2WBFX

Crystal structure analysis of sera5e from plasmodium falciparum with loop 690-700 ordered
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
265
structure length
265
Chain Sequence
DNMFCNKEYCNRLKDENNCISNLQVEDQGNCDTSWIFASKYHLETIRCMKGYEPTKISALYVANCYKGEHKDRCDEGSSPMEFLQIIEDYGFLPAESNYPYNYVKVGEQCPKVEDHWMNLWDNGKILHNKNEPNSLDGKGYTAYESERFHDNMDAFVKIIKTEVMNKGSVIAYIKAENVMGYEFSGKKVKNLCGDDTADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKVDMYGPTHCHFNFIHSVVIFNVDLPMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE-REPEAT ANTIGEN PROTEIN
publication title Structural insights into the protease-like antigen Plasmodium falciparum SERA5 and its noncanonical active-site serine.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 71
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2wbfX00
3KWBX 4N8WA 3H6SA 2WBFX 4ZUXU 4QBBA 4FJCA 1TL9A 3D6SA 2FO5A 1BY8A 1MEGA 2DJFB 2E00A 3K8UA 2P0RA 3IHPA 5FPWA 3IMAA 5J94A 2XU4A 3MHSA 1U5IA 2FTDA 3OISA 3H89A 3PDFA 1Q6KA 2AU1A 2AYNA 2OULA 3S3QA 4HWYA 3MORA 1U9WA 3PBHA 3KW9A 3RVVA 4QRGA 1SNKA 1AECA 1YALA 3DF0A 4BS5A 3BPFA 1ICFA 2GHUA 1K3BB 1MDWA 3K9MA 2FQ9A 2YJ8A 4BSQA 1NL6A 1BP4A 1M6DA 1AYVA 3N4CA 2IBIA 1EWLA 1GCBA 1ME3A 2HD5A 3MHHA 5A24A 3S3RA 1PIPA 3HD3A 1PXVA 2R6NA 2G8EA 1U9XA 4CDEB 3WXEA 2AYOA 5CHVA 1F29A 3OVZA 1KXRA 9PAPA 2CB5A 4PP1A 2ARYA 4MZOA 2GFOA 3AI8A 1AYWA 3CBKA 1A6RA 5CVOB 2G8JA 1EWPA 2E03A 2B1MA 2FYEA 4P6GA 2ACTA 4CDCB 3P5VA 3M99A 4X6HA 1YT7A 5EF4A 4CDDB 1QMYA 1ATKA 1ZCMA 1QXPA 2DZYA 1EF7A 1XKGA 2P7UA 4PI3A 2YJBA 1TLOA 1YVBA 1Y08A 3CH3X 1CS8A 2G7YA 1QOLA 3O1GA 4YYWA 3N3KA 2AIMA 3ERVA 1F2BA 1MEMA 2DCAA 4N4ZA 4YYRA 3H8CA 3MTNA 1GMYA 1IWDA 3N3GA 2R9MA 3I3TA 3P5WA 5JH3A 2DC9A 4BS6A 4I05A 2NQDB 1YK7A 4PP2E 2HHNA 1ITOA 3C9EA 3P5UA 3OF9A 3HHIA 4DMXA 2PREA 3H7DA 5CVMA 4MZSA 3B79A 3NHEA 2Y6EA 2JQGR 1BGOA 7PCKA 4MSXA 4W5BA 2DC6A 2DCCA 4W5CA 4YVAA 2HXZA 2R9NA 1TU6A 3O0UA 4Q8GA 1PPOA 4PADA 2DC8A 2XU3A 2G6DA 2FRAA 4P6EA 1NB3A 3QJ3A 1BQIA 2FRQA 1VJVA 1CV8A 1MS6A 3F5VA 3LFYA 3E1ZB 4FIPA 1U9VA 1CJLA 2E02A 2YJCA 2PBHA 3U8EA 4YYUA 1KHQA 3CH2X 3H8BA 1CQDA 4XR7A 2DCBA 4FK5A 1MIRA 1FH0A 2CIOA 2BDLA 3BC3A 2R9CA 2R9FA 3KX1A 4WA6A 4G54A 1O0EA 1NB5A 2VHSA 1AYUA 3BCNA 1STFE 2FUDA 1VSNA 4YYSA 3HHAA 8PCHA 3BOWA 1PPDA 5F02A 1NPZA 3WXGA 2AUXA 1PPPA 3RVWA 1AU4A 2O6XA 3KFQA 3KWZA 4X6IA 1AU0A 1EWOA 2B1NA 2NQIA 4XUIA 4OEMA 2P86A 3CBJA 2VHFA 1QDQA 4YYQA 2DCDA 1NLJA 2AVWA 2OZ2A 2ATOA 4QH6A 3BPMA 1Y4HA 2YJ2A 3OVXA 2DZZA 5CVNB 5PADA 1KHPA 1AU3A 2R9OA 1PBHA 2XU1A 2DJGB 4BPVA 3PNRA 4DMYA 1POPA 3TNXA 2NQAA 1GLOA 2E01A 3IEJA 1F2CA 1PADA 3ZUAA 1HUCB 4BQVA 2NQGA 1DF0A 2AUZA 3LXSA 2OP3A 3KKUA 3RVXA 1F2AA 5K16A 1PE6A 1S4VA 2JQFR 1MHWA 1AU2A 1KFXL 1JQPA 1X9YA 5EGWA 2PADA 1PCIA 1CSBB 2AS8A 2BDZA 4OELA 1DEUA 2F7DA 3P5XA 5CHTA 2HH5A 1CTEA 5JA7A 3KSEA 2F1GA 1SP4B 4Q8HA 4YYVA 1YK8A 4I07A 3IV2A 2H7JA 2IPPB 1GECE 3GCBA 1AIMA 1CPJA 4KLBA 3V6EA 4AXMA 1CB5A 4CZWA 4QRVA 3I06A 1NQCA 4N79A 4QRXA 2YJ9A 2Y5BA 3HWNA 3IOQA 3QSDA 2PNSA 1THEA 6PADA 2DC7A 4CDFB 3OF8A 1PPNA 3PW3A 1KFUL 1CVZA 2C0YA 3K24A 2XU5A 1ME4A 4K7CA 3USVA 4W4UA 4X6JA 3BWKA 3WXFA 3V6CA 4AXLA 1EWMA 3QT4A 4YV8A 4RY2A 3IUTA 4I04A 1U9QX 2FT2A 3F75A 1ZIVA
chains in the Genus database with same CATH superfamily
3KWBX 4N8WA 3H6SA 2WBFX 3B21A 4QBBA 4ZUXU 4FJCA 5EZQA 3MP2A 1TL9A 3D6SA 2FO5A 1BY8A 1MEGA 2DJFB 2E00A 3K8UA 4BOUA 4MI7A 3ZNHA 2P0RA 3IHPA 5FPWA 3E9SA 3IMAA 5J94A 2XU4A 3MHSA 1U5IA 2FTDA 3OISA 3H89A 3PDFA 1Q6KA 2AU1A 2AYNA 2OULA 3S3QA 4HWYA 3MORA 1U9WA 3PBHA 3KW9A 4XZXA 3RVVA 4BOQA 4QRGA 1SNKA 1DKIA 1AECA 1YALA 3DF0A 4BS5A 3BPFA 4ZTBA 1ICFA 2GHUA 1K3BB 4D8BA 5EZSA 1MDWA 2UZJA 3K9MA 2FQ9A 2YJ8A 4BSQA 1NL6A 1BP4A 1M6DA 1AYVA 3N4CA 2IBIA 1EWLA 1GCBA 1ME3A 2HD5A 3MHHA 5A24A 3W31A 3S3RA 1PIPA 3HD3A 3PHUA 1PXVA 2R6NA 2G8EA 1U9XA 4CDEB 3WXEA 3MJ5A 2AYOA 5CHVA 1F29A 3OVZA 1KXRA 4R3DA 9PAPA 2CB5A 4PP1A 2ARYA 4MZOA 2GFOA 3AI8A 1AYWA 3CBKA 1A6RA 5CVOB 2G8JA 1EWPA 2E03A 2B1MA 2FYEA 3BBAA 4P6GA 2ACTA 4CDCB 3P5VA 3M99A 3BY4A 4X6HA 1YT7A 5EF4A 4CDDB 1QMYA 1PVJA 1ATKA 1ZCMA 1QXPA 2DZYA 1EF7A 3PRPA 1XKGA 2P7UA 4PI3A 2YJBA 1TLOA 1YVBA 1Y08A 3CH3X 1CS8A 2G7YA 1QOLA 3O1GA 4YYWA 3N3KA 2AIMA 3ERVA 4A5UA 1F2BA 1MEMA 2J7QA 2DCAA 4OW0A 4N4ZA 4YYRA 3H8CA 3MTNA 1GMYA 1IWDA 3N3GA 2R9MA 3I3TA 3P5WA 5JH3A 4M0WA 2DC9A 4BS6A 4I05A 2NQDB 2AGAA 1YK7A 4MM3B 2HHNA 1ITOA 3C9EA 3P5UA 4PP2E 3OF9A 3HHIA 4DMXA 2PREA 3H7DA 5CVMA 4P16A 4MZSA 3C0RA 3B79A 3NHEA 2Y6EA 2JQGR 2BU3A 1BGOA 7PCKA 4MSXA 4W5BA 2DC6A 2DCCA 4W5CA 4YVAA 2HXZA 2R9NA 1TU6A 3O0UA 4Q8GA 1PPOA 4PADA 2DC8A 2XU3A 2G6DA 2FRAA 4P6EA 1NB3A 3QJ3A 1BQIA 2FRQA 1VJVA 1CV8A 1MS6A 3F5VA 3LFYA 5KO3A 3E1ZB 4FIPA 1U9VA 1CJLA 2E02A 2YJCA 2PBHA 1YZBA 3U8EA 4YYUA 1KHQA 3CH2X 3H8BA 4OVZA 4BOZA 1CQDA 4XR7A 2DCBA 4FK5A 1MIRA 1FH0A 3IFUA 2CIOA 3PHXA 2BDLA 4WURA 3BC3A 4RNAA 2R9CA 2R9FA 3W30A 3KX1A 4WA6A 4G54A 3PT2A 1O0EA 1NB5A 2VHSA 1AYUA 3BCNA 1STFE 2FUDA 1VSNA 4YYSA 3HHAA 8PCHA 3BOWA 1PPDA 5F02A 1NPZA 3TMPA 3WXGA 2AUXA 1PPPA 3RVWA 1AU4A 2O6XA 3KFQA 3OQCA 3KWZA 4X6IA 1AU0A 1EWOA 5JZEA 2B1NA 2NQIA 4XUIA 4OEMA 4D8IA 2P86A 3CBJA 2VHFA 1QDQA 4YYQA 2DCDA 1NLJA 2AVWA 2DOSA 3PRMA 2OZ2A 2JRIA 4BOPA 2ATOA 2BTWA 4HXDB 4QH6A 3BPMA 1Y4HA 2YJ2A 3OVXA 2DZZA 5CVNB 5PADA 1KHPA 1AU3A 2R9OA 1PBHA 2XU1A 2J7QC 2DJGB 4BPVA 3PNRA 4DMYA 1POPA 3TNXA 2NQAA 1GLOA 2E01A 3IEJA 2FE8A 4BOSA 3TRKA 1F2CA 4RKXA 1PADA 3ZUAA 1HUCB 4BQVA 2NQGA 4OVZB 1DF0A 2AUZA 3PSEA 4RF0A 3LXSA 2OP3A 3KKUA 4GUAA 3RVXA 1F2AA 3PHWA 5K16A 1PE6A 1S4VA 2JQFR 1MHWA 3O65A 1AU2A 4D8EA 1KFXL 1JQPA 1X9YA 5EGWA 3RNVA 2PADA 1PCIA 1CSBB 2AS8A 2BDZA 4OELA 1DEUA 2F7DA 3P5XA 5CHTA 2HH5A 1CTEA 5JA7A 4RF1A 3KSEA 2F1GA 1SP4B 4Q8HA 4YYVA 4IUMA 1YK8A 4I07A 3IV2A 2H7JA 4REZA 2IPPB 4PT5A 1GECE 3MTVA 2HWKA 3GCBA 1AIMA 1CPJA 2BTWB 4KLBA 3V6EA 4AXMA 1CB5A 4CZWA 2JTCA 3BB7A 4QRVA 3I06A 1NQCA 4N79A 4QRXA 2YJ9A 2Y5BA 3HWNA 3IOQA 3QSDA 2PNSA 1THEA 6PADA 2DC7A 4CDFB 3OF8A 1PPNA 3PW3A 1KFUL 1CVZA 2C0YA 3K24A 2XU5A 1ME4A 4K7CA 1UKFA 3USVA 4W4UA 4X6JA 3BWKA 3WXFA 4IP3A 3V6CA 4AXLA 2Z84A 1EWMA 3QT4A 4YV8A 4RY2A 5E6JA 3IUTA 4I04A 1U9QX 2FT2A 3F75A 1ZIVA
chains in the Genus database with same CATH topology
3KWBX 4N8WA 3H6SA 2WBFX 4ZUXU 4QBBA 4FJCA 1TL9A 1W4TA 3D6SA 2FO5A 1BY8A 1MEGA 2DJFB 2E00A 3K8UA 2P0RA 3IHPA 5FPWA 3IMAA 4BGFA 5J94A 2XU4A 3MHSA 1U5IA 2FTDA 3OISA 3H89A 3PDFA 1Q6KA 2AU1A 2AYNA 2OULA 3S3QA 4HWYA 3MORA 1U9WA 3PBHA 3KW9A 3RVVA 4QRGA 1SNKA 4C5PA 1AECA 1YALA 3DF0A 4BS5A 3BPFA 1ICFA 2GHUA 1K3BB 1MDWA 3K9MA 2FQ9A 2YJ8A 4BSQA 1NL6A 1BP4A 1M6DA 1AYVA 3N4CA 2IBIA 1EWLA 1GCBA 1ME3A 2HD5A 3MHHA 5A24A 3S3RA 1PIPA 3HD3A 1PXVA 2R6NA 2G8EA 1U9XA 4CDEB 3WXEA 2AYOA 5CHVA 1F29A 3OVZA 1KXRA 9PAPA 2CB5A 4PP1A 2ARYA 4MZOA 2GFOA 3AI8A 1AYWA 3CBKA 1A6RA 5CVOB 2G8JA 1EWPA 2E03A 2B1MA 2FYEA 4P6GA 2ACTA 4CDCB 3P5VA 3M99A 4X6HA 1YT7A 5EF4A 4CDDB 1QMYA 1ATKA 1ZCMA 1QXPA 2DZYA 1EF7A 1XKGA 2P7UA 4PI3A 2YJBA 1TLOA 1YVBA 1Y08A 3CH3X 1CS8A 2G7YA 1QOLA 3O1GA 4YYWA 3N3KA 2AIMA 2VFBA 3ERVA 1F2BA 1E2TA 1MEMA 2DCAA 4N4ZA 4YYRA 3H8CA 3MTNA 1GMYA 1IWDA 3N3GA 2R9MA 3I3TA 3P5WA 5JH3A 2DC9A 4BS6A 4I05A 2NQDB 1YK7A 4PP2E 2HHNA 1ITOA 3C9EA 3P5UA 3OF9A 3HHIA 4DMXA 2PREA 3H7DA 5CVMA 4MZSA 3B79A 3NHEA 2Y6EA 2JQGR 4NV7A 1BGOA 7PCKA 4MSXA 4W5BA 2DC6A 2DCCA 4W5CA 4YVAA 2HXZA 2R9NA 1TU6A 3O0UA 4Q8GA 1PPOA 4PADA 2DC8A 2XU3A 2G6DA 2FRAA 4P6EA 1NB3A 3QJ3A 1BQIA 2FRQA 1VJVA 1CV8A 1MS6A 3F5VA 3LFYA 3E1ZB 4FIPA 1U9VA 1CJLA 2E02A 2YJCA 2PBHA 3U8EA 4YYUA 1KHQA 3CH2X 3H8BA 1CQDA 4XR7A 2DCBA 4FK5A 1MIRA 1FH0A 2CIOA 2BDLA 3BC3A 2R9CA 2R9FA 2BSZA 3KX1A 4WA6A 4G54A 1O0EA 1NB5A 2VHSA 1AYUA 3BCNA 1STFE 2FUDA 1VSNA 4YYSA 3HHAA 8PCHA 3BOWA 1PPDA 5F02A 1NPZA 3WXGA 2AUXA 1PPPA 3RVWA 1AU4A 2O6XA 3KFQA 3KWZA 4X6IA 1AU0A 1EWOA 2B1NA 2NQIA 4XUIA 4OEMA 2P86A 3CBJA 2VHFA 1QDQA 4YYQA 2DCDA 1NLJA 2AVWA 2OZ2A 2VFCA 2ATOA 4B55A 4QH6A 3BPMA 1Y4HA 2YJ2A 3OVXA 2DZZA 5CVNB 5PADA 1KHPA 1AU3A 2R9OA 1PBHA 2XU1A 2DJGB 4BPVA 3PNRA 4DMYA 1POPA 3TNXA 2NQAA 1GLOA 2E01A 3D9WA 3IEJA 1F2CA 1PADA 3ZUAA 1HUCB 4BQVA 2NQGA 1DF0A 2AUZA 3LXSA 2OP3A 3KKUA 3RVXA 4GUZA 1F2AA 5K16A 1PE6A 1S4VA 2JQFR 1MHWA 1AU2A 1KFXL 1JQPA 1X9YA 5EGWA 2PADA 1PCIA 1CSBB 2AS8A 2BDZA 4OELA 1DEUA 2F7DA 3P5XA 5CHTA 2HH5A 1CTEA 5JA7A 3KSEA 2F1GA 1SP4B 4Q8HA 4YYVA 1YK8A 4I07A 3IV2A 2H7JA 2IPPB 1GECE 3GCBA 1AIMA 1CPJA 4KLBA 3V6EA 4AXMA 1CB5A 4CZWA 4QRVA 3I06A 1NQCA 4N79A 4QRXA 1W5RA 2YJ9A 2Y5BA 3HWNA 3IOQA 3QSDA 2PNSA 1THEA 6PADA 2DC7A 4CDFB 3OF8A 1PPNA 3PW3A 1KFUL 1CVZA 2C0YA 3K24A 2XU5A 4NV8A 1ME4A 4K7CA 3USVA 4W4UA 4X6JA 3BWKA 3WXFA 1GX3A 3V6CA 4AXLA 1EWMA 3LTWA 3QT4A 4YV8A 4RY2A 3IUTA 4I04A 1U9QX 2FT2A 3F75A 1ZIVA 1W6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWB X;  4N8W A;  3H6S A;  2WBF X;  4ZUX U;  4QBB A;  4FJC A;  1TL9 A;  3D6S A;  2FO5 A;  1BY8 A;  1MEG A;  2DJF B;  2E00 A;  3K8U A;  2P0R A;  3IHP A;  5FPW A;  3IMA A;  5J94 A;  2XU4 A;  3MHS A;  1U5I A;  2FTD A;  3OIS A;  3H89 A;  3PDF A;  1Q6K A;  2AU1 A;  2AYN A;  2OUL A;  3S3Q A;  4HWY A;  3MOR A;  1U9W A;  3PBH A;  3KW9 A;  3RVV A;  4QRG A;  1SNK A;  1AEC A;  1YAL A;  3DF0 A;  4BS5 A;  3BPF A;  1ICF A;  2GHU A;  1K3B B;  1MDW A;  3K9M A;  2FQ9 A;  2YJ8 A;  4BSQ A;  1NL6 A;  1BP4 A;  1M6D A;  1AYV A;  3N4C A;  2IBI A;  1EWL A;  1GCB A;  1ME3 A;  2HD5 A;  3MHH A;  5A24 A;  3S3R A;  1PIP A;  3HD3 A;  1PXV A;  2R6N A;  2G8E A;  1U9X A;  4CDE B;  3WXE A;  2AYO A;  5CHV A;  1F29 A;  3OVZ A;  1KXR A;  9PAP A;  2CB5 A;  4PP1 A;  2ARY A;  4MZO A;  2GFO A;  3AI8 A;  1AYW A;  3CBK A;  1A6R A;  5CVO B;  2G8J A;  1EWP A;  2E03 A;  2B1M A;  2FYE A;  4P6G A;  2ACT A;  4CDC B;  3P5V A;  3M99 A;  4X6H A;  1YT7 A;  5EF4 A;  4CDD B;  1QMY A;  1ATK A;  1ZCM A;  1QXP A;  2DZY A;  1EF7 A;  1XKG A;  2P7U A;  4PI3 A;  2YJB A;  1TLO A;  1YVB A;  1Y08 A;  3CH3 X;  1CS8 A;  2G7Y A;  1QOL A;  3O1G A;  4YYW A;  3N3K A;  2AIM A;  3ERV A;  1F2B A;  1MEM A;  2DCA A;  4N4Z A;  4YYR A;  3H8C A;  3MTN A;  1GMY A;  1IWD A;  3N3G A;  2R9M A;  3I3T A;  3P5W A;  5JH3 A;  2DC9 A;  4BS6 A;  4I05 A;  2NQD B;  1YK7 A;  4PP2 E;  2HHN A;  1ITO A;  3C9E A;  3P5U A;  3OF9 A;  3HHI A;  4DMX A;  2PRE A;  3H7D A;  5CVM A;  4MZS A;  3B79 A;  3NHE A;  2Y6E A;  2JQG R;  1BGO A;  7PCK A;  4MSX A;  4W5B A;  2DC6 A;  2DCC A;  4W5C A;  4YVA A;  2HXZ A;  2R9N A;  1TU6 A;  3O0U A;  4Q8G A;  1PPO A;  4PAD A;  2DC8 A;  2XU3 A;  2G6D A;  2FRA A;  4P6E A;  1NB3 A;  3QJ3 A;  1BQI A;  2FRQ A;  1VJV A;  1CV8 A;  1MS6 A;  3F5V A;  3LFY A;  3E1Z B;  4FIP A;  1U9V A;  1CJL A;  2E02 A;  2YJC A;  2PBH A;  3U8E A;  4YYU A;  1KHQ A;  3CH2 X;  3H8B A;  1CQD A;  4XR7 A;  2DCB A;  4FK5 A;  1MIR A;  1FH0 A;  2CIO A;  2BDL A;  3BC3 A;  2R9C A;  2R9F A;  3KX1 A;  4WA6 A;  4G54 A;  1O0E A;  1NB5 A;  2VHS A;  1AYU A;  3BCN A;  1STF E;  2FUD A;  1VSN A;  4YYS A;  3HHA A;  8PCH A;  3BOW A;  1PPD A;  5F02 A;  1NPZ A;  3WXG A;  2AUX A;  1PPP A;  3RVW A;  1AU4 A;  2O6X A;  3KFQ A;  3KWZ A;  4X6I A;  1AU0 A;  1EWO A;  2B1N A;  2NQI A;  4XUI A;  4OEM A;  2P86 A;  3CBJ A;  2VHF A;  1QDQ A;  4YYQ A;  2DCD A;  1NLJ A;  2AVW A;  2OZ2 A;  2ATO A;  4QH6 A;  3BPM A;  1Y4H A;  2YJ2 A;  3OVX A;  2DZZ A;  5CVN B;  5PAD A;  1KHP A;  1AU3 A;  2R9O A;  1PBH A;  2XU1 A;  2DJG B;  4BPV A;  3PNR A;  4DMY A;  1POP A;  3TNX A;  2NQA A;  1GLO A;  2E01 A;  3IEJ A;  1F2C A;  1PAD A;  3ZUA A;  1HUC B;  4BQV A;  2NQG A;  1DF0 A;  2AUZ A;  3LXS A;  2OP3 A;  3KKU A;  3RVX A;  1F2A A;  5K16 A;  1PE6 A;  1S4V A;  2JQF R;  1MHW A;  1AU2 A;  1KFX L;  1JQP A;  1X9Y A;  5EGW A;  2PAD A;  1PCI A;  1CSB B;  2AS8 A;  2BDZ A;  4OEL A;  1DEU A;  2F7D A;  3P5X A;  5CHT A;  2HH5 A;  1CTE A;  5JA7 A;  3KSE A;  2F1G A;  1SP4 B;  4Q8H A;  4YYV A;  1YK8 A;  4I07 A;  3IV2 A;  2H7J A;  2IPP B;  1GEC E;  3GCB A;  1AIM A;  1CPJ A;  4KLB A;  3V6E A;  4AXM A;  1CB5 A;  4CZW A;  4QRV A;  3I06 A;  1NQC A;  4N79 A;  4QRX A;  2YJ9 A;  2Y5B A;  3HWN A;  3IOQ A;  3QSD A;  2PNS A;  1THE A;  6PAD A;  2DC7 A;  4CDF B;  3OF8 A;  1PPN A;  3PW3 A;  1KFU L;  1CVZ A;  2C0Y A;  3K24 A;  2XU5 A;  1ME4 A;  4K7C A;  3USV A;  4W4U A;  4X6J A;  3BWK A;  3WXF A;  3V6C A;  4AXL A;  1EWM A;  3QT4 A;  4YV8 A;  4RY2 A;  3IUT A;  4I04 A;  1U9Q X;  2FT2 A;  3F75 A;  1ZIV A; 
#chains in the Genus database with same CATH topology
 3KWB X;  4N8W A;  3H6S A;  2WBF X;  3B21 A;  4QBB A;  4ZUX U;  4FJC A;  5EZQ A;  3MP2 A;  1TL9 A;  3D6S A;  2FO5 A;  1BY8 A;  1MEG A;  2DJF B;  2E00 A;  3K8U A;  4BOU A;  4MI7 A;  3ZNH A;  2P0R A;  3IHP A;  5FPW A;  3E9S A;  3IMA A;  5J94 A;  2XU4 A;  3MHS A;  1U5I A;  2FTD A;  3OIS A;  3H89 A;  3PDF A;  1Q6K A;  2AU1 A;  2AYN A;  2OUL A;  3S3Q A;  4HWY A;  3MOR A;  1U9W A;  3PBH A;  3KW9 A;  4XZX A;  3RVV A;  4BOQ A;  4QRG A;  1SNK A;  1DKI A;  1AEC A;  1YAL A;  3DF0 A;  4BS5 A;  3BPF A;  4ZTB A;  1ICF A;  2GHU A;  1K3B B;  4D8B A;  5EZS A;  1MDW A;  2UZJ A;  3K9M A;  2FQ9 A;  2YJ8 A;  4BSQ A;  1NL6 A;  1BP4 A;  1M6D A;  1AYV A;  3N4C A;  2IBI A;  1EWL A;  1GCB A;  1ME3 A;  2HD5 A;  3MHH A;  5A24 A;  3W31 A;  3S3R A;  1PIP A;  3HD3 A;  3PHU A;  1PXV A;  2R6N A;  2G8E A;  1U9X A;  4CDE B;  3WXE A;  3MJ5 A;  2AYO A;  5CHV A;  1F29 A;  3OVZ A;  1KXR A;  4R3D A;  9PAP A;  2CB5 A;  4PP1 A;  2ARY A;  4MZO A;  2GFO A;  3AI8 A;  1AYW A;  3CBK A;  1A6R A;  5CVO B;  2G8J A;  1EWP A;  2E03 A;  2B1M A;  2FYE A;  3BBA A;  4P6G A;  2ACT A;  4CDC B;  3P5V A;  3M99 A;  3BY4 A;  4X6H A;  1YT7 A;  5EF4 A;  4CDD B;  1QMY A;  1PVJ A;  1ATK A;  1ZCM A;  1QXP A;  2DZY A;  1EF7 A;  3PRP A;  1XKG A;  2P7U A;  4PI3 A;  2YJB A;  1TLO A;  1YVB A;  1Y08 A;  3CH3 X;  1CS8 A;  2G7Y A;  1QOL A;  3O1G A;  4YYW A;  3N3K A;  2AIM A;  3ERV A;  4A5U A;  1F2B A;  1MEM A;  2J7Q A;  2DCA A;  4OW0 A;  4N4Z A;  4YYR A;  3H8C A;  3MTN A;  1GMY A;  1IWD A;  3N3G A;  2R9M A;  3I3T A;  3P5W A;  5JH3 A;  4M0W A;  2DC9 A;  4BS6 A;  4I05 A;  2NQD B;  2AGA A;  1YK7 A;  4MM3 B;  2HHN A;  1ITO A;  3C9E A;  3P5U A;  4PP2 E;  3OF9 A;  3HHI A;  4DMX A;  2PRE A;  3H7D A;  5CVM A;  4P16 A;  4MZS A;  3C0R A;  3B79 A;  3NHE A;  2Y6E A;  2JQG R;  2BU3 A;  1BGO A;  7PCK A;  4MSX A;  4W5B A;  2DC6 A;  2DCC A;  4W5C A;  4YVA A;  2HXZ A;  2R9N A;  1TU6 A;  3O0U A;  4Q8G A;  1PPO A;  4PAD A;  2DC8 A;  2XU3 A;  2G6D A;  2FRA A;  4P6E A;  1NB3 A;  3QJ3 A;  1BQI A;  2FRQ A;  1VJV A;  1CV8 A;  1MS6 A;  3F5V A;  3LFY A;  5KO3 A;  3E1Z B;  4FIP A;  1U9V A;  1CJL A;  2E02 A;  2YJC A;  2PBH A;  1YZB A;  3U8E A;  4YYU A;  1KHQ A;  3CH2 X;  3H8B A;  4OVZ A;  4BOZ A;  1CQD A;  4XR7 A;  2DCB A;  4FK5 A;  1MIR A;  1FH0 A;  3IFU A;  2CIO A;  3PHX A;  2BDL A;  4WUR A;  3BC3 A;  4RNA A;  2R9C A;  2R9F A;  3W30 A;  3KX1 A;  4WA6 A;  4G54 A;  3PT2 A;  1O0E A;  1NB5 A;  2VHS A;  1AYU A;  3BCN A;  1STF E;  2FUD A;  1VSN A;  4YYS A;  3HHA A;  8PCH A;  3BOW A;  1PPD A;  5F02 A;  1NPZ A;  3TMP A;  3WXG A;  2AUX A;  1PPP A;  3RVW A;  1AU4 A;  2O6X A;  3KFQ A;  3OQC A;  3KWZ A;  4X6I A;  1AU0 A;  1EWO A;  5JZE A;  2B1N A;  2NQI A;  4XUI A;  4OEM A;  4D8I A;  2P86 A;  3CBJ A;  2VHF A;  1QDQ A;  4YYQ A;  2DCD A;  1NLJ A;  2AVW A;  2DOS A;  3PRM A;  2OZ2 A;  2JRI A;  4BOP A;  2ATO A;  2BTW A;  4HXD B;  4QH6 A;  3BPM A;  1Y4H A;  2YJ2 A;  3OVX A;  2DZZ A;  5CVN B;  5PAD A;  1KHP A;  1AU3 A;  2R9O A;  1PBH A;  2XU1 A;  2J7Q C;  2DJG B;  4BPV A;  3PNR A;  4DMY A;  1POP A;  3TNX A;  2NQA A;  1GLO A;  2E01 A;  3IEJ A;  2FE8 A;  4BOS A;  3TRK A;  1F2C A;  4RKX A;  1PAD A;  3ZUA A;  1HUC B;  4BQV A;  2NQG A;  4OVZ B;  1DF0 A;  2AUZ A;  3PSE A;  4RF0 A;  3LXS A;  2OP3 A;  3KKU A;  4GUA A;  3RVX A;  1F2A A;  3PHW A;  5K16 A;  1PE6 A;  1S4V A;  2JQF R;  1MHW A;  3O65 A;  1AU2 A;  4D8E A;  1KFX L;  1JQP A;  1X9Y A;  5EGW A;  3RNV A;  2PAD A;  1PCI A;  1CSB B;  2AS8 A;  2BDZ A;  4OEL A;  1DEU A;  2F7D A;  3P5X A;  5CHT A;  2HH5 A;  1CTE A;  5JA7 A;  4RF1 A;  3KSE A;  2F1G A;  1SP4 B;  4Q8H A;  4YYV A;  4IUM A;  1YK8 A;  4I07 A;  3IV2 A;  2H7J A;  4REZ A;  2IPP B;  4PT5 A;  1GEC E;  3MTV A;  2HWK A;  3GCB A;  1AIM A;  1CPJ A;  2BTW B;  4KLB A;  3V6E A;  4AXM A;  1CB5 A;  4CZW A;  2JTC A;  3BB7 A;  4QRV A;  3I06 A;  1NQC A;  4N79 A;  4QRX A;  2YJ9 A;  2Y5B A;  3HWN A;  3IOQ A;  3QSD A;  2PNS A;  1THE A;  6PAD A;  2DC7 A;  4CDF B;  3OF8 A;  1PPN A;  3PW3 A;  1KFU L;  1CVZ A;  2C0Y A;  3K24 A;  2XU5 A;  1ME4 A;  4K7C A;  1UKF A;  3USV A;  4W4U A;  4X6J A;  3BWK A;  3WXF A;  4IP3 A;  3V6C A;  4AXL A;  2Z84 A;  1EWM A;  3QT4 A;  4YV8 A;  4RY2 A;  5E6J A;  3IUT A;  4I04 A;  1U9Q X;  2FT2 A;  3F75 A;  1ZIV A; 
#chains in the Genus database with same CATH homology
 3KWB X;  4N8W A;  3H6S A;  2WBF X;  4ZUX U;  4QBB A;  4FJC A;  1TL9 A;  1W4T A;  3D6S A;  2FO5 A;  1BY8 A;  1MEG A;  2DJF B;  2E00 A;  3K8U A;  2P0R A;  3IHP A;  5FPW A;  3IMA A;  4BGF A;  5J94 A;  2XU4 A;  3MHS A;  1U5I A;  2FTD A;  3OIS A;  3H89 A;  3PDF A;  1Q6K A;  2AU1 A;  2AYN A;  2OUL A;  3S3Q A;  4HWY A;  3MOR A;  1U9W A;  3PBH A;  3KW9 A;  3RVV A;  4QRG A;  1SNK A;  4C5P A;  1AEC A;  1YAL A;  3DF0 A;  4BS5 A;  3BPF A;  1ICF A;  2GHU A;  1K3B B;  1MDW A;  3K9M A;  2FQ9 A;  2YJ8 A;  4BSQ A;  1NL6 A;  1BP4 A;  1M6D A;  1AYV A;  3N4C A;  2IBI A;  1EWL A;  1GCB A;  1ME3 A;  2HD5 A;  3MHH A;  5A24 A;  3S3R A;  1PIP A;  3HD3 A;  1PXV A;  2R6N A;  2G8E A;  1U9X A;  4CDE B;  3WXE A;  2AYO A;  5CHV A;  1F29 A;  3OVZ A;  1KXR A;  9PAP A;  2CB5 A;  4PP1 A;  2ARY A;  4MZO A;  2GFO A;  3AI8 A;  1AYW A;  3CBK A;  1A6R A;  5CVO B;  2G8J A;  1EWP A;  2E03 A;  2B1M A;  2FYE A;  4P6G A;  2ACT A;  4CDC B;  3P5V A;  3M99 A;  4X6H A;  1YT7 A;  5EF4 A;  4CDD B;  1QMY A;  1ATK A;  1ZCM A;  1QXP A;  2DZY A;  1EF7 A;  1XKG A;  2P7U A;  4PI3 A;  2YJB A;  1TLO A;  1YVB A;  1Y08 A;  3CH3 X;  1CS8 A;  2G7Y A;  1QOL A;  3O1G A;  4YYW A;  3N3K A;  2AIM A;  2VFB A;  3ERV A;  1F2B A;  1E2T A;  1MEM A;  2DCA A;  4N4Z A;  4YYR A;  3H8C A;  3MTN A;  1GMY A;  1IWD A;  3N3G A;  2R9M A;  3I3T A;  3P5W A;  5JH3 A;  2DC9 A;  4BS6 A;  4I05 A;  2NQD B;  1YK7 A;  4PP2 E;  2HHN A;  1ITO A;  3C9E A;  3P5U A;  3OF9 A;  3HHI A;  4DMX A;  2PRE A;  3H7D A;  5CVM A;  4MZS A;  3B79 A;  3NHE A;  2Y6E A;  2JQG R;  4NV7 A;  1BGO A;  7PCK A;  4MSX A;  4W5B A;  2DC6 A;  2DCC A;  4W5C A;  4YVA A;  2HXZ A;  2R9N A;  1TU6 A;  3O0U A;  4Q8G A;  1PPO A;  4PAD A;  2DC8 A;  2XU3 A;  2G6D A;  2FRA A;  4P6E A;  1NB3 A;  3QJ3 A;  1BQI A;  2FRQ A;  1VJV A;  1CV8 A;  1MS6 A;  3F5V A;  3LFY A;  3E1Z B;  4FIP A;  1U9V A;  1CJL A;  2E02 A;  2YJC A;  2PBH A;  3U8E A;  4YYU A;  1KHQ A;  3CH2 X;  3H8B A;  1CQD A;  4XR7 A;  2DCB A;  4FK5 A;  1MIR A;  1FH0 A;  2CIO A;  2BDL A;  3BC3 A;  2R9C A;  2R9F A;  2BSZ A;  3KX1 A;  4WA6 A;  4G54 A;  1O0E A;  1NB5 A;  2VHS A;  1AYU A;  3BCN A;  1STF E;  2FUD A;  1VSN A;  4YYS A;  3HHA A;  8PCH A;  3BOW A;  1PPD A;  5F02 A;  1NPZ A;  3WXG A;  2AUX A;  1PPP A;  3RVW A;  1AU4 A;  2O6X A;  3KFQ A;  3KWZ A;  4X6I A;  1AU0 A;  1EWO A;  2B1N A;  2NQI A;  4XUI A;  4OEM A;  2P86 A;  3CBJ A;  2VHF A;  1QDQ A;  4YYQ A;  2DCD A;  1NLJ A;  2AVW A;  2OZ2 A;  2VFC A;  2ATO A;  4B55 A;  4QH6 A;  3BPM A;  1Y4H A;  2YJ2 A;  3OVX A;  2DZZ A;  5CVN B;  5PAD A;  1KHP A;  1AU3 A;  2R9O A;  1PBH A;  2XU1 A;  2DJG B;  4BPV A;  3PNR A;  4DMY A;  1POP A;  3TNX A;  2NQA A;  1GLO A;  2E01 A;  3D9W A;  3IEJ A;  1F2C A;  1PAD A;  3ZUA A;  1HUC B;  4BQV A;  2NQG A;  1DF0 A;  2AUZ A;  3LXS A;  2OP3 A;  3KKU A;  3RVX A;  4GUZ A;  1F2A A;  5K16 A;  1PE6 A;  1S4V A;  2JQF R;  1MHW A;  1AU2 A;  1KFX L;  1JQP A;  1X9Y A;  5EGW A;  2PAD A;  1PCI A;  1CSB B;  2AS8 A;  2BDZ A;  4OEL A;  1DEU A;  2F7D A;  3P5X A;  5CHT A;  2HH5 A;  1CTE A;  5JA7 A;  3KSE A;  2F1G A;  1SP4 B;  4Q8H A;  4YYV A;  1YK8 A;  4I07 A;  3IV2 A;  2H7J A;  2IPP B;  1GEC E;  3GCB A;  1AIM A;  1CPJ A;  4KLB A;  3V6E A;  4AXM A;  1CB5 A;  4CZW A;  4QRV A;  3I06 A;  1NQC A;  4N79 A;  4QRX A;  1W5R A;  2YJ9 A;  2Y5B A;  3HWN A;  3IOQ A;  3QSD A;  2PNS A;  1THE A;  6PAD A;  2DC7 A;  4CDF B;  3OF8 A;  1PPN A;  3PW3 A;  1KFU L;  1CVZ A;  2C0Y A;  3K24 A;  2XU5 A;  4NV8 A;  1ME4 A;  4K7C A;  3USV A;  4W4U A;  4X6J A;  3BWK A;  3WXF A;  1GX3 A;  3V6C A;  4AXL A;  1EWM A;  3LTW A;  3QT4 A;  4YV8 A;  4RY2 A;  3IUT A;  4I04 A;  1U9Q X;  2FT2 A;  3F75 A;  1ZIV A;  1W6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...