3PT2A

Structure of a viral otu domain protease bound to ubiquitin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
PGMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
molecule keywords RNA polymerase
total genus 46
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3pt2A00
3PT2A 3C0RA 3TMPA 4BOSA 3PHWA 3PRMA 3PRPA 3BY4A 5JZEA 3PHXA 3PSEA 4BOPA 4BOQA 4BOUA 4BOZA 3PHUA 4HXDB 3ZNHA
chains in the Genus database with same CATH superfamily
1CPJA 1PPNA 4KLBA 3KSEA 3KWZA 2PBHA 2AUZA 4BS5A 4RNAA 3M99A 2XU1A 4FJCA 1YVBA 1PIPA 1POPA 5CVMA 2P0RA 4REZA 5EF4A 2YJCA 1X9YA 1CQDA 4BPVA 4HWYA 1Y08A 5F02A 1YT7A 3K24A 4RKXA 3H8BA 2JQFR 1F2AA 2FQ9A 1KHPA 1AU2A 4YYVA 1DKIA 1QMYA 3KX1A 1TLOA 4K7CA 3PHXA 2R9FA 3BCNA 4CDDB 3IFUA 3H8CA 1PE6A 2AYNA 1KHQA 3N3KA 2WBFX 1TU6A 4PT5A 2BU3A 2NQGA 2AUXA 1CVZA 2R9OA 4YYSA 2HH5A 1EWMA 1TL9A 4QRVA 1ICFA 4DMYA 3O1GA 1U5IA 3MJ5A 3N4CA 2F7DA 4HXDB 5JH3A 3CH3X 3KKUA 3F5VA 3OF9A 4FIPA 3OISA 1F2BA 4PP1A 2E02A 3PHUA 3TNXA 1MDWA 3PHWA 1Y4HA 3OVXA 1PVJA 1O0EA 2R6NA 8PCHA 5FPWA 3BPFA 1JQPA 4BSQA 4CZWA 1YALA 4IP3A 3S3RA 3W31A 2FE8A 3GCBA 4QBBA 4D8BA 2AGAA 2AS8A 1Q6KA 3IMAA 2XU4A 2AYOA 2JTCA 4G54A 4YYQA 1IWDA 4PI3A 3P5VA 4MZSA 3IEJA 4XZXA 1K3BB 1EF7A 3KWBX 1YK8A 3PW3A 1QOLA 2B1MA 1M6DA 5EZSA 1MEGA 4FK5A 3MHSA 1KXRA 4MM3B 2C0YA 3IOQA 2E01A 3LFYA 4RF0A 3AI8A 1AECA 2BTWB 2HXZA 1CS8A 2IBIA 3LXSA 2G7YA 4X6JA 2R9MA 3IV2A 4A5UA 3I06A 4M0WA 4YYWA 4ZUXU 2OP3A 4CDCB 2DJFB 5JZEA 1GECE 4AXLA 3HHAA 3P5XA 1PBHA 2FTDA 2FRAA 2GHUA 4BS6A 2IPPB 1PCIA 4ZTBA 1EWPA 2R9NA 2DZZA 4MI7A 3H7DA 2J7QC 3USVA 5JA7A 1QXPA 3HHIA 3PRMA 2JQGR 1AU0A 3E9SA 1BY8A 4I05A 1VJVA 2ARYA 4QRXA 3TMPA 3PSEA 4QRGA 3CBKA 4BQVA 1VSNA 4YVAA 3QT4A 2DCBA 5CHTA 2DC6A 3O0UA 3WXEA 1S4VA 1CV8A 1KFUL 2AIMA 4XUIA 2DOSA 2G8EA 1CJLA 2OULA 2GFOA 2VHFA 3PBHA 4Q8HA 1NPZA 2BDZA 5E6JA 4YV8A 2DCDA 3ZUAA 4WURA 4DMXA 1CTEA 5CVNB 3HD3A 2OZ2A 3RVXA 1AU3A 1PPOA 3P5UA 3B79A 1DEUA 1F2CA 2H7JA 2AVWA 2F1GA 4OEMA 1PADA 3PNRA 4XR7A 3D6SA 3F75A 1CSBB 1GMYA 2NQIA 3RVVA 3MTVA 4OW0A 5EGWA 3MORA 3N3GA 1AYUA 4BOQA 5J94A 1QDQA 4BOUA 4WA6A 2FO5A 4P16A 4X6HA 3IHPA 4CDFB 2NQDB 3KFQA 4PADA 1SNKA 1BQIA 5EZQA 1THEA 3S3QA 2DCAA 2E03A 4D8EA 2J7QA 4QH6A 3RNVA 1BP4A 3IUTA 3BWKA 4OELA 4Q8GA 4N79A 4P6EA 1MIRA 3BY4A 3C9EA 3U8EA 4W4UA 1PXVA 2BTWA 5PADA 4RF1A 1KFXL 2YJ2A 3ZNHA 2Z84A 3RVWA 2YJ8A 2E00A 1AIMA 4YYUA 2DC9A 1NLJA 1DF0A 2P7UA 1U9QX 3OQCA 4P6GA 4MZOA 3K9MA 1PPDA 1ITOA 1AU4A 3CH2X 2DZYA 3V6CA 4W5BA 2HD5A 2FUDA 3BOWA 3P5WA 3DF0A 1UKFA 2PREA 2DC7A 4CDEB 3BBAA 1FH0A 3H89A 3O65A 5CVOB 2DC8A 3ERVA 4BOZA 1MS6A 5K16A 3I3TA 3PRPA 2AU1A 1ZIVA 1U9WA 9PAPA 2O6XA 3CBJA 2PNSA 3K8UA 4RY2A 4N8WA 1F29A 4R3DA 4I04A 7PCKA 4OVZA 1NB5A 4YYRA 3MP2A 1U9XA 2P86A 2G8JA 1EWLA 1PPPA 3KW9A 1MEMA 2Y6EA 4N4ZA 3H6SA 1NB3A 3OVZA 4BOSA 1YK7A 3C0RA 1EWOA 1ME4A 1ZCMA 4I07A 5CHVA 3B21A 1AYVA 1HUCB 2DJGB 1GCBA 1AYWA 2VHSA 2PADA 6PADA 1STFE 4MSXA 2XU5A 2B1NA 2XU3A 5KO3A 2FT2A 3PDFA 1A6RA 4BOPA 2BDLA 2UZJA 3PT2A 3E1ZB 3HWNA 2FYEA 1CB5A 4OVZB 3TRKA 1NQCA 3W30A 2ACTA 4W5CA 3OF8A 3V6EA 2DCCA 1U9VA 1BGOA 4GUAA 4AXMA 2YJ9A 3BPMA 2CIOA 2HWKA 2ATOA 2Y5BA 3MTNA 1NL6A 4X6IA 2YJBA 2HHNA 1GLOA 2R9CA 3BC3A 3MHHA 1SP4B 1MHWA 4PP2E 2JRIA 4D8IA 2NQAA 3QJ3A 3BB7A 3WXFA 3WXGA 1XKGA 2CB5A 1ME3A 3NHEA 2FRQA 4IUMA 3QSDA 1YZBA 2G6DA 1ATKA 5A24A
chains in the Genus database with same CATH topology
4OW0A 3PT2A 4RKXA 3C0RA 1UKFA 4XZXA 3TMPA 3BY4A 4OVZA 4ZTBA 3PSEA 4BOQA 3MJ5A 3BBAA 2BTWA 4OVZB 4WURA 3B21A 4BOUA 4RF1A 3MP2A 4HXDB 1DKIA 2Z84A 3ZNHA 4IP3A 4P16A 4RNAA 3TRKA 4MI7A 3O65A 3W30A 2JRIA 3PHXA 2J7QC 3W31A 4D8IA 2FE8A 4BOZA 4D8BA 3BB7A 2AGAA 3IFUA 3PRMA 3PRPA 5EZQA 3OQCA 4REZA 5EZSA 4GUAA 4A5UA 5KO3A 2DOSA 4M0WA 3E9SA 4IUMA 1YZBA 3PHUA 2JTCA 4MM3B 2BU3A 4PT5A 4BOSA 3PHWA 5JZEA 2HWKA 4D8EA 2J7QA 3MTVA 4RF0A 1PVJA 3RNVA 4BOPA 5E6JA 4R3DA 2BTWB 2UZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 A;  3C0R A;  3TMP A;  4BOS A;  3PHW A;  3PRM A;  3PRP A;  3BY4 A;  5JZE A;  3PHX A;  3PSE A;  4BOP A;  4BOQ A;  4BOU A;  4BOZ A;  3PHU A;  4HXD B;  3ZNH A; 
#chains in the Genus database with same CATH topology
 1CPJ A;  1PPN A;  4KLB A;  3KSE A;  3KWZ A;  2PBH A;  2AUZ A;  4BS5 A;  4RNA A;  3M99 A;  2XU1 A;  4FJC A;  1YVB A;  1PIP A;  1POP A;  5CVM A;  2P0R A;  4REZ A;  5EF4 A;  2YJC A;  1X9Y A;  1CQD A;  4BPV A;  4HWY A;  1Y08 A;  5F02 A;  1YT7 A;  3K24 A;  4RKX A;  3H8B A;  2JQF R;  1F2A A;  2FQ9 A;  1KHP A;  1AU2 A;  4YYV A;  1DKI A;  1QMY A;  3KX1 A;  1TLO A;  4K7C A;  3PHX A;  2R9F A;  3BCN A;  4CDD B;  3IFU A;  3H8C A;  1PE6 A;  2AYN A;  1KHQ A;  3N3K A;  2WBF X;  1TU6 A;  4PT5 A;  2BU3 A;  2NQG A;  2AUX A;  1CVZ A;  2R9O A;  4YYS A;  2HH5 A;  1EWM A;  1TL9 A;  4QRV A;  1ICF A;  4DMY A;  3O1G A;  1U5I A;  3MJ5 A;  3N4C A;  2F7D A;  4HXD B;  5JH3 A;  3CH3 X;  3KKU A;  3F5V A;  3OF9 A;  4FIP A;  3OIS A;  1F2B A;  4PP1 A;  2E02 A;  3PHU A;  3TNX A;  1MDW A;  3PHW A;  1Y4H A;  3OVX A;  1PVJ A;  1O0E A;  2R6N A;  8PCH A;  5FPW A;  3BPF A;  1JQP A;  4BSQ A;  4CZW A;  1YAL A;  4IP3 A;  3S3R A;  3W31 A;  2FE8 A;  3GCB A;  4QBB A;  4D8B A;  2AGA A;  2AS8 A;  1Q6K A;  3IMA A;  2XU4 A;  2AYO A;  2JTC A;  4G54 A;  4YYQ A;  1IWD A;  4PI3 A;  3P5V A;  4MZS A;  3IEJ A;  4XZX A;  1K3B B;  1EF7 A;  3KWB X;  1YK8 A;  3PW3 A;  1QOL A;  2B1M A;  1M6D A;  5EZS A;  1MEG A;  4FK5 A;  3MHS A;  1KXR A;  4MM3 B;  2C0Y A;  3IOQ A;  2E01 A;  3LFY A;  4RF0 A;  3AI8 A;  1AEC A;  2BTW B;  2HXZ A;  1CS8 A;  2IBI A;  3LXS A;  2G7Y A;  4X6J A;  2R9M A;  3IV2 A;  4A5U A;  3I06 A;  4M0W A;  4YYW A;  4ZUX U;  2OP3 A;  4CDC B;  2DJF B;  5JZE A;  1GEC E;  4AXL A;  3HHA A;  3P5X A;  1PBH A;  2FTD A;  2FRA A;  2GHU A;  4BS6 A;  2IPP B;  1PCI A;  4ZTB A;  1EWP A;  2R9N A;  2DZZ A;  4MI7 A;  3H7D A;  2J7Q C;  3USV A;  5JA7 A;  1QXP A;  3HHI A;  3PRM A;  2JQG R;  1AU0 A;  3E9S A;  1BY8 A;  4I05 A;  1VJV A;  2ARY A;  4QRX A;  3TMP A;  3PSE A;  4QRG A;  3CBK A;  4BQV A;  1VSN A;  4YVA A;  3QT4 A;  2DCB A;  5CHT A;  2DC6 A;  3O0U A;  3WXE A;  1S4V A;  1CV8 A;  1KFU L;  2AIM A;  4XUI A;  2DOS A;  2G8E A;  1CJL A;  2OUL A;  2GFO A;  2VHF A;  3PBH A;  4Q8H A;  1NPZ A;  2BDZ A;  5E6J A;  4YV8 A;  2DCD A;  3ZUA A;  4WUR A;  4DMX A;  1CTE A;  5CVN B;  3HD3 A;  2OZ2 A;  3RVX A;  1AU3 A;  1PPO A;  3P5U A;  3B79 A;  1DEU A;  1F2C A;  2H7J A;  2AVW A;  2F1G A;  4OEM A;  1PAD A;  3PNR A;  4XR7 A;  3D6S A;  3F75 A;  1CSB B;  1GMY A;  2NQI A;  3RVV A;  3MTV A;  4OW0 A;  5EGW A;  3MOR A;  3N3G A;  1AYU A;  4BOQ A;  5J94 A;  1QDQ A;  4BOU A;  4WA6 A;  2FO5 A;  4P16 A;  4X6H A;  3IHP A;  4CDF B;  2NQD B;  3KFQ A;  4PAD A;  1SNK A;  1BQI A;  5EZQ A;  1THE A;  3S3Q A;  2DCA A;  2E03 A;  4D8E A;  2J7Q A;  4QH6 A;  3RNV A;  1BP4 A;  3IUT A;  3BWK A;  4OEL A;  4Q8G A;  4N79 A;  4P6E A;  1MIR A;  3BY4 A;  3C9E A;  3U8E A;  4W4U A;  1PXV A;  2BTW A;  5PAD A;  4RF1 A;  1KFX L;  2YJ2 A;  3ZNH A;  2Z84 A;  3RVW A;  2YJ8 A;  2E00 A;  1AIM A;  4YYU A;  2DC9 A;  1NLJ A;  1DF0 A;  2P7U A;  1U9Q X;  3OQC A;  4P6G A;  4MZO A;  3K9M A;  1PPD A;  1ITO A;  1AU4 A;  3CH2 X;  2DZY A;  3V6C A;  4W5B A;  2HD5 A;  2FUD A;  3BOW A;  3P5W A;  3DF0 A;  1UKF A;  2PRE A;  2DC7 A;  4CDE B;  3BBA A;  1FH0 A;  3H89 A;  3O65 A;  5CVO B;  2DC8 A;  3ERV A;  4BOZ A;  1MS6 A;  5K16 A;  3I3T A;  3PRP A;  2AU1 A;  1ZIV A;  1U9W A;  9PAP A;  2O6X A;  3CBJ A;  2PNS A;  3K8U A;  4RY2 A;  4N8W A;  1F29 A;  4R3D A;  4I04 A;  7PCK A;  4OVZ A;  1NB5 A;  4YYR A;  3MP2 A;  1U9X A;  2P86 A;  2G8J A;  1EWL A;  1PPP A;  3KW9 A;  1MEM A;  2Y6E A;  4N4Z A;  3H6S A;  1NB3 A;  3OVZ A;  4BOS A;  1YK7 A;  3C0R A;  1EWO A;  1ME4 A;  1ZCM A;  4I07 A;  5CHV A;  3B21 A;  1AYV A;  1HUC B;  2DJG B;  1GCB A;  1AYW A;  2VHS A;  2PAD A;  6PAD A;  1STF E;  4MSX A;  2XU5 A;  2B1N A;  2XU3 A;  5KO3 A;  2FT2 A;  3PDF A;  1A6R A;  4BOP A;  2BDL A;  2UZJ A;  3PT2 A;  3E1Z B;  3HWN A;  2FYE A;  1CB5 A;  4OVZ B;  3TRK A;  1NQC A;  3W30 A;  2ACT A;  4W5C A;  3OF8 A;  3V6E A;  2DCC A;  1U9V A;  1BGO A;  4GUA A;  4AXM A;  2YJ9 A;  3BPM A;  2CIO A;  2HWK A;  2ATO A;  2Y5B A;  3MTN A;  1NL6 A;  4X6I A;  2YJB A;  2HHN A;  1GLO A;  2R9C A;  3BC3 A;  3MHH A;  1SP4 B;  1MHW A;  4PP2 E;  2JRI A;  4D8I A;  2NQA A;  3QJ3 A;  3BB7 A;  3WXF A;  3WXG A;  1XKG A;  2CB5 A;  1ME3 A;  3NHE A;  2FRQ A;  4IUM A;  3QSD A;  1YZB A;  2G6D A;  1ATK A;  5A24 A; 
#chains in the Genus database with same CATH homology
 4OW0 A;  3PT2 A;  4RKX A;  3C0R A;  1UKF A;  4XZX A;  3TMP A;  3BY4 A;  4OVZ A;  4ZTB A;  3PSE A;  4BOQ A;  3MJ5 A;  3BBA A;  2BTW A;  4OVZ B;  4WUR A;  3B21 A;  4BOU A;  4RF1 A;  3MP2 A;  4HXD B;  1DKI A;  2Z84 A;  3ZNH A;  4IP3 A;  4P16 A;  4RNA A;  3TRK A;  4MI7 A;  3O65 A;  3W30 A;  2JRI A;  3PHX A;  2J7Q C;  3W31 A;  4D8I A;  2FE8 A;  4BOZ A;  4D8B A;  3BB7 A;  2AGA A;  3IFU A;  3PRM A;  3PRP A;  5EZQ A;  3OQC A;  4REZ A;  5EZS A;  4GUA A;  4A5U A;  5KO3 A;  2DOS A;  4M0W A;  3E9S A;  4IUM A;  1YZB A;  3PHU A;  2JTC A;  4MM3 B;  2BU3 A;  4PT5 A;  4BOS A;  3PHW A;  5JZE A;  2HWK A;  4D8E A;  2J7Q A;  3MTV A;  4RF0 A;  1PVJ A;  3RNV A;  4BOP A;  5E6J A;  4R3D A;  2BTW B;  2UZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...