3PT2A

Structure of a viral otu domain protease bound to ubiquitin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
PGMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
molecule keywords RNA polymerase
total genus 46
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3pt2A00
3PHWA 4BOQA 3C0RA 4BOPA 3ZNHA 3PSEA 4BOUA 5JZEA 3TMPA 4BOZA 3BY4A 3PHXA 4BOSA 3PRMA 3PHUA 4HXDB 3PT2A 3PRPA
chains in the Genus database with same CATH superfamily
1MDWA 1PPDA 1SP4B 4BPVA 2FYEA 4OVZB 2UZJA 4W5CA 1IWDA 1BY8A 1CPJA 4QRGA 1KFXL 1VJVA 2NQDB 2DZYA 2Y5BA 3HD3A 4BOZA 1JQPA 1X9YA 2AUZA 3WXEA 3IMAA 3N3GA 2P86A 1KXRA 3IUTA 1XKGA 1EWLA 4IUMA 5EF4A 4GUAA 2DCBA 4QRVA 4YV8A 3BWKA 1EWOA 3IFUA 3H8CA 3PT2A 4BOQA 2OULA 8PCHA 1GLOA 2P0RA 1CSBB 4N8WA 5CHTA 4Q8GA 1U9VA 2BTWA 2F1GA 2G8JA 3D6SA 2F7DA 3DF0A 5JH3A 2Z84A 4YVAA 3K9MA 3RNVA 2FRAA 2Y6EA 2G8EA 2AU1A 1U9WA 1Y4HA 2C0YA 2XU4A 1QDQA 1DKIA 1ICFA 3PNRA 4RKXA 3K24A 3ZUAA 3MHHA 3BPFA 4P6EA 4RY2A 3IOQA 3PW3A 2OP3A 4PADA 1M6DA 4RNAA 4OVZA 4XR7A 1PIPA 1EF7A 3KWZA 3PHUA 4WA6A 4YYSA 1NL6A 3F75A 2JQGR 4YYWA 4RF0A 2ACTA 1PE6A 2BU3A 1CTEA 6PADA 4D8EA 2AIMA 2GFOA 3H89A 4FK5A 2IPPB 1NB5A 2ARYA 4OW0A 4REZA 1YK7A 4BSQA 3PBHA 2R9OA 1MEMA 2E03A 4AXMA 2FUDA 4QRXA 1STFE 4PI3A 2E01A 3MP2A 1AIMA 2CB5A 4OEMA 4YYQA 4YYUA 2FO5A 5CVNB 5CVOB 3C0RA 3BC3A 1YALA 1U9XA 3BOWA 1BGOA 2NQAA 2DJFB 2YJ2A 2R9FA 3P5WA 3U8EA 4PP2E 4OELA 4W5BA 3MJ5A 1Q6KA 5JA7A 2H7JA 3W30A 4P6GA 5PADA 1ME4A 2DC9A 4X6IA 3AI8A 4IP3A 3GCBA 3KX1A 1MS6A 4PT5A 3C9EA 3K8UA 4D8IA 3QT4A 1MEGA 3BBAA 3P5XA 3TNXA 2FRQA 2FTDA 2DC8A 1QOLA 1HUCB 2HWKA 4MZOA 1AU3A 3PHXA 4MSXA 2AGAA 2E02A 3S3QA 1NLJA 3P5UA 1NPZA 5FPWA 5JZEA 1YZBA 2AYNA 1CVZA 3BPMA 2YJBA 2DZZA 3QSDA 1TU6A 3HHIA 4QBBA 2E00A 3H7DA 1CS8A 3E9SA 2HD5A 1ZIVA 2BTWB 1QXPA 2R6NA 3B79A 1Y08A 2DOSA 1VSNA 2ATOA 2BDLA 3IHPA 1AU4A 3PDFA 2AYOA 2J7QA 4BS5A 1CB5A 4HXDB 2YJCA 2DC7A 1SNKA 2HXZA 1ATKA 4I07A 4XZXA 4MZSA 1PPNA 3MTVA 1YK8A 2GHUA 1GMYA 3KKUA 1TL9A 4MI7A 4X6JA 5F02A 1YVBA 3BCNA 2NQGA 2B1MA 2HH5A 4AXLA 1THEA 2AUXA 2XU5A 1UKFA 4CDEB 5EZQA 1MHWA 2PADA 3CBKA 2DCCA 4YYVA 1ZCMA 3ZNHA 1F29A 2R9NA 5CVMA 1FH0A 2CIOA 2FQ9A 2PBHA 3CH2X 4X6HA 3RVWA 2YJ9A 2JRIA 3TMPA 3WXFA 2DC6A 1POPA 3PHWA 1TLOA 3KFQA 4N4ZA 4I04A 3ERVA 1KHPA 3O65A 2PNSA 2AS8A 1U5IA 3OISA 5EGWA 4CZWA 7PCKA 4PP1A 5CHVA 1O0EA 1PADA 4A5UA 1DF0A 1CJLA 4BOSA 3P5VA 4R3DA 3OF9A 2G6DA 4BQVA 3H8BA 4DMYA 1GCBA 4Q8HA 5K16A 4QH6A 1DEUA 4MM3B 4XUIA 4G54A 3W31A 4BOPA 4DMXA 2PREA 3MTNA 3HHAA 3I06A 4BS6A 1PCIA 1NQCA 2R9MA 4M0WA 3N4CA 4N79A 3O0UA 1F2AA 1PVJA 4W4UA 2R9CA 2DCAA 3PSEA 2VHSA 1AYUA 1AU0A 3HWNA 1S4VA 1KHQA 3NHEA 2HHNA 5E6JA 2IBIA 1AYWA 2JQFR 2XU3A 3RVXA 4YYRA 1EWPA 3H6SA 4CDFB 3USVA 1U9QX 4K7CA 3KSEA 5A24A 3PRPA 3M99A 2OZ2A 3V6CA 2BDZA 3RVVA 3OVXA 3MORA 2DCDA 2O6XA 2XU1A 3MHSA 2J7QC 4HWYA 4CDDB 3CH3X 3V6EA 4D8BA 3OQCA 3TRKA 1F2BA 1A6RA 1F2CA 1CQDA 9PAPA 3F5VA 3WXGA 4CDCB 2FE8A 1YT7A 2DJGB 4FIPA 1PPOA 3OF8A 2B1NA 3I3TA 2AVWA 4P16A 4FJCA 2G7YA 4KLBA 1AYVA 1PPPA 3LFYA 3S3RA 5KO3A 5EZSA 2YJ8A 2P7UA 5J94A 1K3BB 1GECE 1CV8A 2VHFA 1KFUL 2FT2A 3LXSA 2JTCA 3E1ZB 3O1GA 1ME3A 1MIRA 3BB7A 3QJ3A 1EWMA 3PRMA 4ZUXU 1PXVA 2WBFX 3CBJA 1AU2A 1NB3A 1BP4A 3N3KA 1AECA 1ITOA 1PBHA 3BY4A 3IV2A 3OVZA 2NQIA 3B21A 4ZTBA 3KWBX 1QMYA 4WURA 4I05A 1BQIA 3KW9A 4BOUA 4RF1A 3IEJA
chains in the Genus database with same CATH topology
3PHWA 5EZQA 3BBAA 4D8BA 3W31A 4RKXA 3OQCA 3TRKA 4BOPA 4OW0A 3BY4A 5KO3A 4OVZB 4REZA 4XZXA 4IUMA 2UZJA 5EZSA 2BTWA 3MJ5A 2FE8A 3W30A 3O65A 4M0WA 2HWKA 4RNAA 3ZNHA 3MTVA 3PHXA 1PVJA 3E9SA 4OVZA 2AGAA 3PHUA 4GUAA 3PRPA 3B21A 2Z84A 2BTWB 2JTCA 4ZTBA 4MI7A 4A5UA 3PSEA 4IP3A 4BOZA 3BB7A 2DOSA 4BOSA 3MP2A 3RNVA 4RF0A 4WURA 3IFUA 4R3DA 3PT2A 4P16A 4BOQA 3C0RA 2BU3A 4PT5A 5E6JA 5JZEA 2JRIA 1YZBA 4BOUA 3TMPA 4D8EA 2J7QC 1UKFA 1DKIA 3PRMA 2J7QA 4D8IA 4HXDB 4RF1A 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHW A;  4BOQ A;  3C0R A;  4BOP A;  3ZNH A;  3PSE A;  4BOU A;  5JZE A;  3TMP A;  4BOZ A;  3BY4 A;  3PHX A;  4BOS A;  3PRM A;  3PHU A;  4HXD B;  3PT2 A;  3PRP A; 
#chains in the Genus database with same CATH topology
 1MDW A;  1PPD A;  1SP4 B;  4BPV A;  2FYE A;  4OVZ B;  2UZJ A;  4W5C A;  1IWD A;  1BY8 A;  1CPJ A;  4QRG A;  1KFX L;  1VJV A;  2NQD B;  2DZY A;  2Y5B A;  3HD3 A;  4BOZ A;  1JQP A;  1X9Y A;  2AUZ A;  3WXE A;  3IMA A;  3N3G A;  2P86 A;  1KXR A;  3IUT A;  1XKG A;  1EWL A;  4IUM A;  5EF4 A;  4GUA A;  2DCB A;  4QRV A;  4YV8 A;  3BWK A;  1EWO A;  3IFU A;  3H8C A;  3PT2 A;  4BOQ A;  2OUL A;  8PCH A;  1GLO A;  2P0R A;  1CSB B;  4N8W A;  5CHT A;  4Q8G A;  1U9V A;  2BTW A;  2F1G A;  2G8J A;  3D6S A;  2F7D A;  3DF0 A;  5JH3 A;  2Z84 A;  4YVA A;  3K9M A;  3RNV A;  2FRA A;  2Y6E A;  2G8E A;  2AU1 A;  1U9W A;  1Y4H A;  2C0Y A;  2XU4 A;  1QDQ A;  1DKI A;  1ICF A;  3PNR A;  4RKX A;  3K24 A;  3ZUA A;  3MHH A;  3BPF A;  4P6E A;  4RY2 A;  3IOQ A;  3PW3 A;  2OP3 A;  4PAD A;  1M6D A;  4RNA A;  4OVZ A;  4XR7 A;  1PIP A;  1EF7 A;  3KWZ A;  3PHU A;  4WA6 A;  4YYS A;  1NL6 A;  3F75 A;  2JQG R;  4YYW A;  4RF0 A;  2ACT A;  1PE6 A;  2BU3 A;  1CTE A;  6PAD A;  4D8E A;  2AIM A;  2GFO A;  3H89 A;  4FK5 A;  2IPP B;  1NB5 A;  2ARY A;  4OW0 A;  4REZ A;  1YK7 A;  4BSQ A;  3PBH A;  2R9O A;  1MEM A;  2E03 A;  4AXM A;  2FUD A;  4QRX A;  1STF E;  4PI3 A;  2E01 A;  3MP2 A;  1AIM A;  2CB5 A;  4OEM A;  4YYQ A;  4YYU A;  2FO5 A;  5CVN B;  5CVO B;  3C0R A;  3BC3 A;  1YAL A;  1U9X A;  3BOW A;  1BGO A;  2NQA A;  2DJF B;  2YJ2 A;  2R9F A;  3P5W A;  3U8E A;  4PP2 E;  4OEL A;  4W5B A;  3MJ5 A;  1Q6K A;  5JA7 A;  2H7J A;  3W30 A;  4P6G A;  5PAD A;  1ME4 A;  2DC9 A;  4X6I A;  3AI8 A;  4IP3 A;  3GCB A;  3KX1 A;  1MS6 A;  4PT5 A;  3C9E A;  3K8U A;  4D8I A;  3QT4 A;  1MEG A;  3BBA A;  3P5X A;  3TNX A;  2FRQ A;  2FTD A;  2DC8 A;  1QOL A;  1HUC B;  2HWK A;  4MZO A;  1AU3 A;  3PHX A;  4MSX A;  2AGA A;  2E02 A;  3S3Q A;  1NLJ A;  3P5U A;  1NPZ A;  5FPW A;  5JZE A;  1YZB A;  2AYN A;  1CVZ A;  3BPM A;  2YJB A;  2DZZ A;  3QSD A;  1TU6 A;  3HHI A;  4QBB A;  2E00 A;  3H7D A;  1CS8 A;  3E9S A;  2HD5 A;  1ZIV A;  2BTW B;  1QXP A;  2R6N A;  3B79 A;  1Y08 A;  2DOS A;  1VSN A;  2ATO A;  2BDL A;  3IHP A;  1AU4 A;  3PDF A;  2AYO A;  2J7Q A;  4BS5 A;  1CB5 A;  4HXD B;  2YJC A;  2DC7 A;  1SNK A;  2HXZ A;  1ATK A;  4I07 A;  4XZX A;  4MZS A;  1PPN A;  3MTV A;  1YK8 A;  2GHU A;  1GMY A;  3KKU A;  1TL9 A;  4MI7 A;  4X6J A;  5F02 A;  1YVB A;  3BCN A;  2NQG A;  2B1M A;  2HH5 A;  4AXL A;  1THE A;  2AUX A;  2XU5 A;  1UKF A;  4CDE B;  5EZQ A;  1MHW A;  2PAD A;  3CBK A;  2DCC A;  4YYV A;  1ZCM A;  3ZNH A;  1F29 A;  2R9N A;  5CVM A;  1FH0 A;  2CIO A;  2FQ9 A;  2PBH A;  3CH2 X;  4X6H A;  3RVW A;  2YJ9 A;  2JRI A;  3TMP A;  3WXF A;  2DC6 A;  1POP A;  3PHW A;  1TLO A;  3KFQ A;  4N4Z A;  4I04 A;  3ERV A;  1KHP A;  3O65 A;  2PNS A;  2AS8 A;  1U5I A;  3OIS A;  5EGW A;  4CZW A;  7PCK A;  4PP1 A;  5CHV A;  1O0E A;  1PAD A;  4A5U A;  1DF0 A;  1CJL A;  4BOS A;  3P5V A;  4R3D A;  3OF9 A;  2G6D A;  4BQV A;  3H8B A;  4DMY A;  1GCB A;  4Q8H A;  5K16 A;  4QH6 A;  1DEU A;  4MM3 B;  4XUI A;  4G54 A;  3W31 A;  4BOP A;  4DMX A;  2PRE A;  3MTN A;  3HHA A;  3I06 A;  4BS6 A;  1PCI A;  1NQC A;  2R9M A;  4M0W A;  3N4C A;  4N79 A;  3O0U A;  1F2A A;  1PVJ A;  4W4U A;  2R9C A;  2DCA A;  3PSE A;  2VHS A;  1AYU A;  1AU0 A;  3HWN A;  1S4V A;  1KHQ A;  3NHE A;  2HHN A;  5E6J A;  2IBI A;  1AYW A;  2JQF R;  2XU3 A;  3RVX A;  4YYR A;  1EWP A;  3H6S A;  4CDF B;  3USV A;  1U9Q X;  4K7C A;  3KSE A;  5A24 A;  3PRP A;  3M99 A;  2OZ2 A;  3V6C A;  2BDZ A;  3RVV A;  3OVX A;  3MOR A;  2DCD A;  2O6X A;  2XU1 A;  3MHS A;  2J7Q C;  4HWY A;  4CDD B;  3CH3 X;  3V6E A;  4D8B A;  3OQC A;  3TRK A;  1F2B A;  1A6R A;  1F2C A;  1CQD A;  9PAP A;  3F5V A;  3WXG A;  4CDC B;  2FE8 A;  1YT7 A;  2DJG B;  4FIP A;  1PPO A;  3OF8 A;  2B1N A;  3I3T A;  2AVW A;  4P16 A;  4FJC A;  2G7Y A;  4KLB A;  1AYV A;  1PPP A;  3LFY A;  3S3R A;  5KO3 A;  5EZS A;  2YJ8 A;  2P7U A;  5J94 A;  1K3B B;  1GEC E;  1CV8 A;  2VHF A;  1KFU L;  2FT2 A;  3LXS A;  2JTC A;  3E1Z B;  3O1G A;  1ME3 A;  1MIR A;  3BB7 A;  3QJ3 A;  1EWM A;  3PRM A;  4ZUX U;  1PXV A;  2WBF X;  3CBJ A;  1AU2 A;  1NB3 A;  1BP4 A;  3N3K A;  1AEC A;  1ITO A;  1PBH A;  3BY4 A;  3IV2 A;  3OVZ A;  2NQI A;  3B21 A;  4ZTB A;  3KWB X;  1QMY A;  4WUR A;  4I05 A;  1BQI A;  3KW9 A;  4BOU A;  4RF1 A;  3IEJ A; 
#chains in the Genus database with same CATH homology
 3PHW A;  5EZQ A;  3BBA A;  4D8B A;  3W31 A;  4RKX A;  3OQC A;  3TRK A;  4BOP A;  4OW0 A;  3BY4 A;  5KO3 A;  4OVZ B;  4REZ A;  4XZX A;  4IUM A;  2UZJ A;  5EZS A;  2BTW A;  3MJ5 A;  2FE8 A;  3W30 A;  3O65 A;  4M0W A;  2HWK A;  4RNA A;  3ZNH A;  3MTV A;  3PHX A;  1PVJ A;  3E9S A;  4OVZ A;  2AGA A;  3PHU A;  4GUA A;  3PRP A;  3B21 A;  2Z84 A;  2BTW B;  2JTC A;  4ZTB A;  4MI7 A;  4A5U A;  3PSE A;  4IP3 A;  4BOZ A;  3BB7 A;  2DOS A;  4BOS A;  3MP2 A;  3RNV A;  4RF0 A;  4WUR A;  3IFU A;  4R3D A;  3PT2 A;  4P16 A;  4BOQ A;  3C0R A;  2BU3 A;  4PT5 A;  5E6J A;  5JZE A;  2JRI A;  1YZB A;  4BOU A;  3TMP A;  4D8E A;  2J7Q C;  1UKF A;  1DKI A;  3PRM A;  2J7Q A;  4D8I A;  4HXD B;  4RF1 A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...