2DOSA

Structural basis for the recognition of lys48-linked polyubiquitin chain by the josephin domain of ataxin-3, a putative deubiquitinating enzyme
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
b'MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ataxin-3
publication title Mode of substrate recognition by the Josephin domain of ataxin-3, which has an endo-type deubiquitinase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 37
structure length 171
sequence length 171
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2dosA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2dosA01
4AQYO 1YZBA 2F4VO 1N33O 4B3RO 2Z0AA 1FYJA 4JI6O 4JI2O 4DUZO 4X64O 4YY3O 4X62O 4JYAO 4DV3O 1N34O 4LF7O 1AB3A 2ZM6O 2DJVA 4DR2O 1IBLO 2VQFO 4X65O 4YHHO 1X59A 2HHHO 1HR0O 4JI3O 4NXNO 2UUAO 2FKXA 5A2QN 1IBMO 2UXBO 4B3SO 5IWAO 2VQEO 5LMNO 1HNZO 2UXDO 4LFBO 2UUBO 1G1XB 2UU9O 4DV1O 2UUCO 4NXMO 1XEQA 5IT9N 4DV5O 3J80N 3J7AU 2ZKOA 4DV2O 2UXCO 2E5LO 4DV7O 4DR3O 1D2DA 1N32O 1J5EO 3M8AA 1R1BA 1A32A 3J81N 3R66A 4DR6O 5BY1A 3JAMN 1HNWO 3OTOO 5BR8O 4JI1O 1I94O 4KHPO 4DV6O 4LF9O 4LFAO 1AILA 4LF5O 4K0KO 4DR5O 2N74A 5LMUO 4B3TO 4JI0O 4LFCO 4JI4O 1XMQO 4LF4O 4JI7O 1IBKO 5BXZA 4OPHA 1N36O 4LF8O 4DV4O 2LW7A 4DV0O 4GKJO 4JV5O 3T1YO 4LF6O 4A5UB 3F5TA 1XNRO 4OX9O 3SDLA 1KUQA 3O65A 1HNXO 1R6TA 4DR7O 1NS1A 1FJGO 4JI8O 4JI5O 2AGAA 5LL6Y 5H5NA 5FLXN 4OPAA 1XMOO 1DK1A 1FKAO 4B3MO 1XNQO 2JRIA 4DUYO 4DR4O 4X66O 3RT3C 2DOSA 1F7YA 3T1HO 4DR1O 4GKKO
chains in the Genus database with same CATH superfamily
2DC7A 2NNUA 3GWOA 2VWJA 1I0HA 2ITCC 5CBFA 4AXLA 1E79G 1Q43A 3ETQA 4JI6O 1OCOC 2B9ZA 1PV0A 4DV4B 2DC8A 2PTMA 4NR1A 1H2GA 5IY5C 1N34O 1YJNV 2YDEA 3AG2C 1LR1A 4CH5A 4YV8A 3KFQA 2DJVA 3K5OA 2EILB 2QJ1A 4X65O 2OULA 3H8BA 1RPRA 4LF9B 2GHUA 4I9WA 1MS6A 3Q4HA 5A2QN 5B5EZ 3B77A 4JI8B 4JI5B 4O4IB 1NZ6A 3H1KH 3U10A 2YC0A 1TA8A 1PPOA 2DZYA 1IURA 3DF0A 3A8TA 2QWOB 1GECE 2RJZA 2V4DA 4JV5B 3CCSV 3CRMA 1GTOA 1FD9A 2Q0AA 1PL4A 3SJAC 1GLOA 1A32A 3FB6C 3IC9A 2K1EA 5KX5B 1Q82W 4N21A 4JI1O 5LBQA 4N4ZA 1OZ0A 5GONA 4LF9O 1OCZC 1GCBA 4IL6Z 2CTPA 1N8RW 1NU1H 4JI4O 1NTKH 3OGCC 4BOSA 4X6HA 4I05A 1AU3A 1SQFA 2A0LA 3K9MA 2OCHA 2OCCC 3JALB 4JV5O 1J95A 3SGIA 1K5SA 2XUMA 2E02A 4DR3B 1IBLB 3CH3X 1ZL8A 1ZSPA 3K58A 1MDWA 3EVKA 4YYSA 4BPVA 1HW7A 1FXKC 4Q6GA 3CE2A 4R7CA 4L8JA 2FMLA 2QKAA 3ZCCA 1VMGA 3K3WA 3CCMV 2NN4A 3ABTA 5L3DA 1DK1A 2FT2A 2G8EA 4RQEA 4DR1O 4GYCB 3EXAA 3JCUZ 4TT3G 3ERVA 1SQVH 4NB5A 2CH7A 4DV5B 3QNEA 4PV1B 4HZ3A 3I5DA 5KAFZ 2YUAA 2OZ2A 3IV2A 1QCEA 1FAFA 1BQIA 1XUQA 1BP4A 2JGDB 4PI0A 2QA4V 3JASB 2DC6A 4BWAA 1HNWB 1UJWB 3K24A 3CH2X 1OCOB 5JVDA 1POPA 4QIWF 1IBLO 3OAAG 4KHPB 2P86A 5IY5B 3AG2B 1OHHG 1JQPA 3O9OA 5C93A 1Q81W 3PRMA 1XMQB 4JTDB 1NB3A 4I0XA 4P6EA 2XAGA 1AR1B 3TXSA 2FE8A 5JA7A 2YIAA 2A3QA 3D36C 4YYVA 4DV5O 4P2ZA 2QM8A 2XOKG 3JATA 4DUZB 3ICXA 1U9WA 1VARA 2A7WA 2EINB 3VQVA 3AG3C 5KMGA 2MK3A 1T5EA 3R66A 1PVJA 3SYPA 1GN6A 2E75B 2WWWA 1HNWO 2E00A 2ZR3A 2QEXV 2OTJV 2GBOA 3OW2U 1N0JA 2WLJA 3F7YC 4KHPO 2AZ0A 4NXNB 3L71H 3B21A 1S0VA 4FLZA 1U9QX 1XMQO 4H33A 2N05A 5J94A 1AROP 1OCZB 5EC2C 3NXSA 4OW0A 4WFFA 4TQFA 2EIMC 3MAQA 4PHZA 3SPIA 2A06H 1MHWA 4D8IA 3LSQA 3L74H 2OCCB 4X89A 3LNNA 2EJRA 3KKYA 2JK5C 3OTOB 1K4CC 2WLKA 5E1AC 1VSNA 4QGPA 4B3MO 4FVMA 3T4DA 2YI8A 1K4DC 1X9YA 5CHVA 3RGBA 3MTNA 1WP7A 4LBEC 1KU9A 4WBNB 1S5LZ 5KX5A 4LF4B 1KD1W 1DEUA 2ZE5A 2GDSA 2AHYA 1JJOA 5K16A 3L73H 1SC5B 1D5NA 2VRZA 4XR7A 4J10A 2OP3A 4I5SA 4LP8A 1THZA 4CH4A 5CVOB 5JCOC 1AR5A 2GV9A 2VS0A 1CP9A 4LR3A 4PD4F 1EZJA 3APOA 3USVA 1AI6A 2Q7GA 4O2AA 2FB5A 3RVVA 2NLJC 1PKXA 3ZN1A 4XUIA 3IHPA 1XHZA 1M5IA 3P3NA 3A0BZ 4J7ZA 2CIOA 5IT9N 2G7YA 3T1YB 3ASNB 2JEUA 3KCYA 3W30A 4FJCA 4F6RB 3QTCA 1Q6UA 1BHAA 1R1BA 4DRXB 2PF4E 3IGAC 1DF0A 2DCBA 1YVWA 4JAAA 1VJVA 3IFUA 2LO1A 1XL4A 3CRRA 5TISZ 5KLVH 3WB2A 1X4TA 3OQCA 5CA0B 3AG3B 1IZ3A 2JGDA 5KHKA 3JASA 4DXWA 4LF5O 1YT7A 3UT5B 2Y6EA 1L0NH 1QQCA 1VF7A 3KCXA 4PDVA 1SKVA 1WJZA 1WLEA 3UCSC 4BS5A 3T1YO 5IE9A 2P4VA 3P5WA 1KUQA 1ZX3A 1N32B 4K7CA 4MW3A 5GTIZ 3A0HZ 1I5YA 4FM2A 4UB6Z 2UUAB 4PDLA 1KP2A 1KECA 3TJTA 5EF4A 2EIMB 2EIJC 3CJHB 2DQ3A 1FFTB 4CDFB 3CSXA 2VWKA 3RYHA 6PADA 3K8UA 1Z5WA 3ASOC 4LFAB 4UCOA 1KBHA 1JA8A 1K34A 4I55A 3BC3A 1LUVA 4CBCA 2DE0X 2CGNA 1FYJA 3C0RA 5KUMA 1ITOA 3A2FA 1BSMA 4I9QA 1G4YB 4B7KA 1VEWA 5FNVB 5BMVA 1AYVA 4PI2A 1RM1C 4ASUG 3JAWB 1M57C 4F4LA 5JH7B 1AU4A 1FFXB 1AJQA 1JR9A 5LGUA 1P49A 3G71V 3IAYA 4YHHO 4O4HB 4YJ3B 3SYCA 2UUAO 4UV9A 5L3GA 3DC5A 2AU1A 1GKFA 1ATKA 1KFUL 2CE4A 5IYCO 2UXDO 3RVXA 4ZTBA 4MVMA 3ZMVA 4AQYB 3QVNA 1PNKA 2HLDG 2UUCO 1XEQA 4BIZA 4BS6A 3J80N 3GB7C 3N4CA 4W4LA 3OISA 3LSUA 2IM9A 1FH0A 3I3TA 1WPBA 5JWPA 4NYKA 2GUZB 4YYQA 4FFBA 3B40A 1HWYA 3AG7A 3E86A 4EB6B 4JI3B 2IJHA 2YIDA 4I4TB 5JJJB 4PT5A 3H01A 1CV8A 1AILA 4K0KO 3JD3A 2BE3A 4JI0O 4B3RB 1SZXA 3UO3A 4P9PA 4LCUC 4UVAA 4X1KB 2BU3A 5CBHA 2JQGR 5FPWA 1AR4A 2FRAA 3FB8C 4G54A 5AG2A 1KHPA 1CPYA 4TUYA 5F02A 4JPRA 2UXNA 3SDLA 2ZE6A 1H8HG 2R9NA 2XT9A 3SPHA 1R6TA 5B1NA 5FPRA 5IWAB 2Y48A 2AUXA 3AK3A 1EWMA 2NR5A 1QOLA 4PJ0Z 3AK2A 4DRXA 1YZBA 1R3IC 2P67A 3JARA 1F23A 3Q4HB 5L3FA 3CS5A 2EIJB 3WFVA 4QBBA 4B3RO 5A9GA 4X20B 3MP2A 4QNHB 1M4UA 2E76B 1CTEA 3ASOB 2M6YA 3CMEV 1V55C 3OVZA 3TGUH 1MEMA 4YJ2B 4BAYA 2X0LA 3UT5A 3U0ZA 1ENVA 4FZ1A 2XAHA 1QMYA 1PP9H 3BPMA 2Y0IA 4W4UA 1X59A 5LYJA 4DR7B 3BWKA 3K08A 1WB7A 2FL4A 4FM0A 1RM1B 3CCLV 5B1OA 4G2KA 1XOUA 1M57B 1WP8A 2WA3A 2Q67A 5IWAO 4DK0A 1XMOB 2XNDG 3T1HB 4UCSA 3HKDB 5LGTA 1VF6C 2BSKB 1QBZA 3UO2A 3CJHA 4PI3A 4XDLA 1GMGA 3THOA 2ZKOA 2E5LO 1H2KA 1D2DA 1WN7A 4IYHA 1M56B 4BOQA 4LF7B 1FJGB 2ZM6B 3GWKC 1R3JC 1Q5OA 1ROPA 3AG1C 4FK5A 1JJ2U 2CGOA 3ZHVA 4RY2A 1ZL8B 3FB7C 1RFYA 1YF2A 1VP7A 5FNVA 1YTFD 2YS8A 4X9QA 4X6JA 4FLXA 4IUMA 4JI2B 5JH7A 1D5AA 4YJ3A 2J7QA 4CDDB 1AI7A 5EZYA 1XI1A 2CH7B 4BSQA 1DLBA 3GVMA 3ZRWB 3K0GA 4UVCA 2XAFA 1B6QA 3BBAA 4FZ0A 4JYCA 4J80A 2DC9A 2OIGA 1Q3EA 2JGUA 3N2KB 1HNXO 5E79Z 3QJ3A 1QLEC 1BGOA 4I04A 1FJGO 3DC6A 3EHBB 3WB0A 3E35A 2XASA 1B06A 3BA9A 5JVDB 4CH3A 3H1HH 4H37A 3ZS8C 2KB1A 2LGQA 2ZT9B 1F7YA 2VHSA 1F2AA 1MZFA 3K04A 2XTAA 1K8AW 1B04A 3IMAA 4OEMA 4OXSA 4JI2O 1KKDA 4FJCC 4I0XB 4YXWG 3B09A 1ZLZA 2V1DA 2Q4PA 2OTLV 1Y74A 2UZJA 1FPOA 3O0UA 4ZOLB 4WFAV 2CB5A 3LDEA 5B1BC 4MVZA 5LA6B 3JATB 4D6TH 3OMNB 2YXHA 3CP1A 1KC8W 2WAMA 4MTGA 1TL9A 4PA4A 1K3BB 1V55B 1SERA 3W7TA 3F7VC 5CVMA 1VQKV 3UKMA 1LUWA 4DYLA 4GX5A 2AHZA 1NJIW 1QXPA 1R73A 4HWYA 2ZNIA 2F4VB 3STLC 2CUGA 1XQ8A 4DO2A 3J7AU 4C7UA 3E9SA 4DV3B 2GTSA 3FAVA 3OTFA 3ZHTA 4QJFB 3K06A 2QR4A 4X20A 3H1IH 4ZKIA 1XNQB 1HR0B 3LDCA 2EINC 3CPWU 4BIUA 3LNMB 1TVKB 1GN4A 2A79B 4PDRA 1ZIVA 3S3RA 3P30A 5EIBD 2AYOA 1Q6KA 5CB4B 3WG7B 4YJ2A 3ABKC 3AG1B 4TQDA 3AG4C 1K7DA 1V54C 2H8PC 1BY8A 2UU9B 4DV4O 2NQGA 2YSUB 3WXFA 4A5UB 2DJFB 1H8EG 4PA9A 4M0WA 3NHEA 1O0EA 2BTQA 3CYOA 2D2CB 2A9HA 3OT7A 3O65A 3HKDA 3CXCU 2BSKA 3DXRA 2FQ9A 2DWDC 3G6BA 1S3JA 4RUFA 3K5NA 2VQEB 2OYQA 4JI5O 4JI8O 1YITV 1PCIA 1U96A 2B1NA 1XNQO 1VIBA 5KHIA 3S3XA 4QRVA 4GUAA 1QLEB 5KA5A 2LJ2A 1L1FA 1E1RG 1B3QA 4HNAB 1Q8IA 2IH3C 2JS5A 2ZCEA 1NTZH 2UXCB 4JTCB 4O2AB 2BOBC 3BAAA 3OMIB 4MVUA 1M6DA 4QRGA 4PA7A 3TK1A 3CRQA 4JTAB 2IPPB 2N04A 2DW4A 2QM7A 4ICGA 2F93B 4B3TB 1MABG 5B1BB 2VQEO 1HP8A 4BOPA 2QKSA 1HDJA 1TLOA 3TCUA 3ZRWA 2FUDA 4WA6A 3N2KA 1TUBB 1QR9A 1JFFB 2R9IA 3C3SA 2F43G 3MHHA 2UXCO 2F1GA 2JJ2G 4DR3O 4J7JA 2ACTA 3E83A 3QO5A 1GN3A 3H8CA 1K3EA 3JAMN 2X6BA 3MTVA 3KZIZ 4BOZA 3D3IA 3JD1A 3ASNC 3RYCA 2F95B 1S77D 2FRQA 3AI8A 4DUYB 4XDJA 3CB2A 1DF5A 3MORA 4KL1A 4ZI7B 3ETDA 4IIJA 4ZOLA 5KUKA 4B3TO 4CDCB 3H9VA 5LMNB 2R9OA 5LA6A 1PPJH 1AU0A 3RYHB 2UUBB 1Y08A 2PI4A 1DGSA 2LW7A 3ZIAG 3TETA 3ABKB 4I55B 3AG4B 1BZKA 2HVKC 1V54B 5B3SC 2E74B 3F5VA 2HHNA 4YYRA 1BCCH 2YXLA 1VQ8V 4U7NA 3RW0A 5BMVB 1IBMB 2ZIOA 3ZRXA 3IOQA 3D6SA 3OEHG 1MEGA 3HR0A 1AI5A 4GLXA 4ZIBA 3BY4A 3QSDA 2PZSA 3RVYA 4DUYO 1YJWV 1VF6A 4NXMB 2ETNA 3G4SV 3X2QC 3HPLC 4JYBA 3CBKA 4PA3A 2AZ2A 4DUZO 1NH2B 1N36B 4B7EA 4FLYA 3MHSA 3E22B 3F75A 1COWG 4FIPC 1TVKA 1XDCA 4CS3A 5CB4A 5H2FZ 3PHWA 4FK5C 1F4MA 1BS3A 2OIEA 3SJQC 1BE3H 2P90A 5JJNB 4NXNO 1HUCB 3BEHA 2ZE7A 1SQXH 3OE7G 1IBMO 2R70A 3CEIA 4GX0A 4FFBB 1K92A 2M7WA 2MW2B 4A5UA 4FFKA 2WSSG 4N8WA 1L0LH 3BFRA 5GTHZ 1SETA 1YI2V 4NXMO 2EX3A 4Z1VA 1OV9A 2J7QC 3JSNA 1EWLA 1A6RA 2Q8VA 1DF4A 2FTKA 2ILMA 3M8AA 3B8NA 1XILA 2RCVA 1AECA 1YEWA 1AVMA 4TUYB 4CC5A 3OTOO 4HNAA 5EGWA 4JGSA 4U3FH 2WLHA 1XL6A 3HD3A 4J9ZB 3QF7A 1NQCA 3BOWA 1ZAUA 1MSWD 3A0RA 4LF4O 1PNMA 2YIBA 4UVBA 3FFQA 4DV1B 1KMIZ 1CVZA 4E4EA 2G8JA 3JARB 3SPGA 4YYWA 4WURA 4DV2B 1N0NA 1P84F 4IHJB 1PADA 3E8FA 2WLIA 1TUBA 4XBFA 1O9HA 1QNMA 3CWBH 2KG7A 2Q5ZA 2Z5UA 2CTRA 5BR8B 1JFFA 5B3SB 2AGAA 3BVOA 1HNZB 1KP3A 2P4KA 5EBWC 5BZBA 2DOSA 5LYJB 4LC1A 3IFXA 4P6GA 3PW3A 1CJLA 3ZMZA 1WA8B 1NBMG 4O4LA 2QKCA 4MSWC 3ABUA 2PREA 3GCBA 3I55V 1SQGA 3HKBB 2PYLA 3JAKB 3AK1A 1AP6A 1U9VA 4MVSA 2NQIA 3BPFA 2YXYA 4ZI7A 3X2QB 1E1QG 5IDJA 1XNRB 1GN2A 2IH1C 1VQ6V 1N4CA 1F2CA 4HAMA 3IC7A 2F23A 4KFMA 1FXVA 1OCCC 1MIRA 1NQTA 4K3AA 3FYEB 5LMUB 3CCUV 2YEVA 1PE6A 1GRJA 2XHBA 2DMXA 1SQPH 2Q6AA 5CA1B 1EBOA 1L8DA 3E8HA 1HNZO 4X66B 3OFNG 4LNUB 1V9PA 3PT2A 2Q73A 1SESA 2Y4UA 4UCUA 3CCVV 4BR6A 1KQSU 3KX1A 3CD6V 4K35A 1EN4A 4DK1A 1N32O 4JYAB 2QTOA 2R9RB 3J81N 4G28B 4Z1MG 2KKWA 5EZYB 2X7RB 4DR2B 5EBLC 4LWSB 1Y76B 3KWBX 2F66C 4N23A 4ZUXU 3E22A 4LFAO 3HHIA 4UV8A 3VOUA 1XKGA 3ZJZA 5JQGB 1M56C 5LMUO 5KA6A 2ZNJA 2IJKA 4WFEA 1JCHA 4DMXA 4LFBB 4BQVA 4X62B 4I7ZB 5LP6C 1ZTEA 3RBZA 1CPJA 5K1XA 3BCCH 4TV9B 1NB5A 4B08A 4DV7B 4QPKA 3OUFA 1VQ4V 5L3CA 1KFXL 4DR6B 3T2MA 3JD2A 1VQLV 1Y74B 4L87A 1Z5VA 3OGIB 1M90W 5CVNB 4MVRA 4ZBMA 3SYOA 5L3EA 3W7XA 5FLXN 1FKAO 5LXTB 2Q69A 2HG5C 1Y66A 2ZXWC 3UQ8A 1M1KW 4K8ZA 1RPOA 2HJDA 4Q8GA 2R9AA 4AQYO 4PA6A 3ZHSA 1BL8A 2D3OW 5PADA 4JI7B 5GW7A 2BTWA 1BT8A 1IBKB 3TMPA 3MHHC 4MVQA 4NTYA 3MJ5A 2L6LA 3RN4A 1WB8A 4P30A 3M99B 4X62O 5IYBO 4DV0B 3NR7A 4JZGA 1IXBA 2OT5A 2ADQB 2DWEC 2DJGB 5EK0A 2BTOA 1F2BA 2WPDG 3FAVB 4JI3O 1Y4MA 5J2UB 1Y6XA 2QWNB 3RNVA 2FKXA 3QG5A 5H6RA 5IJ0B 2EIKC 3K5MA 1SZTA 3ML0A 2WBFX 4PADA 1DTOA 3RFRA 3CRCA 4DR4B 4IHJA 4P9OA 3T1CA 2Z3YA 1OCCB 4GKKB 3CC7V 3ABMC 3CC2V 1YXBA 7PCKA 1OCRC 1YCIA 4X6IA 4OX9B 1I7FA 3LUTB 1PPDA 2IBZH 1O9GA 5LHHA 2RN9A 1QU7A 1WA8A 1IVSA 2QWRB 1WPXA 1QVGU 3JCZA 4W4KA 1NPZA 1Z2GA 2BTQB 2X6AA 1VQNV 1H38A 3HKBA 3JAKA 1WAZA 3K5LA 4KXRA 2XAQA 4MT8A 3DXRB 4LH6A 1UKFA 3VQWA 2B1IA 2QM4A 2W0XA 2EBOA 3MHSC 1KB9F 4FIPA 2QE7G 2QTSA 1JQ0A 3F5TA 3SJCC 5EZQA 4OX9O 2YJBA 3B4SA 3WG7C 5CA1A 1P7BA 5LHGA 4AI8A 2ADPA 1YDXA 1VF5B 4LNUA 5LP6B 4UB8Z 1BHBA 3PHXA 4DR7O 2HD5A 2WLLB 3L75H 3L9DA 1NS1A 2RMKB 1WNSA 1QHTA 4OVZB 1NLJA 3RVZA 2B5UA 1XMOO 3CCJV 4TV8B 2HP8A 1SP4B 3SJBC 3DSQA 1NVPD 4NVPA 3C90A 3T1HO 4QRXA 4GT1A 5LHIA 1PNLA 2PYJA 4LWSA 1Y76A 3PRPA 2ZXWB 3VQYA 4LF8B 2P22C 1Q6IA 3MD0A 4AILC 1YSCA 3BABA 5B66Z 3N27A 3CC4V 3TNXA 4KP4A 3PN1A 1EN6A 4I50B 5JQGA 1H2LA 4LF7O 1DKIA 4OELA 3PJSK 2ZM6O 3EFFK 4O4JA 2NQAA 5KO3A 1W59A 2RQ6A 2O6XA 4HYOA 2ZD9A 3WU2Z 2O57A 4LFCB 3O1GA 4TV9A 4J7KA 3BPZA 3RYCB 5B1AC 1KHQA 1ME4A 1G1XB 2HXZA 4H0LB 4J41A 1EFRG 4Z2WA 3W7SA 2EIKB 4GX1A 4IIJB 4LF6B 4JI6B 1AYUA 4AHCA 5JZEA 3IUTA 5LXTA 3ABMB 3P5XA 1N34B 1TUEB 2PY5A 1OCRB 2HWKA 1RSOB 4X65B 3U8EA 4QE9A 1VQOV 3N2GA 4JAUA 2PADA 3M99A 2XU3A 1RP3B 4O2BA 2V7QG 4H44B 1KKCA 2HKOA 4NKGB 4LFCO 1QVFU 1PPNA 1PL0A 4X88A 3ZMUA 1S5JA 2YJCA 1U5IA 3CXHF 1Y4HA 3S3QA 2DYSC 5J2UA 5IJ0A 2JTCA 4LF6O 1SS3A 3HKCB 3WB1A 2PNSA 3CMAV 2Q7HA 1GH6A 1S76D 1H2MA 1XBLA 4HXDB 5FPOA 2PUSA 2BOCC 3ZNHA 2GSMB 2W0FC 2WA4A 4JI1B 4OPAA 4YVAA 1K33A 2JRIA 3KG2A 4FLWA 1ORQC 1VQMV 3H1JH 2Y5BA 3FYIB 2F4VO 4JI4B 2CDYA 4PDMA 1XHXA 5KHGA 2JQFR 3KW9A 3DTUB 2WLNA 3ABLC 4DV3O 2IJJA 3ETGA 4FLVA 3HB3B 1EZVH 5DN6G 3HKEB 1I94B 3ZX6A 1NTMH 1NT2B 1HR0O 1NR1A 1TGOA 2CTWA 2Y69C 3RVWA 2ZINA 2DN9A 4U3JB 4DR1B 1R6NA 2YICA 4JYYA 5LP6A 4BIOA 2HJFC 5KAIZ 2UU9O 1M93A 2WLLA 4GKJB 3OEEG 1PBHA 2B1GA 4OVZA 5B1AB 3DGEA 4PP1A 3I06A 4TV8A 3C9EA 4YYUA 2IU3A 1H2NA 1MNGA 5DECA 2GTAA 3PSEA 4REZA 2EJ7A 5BY1A 3K9AA 1CS8A 5J2TA 3ZRSA 3FX7A 1I94O 3IEJA 5C8YB 3OR7C 3ZBHA 4NTXA 4GZRB 5IYZB 1PM9A 2WLIB 3RYFB 4OGQB 4CZZA 1R6KA 2IU0A 2KG7B 1W0JG 4I50A 3HWNA 3T4ZA 5LOVA 3SPJA 4XDKA 2QWQB 4PELA 3E1ZB 4YY3B 1IDSA 3OD4A 1GAXA 1K9MW 5ITZA 4GKJO 2R9FA 4O4LB 1GM9A 2DQ0A 1G8MA 1JPXA 2HHHB 3H7DA 2BDLA 4EFEA 5DM6V 2DYSB 4PP2E 2LQTA 4DW0A 2ZDIC 1ME3A 3STZC 2YJ9A 1TAEA 2PBHA 4B3SB 4MI7A 3V6EA 2E3CA 3RYIB 5H5NA 9PAPA 4TWKA 1FS0G 1F29A 4WFHA 4X1IA 1GO3F 3BB7A 3RT3C 2K9PA 1GM7A 5IYDO 1VQ9V 1Q6HA 1UFIA 4MW8A 4FM1A 1PPPA 2YEVB 5CBGA 2Z0AA 2FTDA 4DMYA 2IW5A 4HBNA 3MDSA 1RSOA 4RF1A 3C3TA 4MTFA 1J5EB 4YY3O 1W0KG 1SA0B 1NR7A 5L3BA 1I5XA 4FLTA 1AYWA 3VBBA 2BCCH 2VHFA 4UCVA 1EWPA 4DV6B 2HHHO 3ABLB 1IXMA 2ZE8A 1VQ7V 3P3PA 3PNRA 3TRKA 2AXTZ 4DR5B 4D8EA 4B3SO 2R9CA 4W5BA 2AS8A 5E6JA 2JVDA 3HKCA 4B3MB 5LMNO 2HH5A 1UPGA 2UUBO 1NI8A 1URFA 1IWDA 2Y69B 3W7WA 2B1MA 1J5EO 3ZMTA 4AXMA 2P5OA 1MA1A 3L70H 4O4IA 3BA8A 3L72H 2AIMA 3W7UA 4P16A 3H6SA 1OJHA 2ATKC 4DV6O 4MZSA 2RDCA 4MTXA 2AYNA 4DR5O 2H94A 1N33B 3ZHQA 3OVXA 2CK3G 1U9XA 3KKUA 3PHUA 3S3WA 4MS2A 4I07A 5BXZA 4X64B 3HKEA 4OPHA 2BDZA 4W5CA 4RAIA 1N36O 3WXGA 1NKDA 3CBJA 1GMYA 1FXKB 1R3LC 2BTWB 1GK9A 1ICFA 2VQFB 3QT4A 4U3JA 1QR8A 4N79A 1SRYA 2CAZC 2LGWA 1CEZA 2G38A 2H3OA 1U97A 4RQFA 3KWZA 4KLBA 2LP7A 4RO2A 1QDQA 2DCCA 4LF5B 3BHPA 2DZZA 2P6JA 3JALA 3E89A 4RWUA 1N33O 4RF0A 5EYPB 4G27B 4JASA 3ZHUA 3PDFA 3LFYA 4X64O 2EULA 3OF9A 2PGGA 4WFGA 1FXHA 1Y67A 5D5QA 2F1MA 2ITDC 5C8YA 1P7GA 2NQDB 3PBHA 1EN5A 5IYZA 1BQ0A 3RYFA 4FPPA 4RKXA 1F51A 3U11A 1EF7A 3CHXA 4BW5A 2VQFO 5CMUA 5EIBC 5KHHA 4MZOA 1AP5A 2QSAA 4D7TA 1JMKC 2W6JG 3G80A 1SNKA 5KHJA 1YTFB 3FB5C 3H89A 4EFBA 1S4VA 2XU5A 4DV1O 2HEPA 1NVPB 1R3KC 2E01A 3JD4A 3UM7A 3RYIA 4X8AA 4DV2O 3JSLA 2YIBD 4WF9V 4K8XA 2HFEC 3D3QA 1EM1A 1I08A 1F4NA 4XZXA 5BR8O 4YHHB 1Q90D 2LFSA 5EC1C 3F5WC 1AIMA 1BGYH 3ZUAA 4LH7A 3JYCA 4TSFG 1SA0A 4FLUA 4GUNA 4YIOA 4X1YB 2UXDB 4D8BA 2P7UA 2JS3A 2PI5A 3BCNA 2ZIMA 5CN0A 1CQDA 1YVBA 3P5UA 4F6EA 4D7SA 2UUCB 5EBMC 5HFLA 1YK8A 2DCDA 1MSDA 1XNRO 2RNBA 4U7OA 3M7MX 1MG1A 1PXVA 4J9YB 1LNQA 4IT5A 3OMAB 1H2SB 2LW1A 3B79A 4GX2A 1THEA 4BW9A 2FO5A 2UXXA 3K57A 1ZUQA 2IJIA 4O4JB 4X66O 4K0KB 2JEXA 3BRCA 1PIPA 1IX9A 2WLMA 4ZHQB 2F7DA 4JI0B 3KSEA 3AEIA 2ODMA 3FD9A 2AUZA 5EZSA 4J42A 3QO7A 5LGNA 5FL7G 4QE7A 4JYAO 5CA3A 1JVMA 3OR6C 4RUEA 4BOUA 2HR3A 4R3DA 4DW1A 1SQQH 2P06A 4MTOA 1AB3A 1QLNA 2XU4A 4UCTA 4DR2O 2Q0OC 3ZEDA 3FKSG 2JDIG 1FXKA 3CCRV 5CHTA 2DCAA 4WBNA 1S5HC 1AJNA 4JZ2A 2IBIA 3K79A 3N2GB 4LFBO 2R9MA 2CTQA 2XAJA 4IGGA 2QGNA 1NH2D 4YIPA 4O2BB 3P32A 3K03A 3SYQA 1TU6A 1PD3A 5DEDA 1K5QA 2KSDA 4EKWA 3B2EE 3P5VA 5IJ9B 4DV7O 1MZEA 2GHYA 2EZOA 4WCEV 3V6CA 3G6EV 2ZDIA 4DR6O 3JD0A 4UCRA 3ZHRA 1GM8A 4JAVA 4RNAA 1W2BU 5EYPA 2Z84A 2C0YA 2QDOA 3LXSA 4GCZA 4ABMA 1ZCMA 3I56V 3ZMSA 2JJ1G 1YJ9V 5H9CA 3TXQA 4F6RA 4JI7O 1IBKO 1MMMA 4QPJA 3BY6A 4E2LA 2ATOA 4IP3A 5JH3A 4DV0O 3D36A 5F2VO 3K59A 1STFE 4UUJC 2YI9A 4CH6A 3QO8A 2E5LB 2XU1A 5CA0A 1CSBB 1YK7A 4CZWA 2DYRC 2C2AA 2Y0PA 3SYAA 2UXBB 4EEQA 1NL6A 3VQXA 1SF9A 4Q8HA 1JOYA 4UXNA 3CCQV 4DR4O 3W31A 1AJPA 1BMFG 5K1PA 4GKKO 1AU2A 2E03A 2FYEA 2KQXA 2GFOA 2R6NA 3H1LH 3OM3B 2EILC 5GONB 1XREA 1ZWIC 3CCEV 4QH6A 2FYUH 3E8GA 5J9PC 1S72V 1Q7YW 4X1YA 2Q7EA 4Q20A 1HNXB 4CC6A 2Q68A 3G67A 3RWRD 3IJ4A 1EWOA 3E2EA 2UXBO 3ETEA 4J11A 2W6IG 5J2TB 1US6A 4MSXA 4KUMA 1AI4A 2ZQMA 1MOFA 1YIJV 2ARYA 2EZPA 3JAWA 2YJ2A 1KXRA 5HFMA 3K9SA 3ZN0A 1FFXA 3HHAA 2ZR2A 2Y4TA 4NTWA 1YHQV 1P4RA 3LSSA 5LOVB 4O4HA 3WXEA 1JX9A 3SR2C 1VQPV 4CS2A 4R50A 5ITZB 2P0RA 4JF3A 4ZHQA 2OWOA 3N3GA 2JIZG 3ZRVA 3OUSA 4R6ZA 2G6DA 1VQ5V 5JJEB 5D5PA 3CRAA 1Q86W 4CS4A 5JCOA 3LDDA 1CXZB 2YJ8A 2N74A 4R8CA 1K97A 1M9NA 2AVWA 2H7JA 2AW9A 1KYOF 2L35A 4MVOA 4UFZA 4X1IB 1CB5A 5A24A 1SQBH 4LF8O 3OF8A 3CX5F 2LFRA 2GUZA 4H13B 3SPCA 2P7TC 2HVJC 2R72A 4EB6A 3D8CA 4I4TA 4TOIA 1K73W 2ARHA 3APQA 3R65A 2Q9LA 8PCHA 2X6CA 2QWPB 4FMTA 1BQZA 3B8MA 1YALA 4CDEB 5LL6Y 4IYIA 3N3KA 5H6QA 4X1KA 4WFBV 4MM3B 5IJ9A 3K0DA 5KMGB 1G6UA 3E8BA 2DYRB
chains in the Genus database with same CATH topology
4AQYO 1YZBA 4GUAA 2F4VO 1N33O 4B3RO 4RF0A 2Z0AA 1FYJA 2BTWA 3C0RA 4JI6O 3MP2A 5EZSA 3TMPA 4JI2O 3PRPA 4RF1A 4DUZO 4X64O 3MJ5A 4YY3O 4X62O 4JYAO 4DV3O 2UZJA 1N34O 4BOUA 4R3DA 1DKIA 4RKXA 4LF7O 1AB3A 2ZM6O 3PHWA 2DJVA 4DR2O 1IBLO 2VQFO 4X65O 4YHHO 1X59A 2HHHO 5KO3A 1HR0O 4JI3O 3RNVA 4NXNO 2UUAO 3TRKA 2FKXA 4D8EA 5A2QN 1IBMO 2UXBO 4B3SO 3PRMA 5IWAO 2VQEO 4A5UA 4BOPA 5E6JA 5LMNO 1HNZO 2UXDO 4ZTBA 2FE8A 4LFBO 2UUBO 1G1XB 3PT2A 2UU9O 4DV1O 2UUCO 4NXMO 1XEQA 2J7QC 5IT9N 4DV5O 3J80N 3W30A 4OVZA 3J7AU 2ZKOA 4DV2O 2UXCO 2E5LO 4DV7O 4DR3O 1D2DA 3E9SA 5JZEA 1N32O 1J5EO 3M8AA 1R1BA 1A32A 3J81N 3PSEA 1PVJA 3R66A 4DR6O 4REZA 4BOQA 5BY1A 3JAMN 3MTVA 1HNWO 3OTOO 2HWKA 3IFUA 4RNAA 4XZXA 4BOZA 5BR8O 2Z84A 4JI1O 4P16A 1I94O 3OQCA 4KHPO 4DV6O 4LF9O 4PT5A 4LFAO 1AILA 4LF5O 4K0KO 4DR5O 2N74A 3B21A 5LMUO 1UKFA 4B3TO 4JI0O 4LFCO 4JI4O 4BOSA 3PHUA 1XMQO 4LF4O 4IUMA 4D8BA 4JI7O 1IBKO 2BU3A 5BXZA 4OPHA 1N36O 4LF8O 4OW0A 4DV4O 2LW7A 4IP3A 4DV0O 2J7QA 4GKJO 4JV5O 3T1YO 2JTCA 4LF6O 4A5UB 3F5TA 1XNRO 5EZQA 4WURA 4OX9O 2BTWB 3SDLA 1KUQA 4M0WA 4D8IA 3BBAA 3O65A 1HNXO 4HXDB 3PHXA 1R6TA 4DR7O 1NS1A 1FJGO 4MI7A 3ZNHA 4JI8O 4OVZB 4JI5O 2AGAA 5LL6Y 5H5NA 5FLXN 4OPAA 1XMOO 1DK1A 1FKAO 4B3MO 3BY4A 4MM3B 1XNQO 2JRIA 4DUYO 4DR4O 3BB7A 4X66O 3RT3C 2DOSA 3W31A 1F7YA 3T1HO 4DR1O 4GKKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  1YZB A;  2F4V O;  1N33 O;  4B3R O;  2Z0A A;  1FYJ A;  4JI6 O;  4JI2 O;  4DUZ O;  4X64 O;  4YY3 O;  4X62 O;  4JYA O;  4DV3 O;  1N34 O;  4LF7 O;  1AB3 A;  2ZM6 O;  2DJV A;  4DR2 O;  1IBL O;  2VQF O;  4X65 O;  4YHH O;  1X59 A;  2HHH O;  1HR0 O;  4JI3 O;  4NXN O;  2UUA O;  2FKX A;  5A2Q N;  1IBM O;  2UXB O;  4B3S O;  5IWA O;  2VQE O;  5LMN O;  1HNZ O;  2UXD O;  4LFB O;  2UUB O;  1G1X B;  2UU9 O;  4DV1 O;  2UUC O;  4NXM O;  1XEQ A;  5IT9 N;  4DV5 O;  3J80 N;  3J7A U;  2ZKO A;  4DV2 O;  2UXC O;  2E5L O;  4DV7 O;  4DR3 O;  1D2D A;  1N32 O;  1J5E O;  3M8A A;  1R1B A;  1A32 A;  3J81 N;  3R66 A;  4DR6 O;  5BY1 A;  3JAM N;  1HNW O;  3OTO O;  5BR8 O;  4JI1 O;  1I94 O;  4KHP O;  4DV6 O;  4LF9 O;  4LFA O;  1AIL A;  4LF5 O;  4K0K O;  4DR5 O;  2N74 A;  5LMU O;  4B3T O;  4JI0 O;  4LFC O;  4JI4 O;  1XMQ O;  4LF4 O;  4JI7 O;  1IBK O;  5BXZ A;  4OPH A;  1N36 O;  4LF8 O;  4DV4 O;  2LW7 A;  4DV0 O;  4GKJ O;  4JV5 O;  3T1Y O;  4LF6 O;  4A5U B;  3F5T A;  1XNR O;  4OX9 O;  3SDL A;  1KUQ A;  3O65 A;  1HNX O;  1R6T A;  4DR7 O;  1NS1 A;  1FJG O;  4JI8 O;  4JI5 O;  2AGA A;  5LL6 Y;  5H5N A;  5FLX N;  4OPA A;  1XMO O;  1DK1 A;  1FKA O;  4B3M O;  1XNQ O;  2JRI A;  4DUY O;  4DR4 O;  4X66 O;  3RT3 C;  2DOS A;  1F7Y A;  3T1H O;  4DR1 O;  4GKK O; 
#chains in the Genus database with same CATH topology
 2DC7 A;  2NNU A;  3GWO A;  2VWJ A;  1I0H A;  2ITC C;  5CBF A;  4AXL A;  1E79 G;  1Q43 A;  3ETQ A;  4JI6 O;  1OCO C;  2B9Z A;  1PV0 A;  4DV4 B;  2DC8 A;  2PTM A;  4NR1 A;  1H2G A;  5IY5 C;  1N34 O;  1YJN V;  2YDE A;  3AG2 C;  1LR1 A;  4CH5 A;  4YV8 A;  3KFQ A;  2DJV A;  3K5O A;  2EIL B;  2QJ1 A;  4X65 O;  2OUL A;  3H8B A;  1RPR A;  4LF9 B;  2GHU A;  4I9W A;  1MS6 A;  3Q4H A;  5A2Q N;  5B5E Z;  3B77 A;  4JI8 B;  4JI5 B;  4O4I B;  1NZ6 A;  3H1K H;  3U10 A;  2YC0 A;  1TA8 A;  1PPO A;  2DZY A;  1IUR A;  3DF0 A;  3A8T A;  2QWO B;  1GEC E;  2RJZ A;  2V4D A;  4JV5 B;  3CCS V;  3CRM A;  1GTO A;  1FD9 A;  2Q0A A;  1PL4 A;  3SJA C;  1GLO A;  1A32 A;  3FB6 C;  3IC9 A;  2K1E A;  5KX5 B;  1Q82 W;  4N21 A;  4JI1 O;  5LBQ A;  4N4Z A;  1OZ0 A;  5GON A;  4LF9 O;  1OCZ C;  1GCB A;  4IL6 Z;  2CTP A;  1N8R W;  1NU1 H;  4JI4 O;  1NTK H;  3OGC C;  4BOS A;  4X6H A;  4I05 A;  1AU3 A;  1SQF A;  2A0L A;  3K9M A;  2OCH A;  2OCC C;  3JAL B;  4JV5 O;  1J95 A;  3SGI A;  1K5S A;  2XUM A;  2E02 A;  4DR3 B;  1IBL B;  3CH3 X;  1ZL8 A;  1ZSP A;  3K58 A;  1MDW A;  3EVK A;  4YYS A;  4BPV A;  1HW7 A;  1FXK C;  4Q6G A;  3CE2 A;  4R7C A;  4L8J A;  2FML A;  2QKA A;  3ZCC A;  1VMG A;  3K3W A;  3CCM V;  2NN4 A;  3ABT A;  5L3D A;  1DK1 A;  2FT2 A;  2G8E A;  4RQE A;  4DR1 O;  4GYC B;  3EXA A;  3JCU Z;  4TT3 G;  3ERV A;  1SQV H;  4NB5 A;  2CH7 A;  4DV5 B;  3QNE A;  4PV1 B;  4HZ3 A;  3I5D A;  5KAF Z;  2YUA A;  2OZ2 A;  3IV2 A;  1QCE A;  1FAF A;  1BQI A;  1XUQ A;  1BP4 A;  2JGD B;  4PI0 A;  2QA4 V;  3JAS B;  2DC6 A;  4BWA A;  1HNW B;  1UJW B;  3K24 A;  3CH2 X;  1OCO B;  5JVD A;  1POP A;  4QIW F;  1IBL O;  3OAA G;  4KHP B;  2P86 A;  5IY5 B;  3AG2 B;  1OHH G;  1JQP A;  3O9O A;  5C93 A;  1Q81 W;  3PRM A;  1XMQ B;  4JTD B;  1NB3 A;  4I0X A;  4P6E A;  2XAG A;  1AR1 B;  3TXS A;  2FE8 A;  5JA7 A;  2YIA A;  2A3Q A;  3D36 C;  4YYV A;  4DV5 O;  4P2Z A;  2QM8 A;  2XOK G;  3JAT A;  4DUZ B;  3ICX A;  1U9W A;  1VAR A;  2A7W A;  2EIN B;  3VQV A;  3AG3 C;  5KMG A;  2MK3 A;  1T5E A;  3R66 A;  1PVJ A;  3SYP A;  1GN6 A;  2E75 B;  2WWW A;  1HNW O;  2E00 A;  2ZR3 A;  2QEX V;  2OTJ V;  2GBO A;  3OW2 U;  1N0J A;  2WLJ A;  3F7Y C;  4KHP O;  2AZ0 A;  4NXN B;  3L71 H;  3B21 A;  1S0V A;  4FLZ A;  1U9Q X;  1XMQ O;  4H33 A;  2N05 A;  5J94 A;  1ARO P;  1OCZ B;  5EC2 C;  3NXS A;  4OW0 A;  4WFF A;  4TQF A;  2EIM C;  3MAQ A;  4PHZ A;  3SPI A;  2A06 H;  1MHW A;  4D8I A;  3LSQ A;  3L74 H;  2OCC B;  4X89 A;  3LNN A;  2EJR A;  3KKY A;  2JK5 C;  3OTO B;  1K4C C;  2WLK A;  5E1A C;  1VSN A;  4QGP A;  4B3M O;  4FVM A;  3T4D A;  2YI8 A;  1K4D C;  1X9Y A;  5CHV A;  3RGB A;  3MTN A;  1WP7 A;  4LBE C;  1KU9 A;  4WBN B;  1S5L Z;  5KX5 A;  4LF4 B;  1KD1 W;  1DEU A;  2ZE5 A;  2GDS A;  2AHY A;  1JJO A;  5K16 A;  3L73 H;  1SC5 B;  1D5N A;  2VRZ A;  4XR7 A;  4J10 A;  2OP3 A;  4I5S A;  4LP8 A;  1THZ A;  4CH4 A;  5CVO B;  5JCO C;  1AR5 A;  2GV9 A;  2VS0 A;  1CP9 A;  4LR3 A;  4PD4 F;  1EZJ A;  3APO A;  3USV A;  1AI6 A;  2Q7G A;  4O2A A;  2FB5 A;  3RVV A;  2NLJ C;  1PKX A;  3ZN1 A;  4XUI A;  3IHP A;  1XHZ A;  1M5I A;  3P3N A;  3A0B Z;  4J7Z A;  2CIO A;  5IT9 N;  2G7Y A;  3T1Y B;  3ASN B;  2JEU A;  3KCY A;  3W30 A;  4FJC A;  4F6R B;  3QTC A;  1Q6U A;  1BHA A;  1R1B A;  4DRX B;  2PF4 E;  3IGA C;  1DF0 A;  2DCB A;  1YVW A;  4JAA A;  1VJV A;  3IFU A;  2LO1 A;  1XL4 A;  3CRR A;  5TIS Z;  5KLV H;  3WB2 A;  1X4T A;  3OQC A;  5CA0 B;  3AG3 B;  1IZ3 A;  2JGD A;  5KHK A;  3JAS A;  4DXW A;  4LF5 O;  1YT7 A;  3UT5 B;  2Y6E A;  1L0N H;  1QQC A;  1VF7 A;  3KCX A;  4PDV A;  1SKV A;  1WJZ A;  1WLE A;  3UCS C;  4BS5 A;  3T1Y O;  5IE9 A;  2P4V A;  3P5W A;  1KUQ A;  1ZX3 A;  1N32 B;  4K7C A;  4MW3 A;  5GTI Z;  3A0H Z;  1I5Y A;  4FM2 A;  4UB6 Z;  2UUA B;  4PDL A;  1KP2 A;  1KEC A;  3TJT A;  5EF4 A;  2EIM B;  2EIJ C;  3CJH B;  2DQ3 A;  1FFT B;  4CDF B;  3CSX A;  2VWK A;  3RYH A;  6PAD A;  3K8U A;  1Z5W A;  3ASO C;  4LFA B;  4UCO A;  1KBH A;  1JA8 A;  1K34 A;  4I55 A;  3BC3 A;  1LUV A;  4CBC A;  2DE0 X;  2CGN A;  1FYJ A;  3C0R A;  5KUM A;  1ITO A;  3A2F A;  1BSM A;  4I9Q A;  1G4Y B;  4B7K A;  1VEW A;  5FNV B;  5BMV A;  1AYV A;  4PI2 A;  1RM1 C;  4ASU G;  3JAW B;  1M57 C;  4F4L A;  5JH7 B;  1AU4 A;  1FFX B;  1AJQ A;  1JR9 A;  5LGU A;  1P49 A;  3G71 V;  3IAY A;  4YHH O;  4O4H B;  4YJ3 B;  3SYC A;  2UUA O;  4UV9 A;  5L3G A;  3DC5 A;  2AU1 A;  1GKF A;  1ATK A;  1KFU L;  2CE4 A;  5IYC O;  2UXD O;  3RVX A;  4ZTB A;  4MVM A;  3ZMV A;  4AQY B;  3QVN A;  1PNK A;  2HLD G;  2UUC O;  1XEQ A;  4BIZ A;  4BS6 A;  3J80 N;  3GB7 C;  3N4C A;  4W4L A;  3OIS A;  3LSU A;  2IM9 A;  1FH0 A;  3I3T A;  1WPB A;  5JWP A;  4NYK A;  2GUZ B;  4YYQ A;  4FFB A;  3B40 A;  1HWY A;  3AG7 A;  3E86 A;  4EB6 B;  4JI3 B;  2IJH A;  2YID A;  4I4T B;  5JJJ B;  4PT5 A;  3H01 A;  1CV8 A;  1AIL A;  4K0K O;  3JD3 A;  2BE3 A;  4JI0 O;  4B3R B;  1SZX A;  3UO3 A;  4P9P A;  4LCU C;  4UVA A;  4X1K B;  2BU3 A;  5CBH A;  2JQG R;  5FPW A;  1AR4 A;  2FRA A;  3FB8 C;  4G54 A;  5AG2 A;  1KHP A;  1CPY A;  4TUY A;  5F02 A;  4JPR A;  2UXN A;  3SDL A;  2ZE6 A;  1H8H G;  2R9N A;  2XT9 A;  3SPH A;  1R6T A;  5B1N A;  5FPR A;  5IWA B;  2Y48 A;  2AUX A;  3AK3 A;  1EWM A;  2NR5 A;  1QOL A;  4PJ0 Z;  3AK2 A;  4DRX A;  1YZB A;  1R3I C;  2P67 A;  3JAR A;  1F23 A;  3Q4H B;  5L3F A;  3CS5 A;  2EIJ B;  3WFV A;  4QBB A;  4B3R O;  5A9G A;  4X20 B;  3MP2 A;  4QNH B;  1M4U A;  2E76 B;  1CTE A;  3ASO B;  2M6Y A;  3CME V;  1V55 C;  3OVZ A;  3TGU H;  1MEM A;  4YJ2 B;  4BAY A;  2X0L A;  3UT5 A;  3U0Z A;  1ENV A;  4FZ1 A;  2XAH A;  1QMY A;  1PP9 H;  3BPM A;  2Y0I A;  4W4U A;  1X59 A;  5LYJ A;  4DR7 B;  3BWK A;  3K08 A;  1WB7 A;  2FL4 A;  4FM0 A;  1RM1 B;  3CCL V;  5B1O A;  4G2K A;  1XOU A;  1M57 B;  1WP8 A;  2WA3 A;  2Q67 A;  5IWA O;  4DK0 A;  1XMO B;  2XND G;  3T1H B;  4UCS A;  3HKD B;  5LGT A;  1VF6 C;  2BSK B;  1QBZ A;  3UO2 A;  3CJH A;  4PI3 A;  4XDL A;  1GMG A;  3THO A;  2ZKO A;  2E5L O;  1H2K A;  1D2D A;  1WN7 A;  4IYH A;  1M56 B;  4BOQ A;  4LF7 B;  1FJG B;  2ZM6 B;  3GWK C;  1R3J C;  1Q5O A;  1ROP A;  3AG1 C;  4FK5 A;  1JJ2 U;  2CGO A;  3ZHV A;  4RY2 A;  1ZL8 B;  3FB7 C;  1RFY A;  1YF2 A;  1VP7 A;  5FNV A;  1YTF D;  2YS8 A;  4X9Q A;  4X6J A;  4FLX A;  4IUM A;  4JI2 B;  5JH7 A;  1D5A A;  4YJ3 A;  2J7Q A;  4CDD B;  1AI7 A;  5EZY A;  1XI1 A;  2CH7 B;  4BSQ A;  1DLB A;  3GVM A;  3ZRW B;  3K0G A;  4UVC A;  2XAF A;  1B6Q A;  3BBA A;  4FZ0 A;  4JYC A;  4J80 A;  2DC9 A;  2OIG A;  1Q3E A;  2JGU A;  3N2K B;  1HNX O;  5E79 Z;  3QJ3 A;  1QLE C;  1BGO A;  4I04 A;  1FJG O;  3DC6 A;  3EHB B;  3WB0 A;  3E35 A;  2XAS A;  1B06 A;  3BA9 A;  5JVD B;  4CH3 A;  3H1H H;  4H37 A;  3ZS8 C;  2KB1 A;  2LGQ A;  2ZT9 B;  1F7Y A;  2VHS A;  1F2A A;  1MZF A;  3K04 A;  2XTA A;  1K8A W;  1B04 A;  3IMA A;  4OEM A;  4OXS A;  4JI2 O;  1KKD A;  4FJC C;  4I0X B;  4YXW G;  3B09 A;  1ZLZ A;  2V1D A;  2Q4P A;  2OTL V;  1Y74 A;  2UZJ A;  1FPO A;  3O0U A;  4ZOL B;  4WFA V;  2CB5 A;  3LDE A;  5B1B C;  4MVZ A;  5LA6 B;  3JAT B;  4D6T H;  3OMN B;  2YXH A;  3CP1 A;  1KC8 W;  2WAM A;  4MTG A;  1TL9 A;  4PA4 A;  1K3B B;  1V55 B;  1SER A;  3W7T A;  3F7V C;  5CVM A;  1VQK V;  3UKM A;  1LUW A;  4DYL A;  4GX5 A;  2AHZ A;  1NJI W;  1QXP A;  1R73 A;  4HWY A;  2ZNI A;  2F4V B;  3STL C;  2CUG A;  1XQ8 A;  4DO2 A;  3J7A U;  4C7U A;  3E9S A;  4DV3 B;  2GTS A;  3FAV A;  3OTF A;  3ZHT A;  4QJF B;  3K06 A;  2QR4 A;  4X20 A;  3H1I H;  4ZKI A;  1XNQ B;  1HR0 B;  3LDC A;  2EIN C;  3CPW U;  4BIU A;  3LNM B;  1TVK B;  1GN4 A;  2A79 B;  4PDR A;  1ZIV A;  3S3R A;  3P30 A;  5EIB D;  2AYO A;  1Q6K A;  5CB4 B;  3WG7 B;  4YJ2 A;  3ABK C;  3AG1 B;  4TQD A;  3AG4 C;  1K7D A;  1V54 C;  2H8P C;  1BY8 A;  2UU9 B;  4DV4 O;  2NQG A;  2YSU B;  3WXF A;  4A5U B;  2DJF B;  1H8E G;  4PA9 A;  4M0W A;  3NHE A;  1O0E A;  2BTQ A;  3CYO A;  2D2C B;  2A9H A;  3OT7 A;  3O65 A;  3HKD A;  3CXC U;  2BSK A;  3DXR A;  2FQ9 A;  2DWD C;  3G6B A;  1S3J A;  4RUF A;  3K5N A;  2VQE B;  2OYQ A;  4JI5 O;  4JI8 O;  1YIT V;  1PCI A;  1U96 A;  2B1N A;  1XNQ O;  1VIB A;  5KHI A;  3S3X A;  4QRV A;  4GUA A;  1QLE B;  5KA5 A;  2LJ2 A;  1L1F A;  1E1R G;  1B3Q A;  4HNA B;  1Q8I A;  2IH3 C;  2JS5 A;  2ZCE A;  1NTZ H;  2UXC B;  4JTC B;  4O2A B;  2BOB C;  3BAA A;  3OMI B;  4MVU A;  1M6D A;  4QRG A;  4PA7 A;  3TK1 A;  3CRQ A;  4JTA B;  2IPP B;  2N04 A;  2DW4 A;  2QM7 A;  4ICG A;  2F93 B;  4B3T B;  1MAB G;  5B1B B;  2VQE O;  1HP8 A;  4BOP A;  2QKS A;  1HDJ A;  1TLO A;  3TCU A;  3ZRW A;  2FUD A;  4WA6 A;  3N2K A;  1TUB B;  1QR9 A;  1JFF B;  2R9I A;  3C3S A;  2F43 G;  3MHH A;  2UXC O;  2F1G A;  2JJ2 G;  4DR3 O;  4J7J A;  2ACT A;  3E83 A;  3QO5 A;  1GN3 A;  3H8C A;  1K3E A;  3JAM N;  2X6B A;  3MTV A;  3KZI Z;  4BOZ A;  3D3I A;  3JD1 A;  3ASN C;  3RYC A;  2F95 B;  1S77 D;  2FRQ A;  3AI8 A;  4DUY B;  4XDJ A;  3CB2 A;  1DF5 A;  3MOR A;  4KL1 A;  4ZI7 B;  3ETD A;  4IIJ A;  4ZOL A;  5KUK A;  4B3T O;  4CDC B;  3H9V A;  5LMN B;  2R9O A;  5LA6 A;  1PPJ H;  1AU0 A;  3RYH B;  2UUB B;  1Y08 A;  2PI4 A;  1DGS A;  2LW7 A;  3ZIA G;  3TET A;  3ABK B;  4I55 B;  3AG4 B;  1BZK A;  2HVK C;  1V54 B;  5B3S C;  2E74 B;  3F5V A;  2HHN A;  4YYR A;  1BCC H;  2YXL A;  1VQ8 V;  4U7N A;  3RW0 A;  5BMV B;  1IBM B;  2ZIO A;  3ZRX A;  3IOQ A;  3D6S A;  3OEH G;  1MEG A;  3HR0 A;  1AI5 A;  4GLX A;  4ZIB A;  3BY4 A;  3QSD A;  2PZS A;  3RVY A;  4DUY O;  1YJW V;  1VF6 A;  4NXM B;  2ETN A;  3G4S V;  3X2Q C;  3HPL C;  4JYB A;  3CBK A;  4PA3 A;  2AZ2 A;  4DUZ O;  1NH2 B;  1N36 B;  4B7E A;  4FLY A;  3MHS A;  3E22 B;  3F75 A;  1COW G;  4FIP C;  1TVK A;  1XDC A;  4CS3 A;  5CB4 A;  5H2F Z;  3PHW A;  4FK5 C;  1F4M A;  1BS3 A;  2OIE A;  3SJQ C;  1BE3 H;  2P90 A;  5JJN B;  4NXN O;  1HUC B;  3BEH A;  2ZE7 A;  1SQX H;  3OE7 G;  1IBM O;  2R70 A;  3CEI A;  4GX0 A;  4FFB B;  1K92 A;  2M7W A;  2MW2 B;  4A5U A;  4FFK A;  2WSS G;  4N8W A;  1L0L H;  3BFR A;  5GTH Z;  1SET A;  1YI2 V;  4NXM O;  2EX3 A;  4Z1V A;  1OV9 A;  2J7Q C;  3JSN A;  1EWL A;  1A6R A;  2Q8V A;  1DF4 A;  2FTK A;  2ILM A;  3M8A A;  3B8N A;  1XIL A;  2RCV A;  1AEC A;  1YEW A;  1AVM A;  4TUY B;  4CC5 A;  3OTO O;  4HNA A;  5EGW A;  4JGS A;  4U3F H;  2WLH A;  1XL6 A;  3HD3 A;  4J9Z B;  3QF7 A;  1NQC A;  3BOW A;  1ZAU A;  1MSW D;  3A0R A;  4LF4 O;  1PNM A;  2YIB A;  4UVB A;  3FFQ A;  4DV1 B;  1KMI Z;  1CVZ A;  4E4E A;  2G8J A;  3JAR B;  3SPG A;  4YYW A;  4WUR A;  4DV2 B;  1N0N A;  1P84 F;  4IHJ B;  1PAD A;  3E8F A;  2WLI A;  1TUB A;  4XBF A;  1O9H A;  1QNM A;  3CWB H;  2KG7 A;  2Q5Z A;  2Z5U A;  2CTR A;  5BR8 B;  1JFF A;  5B3S B;  2AGA A;  3BVO A;  1HNZ B;  1KP3 A;  2P4K A;  5EBW C;  5BZB A;  2DOS A;  5LYJ B;  4LC1 A;  3IFX A;  4P6G A;  3PW3 A;  1CJL A;  3ZMZ A;  1WA8 B;  1NBM G;  4O4L A;  2QKC A;  4MSW C;  3ABU A;  2PRE A;  3GCB A;  3I55 V;  1SQG A;  3HKB B;  2PYL A;  3JAK B;  3AK1 A;  1AP6 A;  1U9V A;  4MVS A;  2NQI A;  3BPF A;  2YXY A;  4ZI7 A;  3X2Q B;  1E1Q G;  5IDJ A;  1XNR B;  1GN2 A;  2IH1 C;  1VQ6 V;  1N4C A;  1F2C A;  4HAM A;  3IC7 A;  2F23 A;  4KFM A;  1FXV A;  1OCC C;  1MIR A;  1NQT A;  4K3A A;  3FYE B;  5LMU B;  3CCU V;  2YEV A;  1PE6 A;  1GRJ A;  2XHB A;  2DMX A;  1SQP H;  2Q6A A;  5CA1 B;  1EBO A;  1L8D A;  3E8H A;  1HNZ O;  4X66 B;  3OFN G;  4LNU B;  1V9P A;  3PT2 A;  2Q73 A;  1SES A;  2Y4U A;  4UCU A;  3CCV V;  4BR6 A;  1KQS U;  3KX1 A;  3CD6 V;  4K35 A;  1EN4 A;  4DK1 A;  1N32 O;  4JYA B;  2QTO A;  2R9R B;  3J81 N;  4G28 B;  4Z1M G;  2KKW A;  5EZY B;  2X7R B;  4DR2 B;  5EBL C;  4LWS B;  1Y76 B;  3KWB X;  2F66 C;  4N23 A;  4ZUX U;  3E22 A;  4LFA O;  3HHI A;  4UV8 A;  3VOU A;  1XKG A;  3ZJZ A;  5JQG B;  1M56 C;  5LMU O;  5KA6 A;  2ZNJ A;  2IJK A;  4WFE A;  1JCH A;  4DMX A;  4LFB B;  4BQV A;  4X62 B;  4I7Z B;  5LP6 C;  1ZTE A;  3RBZ A;  1CPJ A;  5K1X A;  3BCC H;  4TV9 B;  1NB5 A;  4B08 A;  4DV7 B;  4QPK A;  3OUF A;  1VQ4 V;  5L3C A;  1KFX L;  4DR6 B;  3T2M A;  3JD2 A;  1VQL V;  1Y74 B;  4L87 A;  1Z5V A;  3OGI B;  1M90 W;  5CVN B;  4MVR A;  4ZBM A;  3SYO A;  5L3E A;  3W7X A;  5FLX N;  1FKA O;  5LXT B;  2Q69 A;  2HG5 C;  1Y66 A;  2ZXW C;  3UQ8 A;  1M1K W;  4K8Z A;  1RPO A;  2HJD A;  4Q8G A;  2R9A A;  4AQY O;  4PA6 A;  3ZHS A;  1BL8 A;  2D3O W;  5PAD A;  4JI7 B;  5GW7 A;  2BTW A;  1BT8 A;  1IBK B;  3TMP A;  3MHH C;  4MVQ A;  4NTY A;  3MJ5 A;  2L6L A;  3RN4 A;  1WB8 A;  4P30 A;  3M99 B;  4X62 O;  5IYB O;  4DV0 B;  3NR7 A;  4JZG A;  1IXB A;  2OT5 A;  2ADQ B;  2DWE C;  2DJG B;  5EK0 A;  2BTO A;  1F2B A;  2WPD G;  3FAV B;  4JI3 O;  1Y4M A;  5J2U B;  1Y6X A;  2QWN B;  3RNV A;  2FKX A;  3QG5 A;  5H6R A;  5IJ0 B;  2EIK C;  3K5M A;  1SZT A;  3ML0 A;  2WBF X;  4PAD A;  1DTO A;  3RFR A;  3CRC A;  4DR4 B;  4IHJ A;  4P9O A;  3T1C A;  2Z3Y A;  1OCC B;  4GKK B;  3CC7 V;  3ABM C;  3CC2 V;  1YXB A;  7PCK A;  1OCR C;  1YCI A;  4X6I A;  4OX9 B;  1I7F A;  3LUT B;  1PPD A;  2IBZ H;  1O9G A;  5LHH A;  2RN9 A;  1QU7 A;  1WA8 A;  1IVS A;  2QWR B;  1WPX A;  1QVG U;  3JCZ A;  4W4K A;  1NPZ A;  1Z2G A;  2BTQ B;  2X6A A;  1VQN V;  1H38 A;  3HKB A;  3JAK A;  1WAZ A;  3K5L A;  4KXR A;  2XAQ A;  4MT8 A;  3DXR B;  4LH6 A;  1UKF A;  3VQW A;  2B1I A;  2QM4 A;  2W0X A;  2EBO A;  3MHS C;  1KB9 F;  4FIP A;  2QE7 G;  2QTS A;  1JQ0 A;  3F5T A;  3SJC C;  5EZQ A;  4OX9 O;  2YJB A;  3B4S A;  3WG7 C;  5CA1 A;  1P7B A;  5LHG A;  4AI8 A;  2ADP A;  1YDX A;  1VF5 B;  4LNU A;  5LP6 B;  4UB8 Z;  1BHB A;  3PHX A;  4DR7 O;  2HD5 A;  2WLL B;  3L75 H;  3L9D A;  1NS1 A;  2RMK B;  1WNS A;  1QHT A;  4OVZ B;  1NLJ A;  3RVZ A;  2B5U A;  1XMO O;  3CCJ V;  4TV8 B;  2HP8 A;  1SP4 B;  3SJB C;  3DSQ A;  1NVP D;  4NVP A;  3C90 A;  3T1H O;  4QRX A;  4GT1 A;  5LHI A;  1PNL A;  2PYJ A;  4LWS A;  1Y76 A;  3PRP A;  2ZXW B;  3VQY A;  4LF8 B;  2P22 C;  1Q6I A;  3MD0 A;  4AIL C;  1YSC A;  3BAB A;  5B66 Z;  3N27 A;  3CC4 V;  3TNX A;  4KP4 A;  3PN1 A;  1EN6 A;  4I50 B;  5JQG A;  1H2L A;  4LF7 O;  1DKI A;  4OEL A;  3PJS K;  2ZM6 O;  3EFF K;  4O4J A;  2NQA A;  5KO3 A;  1W59 A;  2RQ6 A;  2O6X A;  4HYO A;  2ZD9 A;  3WU2 Z;  2O57 A;  4LFC B;  3O1G A;  4TV9 A;  4J7K A;  3BPZ A;  3RYC B;  5B1A C;  1KHQ A;  1ME4 A;  1G1X B;  2HXZ A;  4H0L B;  4J41 A;  1EFR G;  4Z2W A;  3W7S A;  2EIK B;  4GX1 A;  4IIJ B;  4LF6 B;  4JI6 B;  1AYU A;  4AHC A;  5JZE A;  3IUT A;  5LXT A;  3ABM B;  3P5X A;  1N34 B;  1TUE B;  2PY5 A;  1OCR B;  2HWK A;  1RSO B;  4X65 B;  3U8E A;  4QE9 A;  1VQO V;  3N2G A;  4JAU A;  2PAD A;  3M99 A;  2XU3 A;  1RP3 B;  4O2B A;  2V7Q G;  4H44 B;  1KKC A;  2HKO A;  4NKG B;  4LFC O;  1QVF U;  1PPN A;  1PL0 A;  4X88 A;  3ZMU A;  1S5J A;  2YJC A;  1U5I A;  3CXH F;  1Y4H A;  3S3Q A;  2DYS C;  5J2U A;  5IJ0 A;  2JTC A;  4LF6 O;  1SS3 A;  3HKC B;  3WB1 A;  2PNS A;  3CMA V;  2Q7H A;  1GH6 A;  1S76 D;  1H2M A;  1XBL A;  4HXD B;  5FPO A;  2PUS A;  2BOC C;  3ZNH A;  2GSM B;  2W0F C;  2WA4 A;  4JI1 B;  4OPA A;  4YVA A;  1K33 A;  2JRI A;  3KG2 A;  4FLW A;  1ORQ C;  1VQM V;  3H1J H;  2Y5B A;  3FYI B;  2F4V O;  4JI4 B;  2CDY A;  4PDM A;  1XHX A;  5KHG A;  2JQF R;  3KW9 A;  3DTU B;  2WLN A;  3ABL C;  4DV3 O;  2IJJ A;  3ETG A;  4FLV A;  3HB3 B;  1EZV H;  5DN6 G;  3HKE B;  1I94 B;  3ZX6 A;  1NTM H;  1NT2 B;  1HR0 O;  1NR1 A;  1TGO A;  2CTW A;  2Y69 C;  3RVW A;  2ZIN A;  2DN9 A;  4U3J B;  4DR1 B;  1R6N A;  2YIC A;  4JYY A;  5LP6 A;  4BIO A;  2HJF C;  5KAI Z;  2UU9 O;  1M93 A;  2WLL A;  4GKJ B;  3OEE G;  1PBH A;  2B1G A;  4OVZ A;  5B1A B;  3DGE A;  4PP1 A;  3I06 A;  4TV8 A;  3C9E A;  4YYU A;  2IU3 A;  1H2N A;  1MNG A;  5DEC A;  2GTA A;  3PSE A;  4REZ A;  2EJ7 A;  5BY1 A;  3K9A A;  1CS8 A;  5J2T A;  3ZRS A;  3FX7 A;  1I94 O;  3IEJ A;  5C8Y B;  3OR7 C;  3ZBH A;  4NTX A;  4GZR B;  5IYZ B;  1PM9 A;  2WLI B;  3RYF B;  4OGQ B;  4CZZ A;  1R6K A;  2IU0 A;  2KG7 B;  1W0J G;  4I50 A;  3HWN A;  3T4Z A;  5LOV A;  3SPJ A;  4XDK A;  2QWQ B;  4PEL A;  3E1Z B;  4YY3 B;  1IDS A;  3OD4 A;  1GAX A;  1K9M W;  5ITZ A;  4GKJ O;  2R9F A;  4O4L B;  1GM9 A;  2DQ0 A;  1G8M A;  1JPX A;  2HHH B;  3H7D A;  2BDL A;  4EFE A;  5DM6 V;  2DYS B;  4PP2 E;  2LQT A;  4DW0 A;  2ZDI C;  1ME3 A;  3STZ C;  2YJ9 A;  1TAE A;  2PBH A;  4B3S B;  4MI7 A;  3V6E A;  2E3C A;  3RYI B;  5H5N A;  9PAP A;  4TWK A;  1FS0 G;  1F29 A;  4WFH A;  4X1I A;  1GO3 F;  3BB7 A;  3RT3 C;  2K9P A;  1GM7 A;  5IYD O;  1VQ9 V;  1Q6H A;  1UFI A;  4MW8 A;  4FM1 A;  1PPP A;  2YEV B;  5CBG A;  2Z0A A;  2FTD A;  4DMY A;  2IW5 A;  4HBN A;  3MDS A;  1RSO A;  4RF1 A;  3C3T A;  4MTF A;  1J5E B;  4YY3 O;  1W0K G;  1SA0 B;  1NR7 A;  5L3B A;  1I5X A;  4FLT A;  1AYW A;  3VBB A;  2BCC H;  2VHF A;  4UCV A;  1EWP A;  4DV6 B;  2HHH O;  3ABL B;  1IXM A;  2ZE8 A;  1VQ7 V;  3P3P A;  3PNR A;  3TRK A;  2AXT Z;  4DR5 B;  4D8E A;  4B3S O;  2R9C A;  4W5B A;  2AS8 A;  5E6J A;  2JVD A;  3HKC A;  4B3M B;  5LMN O;  2HH5 A;  1UPG A;  2UUB O;  1NI8 A;  1URF A;  1IWD A;  2Y69 B;  3W7W A;  2B1M A;  1J5E O;  3ZMT A;  4AXM A;  2P5O A;  1MA1 A;  3L70 H;  4O4I A;  3BA8 A;  3L72 H;  2AIM A;  3W7U A;  4P16 A;  3H6S A;  1OJH A;  2ATK C;  4DV6 O;  4MZS A;  2RDC A;  4MTX A;  2AYN A;  4DR5 O;  2H94 A;  1N33 B;  3ZHQ A;  3OVX A;  2CK3 G;  1U9X A;  3KKU A;  3PHU A;  3S3W A;  4MS2 A;  4I07 A;  5BXZ A;  4X64 B;  3HKE A;  4OPH A;  2BDZ A;  4W5C A;  4RAI A;  1N36 O;  3WXG A;  1NKD A;  3CBJ A;  1GMY A;  1FXK B;  1R3L C;  2BTW B;  1GK9 A;  1ICF A;  2VQF B;  3QT4 A;  4U3J A;  1QR8 A;  4N79 A;  1SRY A;  2CAZ C;  2LGW A;  1CEZ A;  2G38 A;  2H3O A;  1U97 A;  4RQF A;  3KWZ A;  4KLB A;  2LP7 A;  4RO2 A;  1QDQ A;  2DCC A;  4LF5 B;  3BHP A;  2DZZ A;  2P6J A;  3JAL A;  3E89 A;  4RWU A;  1N33 O;  4RF0 A;  5EYP B;  4G27 B;  4JAS A;  3ZHU A;  3PDF A;  3LFY A;  4X64 O;  2EUL A;  3OF9 A;  2PGG A;  4WFG A;  1FXH A;  1Y67 A;  5D5Q A;  2F1M A;  2ITD C;  5C8Y A;  1P7G A;  2NQD B;  3PBH A;  1EN5 A;  5IYZ A;  1BQ0 A;  3RYF A;  4FPP A;  4RKX A;  1F51 A;  3U11 A;  1EF7 A;  3CHX A;  4BW5 A;  2VQF O;  5CMU A;  5EIB C;  5KHH A;  4MZO A;  1AP5 A;  2QSA A;  4D7T A;  1JMK C;  2W6J G;  3G80 A;  1SNK A;  5KHJ A;  1YTF B;  3FB5 C;  3H89 A;  4EFB A;  1S4V A;  2XU5 A;  4DV1 O;  2HEP A;  1NVP B;  1R3K C;  2E01 A;  3JD4 A;  3UM7 A;  3RYI A;  4X8A A;  4DV2 O;  3JSL A;  2YIB D;  4WF9 V;  4K8X A;  2HFE C;  3D3Q A;  1EM1 A;  1I08 A;  1F4N A;  4XZX A;  5BR8 O;  4YHH B;  1Q90 D;  2LFS A;  5EC1 C;  3F5W C;  1AIM A;  1BGY H;  3ZUA A;  4LH7 A;  3JYC A;  4TSF G;  1SA0 A;  4FLU A;  4GUN A;  4YIO A;  4X1Y B;  2UXD B;  4D8B A;  2P7U A;  2JS3 A;  2PI5 A;  3BCN A;  2ZIM A;  5CN0 A;  1CQD A;  1YVB A;  3P5U A;  4F6E A;  4D7S A;  2UUC B;  5EBM C;  5HFL A;  1YK8 A;  2DCD A;  1MSD A;  1XNR O;  2RNB A;  4U7O A;  3M7M X;  1MG1 A;  1PXV A;  4J9Y B;  1LNQ A;  4IT5 A;  3OMA B;  1H2S B;  2LW1 A;  3B79 A;  4GX2 A;  1THE A;  4BW9 A;  2FO5 A;  2UXX A;  3K57 A;  1ZUQ A;  2IJI A;  4O4J B;  4X66 O;  4K0K B;  2JEX A;  3BRC A;  1PIP A;  1IX9 A;  2WLM A;  4ZHQ B;  2F7D A;  4JI0 B;  3KSE A;  3AEI A;  2ODM A;  3FD9 A;  2AUZ A;  5EZS A;  4J42 A;  3QO7 A;  5LGN A;  5FL7 G;  4QE7 A;  4JYA O;  5CA3 A;  1JVM A;  3OR6 C;  4RUE A;  4BOU A;  2HR3 A;  4R3D A;  4DW1 A;  1SQQ H;  2P06 A;  4MTO A;  1AB3 A;  1QLN A;  2XU4 A;  4UCT A;  4DR2 O;  2Q0O C;  3ZED A;  3FKS G;  2JDI G;  1FXK A;  3CCR V;  5CHT A;  2DCA A;  4WBN A;  1S5H C;  1AJN A;  4JZ2 A;  2IBI A;  3K79 A;  3N2G B;  4LFB O;  2R9M A;  2CTQ A;  2XAJ A;  4IGG A;  2QGN A;  1NH2 D;  4YIP A;  4O2B B;  3P32 A;  3K03 A;  3SYQ A;  1TU6 A;  1PD3 A;  5DED A;  1K5Q A;  2KSD A;  4EKW A;  3B2E E;  3P5V A;  5IJ9 B;  4DV7 O;  1MZE A;  2GHY A;  2EZO A;  4WCE V;  3V6C A;  3G6E V;  2ZDI A;  4DR6 O;  3JD0 A;  4UCR A;  3ZHR A;  1GM8 A;  4JAV A;  4RNA A;  1W2B U;  5EYP A;  2Z84 A;  2C0Y A;  2QDO A;  3LXS A;  4GCZ A;  4ABM A;  1ZCM A;  3I56 V;  3ZMS A;  2JJ1 G;  1YJ9 V;  5H9C A;  3TXQ A;  4F6R A;  4JI7 O;  1IBK O;  1MMM A;  4QPJ A;  3BY6 A;  4E2L A;  2ATO A;  4IP3 A;  5JH3 A;  4DV0 O;  3D36 A;  5F2V O;  3K59 A;  1STF E;  4UUJ C;  2YI9 A;  4CH6 A;  3QO8 A;  2E5L B;  2XU1 A;  5CA0 A;  1CSB B;  1YK7 A;  4CZW A;  2DYR C;  2C2A A;  2Y0P A;  3SYA A;  2UXB B;  4EEQ A;  1NL6 A;  3VQX A;  1SF9 A;  4Q8H A;  1JOY A;  4UXN A;  3CCQ V;  4DR4 O;  3W31 A;  1AJP A;  1BMF G;  5K1P A;  4GKK O;  1AU2 A;  2E03 A;  2FYE A;  2KQX A;  2GFO A;  2R6N A;  3H1L H;  3OM3 B;  2EIL C;  5GON B;  1XRE A;  1ZWI C;  3CCE V;  4QH6 A;  2FYU H;  3E8G A;  5J9P C;  1S72 V;  1Q7Y W;  4X1Y A;  2Q7E A;  4Q20 A;  1HNX B;  4CC6 A;  2Q68 A;  3G67 A;  3RWR D;  3IJ4 A;  1EWO A;  3E2E A;  2UXB O;  3ETE A;  4J11 A;  2W6I G;  5J2T B;  1US6 A;  4MSX A;  4KUM A;  1AI4 A;  2ZQM A;  1MOF A;  1YIJ V;  2ARY A;  2EZP A;  3JAW A;  2YJ2 A;  1KXR A;  5HFM A;  3K9S A;  3ZN0 A;  1FFX A;  3HHA A;  2ZR2 A;  2Y4T A;  4NTW A;  1YHQ V;  1P4R A;  3LSS A;  5LOV B;  4O4H A;  3WXE A;  1JX9 A;  3SR2 C;  1VQP V;  4CS2 A;  4R50 A;  5ITZ B;  2P0R A;  4JF3 A;  4ZHQ A;  2OWO A;  3N3G A;  2JIZ G;  3ZRV A;  3OUS A;  4R6Z A;  2G6D A;  1VQ5 V;  5JJE B;  5D5P A;  3CRA A;  1Q86 W;  4CS4 A;  5JCO A;  3LDD A;  1CXZ B;  2YJ8 A;  2N74 A;  4R8C A;  1K97 A;  1M9N A;  2AVW A;  2H7J A;  2AW9 A;  1KYO F;  2L35 A;  4MVO A;  4UFZ A;  4X1I B;  1CB5 A;  5A24 A;  1SQB H;  4LF8 O;  3OF8 A;  3CX5 F;  2LFR A;  2GUZ A;  4H13 B;  3SPC A;  2P7T C;  2HVJ C;  2R72 A;  4EB6 A;  3D8C A;  4I4T A;  4TOI A;  1K73 W;  2ARH A;  3APQ A;  3R65 A;  2Q9L A;  8PCH A;  2X6C A;  2QWP B;  4FMT A;  1BQZ A;  3B8M A;  1YAL A;  4CDE B;  5LL6 Y;  4IYI A;  3N3K A;  5H6Q A;  4X1K A;  4WFB V;  4MM3 B;  5IJ9 A;  3K0D A;  5KMG B;  1G6U A;  3E8B A;  2DYR B; 
#chains in the Genus database with same CATH homology
 4AQY O;  1YZB A;  4GUA A;  2F4V O;  1N33 O;  4B3R O;  4RF0 A;  2Z0A A;  1FYJ A;  2BTW A;  3C0R A;  4JI6 O;  3MP2 A;  5EZS A;  3TMP A;  4JI2 O;  3PRP A;  4RF1 A;  4DUZ O;  4X64 O;  3MJ5 A;  4YY3 O;  4X62 O;  4JYA O;  4DV3 O;  2UZJ A;  1N34 O;  4BOU A;  4R3D A;  1DKI A;  4RKX A;  4LF7 O;  1AB3 A;  2ZM6 O;  3PHW A;  2DJV A;  4DR2 O;  1IBL O;  2VQF O;  4X65 O;  4YHH O;  1X59 A;  2HHH O;  5KO3 A;  1HR0 O;  4JI3 O;  3RNV A;  4NXN O;  2UUA O;  3TRK A;  2FKX A;  4D8E A;  5A2Q N;  1IBM O;  2UXB O;  4B3S O;  3PRM A;  5IWA O;  2VQE O;  4A5U A;  4BOP A;  5E6J A;  5LMN O;  1HNZ O;  2UXD O;  4ZTB A;  2FE8 A;  4LFB O;  2UUB O;  1G1X B;  3PT2 A;  2UU9 O;  4DV1 O;  2UUC O;  4NXM O;  1XEQ A;  2J7Q C;  5IT9 N;  4DV5 O;  3J80 N;  3W30 A;  4OVZ A;  3J7A U;  2ZKO A;  4DV2 O;  2UXC O;  2E5L O;  4DV7 O;  4DR3 O;  1D2D A;  3E9S A;  5JZE A;  1N32 O;  1J5E O;  3M8A A;  1R1B A;  1A32 A;  3J81 N;  3PSE A;  1PVJ A;  3R66 A;  4DR6 O;  4REZ A;  4BOQ A;  5BY1 A;  3JAM N;  3MTV A;  1HNW O;  3OTO O;  2HWK A;  3IFU A;  4RNA A;  4XZX A;  4BOZ A;  5BR8 O;  2Z84 A;  4JI1 O;  4P16 A;  1I94 O;  3OQC A;  4KHP O;  4DV6 O;  4LF9 O;  4PT5 A;  4LFA O;  1AIL A;  4LF5 O;  4K0K O;  4DR5 O;  2N74 A;  3B21 A;  5LMU O;  1UKF A;  4B3T O;  4JI0 O;  4LFC O;  4JI4 O;  4BOS A;  3PHU A;  1XMQ O;  4LF4 O;  4IUM A;  4D8B A;  4JI7 O;  1IBK O;  2BU3 A;  5BXZ A;  4OPH A;  1N36 O;  4LF8 O;  4OW0 A;  4DV4 O;  2LW7 A;  4IP3 A;  4DV0 O;  2J7Q A;  4GKJ O;  4JV5 O;  3T1Y O;  2JTC A;  4LF6 O;  4A5U B;  3F5T A;  1XNR O;  5EZQ A;  4WUR A;  4OX9 O;  2BTW B;  3SDL A;  1KUQ A;  4M0W A;  4D8I A;  3BBA A;  3O65 A;  1HNX O;  4HXD B;  3PHX A;  1R6T A;  4DR7 O;  1NS1 A;  1FJG O;  4MI7 A;  3ZNH A;  4JI8 O;  4OVZ B;  4JI5 O;  2AGA A;  5LL6 Y;  5H5N A;  5FLX N;  4OPA A;  1XMO O;  1DK1 A;  1FKA O;  4B3M O;  3BY4 A;  4MM3 B;  1XNQ O;  2JRI A;  4DUY O;  4DR4 O;  3BB7 A;  4X66 O;  3RT3 C;  2DOS A;  3W31 A;  1F7Y A;  3T1H O;  4DR1 O;  4GKK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...