2DOSA

Structural basis for the recognition of lys48-linked polyubiquitin chain by the josephin domain of ataxin-3, a putative deubiquitinating enzyme
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
b'MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ataxin-3
molecule tags Hydrolase
source organism Homo sapiens
publication title Mode of substrate recognition by the Josephin domain of ataxin-3, which has an endo-type deubiquitinase activity.
pubmed doi rcsb
total genus 37
structure length 171
sequence length 171
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2dosA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2dosA01
2N74A 4DR2O 2HHHO 1XNQO 3R66A 4OPAA 4JI4O 1DK1A 4LF5O 4NXMO 2AGAA 4NXNO 1N33O 1AILA 1HNWO 2Z0AA 1F7YA 2ZKOA 4DR1O 4DR7O 4DR4O 2UUAO 5BR8O 4LFBO 4B3RO 4KHPO 4JI6O 2UXDO 3T1HO 4B3TO 4YHHO 1FKAO 4LF9O 5BY1A 4JI2O 2UXCO 4A5UB 4DV2O 4DR5O 4X64O 3J80N 4LF6O 2UUCO 1NS1A 2VQEO 1D2DA 4X65O 4DV5O 5H5NA 1IBKO 4JI5O 1XNRO 4LF8O 4B3SO 4OPHA 1KUQA 3JAMN 4JI8O 4DV4O 3RT3C 4JI1O 3T1YO 5LMUO 4B3MO 1YZBA 1N34O 2ZM6O 2DOSA 1IBMO 4JV5O 1HNZO 1R6TA 2VQFO 1R1BA 2E5LO 4X62O 4LF4O 5A2QN 5LL6Y 3OTOO 4DR6O 3M8AA 5FLXN 4LFAO 4K0KO 3J7AU 5IT9N 1N32O 4JI0O 2UXBO 3J81N 5LMNO 1X59A 5BXZA 1I94O 1XEQA 1A32A 1N36O 2FKXA 4DV6O 4OX9O 1FJGO 1HNXO 4GKJO 4DUZO 4DR3O 4DV1O 4YY3O 4DV7O 5IWAO 1J5EO 4JYAO 4GKKO 1XMOO 4DV3O 1G1XB 4JI3O 1FYJA 2DJVA 4AQYO 4X66O 4JI7O 3SDLA 4DV0O 4LFCO 2UUBO 4DUYO 2LW7A 4LF7O 3F5TA 3O65A 1AB3A 1HR0O 2UU9O 2F4VO 2JRIA 1XMQO 1IBLO
chains in the Genus database with same CATH superfamily
1F51A 4JI4O 3DF0A 4JYCA 1VQKV 1U9XA 2VHSA 5JJNB 3E8BA 1Q6KA 2WA4A 4ZIBA 2V7QG 3CCMV 4K7CA 1AJQA 2CTPA 2YEVB 3RYFA 3M99B 4CH5A 2DCDA 4HNAB 3H1IH 3BRCA 3J80N 2B9ZA 4QE9A 2VQEO 4CDFB 2G8EA 2YXLA 3C0RA 3OMAB 3PSEA 4X6JA 4WURA 2B1GA 2IU3A 5EK0A 1KUQA 2ADPA 3K5LA 1Z5VA 1AROP 1NH2D 4Z2WA 4X6IA 2XAHA 5LMUO 2H3OA 2WLJA 1M6DA 3ABKC 3U10A 4X66B 1XREA 1IBMO 4CS2A 2OIGA 1YK8A 4PI2A 4FZ0A 4LF8B 5FNVA 3ZIAG 1NTMH 5KHJA 4UVCA 4CH3A 3P32A 1JJOA 1EF7A 1Y74A 2Q7HA 2JEXA 2AHYA 2Y48A 3RGBA 2OULA 1F2BA 1KYOF 3E86A 1HNWB 1Q43A 2RNBA 3LXSA 1X59A 4NYKA 1CP9A 3CWBH 1QR9A 1NQTA 4X88A 1V55C 2LFSA 1EN5A 4H37A 1JMKC 1PVJA 3BABA 2FTKA 2Q7EA 3OR6C 4J7ZA 4Q6GA 3IUTA 4OW0A 8PCHA 3DGEA 1JX9A 5IWAO 3CPWU 1PL4A 2AW9A 1ME4A 3L72H 1HWYA 1GMGA 1KHPA 2JTCA 2EULA 4DV0O 2Y0IA 3H1LH 5KHGA 1H2SB 1Y74B 3TMPA 2QGNA 3K59A 1NZ6A 2AYNA 4DMYA 1CVZA 3KWZA 5CVOB 4UVBA 2B1IA 3E9SA 2BTOA 5CB4A 1AP5A 3ASOB 2AUXA 4DK0A 5B1AC 1VQ5V 4QPKA 1Q6UA 3BBAA 2R70A 1SESA 1Q6HA 5BR8O 2QJ1A 4D8BA 1OCZC 3OFNG 3PN1A 5JJEB 1P4RA 5CA0B 4BW9A 4B08A 2DW4A 2YIDA 3UM7A 4BIOA 3T1CA 3K03A 4DV4B 3RVVA 2X0LA 1EFRG 1ZLZA 2F95B 2ZM6B 4JZGA 1HW7A 2DYSC 3PJSK 2DZZA 1ZUQA 2GUZB 5EBLC 3ASOC 1E1RG 2GSMB 5B1AB 2ZINA 1CPYA 4GX5A 4JYYA 5LGTA 4XR7A 4DV7B 3SYPA 2IJIA 4MZSA 2AU1A 4R50A 5L3CA 1DF5A 4LH7A 2PZSA 1YVBA 5EZYA 2ZNJA 4CS3A 5J9PC 1I94B 1OCRB 2ARHA 1S0VA 1I5XA 1AYVA 1PV0A 3LNNA 5JZEA 1GMYA 3K9SA 1PPPA 3CCJV 1SQPH 1MZFA 4P16A 3L74H 2L35A 1KECA 4IUMA 1DKIA 4GUAA 1NKDA 5BZBA 4DR7B 3T4DA 3NXSA 4GZRB 3N3GA 4DMXA 4MT8A 1FFXB 1KKDA 1QOLA 5CA1A 1AU2A 4GKKO 4JYAB 3TETA 2UUBB 2NLJC 2D2CB 1GN3A 3JATB 4CDCB 1U9QX 5LXTB 4JI2B 2UXCB 1WP7A 2HXZA 1IBKB 4DUYO 4PADA 4QJFB 1ITOA 3F5TA 4UCSA 3KCYA 3BB7A 3SYAA 2CTRA 2PF4E 4GX1A 4IL6Z 4QH6A 3CX5F 2LGWA 2EJRA 1PPOA 5CVNB 1XNQO 1K3BB 1SERA 2W6IG 1QLNA 2PI5A 4NXNO 2FT2A 1QR8A 2B5UA 1Y08A 3B21A 3JSNA 1AU3A 1M90W 4REZA 4L87A 4NR1A 1IBMB 1JFFB 2X7RB 4KHPO 1FPOA 1XHZA 1PE6A 3PBHA 3IV2A 3CCRV 2BOCC 4I0XB 3FKSG 4JTAB 1RPRA 2V1DA 2X6AA 1EM1A 1VQ9V 4O4IB 4YYQA 2BTWB 1FXHA 4LCUC 4LF8O 3OEHG 1H2MA 4B3SO 1Y4MA 3EFFK 4EKWA 4O4JB 1S77D 2YJCA 1W0JG 1Y4HA 2DQ0A 2FMLA 4X9QA 1VQMV 2XAFA 1NPZA 3D36C 2QTOA 4YHHB 1KQSU 3CMAV 1PBHA 2GDSA 3LDCA 2Y5BA 1MOFA 4BIUA 4QRXA 2HVKC 2VQFO 3RYCB 1LUWA 4PP1A 1AI4A 1XDCA 4I4TB 4P2ZA 4YJ3A 3IFUA 1IXBA 1ICFA 4LFAO 3K9MA 1IX9A 1Q86W 1AI7A 1R6NA 4I0XA 4GT1A 5IY5B 2Y4TA 3OM3B 1QU7A 1R3IC 2EIMC 3CRMA 1FD9A 3PW3A 3K8UA 1IZ3A 1ZX3A 1UPGA 4U3FH 4RKXA 2IU0A 5L3FA 2QWOB 4IIJB 2GHUA 2EJ7A 3WU2Z 3K24A 4U7NA 2JK5C 4FLUA 2JDIG 4I07A 3DC5A 4RF1A 1FYJA 4QE7A 4JI3B 3Q4HB 3QSDA 4J9ZB 4JI5B 4LFCO 2ARYA 3PRMA 3UKMA 3F5WC 2W0FC 4UCRA 3FB5C 2LO1A 3I5DA 4D8IA 2ZR2A 2FE8A 1EWOA 2E01A 1U96A 5GTHZ 1H2KA 1D5NA 1BSMA 1F2CA 2JJ1G 3ZRWB 3KKUA 3CCEV 4C7UA 5F2VO 3JCZA 2WSSG 5L3BA 2P6JA 4ZHQB 3W30A 1D5AA 1H2LA 2JGDB 1WJZA 1SA0B 3MHHC 3O0UA 4I9QA 1AR4A 5ITZA 2YXYA 3ZRSA 2Q4PA 1CJLA 3FYEB 3HR0A 3JD1A 3N3KA 1JJ2U 3T1HO 4O4LB 1AYWA 2F1MA 3OT7A 1SQXH 4OEMA 4JI2O 1SZXA 2UXCO 3A0RA 4FPPA 1SZTA 3E22B 4LF6O 3OGCC 4MVRA 3OISA 2P4KA 4X65O 1QLEB 3QNEA 1YALA 5H5NA 2DCBA 2CGNA 5FPWA 2PGGA 3RYIA 2R9FA 3N27A 2FQ9A 1F29A 2LJ2A 1SC5B 3SPJA 2WLIA 3LDDA 5KAIZ 1Y76B 2KG7B 2G7YA 1CB5A 2ITDC 3RVYA 1S4VA 5BMVB 1PNMA 2ZE8A 1YZBA 1N0JA 5IJ0A 3QT4A 2HHNA 4WA6A 2NN4A 2WLHA 4FLTA 1A6RA 4AXLA 1SQVH 4N8WA 1SA0A 1IURA 3D3QA 4ASUG 1KP2A 1TUBB 1V55B 2GTSA 3HKEA 1AP6A 1KP3A 2ZIOA 2HHHB 1IVSA 5L3EA 1B06A 6PADA 1AR1B 4PA4A 2E3CA 1U9WA 3OMIB 1PP9H 3F7VC 4X1IA 2EZPA 1KB9F 2JGUA 3H01A 3HKBA 4UV9A 1FXKC 1JA8A 2OIEA 4B7EA 2OT5A 1EZJA 3UO3A 5JWPA 4YIPA 1Z2GA 2UU9B 1TA8A 1IDSA 3L71H 3ZHTA 3LSQA 2YS8A 1NLJA 3K08A 1VQ8V 1LUVA 3SGIA 5E6JA 2ZIMA 4DRXA 2R9NA 1K8AW 4AILC 3CCVV 2LGQA 4FLXA 3O1GA 3STZC 3OMNB 5IYBO 2BE3A 1FXKB 3AG4C 5B1OA 4LP8A 4NXMB 4QBBA 4E2LA 3ZRVA 3QTCA 4IYHA 2YJ2A 1F7YA 3ABMB 1K9MW 3KFQA 2DYSB 2NQDB 1N33B 2AS8A 1K34A 2ADQB 3CSXA 4X1KB 1UJWB 4YHHO 2QDOA 1ZWIC 5BY1A 2JIZG 1NJIW 2F4VB 3ZUAA 4DR5O 2PY5A 3ZMUA 2CIOA 7PCKA 3BPZA 3D8CA 5L3DA 2ATKC 5KUKA 4WFGA 1JQ0A 1K5QA 2YJBA 1IBKO 4PI0A 3E1ZB 2VQFB 5HFMA 4DR3B 3SR2C 3MJ5A 2IH1C 2F43G 1BQIA 4AI8A 1XMOB 3SYOA 1E1QG 3KSEA 3A8TA 1SQGA 1DTOA 5B1BB 1K92A 1XHXA 2GTAA 2HH5A 4MVUA 4LBEC 2B1MA 4KP4A 1GCBA 2YJ9A 3CRRA 3E83A 3ASNB 1PNLA 3D36A 5EBMC 4O4JA 4DR6B 4W5BA 5IT9N 2AXTZ 3CCQV 3KX1A 3BA9A 4H13B 3KZIZ 3VQXA 3KKYA 3FD9A 1MIRA 5IE9A 4F6EA 3QO5A 4J7KA 2WBFX 3W7XA 2BTQB 4OX9O 4HWYA 1NB5A 3CMEV 1NTZH 1JVMA 2PI4A 1CPJA 3ASNC 1NB3A 5KAFZ 1NU1H 3E22A 2BCCH 5D5QA 1ROPA 1N4CA 5LYJB 1YSCA 1DGSA 1H2NA 4MM3B 4DV5B 4ZKIA 1DEUA 5KHKA 1VF7A 4CDDB 4LF6B 3P5UA 4B3RB 1M9NA 4MVQA 4TQDA 2JRIA 1W2BU 4FK5A 5JCOC 2LP7A 3SJBC 3AG7A 3O9OA 4H44B 5EZSA 3B8MA 1U5IA 3C3TA 4P9OA 3UQ8A 3G71V 3E8GA 1AYUA 5LGUA 3WG7C 1OHHG 2D3OW 9PAPA 1V54B 2XHBA 5AG2A 5J2TA 3BHPA 2ZDIC 3K5NA 2PBHA 5KUMA 4D6TH 3ZX6A 4LFBO 4AHCA 5EIBD 2CTQA 5K1PA 2RDCA 5LA6A 4UB6Z 5JVDA 4RQEA 2H94A 1RPOA 1N32B 4DV2O 3KCXA 3E8FA 1RFYA 1D2DA 4TSFG 4RO2A 3OTOB 3MTVA 2JQGR 1CSBB 1SRYA 2QM7A 1WN7A 4DV1B 4DUZB 3BVOA 3B8NA 3HHAA 3PDFA 3AK2A 4K35A 2XNDG 4FMTA 4IP3A 4JYBA 4JGSA 3AG3B 2OP3A 4WFEA 3L9DA 1K5SA 4J42A 3ZBHA 5IY5C 2PYLA 5FNVB 2IJHA 5A2QN 1EZVH 3JD0A 3FAVB 4KUMA 1NQCA 2DC9A 4RAIA 1X4TA 2Q7GA 4YIOA 1RM1C 2Q9LA 2Q67A 3JATA 3BCCH 2DC8A 2LW1A 1N8RW 3JALA 1S5HC 2KB1A 5ITZB 4X89A 2FYUH 4DV6O 2EBOA 1VJVA 2CGOA 1VP7A 3D6SA 3K3WA 4OELA 2XASA 3DSQA 3TK1A 1EWPA 4BOPA 4DV7O 1VQ7V 3E89A 3ZHQA 3K5MA 4ZI7B 1YTFB 3JAWB 3MORA 3OUSA 1NR1A 3K0DA 3S3XA 4F6RA 4X66O 4AQYB 2E75B 4EFBA 3ABKB 4J9YB 4EB6B 2JEUA 5LHIA 3IJ4A 2R72A 2QTSA 1YCIA 2PYJA 2R9AA 1YJNV 4K8XA 3K5OA 4J41A 2QA4V 1XMQO 2WA3A 3GCBA 4CS4A 1KU9A 4OPAA 2YIAA 3CBKA 3G4SV 1AECA 4YYVA 2FO5A 1X9YA 1TUBA 4DR5B 3U0ZA 3WB2A 2YICA 4FFBA 2JVDA 2UUAO 2GUZA 4B3RO 5CBGA 2DE0X 1VARA 4IHJB 4JI6O 2UXDO 2FTDA 2R9IA 4TOIA 3SPGA 5J2UA 4G54A 1B6QA 1TAEA 2HFEC 2GV9A 1NBMG 2R6NA 5CVMA 5IJ9A 2R9RB 1L0LH 5E79Z 3HKCB 3JARB 4G27B 3MDSA 1EWLA 3BOWA 3CB2A 3UO2A 1VF6A 2Q69A 1M57C 3H8BA 3APQA 4ZOLB 2A0LA 4B3MB 3K57A 3U8EA 5EC2C 3OF9A 1N34O 2YUAA 1CXZB 2KKWA 1GN4A 2DOSA 3OEEG 4PA6A 3MHHA 1R6TA 3VBBA 4J11A 4OX9B 1XKGA 4X62O 4JTCB 3JYCA 2IBZH 2PUSA 1Q82W 3F5VA 1MABG 3P5XA 4TWKA 5LOVA 1Q7YW 4FIPC 2E00A 1HNZB 1JQPA 3V6CA 1M5IA 5IJ9B 1BS3A 5LBQA 1L1FA 2R9MA 3CCUV 4X20A 1DF4A 3JD2A 1F2AA 3S3WA 4WFAV 3HKEB 3CJHB 4UUJC 4FLYA 4DR3O 4UCVA 4R7CA 2FUDA 3L73H 4HXDB 4B7KA 1YIJV 3PHWA 1W59A 1J5EO 4NTXA 4BSQA 2YSUB 2QWQB 4JTDB 4BIZA 2YIBD 5JH7B 3HHIA 4P9PA 1RSOB 3PRPA 1TVKB 4L8JA 1SS3A 3DXRB 1OCOB 3ZRXA 1NR7A 1YJWV 1ENVA 4JI6B 5JH3A 3ETQA 4P30A 3CXCU 4CZWA 5C93A 4KFMA 1SF9A 2AUZA 4CH6A 5IJ0B 1K3EA 4NXNB 1WAZA 1VIBA 1DK1A 2OTLV 2E02A 3I3TA 3IOQA 4I04A 1QQCA 4ZBMA 4JZ2A 1PXVA 2BTQA 4PELA 3CS5A 3RYHA 1O9GA 4PI3A 1K7DA 1SQQH 5CHTA 1NVPB 3W7WA 4YYUA 1XMQB 4PDVA 1RSOA 4YVAA 1MDWA 5JH7A 4WF9V 4I9WA 1URFA 2F23A 2RQ6A 2BTWA 1FXVA 1O9HA 5HFLA 2ETNA 3C3SA 1PKXA 4LWSB 4MTOA 5B66Z 4DV5O 1PIPA 4P6GA 3N4CA 5LP6A 3LSSA 4PA9A 3SPCA 3TCUA 1BQZA 2ITCC 3W7TA 2DYRC 3LSUA 3ZJZA 5JVDB 2R9CA 1Q8IA 1N36B 3H1KH 4JAVA 2M7WA 4IYIA 2CH7A 4I4TA 5F02A 2A3QA 4N4ZA 3WXGA 4YY3B 1VQLV 1Z5WA 2UXDB 2GFOA 3LUTB 2AVWA 5KMGA 2JJ2G 2WLIB 4FFKA 2H7JA 4RWUA 4JI0O 1IBLB 5LMNO 1XOUA 3HPLC 4I5SA 4I55A 3OVXA 5KLVH 5TISZ 1VQOV 5LP6B 4PHZA 4JI1B 4BPVA 5CA3A 2A9HA 1YXBA 4X1YA 5B5EZ 2F93B 3P5WA 3HKCA 3JARA 2DN9A 2C2AA 4UXNA 1MSDA 3BPFA 4XDLA 1GLOA 3MP2A 1OV9A 1H2GA 4MI7A 3BC3A 1QXPA 5KX5B 1GM7A 4ICGA 3OGIB 2LW7A 2JQFR 4BOSA 1US6A 3PNRA 1KBHA 2GBOA 3RNVA 4YYWA 3CEIA 4XUIA 2DZYA 2CTWA 2Y0PA 2Z3YA 4MVOA 1BHAA 1AILA 2EZOA 2Q6AA 3CXHF 2E74B 4LF4B 3K9AA 5GTIZ 3E8HA 3KWBX 4LWSA 3ZHRA 2HG5C 2F66C 4QRGA 4MVMA 2DCCA 3E35A 3CE2A 4B3TO 2UXBB 5JA7A 2BU3A 3W7SA 3JALB 3I55V 1BQ0A 5H6QA 2P67A 1IWDA 4R8CA 3JAWA 5DECA 2OYQA 3C9EA 2J7QC 2RMKB 4X62B 1WA8B 2DC6A 5IYCO 4U7OA 5EGWA 3ML0A 5L3GA 1K73W 3CC2V 4PA7A 5CBHA 2DMXA 3K04A 2XT9A 5KMGB 1L8DA 4GUNA 4ZTBA 4BW5A 3B2EE 4O2BA 3GVMA 4UB8Z 1HNZO 2DJGB 1EN4A 3AI8A 4CDEB 1WPBA 3IGAC 1ZCMA 4OVZA 3BPMA 3ABMC 3RVZA 2EILC 4XDKA 4TV8A 2EIMB 5A9GA 5J2UB 5LHGA 4BS6A 3AK3A 2Z84A 3FX7A 3VQWA 3ZN1A 3KG2A 1QCEA 1NTKH 3OVZA 4FFBB 3CRCA 2FKXA 1S3JA 4J80A 1JFFA 1FJGO 3BWKA 1HR0B 4WBNB 4O2AA 2ZR3A 1KXRA 4YY3O 1UFIA 3BEHA 5B1BC 2NQAA 3ZMSA 3AG2C 2EILB 2NQGA 1OCCB 1P7GA 3ZRWA 3OD4A 4DK1A 1AVMA 4F4LA 3WB1A 1R6KA 1J95A 3RN4A 1SQBH 3UT5B 3HD3A 4CC5A 2ZQMA 4WCEV 5B1NA 2BSKB 2NNUA 2ZNIA 4PDMA 1THEA 1WP8A 2CH7B 2CAZC 3G6BA 1N33O 2QWPB 1HNWO 1S5JA 2OWOA 1DLBA 5EC1C 1SETA 2WWWA 3SJCC 5LGNA 3KW9A 1QDQA 2HR3A 4DR7O 4TV9A 4DR4O 1XUQA 4IGGA 5BR8B 1R3LC 3HKDB 4JAAA 4I7ZB 2PREA 3MD0A 4A5UB 3PT2A 4X64O 1TGOA 2O57A 1G4YB 3JD3A 1NH2B 1XNRO 3T2MA 4DUYB 4FJCA 4GX2A 1FFXA 3OF8A 3MHSC 3X2QB 3JAMN 4JI1O 4O4LA 3WG7B 2NQIA 1MMMA 5FPRA 3WB0A 2QWNB 2DWEC 4JV5O 5LP6C 1V54C 2JS5A 3OTOO 1COWG 2KSDA 4KXRA 2AZ0A 1TU6A 2PNSA 3STLC 3JASA 3ZMVA 3A2FA 1N32O 3QVNA 4K8ZA 3ABTA 3H1JH 3IMAA 2XAQA 2EINC 3L70H 1NL6A 5DEDA 4Q8GA 3CH2X 2OCCB 4MVZA 1A32A 1K4DC 3VQYA 1VF6C 4WBNA 2F1GA 3SYQA 1OCOC 4K0KB 2QM8A 4DUZO 2MW2B 4YV8A 4UVAA 1BGOA 1WB8A 3ZHVA 4IHJA 1BP4A 1P49A 2XU3A 3AEIA 3TRKA 2G38A 4YXWG 3FFQA 4HYOA 2P0RA 4MSXA 4X64B 4DV3B 3ZCCA 2VHFA 2A79B 5H2FZ 4IT5A 1R3JC 3FAVA 4G2KA 1GN2A 5KA5A 3P5VA 2Q73A 1AB3A 4W5CA 3H9VA 2WLNA 4QNHB 3RVWA 5CB4B 1POPA 1THZA 4LF5B 3WXEA 3DXRA 5EYPA 4O4IA 5FL7G 3G80A 4H0LB 4DO2A 1BCCH 1QVGU 4EEQA 4KHPB 3W7UA 4KL1A 3S3QA 3BAAA 2ZT9B 4GX0A 2W0XA 2FL4A 3RW0A 2DCAA 1YI2V 2PTMA 1QVFU 3I56V 1BHBA 4Q20A 5J94A 4TUYA 4NB5A 5JQGB 1GM9A 3IAYA 3ETEA 4RY2A 1KD1W 1SNKA 2HJFC 1Q6IA 1Y6XA 4FVMA 4UCUA 3FB8C 5DM6V 2UXXA 3GWOA 3VOUA 4PV1B 4U3JB 1I0HA 4LF9B 4YYSA 2HEPA 1TLOA 2ZM6O 4WFFA 5DN6G 4GKJB 1R1BA 1XBLA 1FJGB 3NHEA 4LF4O 1ZAUA 1N0NA 3GWKC 3CC4V 4LFAB 2YI8A 4MVSA 1BY8A 3SJQC 2P4VA 5H9CA 4TT3G 1BL8A 3RWRD 4JAUA 1EN6A 3JCUZ 4TUYB 2EX3A 5JQGA 2UXBO 4XZXA 1XEQA 5JJJB 4YJ2A 3IC9A 4A5UA 1GO3F 3CRQA 5CHVA 1M57B 2P06A 2O6XA 4FM0A 4DW0A 4DW1A 4PP2E 4Z1VA 3M99A 1BGYH 4J7JA 5LA6B 2OZ2A 1GTOA 1AU0A 1M4UA 3F7YC 5K16A 3LNMB 4W4LA 1HDJA 2UXNA 4X1IB 1AJNA 2X6BA 4JI3O 1NI8A 3NR7A 5IYDO 3OUFA 1NT2B 2JGDA 4JI7O 4MW8A 1H8EG 3OR7C 3AG1C 2MK3A 2QM4A 4B3SB 1EWMA 1F4NA 4PDLA 4J10A 1Y67A 1PD3A 2FRQA 4QPJA 4JI8B 4NVPA 2ZE5A 3H1HH 1SQFA 2HD5A 4GYCB 1OJHA 1F23A 1M56B 3PHXA 1Q81W 2HHHO 4DR2O 5EYPB 1TUEB 3DC6A 5D5PA 1KHQA 4W4UA 4D7TA 3ERVA 4RUEA 3Q4HA 2WLLA 5CN0A 4X20B 2IPPB 4DR1O 2N04A 4FK5C 4IIJA 3WXFA 4NTWA 4JV5B 2BOBC 1P7BA 1ZSPA 2A06H 3K58A 3SJAC 2QKCA 3ICXA 4JASA 1WPXA 1YT7A 2YIBA 2Q0OC 1I08A 1XQ8A 2G6DA 2IJKA 4FZ1A 1MA1A 1N34B 1QNMA 3N2KB 3LDEA 4DV0B 4OXSA 1MHWA 2Q68A 3HKBB 1K97A 1AI5A 1WNSA 2Y4UA 1GN6A 2EINB 5CA0A 3T1YO 4M0WA 4ZHQA 5GW7A 2VQEB 5LXTA 4YYRA 2AYOA 4LR3A 2A7WA 4BWAA 2VWKA 4JPRA 4O2BB 2CUGA 3F75A 1RM1B 4RUFA 3H6SA 4ZUXU 2FYEA 4JF3A 3M8AA 1VEWA 2Q0AA 2FB5A 1M93A 3QG5A 2DJFB 4PD4F 3V6EA 2ACTA 2HKOA 3CCSV 4ZI7A 1BT8A 2XOKG 1OCCC 4JI4B 1VMGA 3DTUB 1N36O 2Q5ZA 5C8YB 5KA6A 1KKCA 5PADA 2DYRB 1KFXL 3SPIA 4D7SA 4UCTA 3QO7A 4DR2B 1CV8A 3G6EV 4X1KA 5IWAB 3ZNHA 1XMOO 1VF5B 4DV3O 1BZKA 4OGQB 3USVA 2DJVA 1G8MA 1XI1A 3ZHSA 4UFZA 3SPHA 2ILMA 2PADA 1GECE 4XDJA 3JAKB 3A0HZ 3B09A 2EIJC 4YJ3B 5E1AC 3ZEDA 4OPHA 4P6EA 1GKFA 3R66A 1JR9A 2QE7G 4R3DA 2ODMA 2XU5A 5CBFA 4LNUA 2ZKOA 2BSKA 3ETGA 3JAKA 1LR1A 4O4HB 1U97A 5CA1B 2XAGA 1DF0A 2CK3G 1FKAO 2XU4A 3HKDA 1CTEA 2EIJB 2X6CA 1U9VA 2W6JG 2NR5A 1VQ6V 2HWKA 3T4ZA 1PADA 2IM9A 1ZL8A 1SP4B 2P90A 1GK9A 3CCLV 3RFRA 2ATOA 1FXKA 1MG1A 2IBIA 3BY4A 3H7DA 1FAFA 1ZTEA 1S5LZ 5CMUA 4MTXA 4RF0A 1JPXA 1K33A 4CC6A 1CS8A 3D3IA 3MTNA 4FIPA 1Y66A 4PJ0Z 1AIMA 1RP3B 1YITV 3U11A 3UT5A 4I05A 2Q8VA 3EVKA 4DR6O 1V9PA 4GCZA 1STFE 4HAMA 2Y69C 2P86A 3BY6A 1XNQB 3BFRA 1QHTA 5EZQA 3OAAG 4PT5A 4BOQA 4BS5A 3IC7A 3CD6V 5LYJA 2LFRA 5IYZB 1ZIVA 1I94O 1ZL8B 4FJCC 2HP8A 3ZMZA 4X1YB 3BA8A 3ABLB 5J2TB 1L0NH 1AJPA 5H6RA 1M56C 4QRVA 1UKFA 2H8PC 4EFEA 1KMIZ 1OCZB 1GH6A 2LQTA 4LH6A 2OTJV 2P7TC 1PPNA 1LNQA 3SDLA 3H8CA 4W4KA 1HP8A 4OVZB 4TV9B 4LNUB 2XU1A 3CP1A 5IDJA 4HBNA 1M1KW 1HR0O 2Y6EA 3AK1A 2K1EA 1IBLO 4JI0B 3AG4B 3R65A 4B3TB 4QIWF 4LF5O 3N2GA 1PL0A 2E76B 4EB6A 1TVKA 1OZ0A 2M6YA 3B77A 2Z0AA 3FB7C 1HNXB 3B4SA 3CBJA 2DWDC 1EBOA 5C8YA 3FB6C 1WA8A 3TXSA 1MEMA 3CJHA 3JD4A 4LFBB 1Y76A 4H33A 1YF2A 3OQCA 5LMNB 3ETDA 3AG2B 2G8JA 2QKAA 1I7FA 4I55B 1S72V 2KQXA 2YDEA 2UUCO 3CRAA 4WFBV 4D8EA 1E79G 4BAYA 1NVPD 2AHZA 4LFCB 4JI5O 3TJTA 3EHBB 3CYOA 4MTFA 3OW2U 4JI8O 4DV2B 4ABMA 2FRAA 3RVXA 1MSWD 2YC0A 2RJZA 3UCSC 4DR1B 3WFVA 4NKGB 3N2KA 1XILA 2ZD9A 3LFYA 3K06A 4UV8A 3OE7G 1R3KC 2KG7A 2UUAB 3J7AU 2WLKA 3P3PA 3RBZA 4CH4A 4DRXB 1TL9A 4CZZA 2ZE7A 2E5LB 1HNXO 5KHHA 2ZDIA 5EF4A 2E03A 4MS2A 1YK7A 1FH0A 3E2EA 5GONB 4I50A 1YHQV 1QLEC 3T1YB 5EZYB 2HJDA 2DQ3A 4FLVA 3N2GB 2HLDG 4FLZA 4R6ZA 3GB7C 1P84F 1ORQC 2N74A 4TV8B 4U3JA 1XL6A 2AGAA 2P22C 4K3AA 3M7MX 4PDRA 4F6RB 5B3SC 4UCOA 1QMYA 3B40A 1MZEA 2HVJC 5LHHA 3TXQA 5EIBC 1PPDA 2QWRB 3IFXA 3QF7A 1PNKA 4X8AA 4XBFA 4LF9O 1CQDA 4GLXA 3S3RA 4TQFA 1W0KG 3TNXA 1KFUL 4YJ2B 3RYHB 1AU4A 4LF7B 2YI9A 1WB7A 3P30A 1VQNV 1MEGA 3THOA 3I06A 4O4HA 1YVWA 2QKSA 3OTFA 3K0GA 3W31A 2GHYA 3ABUA 4B3MO 2BDLA 2AIMA 3AG3C 2CE4A 2B1NA 2YXHA 2QR4A 2ZCEA 1B3QA 2BDZA 1FFTB 4BQVA 3ABLC 1K4CC 3JASB 4FM1A 4DR4B 5FLXN 4O2AB 2L6LA 1MS6A 1H38A 4K0KO 2XAJA 4KLBA 3C90A 2N05A 3VQVA 4RNAA 2C0YA 3J81N 4HNAA 4N21A 1YTFD 2EIKB 5GONA 1BMFG 2Z5UA 3IEJA 3BCNA 1PM9A 4N23A 1QBZA 3CHXA 2IH3C 4GKJO 2VS0A 4RQFA 1AR5A 1IXMA 4I50B 5K1XA 1I5YA 4GKKB 4JYAO 1AI6A 3QJ3A 2RN9A 1G1XB 5LOVB 5IYZA 5EBWC 5JCOA 3SYCA 4MW3A 2XTAA 1VSNA 5KO3A 4HZ3A 1Q3EA 1R73A 3K79A 1XNRB 1HUCB 3G67A 4DV6B 2ZXWC 2EIKC 4LF7O 3O65A 1Q90D 4BR6A 3ZHUA 1VQPV 1BE3H 5BMVA 4X65B 2VWJA 1YDXA 2YJ8A 2OCHA 2UUCB 2XUMA 2F7DA 3CH3X 3A0BZ 4NXMO 4PA3A 4X6HA 1GAXA 2IJJA 3RYIB 4FM2A 2P5OA 2OCCC 2WLMA 4DXWA 4Q8HA 1T5EA 2ZE6A 2ZXWB 3IHPA 3CC7V 4AXMA 3AG1B 1VQ4V 4MTGA 3MHSA 1JOYA 3H89A 2RCVA 1NS1A 3X2QC 1WLEA 1GM8A 2CB5A 3FYIB 4CBCA 4DYLA 5KHIA 1Q5OA 2K9PA 5FPOA 4DV4O 3RT3C 2Y69B 3APOA 1J5EB 4Z1MG 3HB3B 3T1HB 1G6UA 1H8HG 3L75H 1PCIA 2CDYA 2WLLB 1S76D 3JSLA 5KX5A 2WPDG 1YJ9V 1YEWA 2E5LO 4LC1A 5A24A 4E4EA 1B04A 2V4DA 5LL6Y 2AZ2A 3ZS8C 3P3NA 3TGUH 4QGPA 4NTYA 3QO8A 2J7QA 4G28B 5BXZA 1ME3A 3PHUA 1CEZA 1FS0G 1PPJH 1MNGA 4MSWC 4BOUA 3MAQA 4BOZA 2DC7A 4JI7B 4WFHA 4MZOA 1OCRC 2VRZA 4DV1O 1SKVA 2YEVA 3ZN0A 5LMUB 3HWNA 3RYFB 1JCHA 1XL4A 2UZJA 4AQYO 2WAMA 1GRJA 5B3SB 3ZMTA 2IW5A 2UUBO 1F4MA 2QSAA 3B79A 3RYCA 3EXAA 2UU9O 2F4VO 4FLWA 4ZOLA 2R9OA 1ATKA 2P7UA 2QEXV 1O0EA 2JS3A 1KC8W 4N79A
chains in the Genus database with same CATH topology
2N74A 4DR2O 2HHHO 3E9SA 1XNQO 3R66A 4OPAA 4JI4O 1DK1A 4LF5O 4NXMO 2AGAA 4NXNO 4R3DA 3W30A 1N33O 1AILA 1HNWO 3B21A 2Z0AA 1F7YA 2ZKOA 4DR1O 4DR7O 3BBAA 4REZA 4DR4O 2UUAO 5BR8O 4LFBO 4B3RO 4D8BA 4KHPO 4JI6O 2UXDO 3OQCA 3T1HO 4B3TO 4YHHO 2BU3A 1FKAO 4LF9O 5BY1A 4JI2O 2UXCO 4A5UB 3PT2A 4DV2O 4DR5O 4X64O 3J80N 2HWKA 4LF6O 2UUCO 1NS1A 2VQEO 1D2DA 4X65O 2BTWA 2J7QC 4D8EA 3MTVA 4DV5O 5H5NA 1IBKO 2BTWB 4JI5O 1XNRO 3C0RA 4LF8O 3PSEA 4B3SO 4WURA 4OPHA 1KUQA 3MJ5A 3JAMN 4JI8O 3BY4A 4DV4O 3RT3C 4JI1O 3W31A 3T1YO 4IP3A 4M0WA 5LMUO 4B3MO 1YZBA 4RF0A 1N34O 2ZM6O 2DOSA 4ZTBA 1IBMO 4JV5O 1HNZO 1R6TA 2VQFO 1R1BA 2E5LO 4X62O 4LF4O 4OVZA 5A2QN 3IFUA 5LL6Y 3OTOO 4DR6O 3M8AA 5FLXN 4LFAO 4K0KO 3J7AU 5IT9N 1N32O 4JI0O 5JZEA 5EZQA 4PT5A 4RNAA 2UXBO 3J81N 4BOQA 5LMNO 2Z84A 5EZSA 2J7QA 1X59A 5BXZA 4P16A 1I94O 4XZXA 1XEQA 4IUMA 1A32A 1N36O 1DKIA 4GUAA 4A5UA 3PHUA 2FKXA 4BOUA 4DV6O 4RKXA 4OX9O 1FJGO 1HNXO 4BOZA 4GKJO 1PVJA 4DUZO 4DR3O 4DV1O 4YY3O 4OW0A 4BOPA 4DV7O 4HXDB 3PHWA 5IWAO 1J5EO 4JYAO 4GKKO 1UKFA 3ZNHA 1XMOO 4DV3O 3MP2A 1G1XB 4MI7A 4JI3O 4RF1A 5E6JA 3TRKA 1FYJA 2DJVA 2JTCA 2UZJA 4AQYO 4X66O 4JI7O 3PRPA 5KO3A 4MM3B 3SDLA 4DV0O 4LFCO 2UUBO 3PRMA 4DUYO 2LW7A 4OVZB 4BOSA 4LF7O 4D8IA 3F5TA 2FE8A 3O65A 3BB7A 3TMPA 1AB3A 3RNVA 1HR0O 2UU9O 2F4VO 2JRIA 1XMQO 3PHXA 1IBLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N74 A;  4DR2 O;  2HHH O;  1XNQ O;  3R66 A;  4OPA A;  4JI4 O;  1DK1 A;  4LF5 O;  4NXM O;  2AGA A;  4NXN O;  1N33 O;  1AIL A;  1HNW O;  2Z0A A;  1F7Y A;  2ZKO A;  4DR1 O;  4DR7 O;  4DR4 O;  2UUA O;  5BR8 O;  4LFB O;  4B3R O;  4KHP O;  4JI6 O;  2UXD O;  3T1H O;  4B3T O;  4YHH O;  1FKA O;  4LF9 O;  5BY1 A;  4JI2 O;  2UXC O;  4A5U B;  4DV2 O;  4DR5 O;  4X64 O;  3J80 N;  4LF6 O;  2UUC O;  1NS1 A;  2VQE O;  1D2D A;  4X65 O;  4DV5 O;  5H5N A;  1IBK O;  4JI5 O;  1XNR O;  4LF8 O;  4B3S O;  4OPH A;  1KUQ A;  3JAM N;  4JI8 O;  4DV4 O;  3RT3 C;  4JI1 O;  3T1Y O;  5LMU O;  4B3M O;  1YZB A;  1N34 O;  2ZM6 O;  2DOS A;  1IBM O;  4JV5 O;  1HNZ O;  1R6T A;  2VQF O;  1R1B A;  2E5L O;  4X62 O;  4LF4 O;  5A2Q N;  5LL6 Y;  3OTO O;  4DR6 O;  3M8A A;  5FLX N;  4LFA O;  4K0K O;  3J7A U;  5IT9 N;  1N32 O;  4JI0 O;  2UXB O;  3J81 N;  5LMN O;  1X59 A;  5BXZ A;  1I94 O;  1XEQ A;  1A32 A;  1N36 O;  2FKX A;  4DV6 O;  4OX9 O;  1FJG O;  1HNX O;  4GKJ O;  4DUZ O;  4DR3 O;  4DV1 O;  4YY3 O;  4DV7 O;  5IWA O;  1J5E O;  4JYA O;  4GKK O;  1XMO O;  4DV3 O;  1G1X B;  4JI3 O;  1FYJ A;  2DJV A;  4AQY O;  4X66 O;  4JI7 O;  3SDL A;  4DV0 O;  4LFC O;  2UUB O;  4DUY O;  2LW7 A;  4LF7 O;  3F5T A;  3O65 A;  1AB3 A;  1HR0 O;  2UU9 O;  2F4V O;  2JRI A;  1XMQ O;  1IBL O; 
#chains in the Genus database with same CATH topology
 1F51 A;  4JI4 O;  3DF0 A;  4JYC A;  1VQK V;  1U9X A;  2VHS A;  5JJN B;  3E8B A;  1Q6K A;  2WA4 A;  4ZIB A;  2V7Q G;  3CCM V;  4K7C A;  1AJQ A;  2CTP A;  2YEV B;  3RYF A;  3M99 B;  4CH5 A;  2DCD A;  4HNA B;  3H1I H;  3BRC A;  3J80 N;  2B9Z A;  4QE9 A;  2VQE O;  4CDF B;  2G8E A;  2YXL A;  3C0R A;  3OMA B;  3PSE A;  4X6J A;  4WUR A;  2B1G A;  2IU3 A;  5EK0 A;  1KUQ A;  2ADP A;  3K5L A;  1Z5V A;  1ARO P;  1NH2 D;  4Z2W A;  4X6I A;  2XAH A;  5LMU O;  2H3O A;  2WLJ A;  1M6D A;  3ABK C;  3U10 A;  4X66 B;  1XRE A;  1IBM O;  4CS2 A;  2OIG A;  1YK8 A;  4PI2 A;  4FZ0 A;  4LF8 B;  5FNV A;  3ZIA G;  1NTM H;  5KHJ A;  4UVC A;  4CH3 A;  3P32 A;  1JJO A;  1EF7 A;  1Y74 A;  2Q7H A;  2JEX A;  2AHY A;  2Y48 A;  3RGB A;  2OUL A;  1F2B A;  1KYO F;  3E86 A;  1HNW B;  1Q43 A;  2RNB A;  3LXS A;  1X59 A;  4NYK A;  1CP9 A;  3CWB H;  1QR9 A;  1NQT A;  4X88 A;  1V55 C;  2LFS A;  1EN5 A;  4H37 A;  1JMK C;  1PVJ A;  3BAB A;  2FTK A;  2Q7E A;  3OR6 C;  4J7Z A;  4Q6G A;  3IUT A;  4OW0 A;  8PCH A;  3DGE A;  1JX9 A;  5IWA O;  3CPW U;  1PL4 A;  2AW9 A;  1ME4 A;  3L72 H;  1HWY A;  1GMG A;  1KHP A;  2JTC A;  2EUL A;  4DV0 O;  2Y0I A;  3H1L H;  5KHG A;  1H2S B;  1Y74 B;  3TMP A;  2QGN A;  3K59 A;  1NZ6 A;  2AYN A;  4DMY A;  1CVZ A;  3KWZ A;  5CVO B;  4UVB A;  2B1I A;  3E9S A;  2BTO A;  5CB4 A;  1AP5 A;  3ASO B;  2AUX A;  4DK0 A;  5B1A C;  1VQ5 V;  4QPK A;  1Q6U A;  3BBA A;  2R70 A;  1SES A;  1Q6H A;  5BR8 O;  2QJ1 A;  4D8B A;  1OCZ C;  3OFN G;  3PN1 A;  5JJE B;  1P4R A;  5CA0 B;  4BW9 A;  4B08 A;  2DW4 A;  2YID A;  3UM7 A;  4BIO A;  3T1C A;  3K03 A;  4DV4 B;  3RVV A;  2X0L A;  1EFR G;  1ZLZ A;  2F95 B;  2ZM6 B;  4JZG A;  1HW7 A;  2DYS C;  3PJS K;  2DZZ A;  1ZUQ A;  2GUZ B;  5EBL C;  3ASO C;  1E1R G;  2GSM B;  5B1A B;  2ZIN A;  1CPY A;  4GX5 A;  4JYY A;  5LGT A;  4XR7 A;  4DV7 B;  3SYP A;  2IJI A;  4MZS A;  2AU1 A;  4R50 A;  5L3C A;  1DF5 A;  4LH7 A;  2PZS A;  1YVB A;  5EZY A;  2ZNJ A;  4CS3 A;  5J9P C;  1I94 B;  1OCR B;  2ARH A;  1S0V A;  1I5X A;  1AYV A;  1PV0 A;  3LNN A;  5JZE A;  1GMY A;  3K9S A;  1PPP A;  3CCJ V;  1SQP H;  1MZF A;  4P16 A;  3L74 H;  2L35 A;  1KEC A;  4IUM A;  1DKI A;  4GUA A;  1NKD A;  5BZB A;  4DR7 B;  3T4D A;  3NXS A;  4GZR B;  3N3G A;  4DMX A;  4MT8 A;  1FFX B;  1KKD A;  1QOL A;  5CA1 A;  1AU2 A;  4GKK O;  4JYA B;  3TET A;  2UUB B;  2NLJ C;  2D2C B;  1GN3 A;  3JAT B;  4CDC B;  1U9Q X;  5LXT B;  4JI2 B;  2UXC B;  1WP7 A;  2HXZ A;  1IBK B;  4DUY O;  4PAD A;  4QJF B;  1ITO A;  3F5T A;  4UCS A;  3KCY A;  3BB7 A;  3SYA A;  2CTR A;  2PF4 E;  4GX1 A;  4IL6 Z;  4QH6 A;  3CX5 F;  2LGW A;  2EJR A;  1PPO A;  5CVN B;  1XNQ O;  1K3B B;  1SER A;  2W6I G;  1QLN A;  2PI5 A;  4NXN O;  2FT2 A;  1QR8 A;  2B5U A;  1Y08 A;  3B21 A;  3JSN A;  1AU3 A;  1M90 W;  4REZ A;  4L87 A;  4NR1 A;  1IBM B;  1JFF B;  2X7R B;  4KHP O;  1FPO A;  1XHZ A;  1PE6 A;  3PBH A;  3IV2 A;  3CCR V;  2BOC C;  4I0X B;  3FKS G;  4JTA B;  1RPR A;  2V1D A;  2X6A A;  1EM1 A;  1VQ9 V;  4O4I B;  4YYQ A;  2BTW B;  1FXH A;  4LCU C;  4LF8 O;  3OEH G;  1H2M A;  4B3S O;  1Y4M A;  3EFF K;  4EKW A;  4O4J B;  1S77 D;  2YJC A;  1W0J G;  1Y4H A;  2DQ0 A;  2FML A;  4X9Q A;  1VQM V;  2XAF A;  1NPZ A;  3D36 C;  2QTO A;  4YHH B;  1KQS U;  3CMA V;  1PBH A;  2GDS A;  3LDC A;  2Y5B A;  1MOF A;  4BIU A;  4QRX A;  2HVK C;  2VQF O;  3RYC B;  1LUW A;  4PP1 A;  1AI4 A;  1XDC A;  4I4T B;  4P2Z A;  4YJ3 A;  3IFU A;  1IXB A;  1ICF A;  4LFA O;  3K9M A;  1IX9 A;  1Q86 W;  1AI7 A;  1R6N A;  4I0X A;  4GT1 A;  5IY5 B;  2Y4T A;  3OM3 B;  1QU7 A;  1R3I C;  2EIM C;  3CRM A;  1FD9 A;  3PW3 A;  3K8U A;  1IZ3 A;  1ZX3 A;  1UPG A;  4U3F H;  4RKX A;  2IU0 A;  5L3F A;  2QWO B;  4IIJ B;  2GHU A;  2EJ7 A;  3WU2 Z;  3K24 A;  4U7N A;  2JK5 C;  4FLU A;  2JDI G;  4I07 A;  3DC5 A;  4RF1 A;  1FYJ A;  4QE7 A;  4JI3 B;  3Q4H B;  3QSD A;  4J9Z B;  4JI5 B;  4LFC O;  2ARY A;  3PRM A;  3UKM A;  3F5W C;  2W0F C;  4UCR A;  3FB5 C;  2LO1 A;  3I5D A;  4D8I A;  2ZR2 A;  2FE8 A;  1EWO A;  2E01 A;  1U96 A;  5GTH Z;  1H2K A;  1D5N A;  1BSM A;  1F2C A;  2JJ1 G;  3ZRW B;  3KKU A;  3CCE V;  4C7U A;  5F2V O;  3JCZ A;  2WSS G;  5L3B A;  2P6J A;  4ZHQ B;  3W30 A;  1D5A A;  1H2L A;  2JGD B;  1WJZ A;  1SA0 B;  3MHH C;  3O0U A;  4I9Q A;  1AR4 A;  5ITZ A;  2YXY A;  3ZRS A;  2Q4P A;  1CJL A;  3FYE B;  3HR0 A;  3JD1 A;  3N3K A;  1JJ2 U;  3T1H O;  4O4L B;  1AYW A;  2F1M A;  3OT7 A;  1SQX H;  4OEM A;  4JI2 O;  1SZX A;  2UXC O;  3A0R A;  4FPP A;  1SZT A;  3E22 B;  4LF6 O;  3OGC C;  4MVR A;  3OIS A;  2P4K A;  4X65 O;  1QLE B;  3QNE A;  1YAL A;  5H5N A;  2DCB A;  2CGN A;  5FPW A;  2PGG A;  3RYI A;  2R9F A;  3N27 A;  2FQ9 A;  1F29 A;  2LJ2 A;  1SC5 B;  3SPJ A;  2WLI A;  3LDD A;  5KAI Z;  1Y76 B;  2KG7 B;  2G7Y A;  1CB5 A;  2ITD C;  3RVY A;  1S4V A;  5BMV B;  1PNM A;  2ZE8 A;  1YZB A;  1N0J A;  5IJ0 A;  3QT4 A;  2HHN A;  4WA6 A;  2NN4 A;  2WLH A;  4FLT A;  1A6R A;  4AXL A;  1SQV H;  4N8W A;  1SA0 A;  1IUR A;  3D3Q A;  4ASU G;  1KP2 A;  1TUB B;  1V55 B;  2GTS A;  3HKE A;  1AP6 A;  1KP3 A;  2ZIO A;  2HHH B;  1IVS A;  5L3E A;  1B06 A;  6PAD A;  1AR1 B;  4PA4 A;  2E3C A;  1U9W A;  3OMI B;  1PP9 H;  3F7V C;  4X1I A;  2EZP A;  1KB9 F;  2JGU A;  3H01 A;  3HKB A;  4UV9 A;  1FXK C;  1JA8 A;  2OIE A;  4B7E A;  2OT5 A;  1EZJ A;  3UO3 A;  5JWP A;  4YIP A;  1Z2G A;  2UU9 B;  1TA8 A;  1IDS A;  3L71 H;  3ZHT A;  3LSQ A;  2YS8 A;  1NLJ A;  3K08 A;  1VQ8 V;  1LUV A;  3SGI A;  5E6J A;  2ZIM A;  4DRX A;  2R9N A;  1K8A W;  4AIL C;  3CCV V;  2LGQ A;  4FLX A;  3O1G A;  3STZ C;  3OMN B;  5IYB O;  2BE3 A;  1FXK B;  3AG4 C;  5B1O A;  4LP8 A;  4NXM B;  4QBB A;  4E2L A;  3ZRV A;  3QTC A;  4IYH A;  2YJ2 A;  1F7Y A;  3ABM B;  1K9M W;  3KFQ A;  2DYS B;  2NQD B;  1N33 B;  2AS8 A;  1K34 A;  2ADQ B;  3CSX A;  4X1K B;  1UJW B;  4YHH O;  2QDO A;  1ZWI C;  5BY1 A;  2JIZ G;  1NJI W;  2F4V B;  3ZUA A;  4DR5 O;  2PY5 A;  3ZMU A;  2CIO A;  7PCK A;  3BPZ A;  3D8C A;  5L3D A;  2ATK C;  5KUK A;  4WFG A;  1JQ0 A;  1K5Q A;  2YJB A;  1IBK O;  4PI0 A;  3E1Z B;  2VQF B;  5HFM A;  4DR3 B;  3SR2 C;  3MJ5 A;  2IH1 C;  2F43 G;  1BQI A;  4AI8 A;  1XMO B;  3SYO A;  1E1Q G;  3KSE A;  3A8T A;  1SQG A;  1DTO A;  5B1B B;  1K92 A;  1XHX A;  2GTA A;  2HH5 A;  4MVU A;  4LBE C;  2B1M A;  4KP4 A;  1GCB A;  2YJ9 A;  3CRR A;  3E83 A;  3ASN B;  1PNL A;  3D36 A;  5EBM C;  4O4J A;  4DR6 B;  4W5B A;  5IT9 N;  2AXT Z;  3CCQ V;  3KX1 A;  3BA9 A;  4H13 B;  3KZI Z;  3VQX A;  3KKY A;  3FD9 A;  1MIR A;  5IE9 A;  4F6E A;  3QO5 A;  4J7K A;  2WBF X;  3W7X A;  2BTQ B;  4OX9 O;  4HWY A;  1NB5 A;  3CME V;  1NTZ H;  1JVM A;  2PI4 A;  1CPJ A;  3ASN C;  1NB3 A;  5KAF Z;  1NU1 H;  3E22 A;  2BCC H;  5D5Q A;  1ROP A;  1N4C A;  5LYJ B;  1YSC A;  1DGS A;  1H2N A;  4MM3 B;  4DV5 B;  4ZKI A;  1DEU A;  5KHK A;  1VF7 A;  4CDD B;  4LF6 B;  3P5U A;  4B3R B;  1M9N A;  4MVQ A;  4TQD A;  2JRI A;  1W2B U;  4FK5 A;  5JCO C;  2LP7 A;  3SJB C;  3AG7 A;  3O9O A;  4H44 B;  5EZS A;  3B8M A;  1U5I A;  3C3T A;  4P9O A;  3UQ8 A;  3G71 V;  3E8G A;  1AYU A;  5LGU A;  3WG7 C;  1OHH G;  2D3O W;  9PAP A;  1V54 B;  2XHB A;  5AG2 A;  5J2T A;  3BHP A;  2ZDI C;  3K5N A;  2PBH A;  5KUM A;  4D6T H;  3ZX6 A;  4LFB O;  4AHC A;  5EIB D;  2CTQ A;  5K1P A;  2RDC A;  5LA6 A;  4UB6 Z;  5JVD A;  4RQE A;  2H94 A;  1RPO A;  1N32 B;  4DV2 O;  3KCX A;  3E8F A;  1RFY A;  1D2D A;  4TSF G;  4RO2 A;  3OTO B;  3MTV A;  2JQG R;  1CSB B;  1SRY A;  2QM7 A;  1WN7 A;  4DV1 B;  4DUZ B;  3BVO A;  3B8N A;  3HHA A;  3PDF A;  3AK2 A;  4K35 A;  2XND G;  4FMT A;  4IP3 A;  4JYB A;  4JGS A;  3AG3 B;  2OP3 A;  4WFE A;  3L9D A;  1K5S A;  4J42 A;  3ZBH A;  5IY5 C;  2PYL A;  5FNV B;  2IJH A;  5A2Q N;  1EZV H;  3JD0 A;  3FAV B;  4KUM A;  1NQC A;  2DC9 A;  4RAI A;  1X4T A;  2Q7G A;  4YIO A;  1RM1 C;  2Q9L A;  2Q67 A;  3JAT A;  3BCC H;  2DC8 A;  2LW1 A;  1N8R W;  3JAL A;  1S5H C;  2KB1 A;  5ITZ B;  4X89 A;  2FYU H;  4DV6 O;  2EBO A;  1VJV A;  2CGO A;  1VP7 A;  3D6S A;  3K3W A;  4OEL A;  2XAS A;  3DSQ A;  3TK1 A;  1EWP A;  4BOP A;  4DV7 O;  1VQ7 V;  3E89 A;  3ZHQ A;  3K5M A;  4ZI7 B;  1YTF B;  3JAW B;  3MOR A;  3OUS A;  1NR1 A;  3K0D A;  3S3X A;  4F6R A;  4X66 O;  4AQY B;  2E75 B;  4EFB A;  3ABK B;  4J9Y B;  4EB6 B;  2JEU A;  5LHI A;  3IJ4 A;  2R72 A;  2QTS A;  1YCI A;  2PYJ A;  2R9A A;  1YJN V;  4K8X A;  3K5O A;  4J41 A;  2QA4 V;  1XMQ O;  2WA3 A;  3GCB A;  4CS4 A;  1KU9 A;  4OPA A;  2YIA A;  3CBK A;  3G4S V;  1AEC A;  4YYV A;  2FO5 A;  1X9Y A;  1TUB A;  4DR5 B;  3U0Z A;  3WB2 A;  2YIC A;  4FFB A;  2JVD A;  2UUA O;  2GUZ A;  4B3R O;  5CBG A;  2DE0 X;  1VAR A;  4IHJ B;  4JI6 O;  2UXD O;  2FTD A;  2R9I A;  4TOI A;  3SPG A;  5J2U A;  4G54 A;  1B6Q A;  1TAE A;  2HFE C;  2GV9 A;  1NBM G;  2R6N A;  5CVM A;  5IJ9 A;  2R9R B;  1L0L H;  5E79 Z;  3HKC B;  3JAR B;  4G27 B;  3MDS A;  1EWL A;  3BOW A;  3CB2 A;  3UO2 A;  1VF6 A;  2Q69 A;  1M57 C;  3H8B A;  3APQ A;  4ZOL B;  2A0L A;  4B3M B;  3K57 A;  3U8E A;  5EC2 C;  3OF9 A;  1N34 O;  2YUA A;  1CXZ B;  2KKW A;  1GN4 A;  2DOS A;  3OEE G;  4PA6 A;  3MHH A;  1R6T A;  3VBB A;  4J11 A;  4OX9 B;  1XKG A;  4X62 O;  4JTC B;  3JYC A;  2IBZ H;  2PUS A;  1Q82 W;  3F5V A;  1MAB G;  3P5X A;  4TWK A;  5LOV A;  1Q7Y W;  4FIP C;  2E00 A;  1HNZ B;  1JQP A;  3V6C A;  1M5I A;  5IJ9 B;  1BS3 A;  5LBQ A;  1L1F A;  2R9M A;  3CCU V;  4X20 A;  1DF4 A;  3JD2 A;  1F2A A;  3S3W A;  4WFA V;  3HKE B;  3CJH B;  4UUJ C;  4FLY A;  4DR3 O;  4UCV A;  4R7C A;  2FUD A;  3L73 H;  4HXD B;  4B7K A;  1YIJ V;  3PHW A;  1W59 A;  1J5E O;  4NTX A;  4BSQ A;  2YSU B;  2QWQ B;  4JTD B;  4BIZ A;  2YIB D;  5JH7 B;  3HHI A;  4P9P A;  1RSO B;  3PRP A;  1TVK B;  4L8J A;  1SS3 A;  3DXR B;  1OCO B;  3ZRX A;  1NR7 A;  1YJW V;  1ENV A;  4JI6 B;  5JH3 A;  3ETQ A;  4P30 A;  3CXC U;  4CZW A;  5C93 A;  4KFM A;  1SF9 A;  2AUZ A;  4CH6 A;  5IJ0 B;  1K3E A;  4NXN B;  1WAZ A;  1VIB A;  1DK1 A;  2OTL V;  2E02 A;  3I3T A;  3IOQ A;  4I04 A;  1QQC A;  4ZBM A;  4JZ2 A;  1PXV A;  2BTQ A;  4PEL A;  3CS5 A;  3RYH A;  1O9G A;  4PI3 A;  1K7D A;  1SQQ H;  5CHT A;  1NVP B;  3W7W A;  4YYU A;  1XMQ B;  4PDV A;  1RSO A;  4YVA A;  1MDW A;  5JH7 A;  4WF9 V;  4I9W A;  1URF A;  2F23 A;  2RQ6 A;  2BTW A;  1FXV A;  1O9H A;  5HFL A;  2ETN A;  3C3S A;  1PKX A;  4LWS B;  4MTO A;  5B66 Z;  4DV5 O;  1PIP A;  4P6G A;  3N4C A;  5LP6 A;  3LSS A;  4PA9 A;  3SPC A;  3TCU A;  1BQZ A;  2ITC C;  3W7T A;  2DYR C;  3LSU A;  3ZJZ A;  5JVD B;  2R9C A;  1Q8I A;  1N36 B;  3H1K H;  4JAV A;  2M7W A;  4IYI A;  2CH7 A;  4I4T A;  5F02 A;  2A3Q A;  4N4Z A;  3WXG A;  4YY3 B;  1VQL V;  1Z5W A;  2UXD B;  2GFO A;  3LUT B;  2AVW A;  5KMG A;  2JJ2 G;  2WLI B;  4FFK A;  2H7J A;  4RWU A;  4JI0 O;  1IBL B;  5LMN O;  1XOU A;  3HPL C;  4I5S A;  4I55 A;  3OVX A;  5KLV H;  5TIS Z;  1VQO V;  5LP6 B;  4PHZ A;  4JI1 B;  4BPV A;  5CA3 A;  2A9H A;  1YXB A;  4X1Y A;  5B5E Z;  2F93 B;  3P5W A;  3HKC A;  3JAR A;  2DN9 A;  2C2A A;  4UXN A;  1MSD A;  3BPF A;  4XDL A;  1GLO A;  3MP2 A;  1OV9 A;  1H2G A;  4MI7 A;  3BC3 A;  1QXP A;  5KX5 B;  1GM7 A;  4ICG A;  3OGI B;  2LW7 A;  2JQF R;  4BOS A;  1US6 A;  3PNR A;  1KBH A;  2GBO A;  3RNV A;  4YYW A;  3CEI A;  4XUI A;  2DZY A;  2CTW A;  2Y0P A;  2Z3Y A;  4MVO A;  1BHA A;  1AIL A;  2EZO A;  2Q6A A;  3CXH F;  2E74 B;  4LF4 B;  3K9A A;  5GTI Z;  3E8H A;  3KWB X;  4LWS A;  3ZHR A;  2HG5 C;  2F66 C;  4QRG A;  4MVM A;  2DCC A;  3E35 A;  3CE2 A;  4B3T O;  2UXB B;  5JA7 A;  2BU3 A;  3W7S A;  3JAL B;  3I55 V;  1BQ0 A;  5H6Q A;  2P67 A;  1IWD A;  4R8C A;  3JAW A;  5DEC A;  2OYQ A;  3C9E A;  2J7Q C;  2RMK B;  4X62 B;  1WA8 B;  2DC6 A;  5IYC O;  4U7O A;  5EGW A;  3ML0 A;  5L3G A;  1K73 W;  3CC2 V;  4PA7 A;  5CBH A;  2DMX A;  3K04 A;  2XT9 A;  5KMG B;  1L8D A;  4GUN A;  4ZTB A;  4BW5 A;  3B2E E;  4O2B A;  3GVM A;  4UB8 Z;  1HNZ O;  2DJG B;  1EN4 A;  3AI8 A;  4CDE B;  1WPB A;  3IGA C;  1ZCM A;  4OVZ A;  3BPM A;  3ABM C;  3RVZ A;  2EIL C;  4XDK A;  4TV8 A;  2EIM B;  5A9G A;  5J2U B;  5LHG A;  4BS6 A;  3AK3 A;  2Z84 A;  3FX7 A;  3VQW A;  3ZN1 A;  3KG2 A;  1QCE A;  1NTK H;  3OVZ A;  4FFB B;  3CRC A;  2FKX A;  1S3J A;  4J80 A;  1JFF A;  1FJG O;  3BWK A;  1HR0 B;  4WBN B;  4O2A A;  2ZR3 A;  1KXR A;  4YY3 O;  1UFI A;  3BEH A;  5B1B C;  2NQA A;  3ZMS A;  3AG2 C;  2EIL B;  2NQG A;  1OCC B;  1P7G A;  3ZRW A;  3OD4 A;  4DK1 A;  1AVM A;  4F4L A;  3WB1 A;  1R6K A;  1J95 A;  3RN4 A;  1SQB H;  3UT5 B;  3HD3 A;  4CC5 A;  2ZQM A;  4WCE V;  5B1N A;  2BSK B;  2NNU A;  2ZNI A;  4PDM A;  1THE A;  1WP8 A;  2CH7 B;  2CAZ C;  3G6B A;  1N33 O;  2QWP B;  1HNW O;  1S5J A;  2OWO A;  1DLB A;  5EC1 C;  1SET A;  2WWW A;  3SJC C;  5LGN A;  3KW9 A;  1QDQ A;  2HR3 A;  4DR7 O;  4TV9 A;  4DR4 O;  1XUQ A;  4IGG A;  5BR8 B;  1R3L C;  3HKD B;  4JAA A;  4I7Z B;  2PRE A;  3MD0 A;  4A5U B;  3PT2 A;  4X64 O;  1TGO A;  2O57 A;  1G4Y B;  3JD3 A;  1NH2 B;  1XNR O;  3T2M A;  4DUY B;  4FJC A;  4GX2 A;  1FFX A;  3OF8 A;  3MHS C;  3X2Q B;  3JAM N;  4JI1 O;  4O4L A;  3WG7 B;  2NQI A;  1MMM A;  5FPR A;  3WB0 A;  2QWN B;  2DWE C;  4JV5 O;  5LP6 C;  1V54 C;  2JS5 A;  3OTO O;  1COW G;  2KSD A;  4KXR A;  2AZ0 A;  1TU6 A;  2PNS A;  3STL C;  3JAS A;  3ZMV A;  3A2F A;  1N32 O;  3QVN A;  4K8Z A;  3ABT A;  3H1J H;  3IMA A;  2XAQ A;  2EIN C;  3L70 H;  1NL6 A;  5DED A;  4Q8G A;  3CH2 X;  2OCC B;  4MVZ A;  1A32 A;  1K4D C;  3VQY A;  1VF6 C;  4WBN A;  2F1G A;  3SYQ A;  1OCO C;  4K0K B;  2QM8 A;  4DUZ O;  2MW2 B;  4YV8 A;  4UVA A;  1BGO A;  1WB8 A;  3ZHV A;  4IHJ A;  1BP4 A;  1P49 A;  2XU3 A;  3AEI A;  3TRK A;  2G38 A;  4YXW G;  3FFQ A;  4HYO A;  2P0R A;  4MSX A;  4X64 B;  4DV3 B;  3ZCC A;  2VHF A;  2A79 B;  5H2F Z;  4IT5 A;  1R3J C;  3FAV A;  4G2K A;  1GN2 A;  5KA5 A;  3P5V A;  2Q73 A;  1AB3 A;  4W5C A;  3H9V A;  2WLN A;  4QNH B;  3RVW A;  5CB4 B;  1POP A;  1THZ A;  4LF5 B;  3WXE A;  3DXR A;  5EYP A;  4O4I A;  5FL7 G;  3G80 A;  4H0L B;  4DO2 A;  1BCC H;  1QVG U;  4EEQ A;  4KHP B;  3W7U A;  4KL1 A;  3S3Q A;  3BAA A;  2ZT9 B;  4GX0 A;  2W0X A;  2FL4 A;  3RW0 A;  2DCA A;  1YI2 V;  2PTM A;  1QVF U;  3I56 V;  1BHB A;  4Q20 A;  5J94 A;  4TUY A;  4NB5 A;  5JQG B;  1GM9 A;  3IAY A;  3ETE A;  4RY2 A;  1KD1 W;  1SNK A;  2HJF C;  1Q6I A;  1Y6X A;  4FVM A;  4UCU A;  3FB8 C;  5DM6 V;  2UXX A;  3GWO A;  3VOU A;  4PV1 B;  4U3J B;  1I0H A;  4LF9 B;  4YYS A;  2HEP A;  1TLO A;  2ZM6 O;  4WFF A;  5DN6 G;  4GKJ B;  1R1B A;  1XBL A;  1FJG B;  3NHE A;  4LF4 O;  1ZAU A;  1N0N A;  3GWK C;  3CC4 V;  4LFA B;  2YI8 A;  4MVS A;  1BY8 A;  3SJQ C;  2P4V A;  5H9C A;  4TT3 G;  1BL8 A;  3RWR D;  4JAU A;  1EN6 A;  3JCU Z;  4TUY B;  2EX3 A;  5JQG A;  2UXB O;  4XZX A;  1XEQ A;  5JJJ B;  4YJ2 A;  3IC9 A;  4A5U A;  1GO3 F;  3CRQ A;  5CHV A;  1M57 B;  2P06 A;  2O6X A;  4FM0 A;  4DW0 A;  4DW1 A;  4PP2 E;  4Z1V A;  3M99 A;  1BGY H;  4J7J A;  5LA6 B;  2OZ2 A;  1GTO A;  1AU0 A;  1M4U A;  3F7Y C;  5K16 A;  3LNM B;  4W4L A;  1HDJ A;  2UXN A;  4X1I B;  1AJN A;  2X6B A;  4JI3 O;  1NI8 A;  3NR7 A;  5IYD O;  3OUF A;  1NT2 B;  2JGD A;  4JI7 O;  4MW8 A;  1H8E G;  3OR7 C;  3AG1 C;  2MK3 A;  2QM4 A;  4B3S B;  1EWM A;  1F4N A;  4PDL A;  4J10 A;  1Y67 A;  1PD3 A;  2FRQ A;  4QPJ A;  4JI8 B;  4NVP A;  2ZE5 A;  3H1H H;  1SQF A;  2HD5 A;  4GYC B;  1OJH A;  1F23 A;  1M56 B;  3PHX A;  1Q81 W;  2HHH O;  4DR2 O;  5EYP B;  1TUE B;  3DC6 A;  5D5P A;  1KHQ A;  4W4U A;  4D7T A;  3ERV A;  4RUE A;  3Q4H A;  2WLL A;  5CN0 A;  4X20 B;  2IPP B;  4DR1 O;  2N04 A;  4FK5 C;  4IIJ A;  3WXF A;  4NTW A;  4JV5 B;  2BOB C;  1P7B A;  1ZSP A;  2A06 H;  3K58 A;  3SJA C;  2QKC A;  3ICX A;  4JAS A;  1WPX A;  1YT7 A;  2YIB A;  2Q0O C;  1I08 A;  1XQ8 A;  2G6D A;  2IJK A;  4FZ1 A;  1MA1 A;  1N34 B;  1QNM A;  3N2K B;  3LDE A;  4DV0 B;  4OXS A;  1MHW A;  2Q68 A;  3HKB B;  1K97 A;  1AI5 A;  1WNS A;  2Y4U A;  1GN6 A;  2EIN B;  5CA0 A;  3T1Y O;  4M0W A;  4ZHQ A;  5GW7 A;  2VQE B;  5LXT A;  4YYR A;  2AYO A;  4LR3 A;  2A7W A;  4BWA A;  2VWK A;  4JPR A;  4O2B B;  2CUG A;  3F75 A;  1RM1 B;  4RUF A;  3H6S A;  4ZUX U;  2FYE A;  4JF3 A;  3M8A A;  1VEW A;  2Q0A A;  2FB5 A;  1M93 A;  3QG5 A;  2DJF B;  4PD4 F;  3V6E A;  2ACT A;  2HKO A;  3CCS V;  4ZI7 A;  1BT8 A;  2XOK G;  1OCC C;  4JI4 B;  1VMG A;  3DTU B;  1N36 O;  2Q5Z A;  5C8Y B;  5KA6 A;  1KKC A;  5PAD A;  2DYR B;  1KFX L;  3SPI A;  4D7S A;  4UCT A;  3QO7 A;  4DR2 B;  1CV8 A;  3G6E V;  4X1K A;  5IWA B;  3ZNH A;  1XMO O;  1VF5 B;  4DV3 O;  1BZK A;  4OGQ B;  3USV A;  2DJV A;  1G8M A;  1XI1 A;  3ZHS A;  4UFZ A;  3SPH A;  2ILM A;  2PAD A;  1GEC E;  4XDJ A;  3JAK B;  3A0H Z;  3B09 A;  2EIJ C;  4YJ3 B;  5E1A C;  3ZED A;  4OPH A;  4P6E A;  1GKF A;  3R66 A;  1JR9 A;  2QE7 G;  4R3D A;  2ODM A;  2XU5 A;  5CBF A;  4LNU A;  2ZKO A;  2BSK A;  3ETG A;  3JAK A;  1LR1 A;  4O4H B;  1U97 A;  5CA1 B;  2XAG A;  1DF0 A;  2CK3 G;  1FKA O;  2XU4 A;  3HKD A;  1CTE A;  2EIJ B;  2X6C A;  1U9V A;  2W6J G;  2NR5 A;  1VQ6 V;  2HWK A;  3T4Z A;  1PAD A;  2IM9 A;  1ZL8 A;  1SP4 B;  2P90 A;  1GK9 A;  3CCL V;  3RFR A;  2ATO A;  1FXK A;  1MG1 A;  2IBI A;  3BY4 A;  3H7D A;  1FAF A;  1ZTE A;  1S5L Z;  5CMU A;  4MTX A;  4RF0 A;  1JPX A;  1K33 A;  4CC6 A;  1CS8 A;  3D3I A;  3MTN A;  4FIP A;  1Y66 A;  4PJ0 Z;  1AIM A;  1RP3 B;  1YIT V;  3U11 A;  3UT5 A;  4I05 A;  2Q8V A;  3EVK A;  4DR6 O;  1V9P A;  4GCZ A;  1STF E;  4HAM A;  2Y69 C;  2P86 A;  3BY6 A;  1XNQ B;  3BFR A;  1QHT A;  5EZQ A;  3OAA G;  4PT5 A;  4BOQ A;  4BS5 A;  3IC7 A;  3CD6 V;  5LYJ A;  2LFR A;  5IYZ B;  1ZIV A;  1I94 O;  1ZL8 B;  4FJC C;  2HP8 A;  3ZMZ A;  4X1Y B;  3BA8 A;  3ABL B;  5J2T B;  1L0N H;  1AJP A;  5H6R A;  1M56 C;  4QRV A;  1UKF A;  2H8P C;  4EFE A;  1KMI Z;  1OCZ B;  1GH6 A;  2LQT A;  4LH6 A;  2OTJ V;  2P7T C;  1PPN A;  1LNQ A;  3SDL A;  3H8C A;  4W4K A;  1HP8 A;  4OVZ B;  4TV9 B;  4LNU B;  2XU1 A;  3CP1 A;  5IDJ A;  4HBN A;  1M1K W;  1HR0 O;  2Y6E A;  3AK1 A;  2K1E A;  1IBL O;  4JI0 B;  3AG4 B;  3R65 A;  4B3T B;  4QIW F;  4LF5 O;  3N2G A;  1PL0 A;  2E76 B;  4EB6 A;  1TVK A;  1OZ0 A;  2M6Y A;  3B77 A;  2Z0A A;  3FB7 C;  1HNX B;  3B4S A;  3CBJ A;  2DWD C;  1EBO A;  5C8Y A;  3FB6 C;  1WA8 A;  3TXS A;  1MEM A;  3CJH A;  3JD4 A;  4LFB B;  1Y76 A;  4H33 A;  1YF2 A;  3OQC A;  5LMN B;  3ETD A;  3AG2 B;  2G8J A;  2QKA A;  1I7F A;  4I55 B;  1S72 V;  2KQX A;  2YDE A;  2UUC O;  3CRA A;  4WFB V;  4D8E A;  1E79 G;  4BAY A;  1NVP D;  2AHZ A;  4LFC B;  4JI5 O;  3TJT A;  3EHB B;  3CYO A;  4MTF A;  3OW2 U;  4JI8 O;  4DV2 B;  4ABM A;  2FRA A;  3RVX A;  1MSW D;  2YC0 A;  2RJZ A;  3UCS C;  4DR1 B;  3WFV A;  4NKG B;  3N2K A;  1XIL A;  2ZD9 A;  3LFY A;  3K06 A;  4UV8 A;  3OE7 G;  1R3K C;  2KG7 A;  2UUA B;  3J7A U;  2WLK A;  3P3P A;  3RBZ A;  4CH4 A;  4DRX B;  1TL9 A;  4CZZ A;  2ZE7 A;  2E5L B;  1HNX O;  5KHH A;  2ZDI A;  5EF4 A;  2E03 A;  4MS2 A;  1YK7 A;  1FH0 A;  3E2E A;  5GON B;  4I50 A;  1YHQ V;  1QLE C;  3T1Y B;  5EZY B;  2HJD A;  2DQ3 A;  4FLV A;  3N2G B;  2HLD G;  4FLZ A;  4R6Z A;  3GB7 C;  1P84 F;  1ORQ C;  2N74 A;  4TV8 B;  4U3J A;  1XL6 A;  2AGA A;  2P22 C;  4K3A A;  3M7M X;  4PDR A;  4F6R B;  5B3S C;  4UCO A;  1QMY A;  3B40 A;  1MZE A;  2HVJ C;  5LHH A;  3TXQ A;  5EIB C;  1PPD A;  2QWR B;  3IFX A;  3QF7 A;  1PNK A;  4X8A A;  4XBF A;  4LF9 O;  1CQD A;  4GLX A;  3S3R A;  4TQF A;  1W0K G;  3TNX A;  1KFU L;  4YJ2 B;  3RYH B;  1AU4 A;  4LF7 B;  2YI9 A;  1WB7 A;  3P30 A;  1VQN V;  1MEG A;  3THO A;  3I06 A;  4O4H A;  1YVW A;  2QKS A;  3OTF A;  3K0G A;  3W31 A;  2GHY A;  3ABU A;  4B3M O;  2BDL A;  2AIM A;  3AG3 C;  2CE4 A;  2B1N A;  2YXH A;  2QR4 A;  2ZCE A;  1B3Q A;  2BDZ A;  1FFT B;  4BQV A;  3ABL C;  1K4C C;  3JAS B;  4FM1 A;  4DR4 B;  5FLX N;  4O2A B;  2L6L A;  1MS6 A;  1H38 A;  4K0K O;  2XAJ A;  4KLB A;  3C90 A;  2N05 A;  3VQV A;  4RNA A;  2C0Y A;  3J81 N;  4HNA A;  4N21 A;  1YTF D;  2EIK B;  5GON A;  1BMF G;  2Z5U A;  3IEJ A;  3BCN A;  1PM9 A;  4N23 A;  1QBZ A;  3CHX A;  2IH3 C;  4GKJ O;  2VS0 A;  4RQF A;  1AR5 A;  1IXM A;  4I50 B;  5K1X A;  1I5Y A;  4GKK B;  4JYA O;  1AI6 A;  3QJ3 A;  2RN9 A;  1G1X B;  5LOV B;  5IYZ A;  5EBW C;  5JCO A;  3SYC A;  4MW3 A;  2XTA A;  1VSN A;  5KO3 A;  4HZ3 A;  1Q3E A;  1R73 A;  3K79 A;  1XNR B;  1HUC B;  3G67 A;  4DV6 B;  2ZXW C;  2EIK C;  4LF7 O;  3O65 A;  1Q90 D;  4BR6 A;  3ZHU A;  1VQP V;  1BE3 H;  5BMV A;  4X65 B;  2VWJ A;  1YDX A;  2YJ8 A;  2OCH A;  2UUC B;  2XUM A;  2F7D A;  3CH3 X;  3A0B Z;  4NXM O;  4PA3 A;  4X6H A;  1GAX A;  2IJJ A;  3RYI B;  4FM2 A;  2P5O A;  2OCC C;  2WLM A;  4DXW A;  4Q8H A;  1T5E A;  2ZE6 A;  2ZXW B;  3IHP A;  3CC7 V;  4AXM A;  3AG1 B;  1VQ4 V;  4MTG A;  3MHS A;  1JOY A;  3H89 A;  2RCV A;  1NS1 A;  3X2Q C;  1WLE A;  1GM8 A;  2CB5 A;  3FYI B;  4CBC A;  4DYL A;  5KHI A;  1Q5O A;  2K9P A;  5FPO A;  4DV4 O;  3RT3 C;  2Y69 B;  3APO A;  1J5E B;  4Z1M G;  3HB3 B;  3T1H B;  1G6U A;  1H8H G;  3L75 H;  1PCI A;  2CDY A;  2WLL B;  1S76 D;  3JSL A;  5KX5 A;  2WPD G;  1YJ9 V;  1YEW A;  2E5L O;  4LC1 A;  5A24 A;  4E4E A;  1B04 A;  2V4D A;  5LL6 Y;  2AZ2 A;  3ZS8 C;  3P3N A;  3TGU H;  4QGP A;  4NTY A;  3QO8 A;  2J7Q A;  4G28 B;  5BXZ A;  1ME3 A;  3PHU A;  1CEZ A;  1FS0 G;  1PPJ H;  1MNG A;  4MSW C;  4BOU A;  3MAQ A;  4BOZ A;  2DC7 A;  4JI7 B;  4WFH A;  4MZO A;  1OCR C;  2VRZ A;  4DV1 O;  1SKV A;  2YEV A;  3ZN0 A;  5LMU B;  3HWN A;  3RYF B;  1JCH A;  1XL4 A;  2UZJ A;  4AQY O;  2WAM A;  1GRJ A;  5B3S B;  3ZMT A;  2IW5 A;  2UUB O;  1F4M A;  2QSA A;  3B79 A;  3RYC A;  3EXA A;  2UU9 O;  2F4V O;  4FLW A;  4ZOL A;  2R9O A;  1ATK A;  2P7U A;  2QEX V;  1O0E A;  2JS3 A;  1KC8 W;  4N79 A; 
#chains in the Genus database with same CATH homology
 2N74 A;  4DR2 O;  2HHH O;  3E9S A;  1XNQ O;  3R66 A;  4OPA A;  4JI4 O;  1DK1 A;  4LF5 O;  4NXM O;  2AGA A;  4NXN O;  4R3D A;  3W30 A;  1N33 O;  1AIL A;  1HNW O;  3B21 A;  2Z0A A;  1F7Y A;  2ZKO A;  4DR1 O;  4DR7 O;  3BBA A;  4REZ A;  4DR4 O;  2UUA O;  5BR8 O;  4LFB O;  4B3R O;  4D8B A;  4KHP O;  4JI6 O;  2UXD O;  3OQC A;  3T1H O;  4B3T O;  4YHH O;  2BU3 A;  1FKA O;  4LF9 O;  5BY1 A;  4JI2 O;  2UXC O;  4A5U B;  3PT2 A;  4DV2 O;  4DR5 O;  4X64 O;  3J80 N;  2HWK A;  4LF6 O;  2UUC O;  1NS1 A;  2VQE O;  1D2D A;  4X65 O;  2BTW A;  2J7Q C;  4D8E A;  3MTV A;  4DV5 O;  5H5N A;  1IBK O;  2BTW B;  4JI5 O;  1XNR O;  3C0R A;  4LF8 O;  3PSE A;  4B3S O;  4WUR A;  4OPH A;  1KUQ A;  3MJ5 A;  3JAM N;  4JI8 O;  3BY4 A;  4DV4 O;  3RT3 C;  4JI1 O;  3W31 A;  3T1Y O;  4IP3 A;  4M0W A;  5LMU O;  4B3M O;  1YZB A;  4RF0 A;  1N34 O;  2ZM6 O;  2DOS A;  4ZTB A;  1IBM O;  4JV5 O;  1HNZ O;  1R6T A;  2VQF O;  1R1B A;  2E5L O;  4X62 O;  4LF4 O;  4OVZ A;  5A2Q N;  3IFU A;  5LL6 Y;  3OTO O;  4DR6 O;  3M8A A;  5FLX N;  4LFA O;  4K0K O;  3J7A U;  5IT9 N;  1N32 O;  4JI0 O;  5JZE A;  5EZQ A;  4PT5 A;  4RNA A;  2UXB O;  3J81 N;  4BOQ A;  5LMN O;  2Z84 A;  5EZS A;  2J7Q A;  1X59 A;  5BXZ A;  4P16 A;  1I94 O;  4XZX A;  1XEQ A;  4IUM A;  1A32 A;  1N36 O;  1DKI A;  4GUA A;  4A5U A;  3PHU A;  2FKX A;  4BOU A;  4DV6 O;  4RKX A;  4OX9 O;  1FJG O;  1HNX O;  4BOZ A;  4GKJ O;  1PVJ A;  4DUZ O;  4DR3 O;  4DV1 O;  4YY3 O;  4OW0 A;  4BOP A;  4DV7 O;  4HXD B;  3PHW A;  5IWA O;  1J5E O;  4JYA O;  4GKK O;  1UKF A;  3ZNH A;  1XMO O;  4DV3 O;  3MP2 A;  1G1X B;  4MI7 A;  4JI3 O;  4RF1 A;  5E6J A;  3TRK A;  1FYJ A;  2DJV A;  2JTC A;  2UZJ A;  4AQY O;  4X66 O;  4JI7 O;  3PRP A;  5KO3 A;  4MM3 B;  3SDL A;  4DV0 O;  4LFC O;  2UUB O;  3PRM A;  4DUY O;  2LW7 A;  4OVZ B;  4BOS A;  4LF7 O;  4D8I A;  3F5T A;  2FE8 A;  3O65 A;  3BB7 A;  3TMP A;  1AB3 A;  3RNV A;  1HR0 O;  2UU9 O;  2F4V O;  2JRI A;  1XMQ O;  3PHX A;  1IBL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...