3PT2A

Structure of a viral otu domain protease bound to ubiquitin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
PGMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
total genus 46
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3pt2A00
3BY4A 3PHWA 4BOQA 3PHXA 5JZEA 3PHUA 3PRMA 4BOSA 4BOZA 3TMPA 4BOUA 4BOPA 4HXDB 3PRPA 3PT2A 3PSEA 3ZNHA 3C0RA
chains in the Genus database with same CATH superfamily
2JQGR 2R9OA 2IPPB 5EGWA 4D8IA 4RKXA 2R9CA 3RVWA 2DZZA 4KLBA 2AYOA 6PADA 1A6RA 2JRIA 2IBIA 4MSXA 1YALA 2HXZA 1O0EA 1EWLA 5CVOB 1KHQA 4BOQA 2CIOA 2G8JA 1CS8A 3OQCA 1ITOA 4W5CA 3MJ5A 4RF0A 2VHFA 5PADA 4BSQA 1EWMA 3P5UA 4FJCA 4M0WA 4PP2E 4K7CA 2JTCA 4OVZB 1TU6A 3N4CA 1F2CA 3USVA 1YK8A 1MS6A 3O0UA 3MHHA 2AYNA 2OZ2A 1CTEA 4IP3A 1MEMA 3PT2A 3S3RA 1CSBB 2XU1A 3TMPA 3F5VA 1GMYA 1THEA 3RVVA 1CV8A 1TL9A 3CBKA 4HXDB 2NQAA 4CDDB 1DF0A 2C0YA 2FQ9A 4PT5A 3PRMA 3KWZA 2VHSA 4GUAA 3PNRA 3H7DA 2G8EA 1HUCB 4XZXA 1CQDA 2H7JA 3MORA 4PI3A 3IOQA 5JH3A 1MDWA 5CHVA 2B1NA 3F75A 1M6DA 3IHPA 2DOSA 2ARYA 3CBJA 3S3QA 3PHXA 2BDLA 4BPVA 3B79A 9PAPA 1DEUA 4CDFB 2B1MA 3H6SA 3IEJA 1QDQA 2XU4A 1NLJA 5A24A 3LFYA 4RF1A 2R9NA 1Y08A 4Q8HA 1EWPA 3HHAA 4YYVA 4A5UA 2UZJA 1ICFA 3P5WA 3BPMA 3C9EA 3OF9A 3D6SA 1BGOA 3E9SA 3DF0A 2CB5A 2HHNA 5JZEA 2DCBA 1U9XA 1AYUA 4P6GA 1AU3A 1PPNA 1YT7A 2NQIA 2DZYA 4WURA 2E01A 2NQDB 3HWNA 4MM3B 3LXSA 3P5XA 3KKUA 4ZUXU 4BQVA 3BC3A 1AU0A 3IUTA 4YYWA 1AU4A 4REZA 1POPA 5K16A 2ACTA 3PDFA 2R6NA 4BS5A 7PCKA 3CH2X 2DJGB 3QJ3A 1CB5A 4CDCB 3U8EA 3KFQA 5JA7A 2GHUA 4XUIA 1TLOA 1BY8A 1PPDA 5CVNB 3I3TA 2DC9A 4RY2A 3WXEA 3ZNHA 2AUXA 4QBBA 1CPJA 4I04A 1X9YA 4DMYA 1SP4B 2FYEA 3CH3X 3C0RA 1K3BB 1S4VA 1ZIVA 1XKGA 1FH0A 1GECE 3WXFA 3W30A 1QMYA 2BU3A 2YJBA 2YJCA 5KO3A 3BBAA 1MEGA 1NB5A 1ZCMA 2YJ9A 3IFUA 4MZOA 3KSEA 2F1GA 4PADA 1BQIA 3E1ZB 4I05A 2DC8A 4QRGA 2FTDA 2FO5A 3TNXA 3BY4A 3N3KA 2OP3A 4AXMA 2E00A 3N3GA 4FK5A 1NL6A 1QOLA 3H8BA 5J94A 2R9FA 1KFUL 1YK7A 2AGAA 3BB7A 2HWKA 1CJLA 2BTWB 3B21A 3PHUA 1KHPA 2WBFX 3ZUAA 3PHWA 3OF8A 1KFXL 5EF4A 4N79A 4OVZA 1AIMA 1AYWA 1F29A 4YYUA 2PNSA 4N4ZA 3MTNA 3I06A 2HH5A 3GCBA 4R3DA 5E6JA 2J7QA 3BCNA 1NQCA 3H8CA 2FRQA 1ATKA 1NB3A 1CVZA 2J7QC 4FIPA 1SNKA 3PRPA 4X6HA 4MZSA 1U9QX 2PREA 1QXPA 4IUMA 3RVXA 1U9WA 1EF7A 4BOUA 4YYQA 2Z84A 1U5IA 3OVXA 2DJFB 2AU1A 1PCIA 1STFE 4QRVA 4OEMA 3K24A 4Q8GA 3PW3A 3PSEA 2FRAA 4P6EA 3QT4A 2BDZA 1KXRA 2P0RA 2Y5BA 2XU5A 4RNAA 2E03A 2AVWA 3OISA 2BTWA 4PP1A 1YVBA 4YYRA 4QH6A 3V6EA 4BS6A 1AECA 1PPPA 3KX1A 5FPWA 2Y6EA 1PXVA 3BWKA 3ERVA 1PADA 1JQPA 2NQGA 3H89A 4CZWA 3O1GA 4OW0A 2HD5A 3HD3A 2JQFR 2ATOA 4HWYA 1GLOA 2DCDA 3M99A 3MTVA 5EZSA 2YJ2A 3OVZA 3W31A 3KWBX 4YVAA 2AIMA 4X6IA 1Y4HA 1PIPA 1GCBA 2XU3A 4D8EA 1ME3A 3IMAA 4BOZA 2AUZA 1YZBA 1ME4A 4D8BA 1PBHA 5F02A 3KW9A 5CHTA 4MI7A 3MHSA 1AYVA 4N8WA 2P7UA 1NPZA 3HHIA 4P16A 4WA6A 1BP4A 2O6XA 2GFOA 2DC7A 3QSDA 4YV8A 3AI8A 4ZTBA 3BPFA 2PADA 2FUDA 1PPOA 1PVJA 2AS8A 1AU2A 2P86A 4X6JA 4OELA 3NHEA 1UKFA 4W4UA 4BOPA 2DCAA 3MP2A 8PCHA 4QRXA 1F2AA 1F2BA 3O65A 4YYSA 3BOWA 3V6CA 3RNVA 4XR7A 4G54A 1MHWA 4DMXA 2F7DA 4I07A 2DCCA 2FE8A 2G6DA 2PBHA 1MIRA 1PE6A 3PBHA 5CVMA 1U9VA 3IV2A 1EWOA 2DC6A 1Q6KA 4W5BA 4CDEB 1VSNA 3TRKA 4BOSA 3K8UA 2E02A 3P5VA 1DKIA 1IWDA 4AXLA 2FT2A 2YJ8A 1VJVA 3WXGA 2R9MA 3K9MA 2OULA 5EZQA 2G7YA
chains in the Genus database with same CATH topology
3BY4A 4D8IA 4RKXA 4A5UA 2UZJA 2JRIA 4OW0A 3E9SA 2AGAA 3MTVA 5EZSA 3BB7A 5JZEA 3W31A 2HWKA 2BTWB 3B21A 4BOQA 3PHUA 3OQCA 4WURA 4D8EA 3MJ5A 4RF0A 3PHWA 4MM3B 4BOZA 1YZBA 4D8BA 4M0WA 4MI7A 4OVZA 2JTCA 4REZA 4OVZB 4P16A 4IP3A 4R3DA 3PT2A 5E6JA 2J7QA 4ZTBA 3TMPA 1PVJA 1UKFA 2J7QC 4BOPA 4HXDB 3PRPA 3MP2A 4PT5A 3PRMA 4GUAA 3ZNHA 3O65A 4IUMA 3RNVA 4BOUA 2Z84A 3C0RA 4XZXA 2FE8A 2DOSA 3W30A 2BU3A 5KO3A 3TRKA 3PHXA 4BOSA 3BBAA 3PSEA 3IFUA 1DKIA 4RNAA 2BTWA 4RF1A 5EZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY4 A;  3PHW A;  4BOQ A;  3PHX A;  5JZE A;  3PHU A;  3PRM A;  4BOS A;  4BOZ A;  3TMP A;  4BOU A;  4BOP A;  4HXD B;  3PRP A;  3PT2 A;  3PSE A;  3ZNH A;  3C0R A; 
#chains in the Genus database with same CATH topology
 2JQG R;  2R9O A;  2IPP B;  5EGW A;  4D8I A;  4RKX A;  2R9C A;  3RVW A;  2DZZ A;  4KLB A;  2AYO A;  6PAD A;  1A6R A;  2JRI A;  2IBI A;  4MSX A;  1YAL A;  2HXZ A;  1O0E A;  1EWL A;  5CVO B;  1KHQ A;  4BOQ A;  2CIO A;  2G8J A;  1CS8 A;  3OQC A;  1ITO A;  4W5C A;  3MJ5 A;  4RF0 A;  2VHF A;  5PAD A;  4BSQ A;  1EWM A;  3P5U A;  4FJC A;  4M0W A;  4PP2 E;  4K7C A;  2JTC A;  4OVZ B;  1TU6 A;  3N4C A;  1F2C A;  3USV A;  1YK8 A;  1MS6 A;  3O0U A;  3MHH A;  2AYN A;  2OZ2 A;  1CTE A;  4IP3 A;  1MEM A;  3PT2 A;  3S3R A;  1CSB B;  2XU1 A;  3TMP A;  3F5V A;  1GMY A;  1THE A;  3RVV A;  1CV8 A;  1TL9 A;  3CBK A;  4HXD B;  2NQA A;  4CDD B;  1DF0 A;  2C0Y A;  2FQ9 A;  4PT5 A;  3PRM A;  3KWZ A;  2VHS A;  4GUA A;  3PNR A;  3H7D A;  2G8E A;  1HUC B;  4XZX A;  1CQD A;  2H7J A;  3MOR A;  4PI3 A;  3IOQ A;  5JH3 A;  1MDW A;  5CHV A;  2B1N A;  3F75 A;  1M6D A;  3IHP A;  2DOS A;  2ARY A;  3CBJ A;  3S3Q A;  3PHX A;  2BDL A;  4BPV A;  3B79 A;  9PAP A;  1DEU A;  4CDF B;  2B1M A;  3H6S A;  3IEJ A;  1QDQ A;  2XU4 A;  1NLJ A;  5A24 A;  3LFY A;  4RF1 A;  2R9N A;  1Y08 A;  4Q8H A;  1EWP A;  3HHA A;  4YYV A;  4A5U A;  2UZJ A;  1ICF A;  3P5W A;  3BPM A;  3C9E A;  3OF9 A;  3D6S A;  1BGO A;  3E9S A;  3DF0 A;  2CB5 A;  2HHN A;  5JZE A;  2DCB A;  1U9X A;  1AYU A;  4P6G A;  1AU3 A;  1PPN A;  1YT7 A;  2NQI A;  2DZY A;  4WUR A;  2E01 A;  2NQD B;  3HWN A;  4MM3 B;  3LXS A;  3P5X A;  3KKU A;  4ZUX U;  4BQV A;  3BC3 A;  1AU0 A;  3IUT A;  4YYW A;  1AU4 A;  4REZ A;  1POP A;  5K16 A;  2ACT A;  3PDF A;  2R6N A;  4BS5 A;  7PCK A;  3CH2 X;  2DJG B;  3QJ3 A;  1CB5 A;  4CDC B;  3U8E A;  3KFQ A;  5JA7 A;  2GHU A;  4XUI A;  1TLO A;  1BY8 A;  1PPD A;  5CVN B;  3I3T A;  2DC9 A;  4RY2 A;  3WXE A;  3ZNH A;  2AUX A;  4QBB A;  1CPJ A;  4I04 A;  1X9Y A;  4DMY A;  1SP4 B;  2FYE A;  3CH3 X;  3C0R A;  1K3B B;  1S4V A;  1ZIV A;  1XKG A;  1FH0 A;  1GEC E;  3WXF A;  3W30 A;  1QMY A;  2BU3 A;  2YJB A;  2YJC A;  5KO3 A;  3BBA A;  1MEG A;  1NB5 A;  1ZCM A;  2YJ9 A;  3IFU A;  4MZO A;  3KSE A;  2F1G A;  4PAD A;  1BQI A;  3E1Z B;  4I05 A;  2DC8 A;  4QRG A;  2FTD A;  2FO5 A;  3TNX A;  3BY4 A;  3N3K A;  2OP3 A;  4AXM A;  2E00 A;  3N3G A;  4FK5 A;  1NL6 A;  1QOL A;  3H8B A;  5J94 A;  2R9F A;  1KFU L;  1YK7 A;  2AGA A;  3BB7 A;  2HWK A;  1CJL A;  2BTW B;  3B21 A;  3PHU A;  1KHP A;  2WBF X;  3ZUA A;  3PHW A;  3OF8 A;  1KFX L;  5EF4 A;  4N79 A;  4OVZ A;  1AIM A;  1AYW A;  1F29 A;  4YYU A;  2PNS A;  4N4Z A;  3MTN A;  3I06 A;  2HH5 A;  3GCB A;  4R3D A;  5E6J A;  2J7Q A;  3BCN A;  1NQC A;  3H8C A;  2FRQ A;  1ATK A;  1NB3 A;  1CVZ A;  2J7Q C;  4FIP A;  1SNK A;  3PRP A;  4X6H A;  4MZS A;  1U9Q X;  2PRE A;  1QXP A;  4IUM A;  3RVX A;  1U9W A;  1EF7 A;  4BOU A;  4YYQ A;  2Z84 A;  1U5I A;  3OVX A;  2DJF B;  2AU1 A;  1PCI A;  1STF E;  4QRV A;  4OEM A;  3K24 A;  4Q8G A;  3PW3 A;  3PSE A;  2FRA A;  4P6E A;  3QT4 A;  2BDZ A;  1KXR A;  2P0R A;  2Y5B A;  2XU5 A;  4RNA A;  2E03 A;  2AVW A;  3OIS A;  2BTW A;  4PP1 A;  1YVB A;  4YYR A;  4QH6 A;  3V6E A;  4BS6 A;  1AEC A;  1PPP A;  3KX1 A;  5FPW A;  2Y6E A;  1PXV A;  3BWK A;  3ERV A;  1PAD A;  1JQP A;  2NQG A;  3H89 A;  4CZW A;  3O1G A;  4OW0 A;  2HD5 A;  3HD3 A;  2JQF R;  2ATO A;  4HWY A;  1GLO A;  2DCD A;  3M99 A;  3MTV A;  5EZS A;  2YJ2 A;  3OVZ A;  3W31 A;  3KWB X;  4YVA A;  2AIM A;  4X6I A;  1Y4H A;  1PIP A;  1GCB A;  2XU3 A;  4D8E A;  1ME3 A;  3IMA A;  4BOZ A;  2AUZ A;  1YZB A;  1ME4 A;  4D8B A;  1PBH A;  5F02 A;  3KW9 A;  5CHT A;  4MI7 A;  3MHS A;  1AYV A;  4N8W A;  2P7U A;  1NPZ A;  3HHI A;  4P16 A;  4WA6 A;  1BP4 A;  2O6X A;  2GFO A;  2DC7 A;  3QSD A;  4YV8 A;  3AI8 A;  4ZTB A;  3BPF A;  2PAD A;  2FUD A;  1PPO A;  1PVJ A;  2AS8 A;  1AU2 A;  2P86 A;  4X6J A;  4OEL A;  3NHE A;  1UKF A;  4W4U A;  4BOP A;  2DCA A;  3MP2 A;  8PCH A;  4QRX A;  1F2A A;  1F2B A;  3O65 A;  4YYS A;  3BOW A;  3V6C A;  3RNV A;  4XR7 A;  4G54 A;  1MHW A;  4DMX A;  2F7D A;  4I07 A;  2DCC A;  2FE8 A;  2G6D A;  2PBH A;  1MIR A;  1PE6 A;  3PBH A;  5CVM A;  1U9V A;  3IV2 A;  1EWO A;  2DC6 A;  1Q6K A;  4W5B A;  4CDE B;  1VSN A;  3TRK A;  4BOS A;  3K8U A;  2E02 A;  3P5V A;  1DKI A;  1IWD A;  4AXL A;  2FT2 A;  2YJ8 A;  1VJV A;  3WXG A;  2R9M A;  3K9M A;  2OUL A;  5EZQ A;  2G7Y A; 
#chains in the Genus database with same CATH homology
 3BY4 A;  4D8I A;  4RKX A;  4A5U A;  2UZJ A;  2JRI A;  4OW0 A;  3E9S A;  2AGA A;  3MTV A;  5EZS A;  3BB7 A;  5JZE A;  3W31 A;  2HWK A;  2BTW B;  3B21 A;  4BOQ A;  3PHU A;  3OQC A;  4WUR A;  4D8E A;  3MJ5 A;  4RF0 A;  3PHW A;  4MM3 B;  4BOZ A;  1YZB A;  4D8B A;  4M0W A;  4MI7 A;  4OVZ A;  2JTC A;  4REZ A;  4OVZ B;  4P16 A;  4IP3 A;  4R3D A;  3PT2 A;  5E6J A;  2J7Q A;  4ZTB A;  3TMP A;  1PVJ A;  1UKF A;  2J7Q C;  4BOP A;  4HXD B;  3PRP A;  3MP2 A;  4PT5 A;  3PRM A;  4GUA A;  3ZNH A;  3O65 A;  4IUM A;  3RNV A;  4BOU A;  2Z84 A;  3C0R A;  4XZX A;  2FE8 A;  2DOS A;  3W30 A;  2BU3 A;  5KO3 A;  3TRK A;  3PHX A;  4BOS A;  3BBA A;  3PSE A;  3IFU A;  1DKI A;  4RNA A;  2BTW A;  4RF1 A;  5EZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...