3PT2A

Structure of a viral otu domain protease bound to ubiquitin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
b'PGMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase
publication title Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/protein binding
total genus 46
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3pt2A00
3BY4A 3PHUA 4BOPA 3PRMA 3PSEA 3PT2A 4BOQA 3PHWA 3PHXA 4BOZA 4BOSA 3TMPA 3ZNHA 5JZEA 4BOUA 4HXDB 3C0RA 3PRPA
chains in the Genus database with same CATH superfamily
2P0RA 4PI3A 1YZBA 4CDDB 9PAPA 3TMPA 4BOZA 2E02A 3K9MA 4IP3A 3IHPA 3O0UA 2JQFR 1GMYA 3MP2A 2E01A 2F7DA 2FTDA 3P5UA 1EWLA 3M99A 3PRPA 3PHUA 3C9EA 2G6DA 1PE6A 2BTWB 1UKFA 3H8BA 2YJBA 2PNSA 3OF8A 1PVJA 1TL9A 1QOLA 1Y4HA 2AIMA 1A6RA 1STFE 5JA7A 1FH0A 4AXLA 3HHIA 8PCHA 4Q8GA 3ZNHA 4DMYA 4X6HA 1MDWA 4P6GA 1O0EA 2R9FA 4D8BA 1SNKA 4HWYA 5KO3A 3DF0A 3TRKA 1HUCB 4WA6A 1YALA 1PPNA 2GFOA 1QDQA 1BQIA 1NPZA 2R9OA 1AECA 2DJFB 4BPVA 3GCBA 2DCDA 2GHUA 4YYSA 2NQIA 1F2CA 1AU4A 7PCKA 1XKGA 2AGAA 4WURA 2G8JA 1ZIVA 2CIOA 2DJGB 2FE8A 2OP3A 1NQCA 2R9NA 3KW9A 5K16A 1ZCMA 4AXMA 1PXVA 1ME3A 3I3TA 1MS6A 2PADA 2FT2A 5EGWA 3IFUA 1AYWA 2YJ8A 3E1ZB 4XR7A 3RVXA 4QRVA 1BGOA 1YK8A 3TNXA 4PADA 1EWOA 2XU1A 1YVBA 2J7QC 3V6EA 1CPJA 2FRAA 3P5WA 4OVZA 1KHQA 4PP2E 2XU4A 4CZWA 2UZJA 3BY4A 2R6NA 1EWPA 1PBHA 4MZSA 1POPA 4REZA 5E6JA 1GECE 4D8IA 2E00A 4W5CA 2BTWA 1TLOA 1QMYA 3K24A 2WBFX 1KFXL 4BOSA 1KHPA 2AYNA 4I05A 3S3RA 4BS5A 4I04A 2FQ9A 3N3GA 2HD5A 3IMAA 2DC7A 3PT2A 3S3QA 3QT4A 1AYVA 1CQDA 4FJCA 3NHEA 2HXZA 2VHFA 1M6DA 1SP4B 4YYUA 2JRIA 4BOUA 4DMXA 3OQCA 2IPPB 3WXFA 5EZSA 5J94A 2NQDB 1AIMA 3PBHA 2DC6A 4X6IA 1MIRA 1Y08A 4N79A 4RF1A 4PT5A 2NQAA 2PREA 2E03A 2YJ9A 3E9SA 4MM3B 1DEUA 3HD3A 1DF0A 2Y5BA 1QXPA 4RY2A 2C0YA 2HH5A 2DZZA 4XUIA 4ZTBA 1CJLA 3HWNA 3OVZA 3WXGA 2DC8A 2AVWA 2XU3A 2DZYA 4CDFB 4BSQA 3PHWA 1ME4A 4YVAA 2BDLA 3B79A 1NL6A 4A5UA 3CH3X 5CHVA 3K8UA 4IUMA 4FIPA 4MI7A 3H7DA 2G7YA 1GCBA 1U9XA 1YT7A 5CVOB 2AU1A 4G54A 1K3BB 3PNRA 1MEGA 3CBKA 3QSDA 2ARYA 2HWKA 3WXEA 3CH2X 1CSBB 4I07A 5EF4A 3H89A 4P16A 2DCCA 2PBHA 2P86A 4YYQA 3RVWA 2R9CA 3KX1A 3QJ3A 3BBAA 3PW3A 1YK7A 3ZUAA 6PADA 2FO5A 2FYEA 4RKXA 5PADA 1NLJA 4GUAA 2JQGR 4OW0A 4QBBA 4KLBA 3IOQA 4D8EA 4QH6A 2OZ2A 3U8EA 1CV8A 1S4VA 1EF7A 4QRGA 4W4UA 1EWMA 3IEJA 4M0WA 3KFQA 1ATKA 2ATOA 3KWBX 3W31A 3H6SA 1GLOA 2OULA 2ACTA 2XU5A 1PPPA 2BU3A 3RNVA 2AS8A 4XZXA 4FK5A 3KWZA 2G8EA 1TU6A 3BWKA 3W30A 1X9YA 3CBJA 4HXDB 3KSEA 4W5BA 4Q8HA 3BPMA 4X6JA 2HHNA 4OVZB 4BS6A 1AYUA 2J7QA 4CDCB 1F29A 5CVNB 1AU2A 2O6XA 3PDFA 4P6EA 1DKIA 3P5XA 3MORA 2DC9A 3D6SA 2BDZA 1ICFA 3AI8A 1AU3A 1KXRA 4MZOA 1MHWA 5EZQA 1CB5A 4YYWA 3USVA 2H7JA 1VSNA 3OF9A 1PADA 2Z84A 2AUZA 2B1NA 1F2AA 3OISA 1CTEA 4RF0A 3BC3A 3N4CA 4RNAA 3MTVA 3OVXA 3LXSA 1NB3A 3PSEA 3PHXA 3IUTA 4YYVA 4OELA 2DCAA 4BOPA 3PRMA 3MHHA 2FRQA 1U9WA 3O65A 4CDEB 3F5VA 4N4ZA 3BPFA 3ERVA 1PCIA 1KFUL 5F02A 2CB5A 3MJ5A 3HHAA 5CVMA 4R3DA 2YJ2A 1U9VA 3MTNA 3B21A 4YYRA 4MSXA 3BB7A 3P5VA 3LFYA 1Q6KA 2VHSA 2NQGA 1VJVA 1U9QX 3C0RA 3RVVA 1F2BA 3V6CA 1AU0A 1JQPA 2P7UA 2YJCA 1CVZA 3BCNA 2AUXA 4OEMA 1IWDA 3F75A 1PIPA 2FUDA 2DOSA 1BY8A 1BP4A 4ZUXU 2DCBA 4PP1A 1THEA 1NB5A 5JH3A 3H8CA 2R9MA 3MHSA 1PPDA 3KKUA 2Y6EA 4BQVA 2IBIA 3N3KA 4N8WA 5A24A 3BOWA 5FPWA 2B1MA 2F1GA 4BOQA 4QRXA 1PPOA 1U5IA 3I06A 1CS8A 4YV8A 2JTCA 1ITOA 2AYOA 3IV2A 4K7CA 5JZEA 3O1GA 5CHTA 1MEMA
chains in the Genus database with same CATH topology
4OVZA 1YZBA 5EZQA 4IUMA 4MI7A 3TMPA 2UZJA 4BOZA 3BY4A 4IP3A 2Z84A 4REZA 5E6JA 4D8IA 3MP2A 4RF0A 2BTWA 2HWKA 4RNAA 3MTVA 3PRPA 3PHUA 3PSEA 4P16A 3PHXA 4BOSA 2BTWB 1UKFA 4BOPA 3PRMA 1PVJA 3O65A 3BBAA 4RKXA 3PT2A 4GUAA 3MJ5A 4R3DA 4OW0A 4D8EA 3ZNHA 3B21A 4M0WA 3BB7A 2JRIA 4D8BA 4BOUA 3OQCA 5EZSA 3W31A 5KO3A 3TRKA 3C0RA 2BU3A 3RNVA 4RF1A 4PT5A 4XZXA 2AGAA 4WURA 2DOSA 3E9SA 2FE8A 4MM3B 3W30A 4HXDB 4ZTBA 4OVZB 3IFUA 2J7QA 4BOQA 2JTCA 1DKIA 2J7QC 3PHWA 4A5UA 5JZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY4 A;  3PHU A;  4BOP A;  3PRM A;  3PSE A;  3PT2 A;  4BOQ A;  3PHW A;  3PHX A;  4BOZ A;  4BOS A;  3TMP A;  3ZNH A;  5JZE A;  4BOU A;  4HXD B;  3C0R A;  3PRP A; 
#chains in the Genus database with same CATH topology
 2P0R A;  4PI3 A;  1YZB A;  4CDD B;  9PAP A;  3TMP A;  4BOZ A;  2E02 A;  3K9M A;  4IP3 A;  3IHP A;  3O0U A;  2JQF R;  1GMY A;  3MP2 A;  2E01 A;  2F7D A;  2FTD A;  3P5U A;  1EWL A;  3M99 A;  3PRP A;  3PHU A;  3C9E A;  2G6D A;  1PE6 A;  2BTW B;  1UKF A;  3H8B A;  2YJB A;  2PNS A;  3OF8 A;  1PVJ A;  1TL9 A;  1QOL A;  1Y4H A;  2AIM A;  1A6R A;  1STF E;  5JA7 A;  1FH0 A;  4AXL A;  3HHI A;  8PCH A;  4Q8G A;  3ZNH A;  4DMY A;  4X6H A;  1MDW A;  4P6G A;  1O0E A;  2R9F A;  4D8B A;  1SNK A;  4HWY A;  5KO3 A;  3DF0 A;  3TRK A;  1HUC B;  4WA6 A;  1YAL A;  1PPN A;  2GFO A;  1QDQ A;  1BQI A;  1NPZ A;  2R9O A;  1AEC A;  2DJF B;  4BPV A;  3GCB A;  2DCD A;  2GHU A;  4YYS A;  2NQI A;  1F2C A;  1AU4 A;  7PCK A;  1XKG A;  2AGA A;  4WUR A;  2G8J A;  1ZIV A;  2CIO A;  2DJG B;  2FE8 A;  2OP3 A;  1NQC A;  2R9N A;  3KW9 A;  5K16 A;  1ZCM A;  4AXM A;  1PXV A;  1ME3 A;  3I3T A;  1MS6 A;  2PAD A;  2FT2 A;  5EGW A;  3IFU A;  1AYW A;  2YJ8 A;  3E1Z B;  4XR7 A;  3RVX A;  4QRV A;  1BGO A;  1YK8 A;  3TNX A;  4PAD A;  1EWO A;  2XU1 A;  1YVB A;  2J7Q C;  3V6E A;  1CPJ A;  2FRA A;  3P5W A;  4OVZ A;  1KHQ A;  4PP2 E;  2XU4 A;  4CZW A;  2UZJ A;  3BY4 A;  2R6N A;  1EWP A;  1PBH A;  4MZS A;  1POP A;  4REZ A;  5E6J A;  1GEC E;  4D8I A;  2E00 A;  4W5C A;  2BTW A;  1TLO A;  1QMY A;  3K24 A;  2WBF X;  1KFX L;  4BOS A;  1KHP A;  2AYN A;  4I05 A;  3S3R A;  4BS5 A;  4I04 A;  2FQ9 A;  3N3G A;  2HD5 A;  3IMA A;  2DC7 A;  3PT2 A;  3S3Q A;  3QT4 A;  1AYV A;  1CQD A;  4FJC A;  3NHE A;  2HXZ A;  2VHF A;  1M6D A;  1SP4 B;  4YYU A;  2JRI A;  4BOU A;  4DMX A;  3OQC A;  2IPP B;  3WXF A;  5EZS A;  5J94 A;  2NQD B;  1AIM A;  3PBH A;  2DC6 A;  4X6I A;  1MIR A;  1Y08 A;  4N79 A;  4RF1 A;  4PT5 A;  2NQA A;  2PRE A;  2E03 A;  2YJ9 A;  3E9S A;  4MM3 B;  1DEU A;  3HD3 A;  1DF0 A;  2Y5B A;  1QXP A;  4RY2 A;  2C0Y A;  2HH5 A;  2DZZ A;  4XUI A;  4ZTB A;  1CJL A;  3HWN A;  3OVZ A;  3WXG A;  2DC8 A;  2AVW A;  2XU3 A;  2DZY A;  4CDF B;  4BSQ A;  3PHW A;  1ME4 A;  4YVA A;  2BDL A;  3B79 A;  1NL6 A;  4A5U A;  3CH3 X;  5CHV A;  3K8U A;  4IUM A;  4FIP A;  4MI7 A;  3H7D A;  2G7Y A;  1GCB A;  1U9X A;  1YT7 A;  5CVO B;  2AU1 A;  4G54 A;  1K3B B;  3PNR A;  1MEG A;  3CBK A;  3QSD A;  2ARY A;  2HWK A;  3WXE A;  3CH2 X;  1CSB B;  4I07 A;  5EF4 A;  3H89 A;  4P16 A;  2DCC A;  2PBH A;  2P86 A;  4YYQ A;  3RVW A;  2R9C A;  3KX1 A;  3QJ3 A;  3BBA A;  3PW3 A;  1YK7 A;  3ZUA A;  6PAD A;  2FO5 A;  2FYE A;  4RKX A;  5PAD A;  1NLJ A;  4GUA A;  2JQG R;  4OW0 A;  4QBB A;  4KLB A;  3IOQ A;  4D8E A;  4QH6 A;  2OZ2 A;  3U8E A;  1CV8 A;  1S4V A;  1EF7 A;  4QRG A;  4W4U A;  1EWM A;  3IEJ A;  4M0W A;  3KFQ A;  1ATK A;  2ATO A;  3KWB X;  3W31 A;  3H6S A;  1GLO A;  2OUL A;  2ACT A;  2XU5 A;  1PPP A;  2BU3 A;  3RNV A;  2AS8 A;  4XZX A;  4FK5 A;  3KWZ A;  2G8E A;  1TU6 A;  3BWK A;  3W30 A;  1X9Y A;  3CBJ A;  4HXD B;  3KSE A;  4W5B A;  4Q8H A;  3BPM A;  4X6J A;  2HHN A;  4OVZ B;  4BS6 A;  1AYU A;  2J7Q A;  4CDC B;  1F29 A;  5CVN B;  1AU2 A;  2O6X A;  3PDF A;  4P6E A;  1DKI A;  3P5X A;  3MOR A;  2DC9 A;  3D6S A;  2BDZ A;  1ICF A;  3AI8 A;  1AU3 A;  1KXR A;  4MZO A;  1MHW A;  5EZQ A;  1CB5 A;  4YYW A;  3USV A;  2H7J A;  1VSN A;  3OF9 A;  1PAD A;  2Z84 A;  2AUZ A;  2B1N A;  1F2A A;  3OIS A;  1CTE A;  4RF0 A;  3BC3 A;  3N4C A;  4RNA A;  3MTV A;  3OVX A;  3LXS A;  1NB3 A;  3PSE A;  3PHX A;  3IUT A;  4YYV A;  4OEL A;  2DCA A;  4BOP A;  3PRM A;  3MHH A;  2FRQ A;  1U9W A;  3O65 A;  4CDE B;  3F5V A;  4N4Z A;  3BPF A;  3ERV A;  1PCI A;  1KFU L;  5F02 A;  2CB5 A;  3MJ5 A;  3HHA A;  5CVM A;  4R3D A;  2YJ2 A;  1U9V A;  3MTN A;  3B21 A;  4YYR A;  4MSX A;  3BB7 A;  3P5V A;  3LFY A;  1Q6K A;  2VHS A;  2NQG A;  1VJV A;  1U9Q X;  3C0R A;  3RVV A;  1F2B A;  3V6C A;  1AU0 A;  1JQP A;  2P7U A;  2YJC A;  1CVZ A;  3BCN A;  2AUX A;  4OEM A;  1IWD A;  3F75 A;  1PIP A;  2FUD A;  2DOS A;  1BY8 A;  1BP4 A;  4ZUX U;  2DCB A;  4PP1 A;  1THE A;  1NB5 A;  5JH3 A;  3H8C A;  2R9M A;  3MHS A;  1PPD A;  3KKU A;  2Y6E A;  4BQV A;  2IBI A;  3N3K A;  4N8W A;  5A24 A;  3BOW A;  5FPW A;  2B1M A;  2F1G A;  4BOQ A;  4QRX A;  1PPO A;  1U5I A;  3I06 A;  1CS8 A;  4YV8 A;  2JTC A;  1ITO A;  2AYO A;  3IV2 A;  4K7C A;  5JZE A;  3O1G A;  5CHT A;  1MEM A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  1YZB A;  5EZQ A;  4IUM A;  4MI7 A;  3TMP A;  2UZJ A;  4BOZ A;  3BY4 A;  4IP3 A;  2Z84 A;  4REZ A;  5E6J A;  4D8I A;  3MP2 A;  4RF0 A;  2BTW A;  2HWK A;  4RNA A;  3MTV A;  3PRP A;  3PHU A;  3PSE A;  4P16 A;  3PHX A;  4BOS A;  2BTW B;  1UKF A;  4BOP A;  3PRM A;  1PVJ A;  3O65 A;  3BBA A;  4RKX A;  3PT2 A;  4GUA A;  3MJ5 A;  4R3D A;  4OW0 A;  4D8E A;  3ZNH A;  3B21 A;  4M0W A;  3BB7 A;  2JRI A;  4D8B A;  4BOU A;  3OQC A;  5EZS A;  3W31 A;  5KO3 A;  3TRK A;  3C0R A;  2BU3 A;  3RNV A;  4RF1 A;  4PT5 A;  4XZX A;  2AGA A;  4WUR A;  2DOS A;  3E9S A;  2FE8 A;  4MM3 B;  3W30 A;  4HXD B;  4ZTB A;  4OVZ B;  3IFU A;  2J7Q A;  4BOQ A;  2JTC A;  1DKI A;  2J7Q C;  3PHW A;  4A5U A;  5JZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...