Y4T A;  2DYS B;  1YIT V;  3SR2 C;  4H44 B;  3CE2 A;  5BR8 B;  3HHA A;  3TXS A;  4UVB A;  3PSE A;  3K59 A;  4DR4 O;  1F2C A;  3MTN A;  1QLE B;  1H2S B;  4DV3 O;  4ICG A;  2EBO A;  3VQY A;  3I06 A;  1M9N A;  3LDE A;  2FE8 A;  5J2T B;  1J5E B;  4TV9 A;  2WLN A;  3IHP A;  3KWZ A;  3OF9 A;  1SZX A;  1US6 A;  2P67 A;  2WLI B;  2KG7 A;  1AB3 A;  3D3Q A;  1Q8I A;  5H6Q A;  4B3M B;  5B1A B;  4LFB O;  3I3T A;  1X4T A;  2OT5 A;  3TJT A;  1AJQ A;  1MA1 A;  3CS5 A;  3E86 A;  4DV7 B;  1GM8 A;  3FB5 C;  2DWD C;  3D8C A;  1NJI W;  1E1R G;  1S4V A;  5LP6 C;  2DJF B;  1ZAU A;  2CB5 A;  2N05 A;  1V54 C;  3C90 A;  4DW0 A;  4U7O A;  2F93 B;  3ZRV A;  3V6E A;  5LA6 A;  4QGP A;  4DR6 O;  3SPH A;  3LXS A;  4B3R B;  1BS3 A;  3P3N A;  1FYJ A;  3KKY A;  5GTI Z;  3ASO B;  1AYV A;  4J41 A;  3MTV A;  1LUV A;  2UUB O;  1XDC A;  3UQ8 A;  5DM6 V;  1U9W A;  2E5L O;  1XIL A;  5FNV A;  3FAV B;  2YC0 A;  4ZUX U;  5JQG A;  1HUC B;  2LW7 A;  1DEU A;  2DMX A;  1DF0 A;  3LSU A;  3I55 V;  3ETG A;  5K16 A;  4NXM O;  1KXR A;  3T1Y O;  5J2U B;  2P86 A;  3FX7 A;  3BPF A;  1K34 A;  1F4N A;  2HR3 A;  3RYH B;  3K04 A;  3T1H O;  2JS3 A;  4E2L A;  2VS0 A;  4K8Z A;  5EYP B;  1PPD A;  2EIL C;  3CMA V;  4JI7 B;  5IE9 A;  4JI5 O;  3RYI A;  4GUA A;  1I94 O;  4J42 A;  2UU9 O;  4QH6 A;  4CZZ A;  3L74 H;  2X0L A;  2YJ2 A;  2YDE A;  1PP9 H;  4UCO A;  2XND G;  4P6G A;  1Q90 D;  2BSK A;  2VQE B;  3K9S A;  1KHQ A;  5K1X A;  1EWP A;  3BWK A;  4I0X A;  2Q7E A;  1YI2 V;  2O6X A;  5JVD A;  3CCS V;  1H2G A;  2XU5 A;  1YK7 A;  3D3I A;  3SYO A;  2DJG B;  2ZNJ A;  2QTO A;  4JF3 A;  4DV0 O;  1THZ A;  2ZR2 A;  1SQX H;  1NTM H;  3MOR A;  1WLE A;  4IIJ A;  2HFE C;  2IH1 C;  1VP7 A;  4YJ2 A;  4CC5 A;  4HYO A;  3MHH C;  4U3F H;  1BZK A;  4Q8H A;  2WAM A;  5FLX N;  1IXM A;  2PY5 A;  1IBM O;  1GKF A;  3USV A;  4PI2 A;  2J7Q C;  2ILM A;  4ZOL B;  4DR2 O;  2PI5 A;  1TU6 A;  1OCZ B;  4CBC A;  4RUF A;  2QM8 A;  1EWM A;  3OEH G;  2F95 B;  2XAJ A;  3P5U A;  2ZDI C;  1VQL V;  3HKB B;  4JI6 O;  2P22 C;  5LBQ A;  2OYQ A;  4WFG A;  1HNW B;  2EIJ B;  2DCB A;  2PNS A;  3STZ C;  4DR5 B;  1VF5 B;  4TWK A;  4PI0 A;  3OVX A;  2ZE7 A;  2KSD A;  3SYP A;  4LF6 O;  1K5Q A;  3RBZ A;  2HH5 A;  3OR7 C;  2ZT9 B;  4AQY B;  1FAF A;  4G28 B;  2WLL B;  2YSU B;  4BAY A;  1N8R W;  1OCO C;  5LYJ B;  3LUT B;  4KP4 A;  2H94 A;  4IUM A;  4PAD A;  5EBL C;  2UUA O;  1PPJ H;  1D5A A;  3OMN B;  4W4U A;  1W0K G;  1AJP A;  3V6C A;  4B3T B;  1SF9 A;  2IJH A;  4J9Z B;  3S3W A;  3WB1 A;  1Y4M A;  3CWB H;  1PCI A;  3I56 V;  2ZIO A;  3PHX A;  4FLY A;  2G6D A;  3OGI B;  1XHZ A;  2YI8 A;  2JDI G;  4JI3 O;  5KHG A;  2ZM6 O;  1G8M A;  4AXL A;  4IGG A;  1XNQ B;  3K0G A;  3QO5 A;  2JJ1 G;  1I5X A;  1JA8 A;  2KKW A;  3D36 C;  5LL6 Y;  3C3S A;  2EIL B;  4CDC B;  4NYK A;  1YSC A;  1Y74 B;  4N8W A;  5IY5 C;  1SER A;  1QVG U;  4F6R A;  3ZUA A;  2YI9 A;  3A8T A;  4DYL A;  4DR7 B;  3UT5 B;  3H1K H;  5J2T A;  4OEM A;  3H1L H;  1WP7 A;  2LFS A;  1CXZ B;  3BFR A;  4JZG A;  3CD6 V;  1DKI A;  3N3K A;  4O4H A;  2Q67 A;  3BA8 A;  4JAA A;  2WLI A;  2JEX A;  2JVD A;  4MZO A;  3FFQ A;  3JAL A;  4WFE A;  1ZUQ A;  3FKS G;  4LFC O;  1AYW A;  3C3T A;  3UCS C;  2HG5 C;  3OM3 B;  3E22 B;  4X66 B;  4GKJ O;  3DF0 A;  4JI8 O;  4ZHQ B;  3O65 A;  1GAX A;  2RQ6 A;  1AU3 A;  5CB4 B;  4ZKI A;  2AGA A;  4DMX A;  3SPI A;  3VOU A;  2G38 A;  1R3L C;  2XU4 A;  4WCE V;  7PCK A;  2XAF A;  3FAV A;  4D6T H;  3TXQ A;  1X59 A;  2ZXW C;  4RQF A;  4CDE B;  3WXF A;  1KP3 A;  3QF7 A;  1IUR A;  2R70 A;  4MSX A;  4CS3 A;  3RYH A;  3CRM A;  4PP1 A;  1B04 A;  1ZL8 B;  4YJ3 A;  4JI0 O;  1R3K C;  2Y48 A;  1N34 O;  4LF9 O;  1Y67 A;  5LHG A;  3X2Q B;  2FRA A;  1JFF B;  1F23 A;  3E8B A;  3AK1 A;  3ICX A;  4D7S A;  1OCO B;  4BOS A;  1DGS A;  2Q9L A;  4PDR A;  1OV9 A;  3DC5 A;  4HXD B;  4WFA V;  4PA3 A;  1EZJ A;  4JYA B;  1DK1 A;  3JAK B;  2AW9 A;  4QNH B;  2CH7 B;  4N23 A;  2PGG A;  3A0H Z;  1XOU A;  3JD3 A;  4PDM A;  1PBH A;  3SGI A;  2BTW A;  1FJG B;  5FPO A;  1J95 A;  1CVZ A;  3RVX A;  3RVV A;  2A9H A;  3N4C A;  1S5J A;  2A06 H;  3RNV A;  1IBK B;  5HFL A;  2XOK G;  1YVW A;  2NN4 A;  4N79 A;  1R3J C;  2DCA A;  3NR7 A;  3AG4 B;  3ZRX A;  4ZOL A;  1XL6 A;  5CA0 B;  1PV0 A;  3ZN0 A;  4DV5 B;  2LGQ A;  1CTE A;  3N2K A;  3CSX A;  5A2Q N;  5E1A C;  3HKB A;  2HHN A;  3RVW A;  1F2A A;  2B5U A;  1GMY A;  5IYC O;  1K8A W;  4HZ3 A;  1B6Q A;  3ZHR A;  1I0H A;  5KHH A;  3IOQ A;  3U10 A;  2YIB A;  4IYH A;  1BHB A;  2W0X A;  1K73 W;  2AIM A;  1HP8 A;  2LO1 A;  1BGO A;  3A0R A;  2WLL A;  4BIZ A;  1H2N A;  1GH6 A;  2RNB A;  4MTO A;  3PNR A;  1MG1 A;  1OCR C;  4DR1 B;  1FS0 G;  4DR3 O;  1XMO B;  3SJC C;  1RM1 C;  1YXB A;  2EUL A;  3Q4H B;  1VQO V;  5CBF A;  4GKK B;  2GTA A;  1RPO A;  4D8I A;  1CP9 A;  3AEI A;  2OUL A;  2QWN B;  1NQC A;  4O4L B;  2ZXW B;  2P7T C;  1NB5 A;  4ASU G;  3OAA G;  1ZLZ A;  3H8B A;  3ZS8 C;  3HKD A;  3SYQ A;  2CK3 G;  4D7T A;  4E4E A;  3K8U A;  1BMF G;  2F1M A;  2XHB A;  3OTF A;  4MVZ A;  4NTY A;  5KX5 B;  1N33 O;  5CVO B;  5ITZ B;  2ITC C;  2ARH A;  4MTX A;  4RAI A;  2YIB D;  4H37 A;  1MSD A;  1E1Q G;  1LNQ A;  3UO2 A;  3BPM A;  4P6E A;  3UT5 A;  1D2D A;  5EZQ A;  1EM1 A;  3W7W A;  4FIP C;  3CH3 X;  2BTQ B;  3GB7 C;  4X64 O;  4LFA B;  4GX2 A;  2LQT A;  3N27 A;  4JAV A;  5CA1 B;  1A32 A;  1HDJ A;  2DOS A;  3M99 B;  1ZWI C;  2LP7 A;  4DRX B;  1Y08 A;  2NLJ C;  3L9D A;  3RWR D;  1FXV A;  2Q0O C;  3ABT A;  4R6Z A;  1Y6X A;  2FO5 A;  2IJJ A;  2Q0A A;  2OCC C;  3QT4 A;  4YY3 B;  2N04 A;  2DQ3 A;  4JYB A;  4ZHQ A;  4GX1 A;  5CN0 A;  5LXT A;  3L70 H;  1V55 C;  5LHI A;  1OCC C;  4J7Z A;  2Q7H A;  4L87 A;  1KC8 W;  2Q7G A;  1U9V A;  3WFV A;  1KHP A;  5BR8 O;  2AVW A;  3STL C;  3SPG A;  3KX1 A;  1PAD A;  1KEC A;  3ABU A;  3WB0 A;  3KFQ A;  1L0L H;  4X20 B;  3ZHQ A;  2BTO A;  3KCX A;  1FXK A;  4UB8 Z;  4X8A A;  1AIM A;  1N0J A;  3LNM B;  2A79 B;  1J5E O;  1YJW V;  4MVM A;  3K03 A;  1ZSP A;  1FKA O;  2F1G A;  3TNX A;  1JJO A;  1PIP A;  3WG7 B;  3OE7 G;  4B3M O;  3CJH B;  2UXX A;  2QWP B;  2Y0I A;  1ZL8 A;  4DV7 O;  1XI1 A;  2XAG A;  5JH7 B;  3RYF B;  4LBE C;  3NXS A;  3MHS A;  2Q4P A;  3S3Q A;  1S72 V;  1P4R A;  1JFF A;  1NB3 A;  1Y66 A;  2IM9 A;  2JS5 A;  1HNZ B;  3DTU B;  4B3R O;  3O9O A;  3HPL C;  1SQG A;  1RSO A;  2P0R A;  4FM0 A;  1VMG A;  5IJ0 B;  4OX9 B;  4O4I A;  1NR1 A;  3J7A U;  5CVM A;  1ATK A;  3OW2 U;  1WB8 A;  2DYR B;  3QNE A;  1N32 B;  1VQ8 V;  1VF6 C;  2CH7 A;  1YEW A;  2F43 G;  4BW5 A;  2A0L A;  4PP2 E;  3W7T A;  2X6A A;  1TUB A;  3VQV A;  4QJF B;  2DE0 X;  3BC3 A;  1P7G A;  5B1B C;  2Y69 B;  2OWO A;  3FD9 A;  1JPX A;  3GVM A;  4JI7 O;  1HNX B;  3HKC B;  4CC6 A;  4WFH A;  2RCV A;  3R65 A;  4PDV A;  4CS2 A;  3CRR A;  2QDO A;  1RP3 B;  1BP4 A;  5EIB D;  4LF5 B;  1BL8 A;  5E79 Z;  3HKE A;  3B4S A;  4XR7 A;  2PYL A;  4X1K A;  5EBM C;  1VSN A;  3FB6 C;  1NVP B;  2AHZ A;  3ASN C;  4I5S A;  4UV8 A;  1M56 C;  1RPR A;  2EIK B;  3SJQ C;  4ABM A;  2F4V O;  5JZE A;  1E79 G;  5LMN B;  3CC2 V;  3VQX A;  2QWO B;  5IDJ A;  1WNS A;  4MVQ A;  2UXB B;  1KFU L;  5D5P A;  5LOV B;  1VQ7 V;  1ARO P;  1JOY A;  4YIO A;  3B2E E;  2K9P A;  1V55 B;  4O2A B;  4GYC B;  3CME V;  2QWR B;  3K79 A;  1NTK H;  3DC6 A;  4NB5 A;  4TQD A;  4NTX A;  1O0E A;  1MIR A;  6PAD A;  4UCV A;  2CTQ A;  2O57 A;  1Q5O A;  5JA7 A;  1BHA A;  1SA0 B;  1FD9 A;  1CQD A;  4AHC A;  4O4L A;  4G54 A;  1S5L Z;  1SQV H;  2B1G A;  4FJC A;  3AG3 B;  4IHJ B;  4JYY A;  1Z5W A;  1BE3 H;  3LDD A;  1QLN A;  2PAD A;  4FMT A;  2QR4 A;  3ZRW A;  4F6E A;  3PRM A;  3C0R A;  5K1P A;  2GTS A;  1NZ6 A;  4O4J B;  2HHH B;  1HNW O;  1EFR G;  2AYO A;  4MM3 B;  4DR5 O;  4WF9 V;  5ITZ A;  2DJV A;  4HNA A;  4JTA B;  5KHK A;  1SQQ H;  1KKD A;  4TSF G;  4W4L A;  3SJA C;  4EEQ A;  4AXM A;  1JMK C;  3B79 A;  3ABM B;  1NS1 A;  2YID A;  1N36 B;  1MEM A;  2R9N A;  1QR8 A;  2CUG A;  2DWE C;  2V7Q G;  5IJ9 B;  2L6L A;  4FLX A;  2BTQ A;  1WB7 A;  2ATO A;  1V9P A;  5CA1 A;  4K3A A;  4RWU A;  1XNR O;  3H1H H;  3BRC A;  4DRX A;  1QDQ A;  1I7F A;  4DK0 A;  2QEX V;  1VJV A;  1F51 A;  3FB8 C;  3DXR B;  1COW G;  3K3W A;  2ZR3 A;  5H6R A;  3G6E V;  3BB7 A;  2CTP A;  3FB7 C;  4FK5 C;  4B3T O;  4NXN O;  2FRQ A;  2ZE6 A;  4FM1 A;  1MHW A;  3APO A;  5GON A;  1VQ9 V;  1Y4H A;  4H0L B;  1DTO A;  1XNQ O;  3K57 A;  1TAE A;  4JI2 B;  2EIM B;  1U9Q X;  4DXW A;  3JD4 A;  4XDJ A;  3TK1 A;  3TMP A;  1NR7 A;  4HWY A;  3FYE B;  3SYC A;  2WA3 A;  4X20 A;  1POP A;  4UCR A;  4DV6 B;  3G4S V;  5LGT A;  4WUR A;  4DR7 O;  2AUX A;  3GWO A;  2JEU A;  4X65 B;  3AG7 A;  2QM4 A;  1Q6I A;  4F4L A;  4DMY A;  2Q68 A;  4J7K A;  3OR6 C;  5FPR A;  1Q7Y W;  4FFB B;  3CPW U;  4OW0 A;  5IT9 N;  3H8C A;  1Q6H A;  4Z1V A;  3GWK C;  3ZNH A;  4YV8 A;  4P30 A;  4JI4 B;  3ABK C;  3K58 A;  2IH3 C;  4LFB B;  4X66 O;  5KUK A;  5AG2 A;  3ZMZ A;  4CDF B;  4R3D A;  4JTD B;  3B21 A;  2MK3 A;  2YEV A;  2ACT A;  5DN6 G;  3S3X A;  4DUZ B;  1YCI A;  3P32 A;  2OZ2 A;  2QTS A;  5LP6 B;  1YHQ V;  3CCM V;  1V54 B;  1UPG A;  3M8A A;  1TLO A;  1YAL A;  4BQV A;  4W5B A;  4JTC B;  2QKA A;  5B3S C;  1QVF U;  4WA6 A;  4LNU A;  1F29 A;  1H38 A;  1G4Y B;  4LR3 A;  3RW0 A;  1L1F A;  3JSL A;  4BR6 A;  2K1E A;  3OD4 A;  4R50 A;  3RYC A;  5KA6 A;  2Q5Z A;  1KUQ A;  4YYS A;  2ZIN A;  4MT8 A;  4Q8G A;  4MTG A;  2JJ2 G;  3O1G A;  5L3D A;  1MDW A;  3HKC A;  2VHF A;  2IBZ H;  4JGS A;  1IXB A;  4FLW A;  4X62 B;  1G1X B;  3P3P A;  2UU9 B;  2JGD B;  3KG2 A;  4TUY B;  2HD5 A;  2PBH A;  4I9Q A;  1MEG A;  5JCO C;  4X1I B;  3MDS A;  4P2Z A;  4KXR A;  1K4D C;  1UKF A;  3ZIA G;  4RNA A;  2DW4 A;  1PL4 A;  4M0W A;  4BPV A;  4JYA O;  4LWS B;  4H33 A;  2HKO A;  1VAR A;  4UV9 A;  4DV2 O;  1KKC A;  3F5W C;  3JAW B;  4B7K A;  4B3S B;  4WFF A;  3B8N A;  4UXN A;  3KWB X;  4O2A A;  4YYQ A;  4K7C A;  1FJG O;  1SKV A;  1PPN A;  4QRX A;  1BGY H;  3VQW A;  4RO2 A;  5LMU B;  2B1I A;  1GN2 A;  3B40 A;  4GLX A;  1K9M W;  1IBM B;  1SA0 A;  4OPA A;  1CV8 A;  2DC9 A;  1S0V A;  4J9Y B;  1GN4 A;  2A7W A;  3TGU H;  3CH2 X;  2QSA A;  4DV5 O;  5JWP A;  5IYZ B;  5L3G A;  4G2K A;  2QM7 A;  2GV9 A;  1UJW B;  3R66 A;  5KMG B;  3PRP A;  4CH6 A;  1AEC A;  5E6J A;  1NVP D;  1SP4 B;  1MAB G;  2IPP B;  5CHT A;  3ZRS A;  3F7Y C;  5J2U A;  4PA7 A;  3CCL V;  4MVU A;  2YJ8 A;  2QKC A;  4DW1 A;  1PVJ A;  2ADQ B;  4GX5 A;  3H1J H;  4LF6 B;  1YT7 A;  2RDC A;  5LGN A;  2P7U A;  2E76 B;  3BCN A;  1VQN V;  4DR1 O;  5EYP A;  2X6C A;  3ZMU A;  1K33 A;  4JPR A;  4BWA A;  1XMO O;  3K5M A;  2GUZ B;  2XAQ A;  4FM2 A;  1W59 A;  2UUA B;  4UUJ C;  1XEQ A;  4P9O A;  3K0D A;  3MAQ A;  3RT3 C;  2RMK B;  1CB5 A;  1KP2 A;  2KQX A;  5LGU A;  1GO3 F;  1FH0 A;  2R9M A;  1FXH A;  3G71 V;  2WLH A;  2AZ0 A;  1KBH A;  3JAT B;  4JI3 B;  3THO A;  4R7C A;  1IX9 A;  3JAS B;  1K5S A;  1IWD A;  4FVM A;  1H8E G;  4XUI A;  1Q3E A;  4DUY B;  1JX9 A;  1HR0 B;  3U8E A;  4J11 A;  4X88 A;  4I4T B;  3ZMS A;  3BY6 A;  3N2G B;  2XU1 A;  1QR9 A;  3CC4 V;  4K8X A;  2HP8 A;  1PPP A;  4BOU A;  4FFB A;  5CBH A;  4KL1 A;  5JJE B;  9PAP A;  4KUM A;  5IY5 B;  5DEC A;  1ME4 A;  2E3C A;  4LF8 B;  4OVZ B;  4QRG A;  1MZF A;  4MS2 A;  4U3J B;  5EC2 C;  2DC6 A;  2N74 A;  4LF4 B;  3ETD A;  1STF E;  4JI8 B;  3OF8 A;  1K7D A;  1NH2 B;  1K4C C;  3T1C A;  3L75 H;  2GDS A;  4I55 B;  1BQZ A;  3WB2 A;  5A9G A;  4K0K B;  2BU3 A;  5LP6 A;  3QO8 A;  4I50 B;  3OMA B;  1YJN V;  2DZZ A;  5LYJ A;  1NKD A;  4JI1 O;  1AI7 A;  2UZJ A;  2H8P C;  1QU7 A;  1XMQ B;  3U0Z A;  1KFX L;  5KO3 A;  1NT2 B;  3U11 A;  3OEE G;  4TV9 B;  1KMI Z;  5EGW A;  1AIL A;  3JAR B;  4RQE A;  3CXC U;  2XU3 A;  1U96 A;  3RVZ A;  4BOZ A;  2CDY A;  2KG7 B;  1M57 C;  2UXD B;  4WFB V;  4ZBM A;  3LDC A;  3PW3 A;  3TET A;  4XDL A;  1PNL A;  1M1K W;  3WXG A;  3AG2 C;  2WLJ A;  2AUZ A;  1AI5 A;  1N34 B;  1NLJ A;  2VHS A;  2ZQM A;  2H3O A;  4P9P A;  2JGD A;  1HNZ O;  1B06 A;  2M6Y A;  5JH3 A;  2P6J A;  3OUF A;  4TUY A;  1W0J G;  1EBO A;  4JAS A;  3PBH A;  2LW1 A;  3F75 A;  3A0B Z;  4X1I A;  2CGN A;  2OP3 A;  1WN7 A;  1Y74 A;  3H1I H;  4OX9 O;  1LR1 A;  4YHH B;  4UVA A;  3RGB A;  2ZNI A;  1HW7 A;  2P4K A;  4AIL C;  4UFZ A;  3CRA A;  1TVK B;  3K5L A;  1AI4 A;  5C8Y B;  1N32 O;  5F02 A;  1URF A;  3E8G A;  3BAB A;  1ME3 A;  3UKM A;  1IBL B;  1WJZ A;  1XRE A;  5JQG B;  4FZ1 A;  2VWK A;  2Y0P A;  4DV4 B;  1U9X A;  1HWY A;  4Q20 A;  3TCU A;  5EZY B;  3CCJ V;  4A5U B;  2GHY A;  3BY4 A;  1FFX B;  2AZ2 A;  2QKS A;  4I9W A;  2OTJ V;  2NR5 A;  3OVZ A;  3E22 A;  4U7N A;  2DYS C;  1AYU A;  1GTO A;  1T5E A;  1VQ5 V;  4DO2 A;  1K92 A;  1HNX O;  3AI8 A;  4X6J A;  2UUC B;  3KSE A;  3P5X A;  3RYI B;  2XAS A;  5EF4 A;  4C7U A;  5BMV B;  4G27 B;  4WBN B;  3CCU V;  5CB4 A;  2FML A;  3E2E A;  1SNK A;  1L8D A;  3UO3 A;  4LP8 A;  4W5C A;  4GX0 A;  1YIJ V;  4FZ0 A;  5IYZ A;  5B1N A;  4REZ A;  3SYA A;  1WPX A;  3K9A A;  5KMG A;  1GM9 A;  2J7Q A;  8PCH A;  4PI3 A;  1DF5 A;  1TGO A;  5B1A C;  4ZTB A;  1WP8 A;  3RN4 A;  4YYR A;  1M5I A;  3W7X A;  5IWA B;  1VIB A;  2FTD A;  2UXB O;  2ZDI A;  2DN9 A;  3JCU Z;  5B5E Z;  4DV1 B;  1YDX A;  4YIP A;  1KYO F;  2RN9 A;  4YYV A;  2DCD A;  2C2A A;  1KU9 A;  1GK9 A;  5EK0 A;  4KHP B;  4CH3 A;  2EX3 A;  3ASO C;  2WLK A;  1QNM A;  4DR3 B;  1R73 A;  4BS5 A;  5CMU A;  4OEL A;  1SS3 A;  3E9S A;  3MJ5 A;  1BSM A;  1P7B A;  4BIU A;  1BQI A;  1OCR B;  5F2V O;  1SZT A;  4BIO A;  2YXY A;  1LUW A;  1RM1 B;  4BOP A;  1XL4 A;  1K3B B;  2QWQ B;  4J80 A;  1JVM A;  2QGN A;  2D2C B;  1H2L A;  1M57 B;  3JAK A;  3CCE V;  3T2M A;  1KQS U;  4MSW C;  1SES A;  3CCQ V;  5J9P C;  1ZCM A;  2A3Q A;  1SQP H;  1A6R A;  1PXV A;  3HB3 B;  4ZI7 B;  2NQG A;  2QE7 G;  3AG2 B;  1PKX A;  3OTO B;  5CA3 A;  4I4T A;  1PM9 A;  2HVK C;  4PA6 A;  2VQF B;  1GLO A;  1N36 O;  1QOL A;  2AXT Z;  2YIA A;  3N2G A;  2BOB C;  5EC1 C;  1GN3 A;  2HVJ C;  3LNN A;  3B77 A;  3D36 A;  1WAZ A;  2ATK C;  4I07 A;  3BBA A;  2UXC B;  2R9R B;  3CX5 F;  2EIN C;  3IMA A;  1I5Y A;  3KZI Z;  3E35 A;  2DZY A;  3CB2 A;  4TOI A;  5CA0 A;  2YUA A;  3IC9 A;  5FPW A;  3BA9 A;  4YYU A;  4U3J A;  2FUD A;  2VQE O;  4B7E A;  3SDL A;  5C93 A;  1WA8 B;  1FPO A;  3MD0 A;  1AR4 A;  4I55 A;  5GW7 A;  3FYI B;  2PF4 E;  2GSM B;  4JI2 O;  2OCC B;  1XHX A;  4PDL A;  3EVK A;  3J80 N;  2Z0A A;  1QMY A;  4I50 A;  3DSQ A;  4CS4 A;  1OJH A;  2E02 A;  4EKW A;  2JQF R;  2WLM A;  2DC8 A;  4DV6 O;  1OCC B;  2F23 A;  1MSW D;  1AP6 A;  1EF7 A;  4F6R B;  3M7M X;  1OCZ C;  4X65 O;  3C9E A;  3OQC A;  4IT5 A;  1H2M A;  1U5I A;  3Q4H A;  3JAR A;  4O4H B;  4JI4 O;  3JCZ A;  3QVN A;  1AU4 A;  2F7D A;  3CHX A;  4Z1M G;  2Q6A A;  2EIJ C;  3JAL B;  4IYI A;  3N3G A;  1MS6 A;  2BE3 A;  3F5T A;  2VRZ A;  5GTH Z;  5KHJ A;  1Z5V A;  1NH2 D;  3CXH F;  2IBI A;  3ABL C;  3PJS K;  5KX5 A;  1ZIV A;  4DUZ O;  5TIS Z;  4MVS A;  4GZR B;  2H7J A;  3IUT A;  3ML0 A;  3JAM N;  4AQY O;  1YJ9 V;  2NQD B;  5KAF Z;  1TVK A;  3A2F A;  2E00 A;  2YJB A;  4KLB A;  5C8Y A;  2NQI A;  4X6I A;  4I04 A;  2AHY A;  2WBF X;  3M99 A;  1O9H A;  1DF4 A;  1EWO A;  4LF7 B;  5EZY A;  4A5U A;  1FFX A;  1O9G A;  3ZMT A;  3APQ A;  3ZHU A;  2W6I G;  2UXN A;  3I5D A;  1M93 A;  2BDZ A;  1DLB A;  4W4K A;  1JQ0 A;  3ZBH A;  5L3B A;  3ZCC A;  4MTF A;  4DK1 A;  1R3I C;  4KFM A;  2VWJ A;  1GRJ A;  3BVO A;  2LGW A;  4YJ3 B;  2JRI A;  2Y5B A;  1SET A;  1EN6 A;  1H8H G;  1CEZ A;  1QXP A;  4LCU C;  5BMV A;  4WBN A;  3H89 A;  2Y6E A;  4X62 O;  4JV5 B;  5J94 A;  1PNK A;  1NQT A;  5B1B B;  2EZP A;  4CH4 A;  2B9Z A;  4OXS A;  5BZB A;  3CP1 A;  1S5H C;  1TA8 A;  2AYN A;  2XAH A;  3ZJZ A;  4FFK A;  2EIN B;  3JD2 A;  2R9A A;  3RFR A;  1KB9 F;  4DR4 B;  3VBB A;  4DV3 B;  2ETN A;  4PV1 B;  2F4V B;  2R9I A;  1X9Y A;  1H2K A;  1M4U A;  4B3S O;  2P5O A;  4OPH A;  2OCH A;  2OIE A;  3WU2 Z;  3P30 A;  3CJH A;  1AU0 A;  3ASN B;  1M56 B;  3PHU A;  3ZHV A;  2BTW B;  1Q43 A;  3O0U A;  4TQF A;  5JH7 A;  3CRC A;  3RYF A;  4NVP A;  5LMU O;  3QTC A;  4J7J A;  1CPJ A;  1CSB B;  4JYC A;  4HAM A;  3B09 A;  3CYO A;  2CIO A;  2IJI A;  2X6B A;  1OHH G;  2QA4 V;  2R9F A;  1FXK C;  4DR6 B;  1PPO A;  2CAZ C;  4RKX A;  1GEC E;  3W30 A;  5KAI Z;  5CBG A;  5IJ0 A;  3IEJ A;  2D3O W;  3N2K B;  2UUB B;  3EFF K;  3UM7 A;  1M6D A;  1QBZ A;  3E8F A;  2Y4U A;  3EHB B;  2E5L B;  1VQM V;  1MZE A;  4D8B A;  1NBM G;  3ZED A;  1XKG A;  1NTZ H;  5L3F A;  4UCT A;  4JZ2 A;  4ZI7 A;  4NXM B;  3PT2 A;  3BEH A;  3T1Y B;  2HXZ A;  4QPK A;  3MHS C;  3OMI B;  3X2Q C;  1P84 F;  4TV8 B;  5EIB C;  3ABL B;  2GFO A;  3E83 A;  1Q6U A;  3T1H B;  4YYW A;  1YK8 A;  4EB6 B;  4JI5 B;  1XNR B;  3QO7 A;  4RF0 A;  4BSQ A;  1I94 B;  2B1M A;  2ZD9 A;  3L71 H;  3J81 N;  4FIP A;  1KD1 W;  2G8E A;  2PRE A;  4IP3 A;  2P06 A;  4NXN B;  2JQG R;  1YTF B;  1THE A;  1PNM A;  2X7R B;  3HHI A;  2ARY A;  1WA8 A;  4FLZ A;  3T4Z A;  4NKG B;  2JTC A;  1AR1 B;  3BPZ A;  3HKD B;  3GCB A;  1BQ0 A;  2YIC A;  1GM7 A;  4LH7 A;  1NPZ A;  4N21 A;  5H9C A;  2ZCE A;  3H6S A;  1AVM A;  4FPP A;  1ENV A;  2FT2 A;  4PJ0 Z;  5LOV A;  4DUY O;  1Z2G A;  2JK5 C;  3W7U A;  1HR0 O;  4DV0 B;  3IFX A;  2Z84 A;  4UB6 Z;  3TRK A;  2P4V A;  3H9V A;  3AG4 C;  5LHH A;  1YVB A;  2B1N A;  2KB1 A;  4PEL A;  3P5W A;  1IBK O;  4X6H A;  2XUM A;  2GHU A;  4O2B B;  2WA4 A;  3KCY A;  4K35 A;  3F7V C;  1NL6 A;  4DR2 B;  2OIG A;  1YF2 A;  4LF8 O;  1AI6 A;  4IHJ A;  1AJN A;  1ZTE A;  2CTR A;  4LF4 O;  4I7Z B;  2W6J G;  2ODM A;  3CCV V;  1CJL A;  5B66 Z;  3E89 A;  3SPC A;  4O4J A;  1SRY A;  3ZN1 A;  4JI6 B;  3ZMV A;  3ABK B;  5LXT B;  4CDD B;  1EWL A;  5H5N A;  3JSN A;  3PN1 A;  1QCE A;  1K97 A;  1N0N A;  2CE4 A;  5HFM A;  2WWW A;  4K0K O;  3SJB C;  4YXW G;  2Q69 A;  4PD4 F;  2DCC A;  2AU1 A;  5EZS A;  1JJ2 U;  2Q73 A;  5DED A;  5IJ9 A;  2C0Y A;  3ZHT A;  2R6N A;  1FXK B;  3OFN G;  2G7Y A;  4QE7 A;  4N4Z A;  1XMQ O;  3D6S A;  1VQP V;  4FJC C;  3DXR A;  4GKK O;  1EZV H;  1UFI A;  3K24 A;  4P16 A;  1G6U A;  2FYU H;  2UXD O;  1IDS A;  3JD0 A;  1VF6 A;  5B3S B;  5L3C A;  4HBN A;  2M7W A;  5KUM A;  1GCB A;  4IL6 Z;  1Q81 W;  4MVO A;  1IVS A;  2QJ1 A;  2EJR A;  3G67 A;  2NQA A;  2L35 A;  2ZM6 B;  4I05 A;  1L0N H;  4UCU A;  4XDK A;  4BW9 A;  5CVN B;  4D8E A;  1AU2 A;  4JAU A;  2XTA A;  4RUE A;  1CPY A;  1RSO B;  3JYC A;  3QJ3 A;  1PD3 A;  1XBL A;  1OZ0 A;  4YHH O;  3LSS A;  2JIZ G;  3K08 A;  1F2B A;  1PL0 A;  4O4I B;  2PTM A;  1VQ6 V;  1XQ8 A;  4LFA O;  2HLD G;  4PHZ A;  1IBL O;  1VEW A;  3OUS A;  4DV4 O;  1Q82 W;  2EJ7 A;  5KHI A;  4DV2 B;  4AI8 A;  1F4M A;  3F5V A;  3OGC C;  4RY2 A;  1XUQ A;  3G6B A;  1R6T A;  4LFC B;  1TUB B;  4GCZ A;  4YY3 O;  5BXZ A;  2IW5 A;  4Q6G A;  4X1Y B;  4GKJ B;  3ZHS A;  1Y76 B;  5KA5 A;  4CZW A;  2Q8V A;  2G8J A;  1NU1 H;  4QRV A;  2LFR A;  2UUC O;  3W7S A;  1U97 A;  5H2F Z;  4QIW F;  3MP2 A;  2YS8 A;  2BOC C;  4BOQ A;  2W0F C;  3KKU A;  3HKE B;  3G80 A;  4QPJ A;  2E74 B;  4MZS A;  2YJ9 A;  4X1K B;  5BY1 A;  5KLV H;  4Z2W A;  3L72 H;  3EXA A;  3WG7 C;  5D5Q A;  3PDF A;  1S76 D;  3T4D A;  3CBK A;  2PYJ A;  3AK2 A;  3WXE A;  2IJK A;  1R1B A;  1AR5 A;  5L3E A;  5IWA O;  3LFY A;  2ADP A;  3SPJ A;  4DV1 O;  2ITD C;  1Q86 W;  2HEP A;  3OT7 A;  2HJF C;  2RJZ A;  2FKX A;  4TV8 A;  1N4C A;  1YZB A;  3BHP A;  2V4D A;  4R8C A;  1QQC A;  4EB6 A;  4JI0 B;  4KHP O;  2BCC H;  3ERV A;  2ZE8 A;  1TL9 A;  2FTK A;  4LF9 B;  3BCC H;  4MW8 A;  3L73 H;  1P49 A;  2EZO A;  1JR9 A;  1MMM A;  3IAY A;  2DYR C;  5LA6 B;  3K5N A;  3IGA C;  1M90 W;  2PUS A;  5JJN B;  4XZX A;  2HJD A;  3OIS A;  1S3J A;  1SQB H;  2YXH A;  2R9C A;  4BS6 A;  4LWS A;  1NI8 A;  4GUN A;  2ZIM A;  3ZRW B;  1BY8 A;  3NHE A;  4FK5 A;  2V1D A;  4X9Q A;  3E1Z B;  5FNV B;  1VQ4 V;  1S77 D;  3AG1 C;  3JAW A;  2Y69 C;  1SQF A;  2MW2 B;  3QG5 A;  2NNU A;  4FLV A;  4XBF A;  4HNA B;  3E8H A;  3IV2 A;  1FFT B;  3OTO O;  5IYB O;  4FLT A;  2FYE A;  2YJC A;  2VQF O;  4UCS A;  1WPB A;  3CCR V;  3K06 A;  4LH6 A;  2AS8 A;  4NTW A;  4MVR A;  3AK3 A;  2HWK A;  1BT8 A;  4O2B A;  2UXC O;  5PAD A;  3CEI A;  1D5N A;  2ZE5 A;  2BDL A;  4QBB A;  3B8M A;  3K9M A;  5JJJ B;  1QLE C;  4MW3 A;  4CH5 A;  4B08 A;  4PA4 A;  3MHH A;  2FB5 A;  2EIK C;  5IYD O;  4LF5 O;  2Z3Y A;  2XT9 A;  1ORQ C;  2IU0 A;  2DQ0 A;  2CTW A;  2BSK B;  2P90 A;  2IU3 A;  2E03 A;  5FL7 G;  2YXL A;  3IFU A;  4UVC A;  4YVA A;  1YTF D;  4QE9 A;  4RF1 A;  2PZS A;  5GON B;  4I0X B;  5LMN O;  1JQP A;  5JVD B;  3KW9 A;  1W2B U;  3ZX6 A;  2ZKO A;  1CS8 A;  2CGO A;  1SC5 B;  3RVY A;  1AP5 A; 
#chains in the Genus database with same CATH homology
 4BOP A;  1HNZ O;  4JI7 O;  4B3T O;  4DUZ O;  3BB7 A;  3RNV A;  1R1B A;  4NXN O;  1G1X B;  4D8B A;  5IWA O;  5EZS A;  1AB3 A;  3JAM N;  4AQY O;  5FLX N;  4LFC O;  4DV1 O;  1IBM O;  4OX9 O;  4GKJ O;  4LFB O;  3PT2 A;  2FKX A;  1XMQ O;  4JI8 O;  1UKF A;  1XNQ O;  1YZB A;  2J7Q C;  3O65 A;  4DR2 O;  4RNA A;  1N32 O;  4GKK O;  4KHP O;  4M0W A;  4JYA O;  4P16 A;  1N36 O;  3TMP A;  5A2Q N;  2UXD O;  4A5U A;  5BR8 O;  4DV2 O;  2F4V O;  2AGA A;  5JZE A;  4A5U B;  3BY4 A;  3BBA A;  4DR6 O;  4RF0 A;  4JI6 O;  4WUR A;  4DR7 O;  3W31 A;  4LFA O;  4PT5 A;  1FYJ A;  4BOU A;  2HHH O;  3J81 N;  3MTV A;  2UUB O;  2JRI A;  4IP3 A;  1FJG O;  1J5E O;  4OW0 A;  4XZX A;  5IT9 N;  1HNX O;  2E5L O;  1X59 A;  4D8E A;  4LF6 O;  4X62 O;  3ZNH A;  1FKA O;  2VQE O;  2JTC A;  4OVZ B;  2LW7 A;  3SDL A;  2N74 A;  4B3M O;  3PHW A;  4NXM O;  4X66 O;  4DR3 O;  3T1Y O;  4OPA A;  4YHH O;  4DV7 O;  4R3D A;  3OTO O;  4DV5 O;  4JI2 O;  4IUM A;  4DUY O;  4REZ A;  4D8I A;  3B21 A;  4JI0 O;  3J80 N;  2VQF O;  2Z0A A;  1F7Y A;  1HR0 O;  2UUA O;  4LF7 O;  3T1H O;  1IBL O;  2J7Q A;  1N34 O;  4DV4 O;  2Z84 A;  3R66 A;  4LF9 O;  3TRK A;  2BU3 A;  3PRP A;  4ZTB A;  4JI5 O;  4OVZ A;  2HWK A;  4DV6 O;  4B3S O;  2UXC O;  5E6J A;  4OPH A;  1IBK O;  4GUA A;  1I94 O;  4B3R O;  3C0R A;  3PRM A;  1R6T A;  2UXB O;  1HNW O;  2UU9 O;  4YY3 O;  4X65 O;  4MM3 B;  4DR5 O;  3PHX A;  5BXZ A;  3M8A A;  4BOS A;  3OQC A;  4JI1 O;  2DJV A;  2UZJ A;  3PHU A;  2BTW B;  4JI3 O;  2ZM6 O;  1PVJ A;  4MI7 A;  3J7A U;  4LF5 O;  5KO3 A;  4HXD B;  1N33 O;  5LMU O;  4JV5 O;  2UUC O;  4JI4 O;  4LF8 O;  1AIL A;  4DR1 O;  1NS1 A;  3IFU A;  5LL6 Y;  1DK1 A;  4BOZ A;  4LF4 O;  4RF1 A;  3MP2 A;  1XMO O;  1D2D A;  5EZQ A;  1KUQ A;  3F5T A;  3E9S A;  3PSE A;  4BOQ A;  3MJ5 A;  4DR4 O;  5LMN O;  1XNR O;  4RKX A;  4X64 O;  3W30 A;  5H5N A;  1XEQ A;  5BY1 A;  1A32 A;  4DV3 O;  2DOS A;  4DV0 O;  2ZKO A;  2BTW A;  1DKI A;  3RT3 C;  2FE8 A;  4K0K O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...