2WBFX

Crystal structure analysis of sera5e from plasmodium falciparum with loop 690-700 ordered
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
265
structure length
265
Chain Sequence
b'DNMFCNKEYCNRLKDENNCISNLQVEDQGNCDTSWIFASKYHLETIRCMKGYEPTKISALYVANCYKGEHKDRCDEGSSPMEFLQIIEDYGFLPAESNYPYNYVKVGEQCPKVEDHWMNLWDNGKILHNKNEPNSLDGKGYTAYESERFHDNMDAFVKIIKTEVMNKGSVIAYIKAENVMGYEFSGKKVKNLCGDDTADHAVNIVGYGNYVNSEGEKKSYWIVRNSWGPYWGDEGYFKVDMYGPTHCHFNFIHSVVIFNVDLPMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE-REPEAT ANTIGEN PROTEIN
publication title Structural insights into the protease-like antigen Plasmodium falciparum SERA5 and its noncanonical active-site serine.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 71
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2wbfX00
1CB5A 1QMYA 3KW9A 2AIMA 3HD3A 2CB5A 2C0YA 1DEUA 2IBIA 4CDFB 4BQVA 1YK7A 3BC3A 4YV8A 2DCBA 2YJ2A 3CBKA 1ATKA 2B1NA 2PBHA 1F2BA 2FRQA 3IUTA 2HHNA 3PBHA 4PP2E 3KSEA 4CDDB 4G54A 1U9WA 3M99A 4W5BA 1AIMA 3K24A 4XUIA 2DZZA 1M6DA 4QRXA 2FO5A 2F1GA 2NQGA 3KWBX 3OISA 2XU4A 2P0RA 2ACTA 1NB3A 1CTEA 2VHFA 2R6NA 2CIOA 3HWNA 2AVWA 4YYUA 3O1GA 1AU2A 3K9MA 1U9VA 1MHWA 1NLJA 5EGWA 3ZUAA 1GMYA 4N79A 3WXEA 2OP3A 2XU3A 1QOLA 4PI3A 2HXZA 1BGOA 4DMXA 3IHPA 4YYVA 2YJ9A 4BPVA 3IMAA 4ZUXU 2HH5A 4OEMA 1K3BB 2DC6A 3GCBA 3B79A 3N4CA 4HWYA 3USVA 5PADA 2E01A 2DCAA 2FTDA 3CBJA 3IOQA 1PADA 3KFQA 2DC9A 2PREA 2DJFB 2NQAA 1AU4A 1CJLA 3PNRA 4W5CA 3N3GA 1AECA 4QH6A 1Y08A 4YVAA 2PNSA 2E00A 1ITOA 2FRAA 5K16A 2ARYA 1GECE 2ATOA 3KWZA 1IWDA 4PP1A 2JQFR 2G6DA 3RVXA 1NL6A 2DCDA 6PADA 4MZOA 1DF0A 2DC7A 3HHAA 1QXPA 1AYVA 3BOWA 4CZWA 2O6XA 2R9MA 3C9EA 4CDCB 2JQGR 3F5VA 1ZCMA 1MDWA 4MZSA 3U8EA 3V6EA 4MSXA 1PCIA 4QBBA 4QRGA 4BS6A 1JQPA 5CVOB 5JH3A 3I06A 3MTNA 3N3KA 3RVVA 1F2CA 1MS6A 3D6SA 1KFUL 3QSDA 4WA6A 4FK5A 1F29A 4OELA 1CSBB 1F2AA 1SP4B 3WXGA 1PPPA 3V6CA 2AUZA 3H8BA 2BDLA 3MHHA 2G7YA 3OVXA 2FYEA 1YT7A 3E1ZB 3KKUA 3S3QA 2E02A 5CHTA 4Q8GA 1ICFA 1PPNA 3AI8A 8PCHA 1AU3A 3H7DA 3OVZA 4I04A 3RVWA 1PE6A 1KXRA 2PADA 2AYNA 4W4UA 1YK8A 1GCBA 1CV8A 3S3RA 4FIPA 2DZYA 2OULA 1VJVA 3ERVA 1CPJA 1MEGA 1PPOA 4YYRA 4YYSA 3DF0A 1AU0A 2G8JA 2AUXA 4BSQA 4X6JA 1ME3A 3QT4A 4K7CA 4KLBA 3P5UA 1HUCB 1YALA 2P7UA 4AXLA 1FH0A 1SNKA 1EWLA 1CVZA 2R9NA 2XU1A 1EWPA 3OF9A 3O0UA 3CH3X 1EWMA 3P5XA 4XR7A 4AXMA 2B1MA 4DMYA 1NQCA 3BWKA 3K8UA 1TL9A 3BPMA 1BP4A 3P5VA 3HHIA 2Y6EA 1CS8A 4PADA 1TU6A 7PCKA 1PPDA 2E03A 3PDFA 1A6RA 1NPZA 1U9QX 2OZ2A 4I05A 4P6GA 3I3TA 1STFE 2XU5A 1KHQA 3H6SA 3LFYA 1O0EA 1TLOA 1U9XA 2YJ8A 3OF8A 4X6IA 3H8CA 4BS5A 1KHPA 2H7JA 5JA7A 3H89A 1S4VA 2HD5A 3NHEA 1ME4A 1MIRA 2R9CA 4I07A 3F75A 1AYWA 3TNXA 3P5WA 1PBHA 1KFXL 2VHSA 1EWOA 4RY2A 9PAPA 3IV2A 2FQ9A 3QJ3A 2Y5BA 4FJCA 5CVMA 3KX1A 3BCNA 3LXSA 5CVNB 3CH2X 3WXFA 1VSNA 2YJBA 2YJCA 2DJGB 4N4ZA 1YVBA 1POPA 1AYUA 5J94A 2NQIA 3MORA 5F02A 1NB5A 3BPFA 4X6HA 5A24A 2G8EA 1Q6KA 5FPWA 2GHUA 1EF7A 1MEMA 2NQDB 1ZIVA 2DCCA 3IEJA 4N8WA 1GLOA 1PXVA 1BQIA 1QDQA 2GFOA 5CHVA 1BY8A 2BDZA 2R9FA 5EF4A 2P86A 1XKGA 2AYOA 1THEA 1PIPA 4QRVA 1X9YA 2FT2A 1CQDA 3PW3A 2R9OA 2FUDA 4YYWA 4Q8HA 1Y4HA 3MHSA 2AU1A 2F7DA 2DC8A 2IPPB 4P6EA 1U5IA 2WBFX 4CDEB 2AS8A 4YYQA
chains in the Genus database with same CATH superfamily
1CB5A 4HXDB 1QMYA 4D8EA 2J7QA 3KW9A 2AIMA 3HD3A 2CB5A 2C0YA 1DEUA 2IBIA 4CDFB 4BQVA 1YK7A 3BC3A 4YV8A 2DCBA 3B21A 2YJ2A 4GUAA 4ZTBA 3CBKA 1ATKA 2B1NA 2PBHA 1F2BA 2FRQA 3BB7A 5EZSA 3IUTA 2HHNA 3PBHA 4PP2E 3KSEA 4CDDB 4G54A 1U9WA 3M99A 4W5BA 4RNAA 1AIMA 3K24A 4XUIA 1YZBA 2DZZA 1M6DA 4QRXA 2FO5A 2F1GA 2NQGA 3KWBX 3OISA 2XU4A 2P0RA 3PHWA 2ACTA 1NB3A 1CTEA 2VHFA 4P16A 2R6NA 2JTCA 2CIOA 4R3DA 3HWNA 2AVWA 4YYUA 3O1GA 3PRMA 1AU2A 3K9MA 1U9VA 1MHWA 4MM3B 4XZXA 1NLJA 5EGWA 3ZUAA 1GMYA 4N79A 3WXEA 2OP3A 2XU3A 2BTWA 1QOLA 4PI3A 2HXZA 2UZJA 1BGOA 4DMXA 4OVZA 3IHPA 4A5UA 4YYVA 2YJ9A 4BPVA 3IMAA 4ZUXU 2HH5A 4OEMA 1K3BB 2DC6A 3GCBA 3B79A 3N4CA 4HWYA 3OQCA 3USVA 5PADA 5EZQA 5KO3A 2E01A 2DCAA 2FTDA 4RF0A 3CBJA 1UKFA 3IOQA 1PADA 3KFQA 2DC9A 2PREA 2DJFB 3MTVA 2NQAA 1AU4A 1CJLA 3PNRA 4W5CA 4D8BA 3N3GA 3W30A 1AECA 4QH6A 1Y08A 4YVAA 2PNSA 2E00A 1ITOA 2FRAA 5K16A 2ARYA 1GECE 2ATOA 3KWZA 1IWDA 4PP1A 2JQFR 2HWKA 2G6DA 4PT5A 3RVXA 1NL6A 2DCDA 6PADA 4MZOA 3PHUA 1DF0A 2DC7A 3HHAA 1QXPA 1AYVA 3BOWA 4CZWA 2O6XA 2R9MA 3C9EA 4RKXA 4CDCB 2JQGR 3F5VA 1ZCMA 1MDWA 4MZSA 3U8EA 3V6EA 4MSXA 2BU3A 1PCIA 3TRKA 4QBBA 4QRGA 4BS6A 1JQPA 5CVOB 4OW0A 5JH3A 3I06A 3MTNA 3N3KA 3RVVA 1F2CA 1MS6A 3D6SA 1KFUL 3QSDA 4WA6A 4FK5A 1F29A 4OELA 1CSBB 1F2AA 3O65A 4BOUA 1SP4B 3WXGA 1PPPA 3V6CA 2AUZA 3H8BA 2BDLA 3MHHA 2G7YA 3OVXA 2FYEA 3PT2A 2FE8A 1YT7A 3E1ZB 3TMPA 3KKUA 3S3QA 2E02A 5CHTA 4Q8GA 3PHXA 1ICFA 1PPNA 4IP3A 3AI8A 8PCHA 1AU3A 3H7DA 2BTWB 3OVZA 4I04A 3RVWA 4BOQA 1PE6A 1KXRA 2PADA 2AYNA 4OVZB 4W4UA 1YK8A 1GCBA 1CV8A 3S3RA 4FIPA 2DZYA 2OULA 1VJVA 3ERVA 1CPJA 1MEGA 1PPOA 4YYRA 4YYSA 3RNVA 3DF0A 1AU0A 2G8JA 2AUXA 4BSQA 4X6JA 1ME3A 4BOSA 3QT4A 4K7CA 3W31A 4KLBA 3P5UA 1HUCB 1YALA 2P7UA 4IUMA 1FH0A 4AXLA 1SNKA 1EWLA 3ZNHA 1CVZA 2R9NA 2XU1A 4BOPA 1EWPA 3OF9A 3O0UA 3CH3X 1EWMA 3BBAA 3P5XA 4XR7A 4REZA 4M0WA 4AXMA 2B1MA 4DMYA 1NQCA 3BWKA 3K8UA 1TL9A 3BPMA 1BP4A 3P5VA 3BY4A 3HHIA 2Y6EA 1CS8A 4PADA 1TU6A 7PCKA 1PPDA 2E03A 2Z84A 3PDFA 1A6RA 1NPZA 1U9QX 2OZ2A 4I05A 4P6GA 3I3TA 1STFE 1PVJA 2XU5A 1KHQA 3H6SA 3LFYA 1O0EA 1TLOA 1U9XA 2YJ8A 3OF8A 4X6IA 3H8CA 4BS5A 1KHPA 4RF1A 1DKIA 2H7JA 5JA7A 3H89A 1S4VA 5E6JA 2HD5A 3NHEA 1ME4A 1MIRA 2R9CA 4I07A 3F75A 1AYWA 3TNXA 3P5WA 1PBHA 1KFXL 3C0RA 2VHSA 1EWOA 3E9SA 4RY2A 9PAPA 3MJ5A 3IV2A 2FQ9A 3QJ3A 2Y5BA 4FJCA 5CVMA 4WURA 3KX1A 3BCNA 3LXSA 5CVNB 3CH2X 3WXFA 1VSNA 2YJBA 2YJCA 2DJGB 4N4ZA 1YVBA 1POPA 1AYUA 5J94A 2NQIA 2JRIA 3MORA 5F02A 1NB5A 3BPFA 2AGAA 4X6HA 5A24A 2G8EA 1Q6KA 5FPWA 2GHUA 5JZEA 1EF7A 4D8IA 3PRPA 1MEMA 2NQDB 1ZIVA 3MP2A 2DCCA 3IEJA 4N8WA 3IFUA 1GLOA 1PXVA 1BQIA 1QDQA 2GFOA 5CHVA 1BY8A 2BDZA 2R9FA 5EF4A 2P86A 1XKGA 2AYOA 1THEA 1PIPA 3PSEA 4QRVA 1X9YA 2FT2A 1CQDA 3PW3A 2R9OA 2DOSA 4MI7A 2FUDA 4YYWA 2J7QC 4Q8HA 1Y4HA 3MHSA 2AU1A 2F7DA 2DC8A 4BOZA 2IPPB 4P6EA 1U5IA 2WBFX 4CDEB 2AS8A 4YYQA
chains in the Genus database with same CATH topology
1CB5A 1QMYA 3KW9A 2AIMA 3HD3A 2CB5A 2C0YA 1DEUA 2IBIA 4CDFB 4BQVA 1YK7A 3BC3A 4YV8A 2DCBA 2YJ2A 3CBKA 1ATKA 2B1NA 1GX3A 2PBHA 1F2BA 2FRQA 3IUTA 2BSZA 2HHNA 3PBHA 4PP2E 3KSEA 4CDDB 4G54A 1U9WA 3M99A 4W5BA 1AIMA 3K24A 4GUZA 4XUIA 1W5RA 2DZZA 1M6DA 4QRXA 4BGFA 2FO5A 2F1GA 2NQGA 3KWBX 3OISA 2XU4A 2P0RA 2ACTA 1NB3A 1CTEA 2VHFA 2R6NA 2CIOA 3HWNA 2AVWA 4YYUA 3O1GA 1AU2A 3K9MA 1U9VA 1MHWA 1NLJA 5EGWA 3ZUAA 1GMYA 4N79A 3WXEA 2OP3A 2XU3A 1QOLA 4PI3A 2HXZA 1BGOA 4DMXA 3IHPA 4YYVA 2YJ9A 4BPVA 3IMAA 4ZUXU 2HH5A 4OEMA 1K3BB 2DC6A 3GCBA 3B79A 3N4CA 4HWYA 3USVA 5PADA 2E01A 2DCAA 2FTDA 3CBJA 3IOQA 1PADA 3KFQA 2DC9A 2PREA 2DJFB 2NQAA 1AU4A 1CJLA 3PNRA 4W5CA 3N3GA 1W6FA 1AECA 3LTWA 4QH6A 1Y08A 4YVAA 2PNSA 2E00A 1ITOA 2FRAA 5K16A 2ARYA 1GECE 2ATOA 3KWZA 1IWDA 4PP1A 2JQFR 2G6DA 3RVXA 1NL6A 2DCDA 6PADA 4MZOA 1DF0A 2DC7A 3HHAA 1QXPA 1AYVA 4B55A 3BOWA 4CZWA 2O6XA 2R9MA 3C9EA 4CDCB 2JQGR 3F5VA 1ZCMA 1MDWA 4MZSA 3U8EA 3V6EA 4MSXA 1PCIA 4QBBA 4QRGA 4BS6A 1JQPA 5CVOB 5JH3A 3I06A 3MTNA 3N3KA 3RVVA 1F2CA 1MS6A 3D6SA 1KFUL 3QSDA 4WA6A 4FK5A 1F29A 4OELA 1CSBB 1F2AA 1SP4B 3WXGA 1PPPA 3V6CA 2AUZA 3H8BA 2BDLA 3MHHA 2G7YA 3OVXA 2FYEA 1YT7A 3E1ZB 3KKUA 3S3QA 2E02A 5CHTA 4Q8GA 1ICFA 1PPNA 3AI8A 8PCHA 1AU3A 3H7DA 3OVZA 4I04A 3RVWA 1PE6A 1KXRA 2PADA 2AYNA 4W4UA 1YK8A 1GCBA 1CV8A 3S3RA 4FIPA 2DZYA 2OULA 1VJVA 3ERVA 1CPJA 1MEGA 1PPOA 4YYRA 4YYSA 4NV8A 3DF0A 1AU0A 2G8JA 2AUXA 4BSQA 4X6JA 1ME3A 3QT4A 4K7CA 4KLBA 3P5UA 1HUCB 1YALA 2P7UA 4AXLA 1FH0A 1SNKA 1EWLA 1CVZA 4C5PA 2R9NA 2XU1A 1EWPA 3OF9A 3O0UA 3CH3X 1W4TA 1EWMA 3P5XA 4XR7A 4AXMA 2B1MA 4NV7A 4DMYA 1NQCA 3BWKA 3K8UA 1TL9A 3BPMA 1BP4A 3P5VA 3HHIA 2Y6EA 1CS8A 4PADA 1TU6A 7PCKA 1PPDA 2E03A 3PDFA 1A6RA 1NPZA 1U9QX 2OZ2A 4I05A 4P6GA 3I3TA 1STFE 2XU5A 1KHQA 3H6SA 3LFYA 1O0EA 1TLOA 1U9XA 2YJ8A 3OF8A 4X6IA 3H8CA 4BS5A 1KHPA 2VFBA 2H7JA 5JA7A 3H89A 1S4VA 2HD5A 3NHEA 1ME4A 1MIRA 2R9CA 4I07A 3F75A 1AYWA 3TNXA 3P5WA 1PBHA 1KFXL 2VHSA 1EWOA 4RY2A 9PAPA 3IV2A 2FQ9A 3QJ3A 2Y5BA 4FJCA 5CVMA 3KX1A 3BCNA 3LXSA 5CVNB 3CH2X 3WXFA 1VSNA 2YJBA 2YJCA 2DJGB 4N4ZA 1YVBA 1POPA 1AYUA 5J94A 2NQIA 3MORA 5F02A 1NB5A 3BPFA 4X6HA 5A24A 2G8EA 1Q6KA 5FPWA 2GHUA 1EF7A 3D9WA 1MEMA 2NQDB 1ZIVA 1E2TA 2DCCA 3IEJA 4N8WA 1GLOA 1PXVA 1BQIA 1QDQA 2GFOA 5CHVA 1BY8A 2BDZA 2R9FA 5EF4A 2P86A 1XKGA 2AYOA 1THEA 1PIPA 4QRVA 1X9YA 2FT2A 1CQDA 3PW3A 2R9OA 2FUDA 4YYWA 4Q8HA 1Y4HA 3MHSA 2AU1A 2F7DA 2DC8A 2VFCA 2IPPB 4P6EA 1U5IA 2WBFX 4CDEB 2AS8A 4YYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB5 A;  1QMY A;  3KW9 A;  2AIM A;  3HD3 A;  2CB5 A;  2C0Y A;  1DEU A;  2IBI A;  4CDF B;  4BQV A;  1YK7 A;  3BC3 A;  4YV8 A;  2DCB A;  2YJ2 A;  3CBK A;  1ATK A;  2B1N A;  2PBH A;  1F2B A;  2FRQ A;  3IUT A;  2HHN A;  3PBH A;  4PP2 E;  3KSE A;  4CDD B;  4G54 A;  1U9W A;  3M99 A;  4W5B A;  1AIM A;  3K24 A;  4XUI A;  2DZZ A;  1M6D A;  4QRX A;  2FO5 A;  2F1G A;  2NQG A;  3KWB X;  3OIS A;  2XU4 A;  2P0R A;  2ACT A;  1NB3 A;  1CTE A;  2VHF A;  2R6N A;  2CIO A;  3HWN A;  2AVW A;  4YYU A;  3O1G A;  1AU2 A;  3K9M A;  1U9V A;  1MHW A;  1NLJ A;  5EGW A;  3ZUA A;  1GMY A;  4N79 A;  3WXE A;  2OP3 A;  2XU3 A;  1QOL A;  4PI3 A;  2HXZ A;  1BGO A;  4DMX A;  3IHP A;  4YYV A;  2YJ9 A;  4BPV A;  3IMA A;  4ZUX U;  2HH5 A;  4OEM A;  1K3B B;  2DC6 A;  3GCB A;  3B79 A;  3N4C A;  4HWY A;  3USV A;  5PAD A;  2E01 A;  2DCA A;  2FTD A;  3CBJ A;  3IOQ A;  1PAD A;  3KFQ A;  2DC9 A;  2PRE A;  2DJF B;  2NQA A;  1AU4 A;  1CJL A;  3PNR A;  4W5C A;  3N3G A;  1AEC A;  4QH6 A;  1Y08 A;  4YVA A;  2PNS A;  2E00 A;  1ITO A;  2FRA A;  5K16 A;  2ARY A;  1GEC E;  2ATO A;  3KWZ A;  1IWD A;  4PP1 A;  2JQF R;  2G6D A;  3RVX A;  1NL6 A;  2DCD A;  6PAD A;  4MZO A;  1DF0 A;  2DC7 A;  3HHA A;  1QXP A;  1AYV A;  3BOW A;  4CZW A;  2O6X A;  2R9M A;  3C9E A;  4CDC B;  2JQG R;  3F5V A;  1ZCM A;  1MDW A;  4MZS A;  3U8E A;  3V6E A;  4MSX A;  1PCI A;  4QBB A;  4QRG A;  4BS6 A;  1JQP A;  5CVO B;  5JH3 A;  3I06 A;  3MTN A;  3N3K A;  3RVV A;  1F2C A;  1MS6 A;  3D6S A;  1KFU L;  3QSD A;  4WA6 A;  4FK5 A;  1F29 A;  4OEL A;  1CSB B;  1F2A A;  1SP4 B;  3WXG A;  1PPP A;  3V6C A;  2AUZ A;  3H8B A;  2BDL A;  3MHH A;  2G7Y A;  3OVX A;  2FYE A;  1YT7 A;  3E1Z B;  3KKU A;  3S3Q A;  2E02 A;  5CHT A;  4Q8G A;  1ICF A;  1PPN A;  3AI8 A;  8PCH A;  1AU3 A;  3H7D A;  3OVZ A;  4I04 A;  3RVW A;  1PE6 A;  1KXR A;  2PAD A;  2AYN A;  4W4U A;  1YK8 A;  1GCB A;  1CV8 A;  3S3R A;  4FIP A;  2DZY A;  2OUL A;  1VJV A;  3ERV A;  1CPJ A;  1MEG A;  1PPO A;  4YYR A;  4YYS A;  3DF0 A;  1AU0 A;  2G8J A;  2AUX A;  4BSQ A;  4X6J A;  1ME3 A;  3QT4 A;  4K7C A;  4KLB A;  3P5U A;  1HUC B;  1YAL A;  2P7U A;  4AXL A;  1FH0 A;  1SNK A;  1EWL A;  1CVZ A;  2R9N A;  2XU1 A;  1EWP A;  3OF9 A;  3O0U A;  3CH3 X;  1EWM A;  3P5X A;  4XR7 A;  4AXM A;  2B1M A;  4DMY A;  1NQC A;  3BWK A;  3K8U A;  1TL9 A;  3BPM A;  1BP4 A;  3P5V A;  3HHI A;  2Y6E A;  1CS8 A;  4PAD A;  1TU6 A;  7PCK A;  1PPD A;  2E03 A;  3PDF A;  1A6R A;  1NPZ A;  1U9Q X;  2OZ2 A;  4I05 A;  4P6G A;  3I3T A;  1STF E;  2XU5 A;  1KHQ A;  3H6S A;  3LFY A;  1O0E A;  1TLO A;  1U9X A;  2YJ8 A;  3OF8 A;  4X6I A;  3H8C A;  4BS5 A;  1KHP A;  2H7J A;  5JA7 A;  3H89 A;  1S4V A;  2HD5 A;  3NHE A;  1ME4 A;  1MIR A;  2R9C A;  4I07 A;  3F75 A;  1AYW A;  3TNX A;  3P5W A;  1PBH A;  1KFX L;  2VHS A;  1EWO A;  4RY2 A;  9PAP A;  3IV2 A;  2FQ9 A;  3QJ3 A;  2Y5B A;  4FJC A;  5CVM A;  3KX1 A;  3BCN A;  3LXS A;  5CVN B;  3CH2 X;  3WXF A;  1VSN A;  2YJB A;  2YJC A;  2DJG B;  4N4Z A;  1YVB A;  1POP A;  1AYU A;  5J94 A;  2NQI A;  3MOR A;  5F02 A;  1NB5 A;  3BPF A;  4X6H A;  5A24 A;  2G8E A;  1Q6K A;  5FPW A;  2GHU A;  1EF7 A;  1MEM A;  2NQD B;  1ZIV A;  2DCC A;  3IEJ A;  4N8W A;  1GLO A;  1PXV A;  1BQI A;  1QDQ A;  2GFO A;  5CHV A;  1BY8 A;  2BDZ A;  2R9F A;  5EF4 A;  2P86 A;  1XKG A;  2AYO A;  1THE A;  1PIP A;  4QRV A;  1X9Y A;  2FT2 A;  1CQD A;  3PW3 A;  2R9O A;  2FUD A;  4YYW A;  4Q8H A;  1Y4H A;  3MHS A;  2AU1 A;  2F7D A;  2DC8 A;  2IPP B;  4P6E A;  1U5I A;  2WBF X;  4CDE B;  2AS8 A;  4YYQ A; 
#chains in the Genus database with same CATH topology
 1CB5 A;  4HXD B;  1QMY A;  4D8E A;  2J7Q A;  3KW9 A;  2AIM A;  3HD3 A;  2CB5 A;  2C0Y A;  1DEU A;  2IBI A;  4CDF B;  4BQV A;  1YK7 A;  3BC3 A;  4YV8 A;  2DCB A;  3B21 A;  2YJ2 A;  4GUA A;  4ZTB A;  3CBK A;  1ATK A;  2B1N A;  2PBH A;  1F2B A;  2FRQ A;  3BB7 A;  5EZS A;  3IUT A;  2HHN A;  3PBH A;  4PP2 E;  3KSE A;  4CDD B;  4G54 A;  1U9W A;  3M99 A;  4W5B A;  4RNA A;  1AIM A;  3K24 A;  4XUI A;  1YZB A;  2DZZ A;  1M6D A;  4QRX A;  2FO5 A;  2F1G A;  2NQG A;  3KWB X;  3OIS A;  2XU4 A;  2P0R A;  3PHW A;  2ACT A;  1NB3 A;  1CTE A;  2VHF A;  4P16 A;  2R6N A;  2JTC A;  2CIO A;  4R3D A;  3HWN A;  2AVW A;  4YYU A;  3O1G A;  3PRM A;  1AU2 A;  3K9M A;  1U9V A;  1MHW A;  4MM3 B;  4XZX A;  1NLJ A;  5EGW A;  3ZUA A;  1GMY A;  4N79 A;  3WXE A;  2OP3 A;  2XU3 A;  2BTW A;  1QOL A;  4PI3 A;  2HXZ A;  2UZJ A;  1BGO A;  4DMX A;  4OVZ A;  3IHP A;  4A5U A;  4YYV A;  2YJ9 A;  4BPV A;  3IMA A;  4ZUX U;  2HH5 A;  4OEM A;  1K3B B;  2DC6 A;  3GCB A;  3B79 A;  3N4C A;  4HWY A;  3OQC A;  3USV A;  5PAD A;  5EZQ A;  5KO3 A;  2E01 A;  2DCA A;  2FTD A;  4RF0 A;  3CBJ A;  1UKF A;  3IOQ A;  1PAD A;  3KFQ A;  2DC9 A;  2PRE A;  2DJF B;  3MTV A;  2NQA A;  1AU4 A;  1CJL A;  3PNR A;  4W5C A;  4D8B A;  3N3G A;  3W30 A;  1AEC A;  4QH6 A;  1Y08 A;  4YVA A;  2PNS A;  2E00 A;  1ITO A;  2FRA A;  5K16 A;  2ARY A;  1GEC E;  2ATO A;  3KWZ A;  1IWD A;  4PP1 A;  2JQF R;  2HWK A;  2G6D A;  4PT5 A;  3RVX A;  1NL6 A;  2DCD A;  6PAD A;  4MZO A;  3PHU A;  1DF0 A;  2DC7 A;  3HHA A;  1QXP A;  1AYV A;  3BOW A;  4CZW A;  2O6X A;  2R9M A;  3C9E A;  4RKX A;  4CDC B;  2JQG R;  3F5V A;  1ZCM A;  1MDW A;  4MZS A;  3U8E A;  3V6E A;  4MSX A;  2BU3 A;  1PCI A;  3TRK A;  4QBB A;  4QRG A;  4BS6 A;  1JQP A;  5CVO B;  4OW0 A;  5JH3 A;  3I06 A;  3MTN A;  3N3K A;  3RVV A;  1F2C A;  1MS6 A;  3D6S A;  1KFU L;  3QSD A;  4WA6 A;  4FK5 A;  1F29 A;  4OEL A;  1CSB B;  1F2A A;  3O65 A;  4BOU A;  1SP4 B;  3WXG A;  1PPP A;  3V6C A;  2AUZ A;  3H8B A;  2BDL A;  3MHH A;  2G7Y A;  3OVX A;  2FYE A;  3PT2 A;  2FE8 A;  1YT7 A;  3E1Z B;  3TMP A;  3KKU A;  3S3Q A;  2E02 A;  5CHT A;  4Q8G A;  3PHX A;  1ICF A;  1PPN A;  4IP3 A;  3AI8 A;  8PCH A;  1AU3 A;  3H7D A;  2BTW B;  3OVZ A;  4I04 A;  3RVW A;  4BOQ A;  1PE6 A;  1KXR A;  2PAD A;  2AYN A;  4OVZ B;  4W4U A;  1YK8 A;  1GCB A;  1CV8 A;  3S3R A;  4FIP A;  2DZY A;  2OUL A;  1VJV A;  3ERV A;  1CPJ A;  1MEG A;  1PPO A;  4YYR A;  4YYS A;  3RNV A;  3DF0 A;  1AU0 A;  2G8J A;  2AUX A;  4BSQ A;  4X6J A;  1ME3 A;  4BOS A;  3QT4 A;  4K7C A;  3W31 A;  4KLB A;  3P5U A;  1HUC B;  1YAL A;  2P7U A;  4IUM A;  1FH0 A;  4AXL A;  1SNK A;  1EWL A;  3ZNH A;  1CVZ A;  2R9N A;  2XU1 A;  4BOP A;  1EWP A;  3OF9 A;  3O0U A;  3CH3 X;  1EWM A;  3BBA A;  3P5X A;  4XR7 A;  4REZ A;  4M0W A;  4AXM A;  2B1M A;  4DMY A;  1NQC A;  3BWK A;  3K8U A;  1TL9 A;  3BPM A;  1BP4 A;  3P5V A;  3BY4 A;  3HHI A;  2Y6E A;  1CS8 A;  4PAD A;  1TU6 A;  7PCK A;  1PPD A;  2E03 A;  2Z84 A;  3PDF A;  1A6R A;  1NPZ A;  1U9Q X;  2OZ2 A;  4I05 A;  4P6G A;  3I3T A;  1STF E;  1PVJ A;  2XU5 A;  1KHQ A;  3H6S A;  3LFY A;  1O0E A;  1TLO A;  1U9X A;  2YJ8 A;  3OF8 A;  4X6I A;  3H8C A;  4BS5 A;  1KHP A;  4RF1 A;  1DKI A;  2H7J A;  5JA7 A;  3H89 A;  1S4V A;  5E6J A;  2HD5 A;  3NHE A;  1ME4 A;  1MIR A;  2R9C A;  4I07 A;  3F75 A;  1AYW A;  3TNX A;  3P5W A;  1PBH A;  1KFX L;  3C0R A;  2VHS A;  1EWO A;  3E9S A;  4RY2 A;  9PAP A;  3MJ5 A;  3IV2 A;  2FQ9 A;  3QJ3 A;  2Y5B A;  4FJC A;  5CVM A;  4WUR A;  3KX1 A;  3BCN A;  3LXS A;  5CVN B;  3CH2 X;  3WXF A;  1VSN A;  2YJB A;  2YJC A;  2DJG B;  4N4Z A;  1YVB A;  1POP A;  1AYU A;  5J94 A;  2NQI A;  2JRI A;  3MOR A;  5F02 A;  1NB5 A;  3BPF A;  2AGA A;  4X6H A;  5A24 A;  2G8E A;  1Q6K A;  5FPW A;  2GHU A;  5JZE A;  1EF7 A;  4D8I A;  3PRP A;  1MEM A;  2NQD B;  1ZIV A;  3MP2 A;  2DCC A;  3IEJ A;  4N8W A;  3IFU A;  1GLO A;  1PXV A;  1BQI A;  1QDQ A;  2GFO A;  5CHV A;  1BY8 A;  2BDZ A;  2R9F A;  5EF4 A;  2P86 A;  1XKG A;  2AYO A;  1THE A;  1PIP A;  3PSE A;  4QRV A;  1X9Y A;  2FT2 A;  1CQD A;  3PW3 A;  2R9O A;  2DOS A;  4MI7 A;  2FUD A;  4YYW A;  2J7Q C;  4Q8H A;  1Y4H A;  3MHS A;  2AU1 A;  2F7D A;  2DC8 A;  4BOZ A;  2IPP B;  4P6E A;  1U5I A;  2WBF X;  4CDE B;  2AS8 A;  4YYQ A; 
#chains in the Genus database with same CATH homology
 1CB5 A;  1QMY A;  3KW9 A;  2AIM A;  3HD3 A;  2CB5 A;  2C0Y A;  1DEU A;  2IBI A;  4CDF B;  4BQV A;  1YK7 A;  3BC3 A;  4YV8 A;  2DCB A;  2YJ2 A;  3CBK A;  1ATK A;  2B1N A;  1GX3 A;  2PBH A;  1F2B A;  2FRQ A;  3IUT A;  2BSZ A;  2HHN A;  3PBH A;  4PP2 E;  3KSE A;  4CDD B;  4G54 A;  1U9W A;  3M99 A;  4W5B A;  1AIM A;  3K24 A;  4GUZ A;  4XUI A;  1W5R A;  2DZZ A;  1M6D A;  4QRX A;  4BGF A;  2FO5 A;  2F1G A;  2NQG A;  3KWB X;  3OIS A;  2XU4 A;  2P0R A;  2ACT A;  1NB3 A;  1CTE A;  2VHF A;  2R6N A;  2CIO A;  3HWN A;  2AVW A;  4YYU A;  3O1G A;  1AU2 A;  3K9M A;  1U9V A;  1MHW A;  1NLJ A;  5EGW A;  3ZUA A;  1GMY A;  4N79 A;  3WXE A;  2OP3 A;  2XU3 A;  1QOL A;  4PI3 A;  2HXZ A;  1BGO A;  4DMX A;  3IHP A;  4YYV A;  2YJ9 A;  4BPV A;  3IMA A;  4ZUX U;  2HH5 A;  4OEM A;  1K3B B;  2DC6 A;  3GCB A;  3B79 A;  3N4C A;  4HWY A;  3USV A;  5PAD A;  2E01 A;  2DCA A;  2FTD A;  3CBJ A;  3IOQ A;  1PAD A;  3KFQ A;  2DC9 A;  2PRE A;  2DJF B;  2NQA A;  1AU4 A;  1CJL A;  3PNR A;  4W5C A;  3N3G A;  1W6F A;  1AEC A;  3LTW A;  4QH6 A;  1Y08 A;  4YVA A;  2PNS A;  2E00 A;  1ITO A;  2FRA A;  5K16 A;  2ARY A;  1GEC E;  2ATO A;  3KWZ A;  1IWD A;  4PP1 A;  2JQF R;  2G6D A;  3RVX A;  1NL6 A;  2DCD A;  6PAD A;  4MZO A;  1DF0 A;  2DC7 A;  3HHA A;  1QXP A;  1AYV A;  4B55 A;  3BOW A;  4CZW A;  2O6X A;  2R9M A;  3C9E A;  4CDC B;  2JQG R;  3F5V A;  1ZCM A;  1MDW A;  4MZS A;  3U8E A;  3V6E A;  4MSX A;  1PCI A;  4QBB A;  4QRG A;  4BS6 A;  1JQP A;  5CVO B;  5JH3 A;  3I06 A;  3MTN A;  3N3K A;  3RVV A;  1F2C A;  1MS6 A;  3D6S A;  1KFU L;  3QSD A;  4WA6 A;  4FK5 A;  1F29 A;  4OEL A;  1CSB B;  1F2A A;  1SP4 B;  3WXG A;  1PPP A;  3V6C A;  2AUZ A;  3H8B A;  2BDL A;  3MHH A;  2G7Y A;  3OVX A;  2FYE A;  1YT7 A;  3E1Z B;  3KKU A;  3S3Q A;  2E02 A;  5CHT A;  4Q8G A;  1ICF A;  1PPN A;  3AI8 A;  8PCH A;  1AU3 A;  3H7D A;  3OVZ A;  4I04 A;  3RVW A;  1PE6 A;  1KXR A;  2PAD A;  2AYN A;  4W4U A;  1YK8 A;  1GCB A;  1CV8 A;  3S3R A;  4FIP A;  2DZY A;  2OUL A;  1VJV A;  3ERV A;  1CPJ A;  1MEG A;  1PPO A;  4YYR A;  4YYS A;  4NV8 A;  3DF0 A;  1AU0 A;  2G8J A;  2AUX A;  4BSQ A;  4X6J A;  1ME3 A;  3QT4 A;  4K7C A;  4KLB A;  3P5U A;  1HUC B;  1YAL A;  2P7U A;  4AXL A;  1FH0 A;  1SNK A;  1EWL A;  1CVZ A;  4C5P A;  2R9N A;  2XU1 A;  1EWP A;  3OF9 A;  3O0U A;  3CH3 X;  1W4T A;  1EWM A;  3P5X A;  4XR7 A;  4AXM A;  2B1M A;  4NV7 A;  4DMY A;  1NQC A;  3BWK A;  3K8U A;  1TL9 A;  3BPM A;  1BP4 A;  3P5V A;  3HHI A;  2Y6E A;  1CS8 A;  4PAD A;  1TU6 A;  7PCK A;  1PPD A;  2E03 A;  3PDF A;  1A6R A;  1NPZ A;  1U9Q X;  2OZ2 A;  4I05 A;  4P6G A;  3I3T A;  1STF E;  2XU5 A;  1KHQ A;  3H6S A;  3LFY A;  1O0E A;  1TLO A;  1U9X A;  2YJ8 A;  3OF8 A;  4X6I A;  3H8C A;  4BS5 A;  1KHP A;  2VFB A;  2H7J A;  5JA7 A;  3H89 A;  1S4V A;  2HD5 A;  3NHE A;  1ME4 A;  1MIR A;  2R9C A;  4I07 A;  3F75 A;  1AYW A;  3TNX A;  3P5W A;  1PBH A;  1KFX L;  2VHS A;  1EWO A;  4RY2 A;  9PAP A;  3IV2 A;  2FQ9 A;  3QJ3 A;  2Y5B A;  4FJC A;  5CVM A;  3KX1 A;  3BCN A;  3LXS A;  5CVN B;  3CH2 X;  3WXF A;  1VSN A;  2YJB A;  2YJC A;  2DJG B;  4N4Z A;  1YVB A;  1POP A;  1AYU A;  5J94 A;  2NQI A;  3MOR A;  5F02 A;  1NB5 A;  3BPF A;  4X6H A;  5A24 A;  2G8E A;  1Q6K A;  5FPW A;  2GHU A;  1EF7 A;  3D9W A;  1MEM A;  2NQD B;  1ZIV A;  1E2T A;  2DCC A;  3IEJ A;  4N8W A;  1GLO A;  1PXV A;  1BQI A;  1QDQ A;  2GFO A;  5CHV A;  1BY8 A;  2BDZ A;  2R9F A;  5EF4 A;  2P86 A;  1XKG A;  2AYO A;  1THE A;  1PIP A;  4QRV A;  1X9Y A;  2FT2 A;  1CQD A;  3PW3 A;  2R9O A;  2FUD A;  4YYW A;  4Q8H A;  1Y4H A;  3MHS A;  2AU1 A;  2F7D A;  2DC8 A;  2VFC A;  2IPP B;  4P6E A;  1U5I A;  2WBF X;  4CDE B;  2AS8 A;  4YYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...