3N4CA

6-phenyl-1h-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin s inhibitors
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 6-Phenyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin S
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n4cA00
1MHWA 2B1MA 1PPDA 2AYOA 8PCHA 4N4ZA 4CDDB 3I06A 3KW9A 1BQIA 1MIRA 1QXPA 4PI3A 2PADA 1O0EA 1PE6A 4QBBA 3S3QA 2DJGB 1NL6A 3KWBX 1MS6A 3HHIA 1QOLA 2XU1A 1PADA 2DCBA 2HHNA 3LXSA 1HUCB 4FK5A 4K7CA 5A24A 2YJCA 2DCCA 3HHAA 3PBHA 5CHTA 4RY2A 1QDQA 1ME4A 4MZOA 3IOQA 5JA7A 1F2CA 2NQGA 5PADA 3BOWA 1PIPA 3P5XA 2DZYA 4ZUXU 2AU1A 4MSXA 2C0YA 3V6EA 4Q8GA 2FT2A 4I04A 4CDEB 4Q8HA 2YJ8A 4YYWA 3OISA 3KWZA 2ARYA 1JQPA 1TL9A 1XKGA 2E03A 2AYNA 3B79A 1QMYA 3AI8A 2F7DA 2XU5A 3RVXA 1NPZA 1CSBB 5EGWA 2P7UA 1TU6A 1CB5A 1F2AA 1AU0A 1DF0A 2DCAA 1EWLA 2HXZA 1S4VA 4QRGA 3HD3A 1X9YA 2AVWA 4WA6A 1BP4A 3CH3X 3N3KA 3MHHA 1F2BA 3H8CA 2G8EA 4I07A 4N79A 4HWYA 3KX1A 5JH3A 3ZUAA 4P6EA 7PCKA 1VJVA 4DMXA 1SNKA 1CPJA 2AS8A 4BPVA 2G8JA 1YVBA 5K16A 1AU2A 5EF4A 3DF0A 1VSNA 3BWKA 3TNXA 1IWDA 2YJ9A 3KFQA 4BS6A 1GMYA 3H89A 4P6GA 3V6CA 4FJCA 1PCIA 4YV8A 3HWNA 2XU4A 1STFE 5J94A 2YJBA 1AECA 4YYUA 2R9MA 4QRVA 4YYRA 9PAPA 1CVZA 1A6RA 4PP1A 2OZ2A 1AU4A 2DZZA 2YJ2A 3USVA 3O1GA 1YALA 4YVAA 4OELA 1BY8A 2AUZA 2IPPB 4I05A 3F5VA 1U9XA 2BDLA 1GECE 3BPMA 1AU3A 3BPFA 1YK7A 4XUIA 4KLBA 2P0RA 4YYQA 4FIPA 1THEA 3K24A 3QSDA 4W5CA 2R9FA 2FTDA 1KFXL 3E1ZB 2B1NA 2DCDA 1MDWA 2FUDA 1KXRA 1AIMA 2ACTA 4AXMA 2O6XA 4X6HA 3LFYA 3KKUA 3H6SA 3S3RA 1PBHA 1CS8A 2AUXA 1YK8A 1NQCA 2NQIA 3WXEA 1EWPA 2Y5BA 2FRQA 4QH6A 4PP2E 2OP3A 3K9MA 3IUTA 4N8WA 2NQDB 2E01A 3WXFA 3BCNA 1KHQA 3H7DA 3WXGA 3IHPA 1NLJA 2VHSA 3OF8A 1MEMA 4BS5A 1BGOA 2GFOA 5CVOB 3U8EA 3F75A 1U9WA 4DMYA 2JQFR 1NB3A 1M6DA 2HH5A 4PADA 2ATOA 4AXLA 3CBJA 3OVZA 3H8BA 5CVMA 1CTEA 2CIOA 2FYEA 3P5UA 1ITOA 4QRXA 1EF7A 6PADA 1FH0A 2P86A 2DC6A 1Y4HA 2WBFX 3PDFA 1ZCMA 3I3TA 2OULA 2BDZA 2DC7A 5F02A 3RVWA 3N3GA 1POPA 4OEMA 3OF9A 1SP4B 2FO5A 1U9VA 3MHSA 3ERVA 1PXVA 4YYSA 1KFUL 2FQ9A 3IEJA 1EWMA 4X6IA 3D6SA 3MORA 3CBKA 3GCBA 2CB5A 1NB5A 1KHPA 2GHUA 1PPNA 2H7JA 2E00A 1DEUA 1Q6KA 2G6DA 1GLOA 1U5IA 2HD5A 3IV2A 4CDFB 2AIMA 1CQDA 1ATKA 4YYVA 4BQVA 3NHEA 1AYWA 1CJLA 1AYUA 1YT7A 1GCBA 1ZIVA 1PPPA 2IBIA 1Y08A 2PREA 2R6NA 3QJ3A 3N4CA 5FPWA 3PW3A 5CHVA 1ICFA 1MEGA 2JQGR 4CZWA 3P5VA 2F1GA 3RVVA 2R9NA 5CVNB 2FRAA 3K8UA 3CH2X 2DJFB 2R9OA 3MTNA 3PNRA 3KSEA 1CV8A 1ME3A 1AYVA 3BC3A 3OVXA 3IMAA 2DC8A 1K3BB 2DC9A 1PPOA 1F29A 2NQAA 2R9CA 4W4UA 3C9EA 2VHFA 3P5WA 2G7YA 4MZSA 2XU3A 4W5BA 2PNSA 3O0UA 4BSQA 1TLOA 3M99A 1U9QX 4CDCB 4G54A 4X6JA 2PBHA 2E02A 1EWOA 2Y6EA 3QT4A 4XR7A
chains in the Genus database with same CATH superfamily
1MHWA 2B1MA 1PPDA 2AYOA 4A5UA 8PCHA 4N4ZA 4CDDB 3I06A 3KW9A 1BQIA 4OW0A 1MIRA 1QXPA 4PI3A 5EZSA 2PADA 1O0EA 3TRKA 3PHXA 1PE6A 4QBBA 3S3QA 2DJGB 1NL6A 3KWBX 1MS6A 3HHIA 3RNVA 1QOLA 2XU1A 1PADA 2DCBA 2HHNA 3LXSA 1HUCB 4IUMA 4FK5A 3PT2A 4K7CA 4XZXA 5A24A 2YJCA 2DCCA 3HHAA 3PBHA 5CHTA 4RY2A 1QDQA 1ME4A 4MZOA 3IOQA 5JA7A 1F2CA 2NQGA 5PADA 3BOWA 1PIPA 3P5XA 2DZYA 4ZUXU 2AU1A 4MSXA 2C0YA 3V6EA 4Q8GA 2FT2A 4RF0A 4I04A 4CDEB 4RKXA 4Q8HA 2YJ8A 4YYWA 3OISA 3KWZA 2ARYA 1JQPA 1TL9A 1XKGA 2E03A 2AYNA 3B79A 1QMYA 3AI8A 2F7DA 3RVXA 1NPZA 4WURA 1CSBB 5EGWA 2P7UA 1TU6A 1CB5A 1F2AA 1AU0A 1DF0A 2DCAA 1EWLA 2HXZA 1S4VA 4QRGA 3E9SA 3HD3A 1X9YA 2AVWA 4WA6A 1BP4A 3CH3X 3N3KA 3MHHA 1F2BA 2J7QC 3H8CA 2G8EA 4I07A 3MTVA 4N79A 4HWYA 3C0RA 3KX1A 5JH3A 3ZUAA 4OVZB 4P6EA 7PCKA 1VJVA 3MP2A 4DMXA 1SNKA 2HWKA 1CPJA 3BBAA 2AS8A 4BPVA 2G8JA 3PRMA 1YVBA 5K16A 2AGAA 1AU2A 5EF4A 3DF0A 1VSNA 3BWKA 4RNAA 3TNXA 1IWDA 2YJ9A 3KFQA 4BS6A 1GMYA 3H89A 4P6GA 3V6CA 4FJCA 4MI7A 1PCIA 4YV8A 3HWNA 2XU4A 1STFE 5J94A 2YJBA 1AECA 4YYUA 2R9MA 4QRVA 4YYRA 9PAPA 1CVZA 1A6RA 4PP1A 2OZ2A 1AU4A 2DZZA 2YJ2A 3USVA 4M0WA 3O1GA 1YALA 4YVAA 4OELA 1BY8A 2AUZA 2IPPB 4I05A 3F5VA 4GUAA 1U9XA 2JRIA 3O65A 3W31A 2BDLA 1GECE 3BPMA 1AU3A 3BPFA 1YK7A 4XUIA 4KLBA 2P0RA 4YYQA 4FIPA 1THEA 3K24A 3QSDA 2R9FA 4W5CA 3BY4A 2FTDA 1KFXL 3E1ZB 3OQCA 2B1NA 2DCDA 1MDWA 2FUDA 1KXRA 1AIMA 2ACTA 4AXMA 2O6XA 4X6HA 3LFYA 3KKUA 3H6SA 5JZEA 3S3RA 1PBHA 1CS8A 2JTCA 4IP3A 2AUXA 1YK8A 1DKIA 1NQCA 2NQIA 3WXEA 1EWPA 2Y5BA 2FRQA 4QH6A 4PP2E 2OP3A 3K9MA 3IUTA 3PSEA 4N8WA 2NQDB 2E01A 5E6JA 3ZNHA 3WXFA 3BCNA 1KHQA 3H7DA 4D8EA 3PRPA 3WXGA 3IHPA 1NLJA 2VHSA 3OF8A 4ZTBA 1MEMA 4BS5A 1BGOA 2GFOA 1YZBA 3MJ5A 5CVOB 3U8EA 4BOQA 3F75A 1U9WA 4DMYA 2JQFR 1NB3A 1M6DA 2HH5A 4PADA 2ATOA 4AXLA 3CBJA 3OVZA 3H8BA 5CVMA 1CTEA 2CIOA 2DOSA 2FYEA 3P5UA 1ITOA 4QRXA 1EF7A 3IFUA 6PADA 1FH0A 4HXDB 2P86A 3PHUA 2DC6A 1Y4HA 4R3DA 4D8BA 2WBFX 3PDFA 4REZA 1ZCMA 3I3TA 4BOSA 2OULA 2BDZA 2DC7A 5F02A 3RVWA 3N3GA 1POPA 4OEMA 3OF9A 1SP4B 2FO5A 1U9VA 3MHSA 3ERVA 1PXVA 4YYSA 1KFUL 2FQ9A 3IEJA 1EWMA 5KO3A 4X6IA 3D6SA 1PVJA 3MORA 2UZJA 4XR7A 3W30A 4PT5A 3CBKA 3GCBA 2CB5A 1NB5A 1KHPA 2GHUA 4RF1A 1PPNA 2H7JA 2E00A 1DEUA 1Q6KA 2G6DA 1GLOA 1U5IA 2HD5A 3IV2A 4CDFB 2AIMA 1CQDA 2Z84A 1ATKA 4MM3B 4BQVA 4YYVA 3NHEA 1UKFA 1AYWA 1CJLA 1AYUA 1YT7A 4BOUA 4OVZA 3TMPA 1GCBA 4D8IA 1ZIVA 1PPPA 2IBIA 1Y08A 2PREA 2R6NA 3QJ3A 3N4CA 2BTWB 5FPWA 3PW3A 5CHVA 1ICFA 1MEGA 2JQGR 3B21A 4CZWA 2FE8A 3P5VA 2F1GA 3RVVA 2R9NA 5CVNB 2FRAA 3K8UA 3CH2X 2DJFB 4BOPA 2R9OA 3MTNA 3PNRA 3KSEA 1CV8A 1ME3A 1AYVA 3BC3A 3OVXA 3IMAA 2DC8A 2BU3A 3PHWA 4BOZA 1K3BB 2DC9A 1PPOA 3BB7A 1F29A 2BTWA 2NQAA 2R9CA 4W4UA 3C9EA 2VHFA 3P5WA 2G7YA 4MZSA 2XU3A 4W5BA 2PNSA 2J7QA 3O0UA 4BSQA 1TLOA 4P16A 3M99A 1U9QX 4CDCB 4G54A 4X6JA 2PBHA 2E02A 5EZQA 1EWOA 2Y6EA 3QT4A 2XU5A
chains in the Genus database with same CATH topology
1MHWA 2B1MA 1PPDA 2AYOA 8PCHA 4N4ZA 4CDDB 3I06A 3KW9A 1BQIA 1MIRA 1QXPA 4PI3A 2PADA 1O0EA 1PE6A 4QBBA 3S3QA 2DJGB 1NL6A 3KWBX 1MS6A 3HHIA 1QOLA 2XU1A 1PADA 2DCBA 2HHNA 4GUZA 3LXSA 1HUCB 4FK5A 4K7CA 5A24A 2YJCA 2DCCA 3HHAA 3PBHA 5CHTA 4RY2A 1QDQA 1ME4A 4MZOA 3IOQA 5JA7A 1F2CA 2NQGA 5PADA 3BOWA 1PIPA 3P5XA 2DZYA 4ZUXU 2AU1A 4MSXA 2C0YA 3V6EA 4Q8GA 2FT2A 4I04A 4CDEB 4Q8HA 2YJ8A 4YYWA 3OISA 3KWZA 2ARYA 1JQPA 1TL9A 1XKGA 2E03A 2AYNA 3B79A 1QMYA 3AI8A 2F7DA 2XU5A 3RVXA 1NPZA 1CSBB 5EGWA 2P7UA 1TU6A 1CB5A 1F2AA 1AU0A 1DF0A 2DCAA 1EWLA 2HXZA 1S4VA 4QRGA 3HD3A 1X9YA 2AVWA 4WA6A 1BP4A 3CH3X 3N3KA 3MHHA 1F2BA 3H8CA 2G8EA 4I07A 4N79A 4HWYA 3KX1A 5JH3A 3ZUAA 4P6EA 7PCKA 1VJVA 4DMXA 1SNKA 1CPJA 2AS8A 4BPVA 2G8JA 1YVBA 5K16A 1AU2A 5EF4A 3DF0A 1VSNA 3BWKA 3TNXA 1IWDA 2YJ9A 3KFQA 4NV7A 4BS6A 1GX3A 1GMYA 3H89A 4P6GA 3V6CA 4FJCA 1PCIA 4YV8A 3HWNA 2XU4A 1STFE 5J94A 2YJBA 1AECA 4YYUA 2R9MA 4QRVA 4YYRA 9PAPA 1CVZA 1A6RA 4PP1A 2OZ2A 1AU4A 2DZZA 2YJ2A 3USVA 3O1GA 1YALA 4YVAA 4OELA 1BY8A 2AUZA 2IPPB 4I05A 4BGFA 3F5VA 1U9XA 2BDLA 1GECE 3BPMA 2VFBA 1AU3A 3BPFA 1YK7A 4XUIA 4KLBA 2P0RA 4YYQA 4FIPA 2BSZA 1THEA 3K24A 3QSDA 4W5CA 2R9FA 2FTDA 1KFXL 3E1ZB 2B1NA 2DCDA 1MDWA 2FUDA 1KXRA 1AIMA 2ACTA 4AXMA 2O6XA 4X6HA 3LFYA 3KKUA 3H6SA 3S3RA 1PBHA 1CS8A 2AUXA 1YK8A 1NQCA 2NQIA 3WXEA 1EWPA 2Y5BA 2FRQA 4QH6A 4PP2E 2OP3A 3K9MA 3IUTA 4N8WA 2NQDB 2E01A 3WXFA 3BCNA 1KHQA 3H7DA 3WXGA 3IHPA 1NLJA 2VHSA 3OF8A 1MEMA 4BS5A 1BGOA 2GFOA 5CVOB 3U8EA 3F75A 1U9WA 4DMYA 2JQFR 1NB3A 1M6DA 2HH5A 4PADA 2ATOA 4AXLA 3CBJA 3OVZA 3H8BA 5CVMA 1CTEA 2CIOA 2FYEA 3P5UA 1ITOA 4QRXA 1EF7A 6PADA 1FH0A 2P86A 2DC6A 1Y4HA 2WBFX 3PDFA 1ZCMA 1W4TA 3I3TA 2OULA 2BDZA 2DC7A 5F02A 4B55A 3RVWA 3N3GA 1POPA 4OEMA 3OF9A 1SP4B 2FO5A 1U9VA 3MHSA 3ERVA 1PXVA 4YYSA 1KFUL 2FQ9A 3IEJA 1EWMA 3LTWA 4X6IA 3D6SA 3MORA 2VFCA 3CBKA 3GCBA 2CB5A 1NB5A 1KHPA 2GHUA 4C5PA 1PPNA 2H7JA 2E00A 1DEUA 1Q6KA 3D9WA 2G6DA 1GLOA 1U5IA 2HD5A 3IV2A 4CDFB 2AIMA 1CQDA 1ATKA 4YYVA 4BQVA 3NHEA 1AYWA 1CJLA 1AYUA 1YT7A 1GCBA 1ZIVA 1PPPA 2IBIA 1Y08A 2PREA 2R6NA 3QJ3A 3N4CA 1W5RA 5FPWA 3PW3A 5CHVA 1ICFA 1MEGA 2JQGR 4CZWA 3P5VA 2F1GA 3RVVA 2R9NA 1W6FA 5CVNB 2FRAA 3K8UA 3CH2X 2DJFB 2R9OA 3MTNA 3PNRA 3KSEA 1CV8A 1ME3A 1AYVA 3BC3A 3OVXA 3IMAA 2DC8A 1K3BB 2DC9A 1E2TA 1PPOA 1F29A 2NQAA 4W4UA 2R9CA 3C9EA 2VHFA 3P5WA 4NV8A 2G7YA 4MZSA 2XU3A 4W5BA 2PNSA 3O0UA 4BSQA 1TLOA 3M99A 1U9QX 4CDCB 4G54A 4X6JA 2PBHA 2E02A 1EWOA 2Y6EA 3QT4A 4XR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHW A;  2B1M A;  1PPD A;  2AYO A;  8PCH A;  4N4Z A;  4CDD B;  3I06 A;  3KW9 A;  1BQI A;  1MIR A;  1QXP A;  4PI3 A;  2PAD A;  1O0E A;  1PE6 A;  4QBB A;  3S3Q A;  2DJG B;  1NL6 A;  3KWB X;  1MS6 A;  3HHI A;  1QOL A;  2XU1 A;  1PAD A;  2DCB A;  2HHN A;  3LXS A;  1HUC B;  4FK5 A;  4K7C A;  5A24 A;  2YJC A;  2DCC A;  3HHA A;  3PBH A;  5CHT A;  4RY2 A;  1QDQ A;  1ME4 A;  4MZO A;  3IOQ A;  5JA7 A;  1F2C A;  2NQG A;  5PAD A;  3BOW A;  1PIP A;  3P5X A;  2DZY A;  4ZUX U;  2AU1 A;  4MSX A;  2C0Y A;  3V6E A;  4Q8G A;  2FT2 A;  4I04 A;  4CDE B;  4Q8H A;  2YJ8 A;  4YYW A;  3OIS A;  3KWZ A;  2ARY A;  1JQP A;  1TL9 A;  1XKG A;  2E03 A;  2AYN A;  3B79 A;  1QMY A;  3AI8 A;  2F7D A;  2XU5 A;  3RVX A;  1NPZ A;  1CSB B;  5EGW A;  2P7U A;  1TU6 A;  1CB5 A;  1F2A A;  1AU0 A;  1DF0 A;  2DCA A;  1EWL A;  2HXZ A;  1S4V A;  4QRG A;  3HD3 A;  1X9Y A;  2AVW A;  4WA6 A;  1BP4 A;  3CH3 X;  3N3K A;  3MHH A;  1F2B A;  3H8C A;  2G8E A;  4I07 A;  4N79 A;  4HWY A;  3KX1 A;  5JH3 A;  3ZUA A;  4P6E A;  7PCK A;  1VJV A;  4DMX A;  1SNK A;  1CPJ A;  2AS8 A;  4BPV A;  2G8J A;  1YVB A;  5K16 A;  1AU2 A;  5EF4 A;  3DF0 A;  1VSN A;  3BWK A;  3TNX A;  1IWD A;  2YJ9 A;  3KFQ A;  4BS6 A;  1GMY A;  3H89 A;  4P6G A;  3V6C A;  4FJC A;  1PCI A;  4YV8 A;  3HWN A;  2XU4 A;  1STF E;  5J94 A;  2YJB A;  1AEC A;  4YYU A;  2R9M A;  4QRV A;  4YYR A;  9PAP A;  1CVZ A;  1A6R A;  4PP1 A;  2OZ2 A;  1AU4 A;  2DZZ A;  2YJ2 A;  3USV A;  3O1G A;  1YAL A;  4YVA A;  4OEL A;  1BY8 A;  2AUZ A;  2IPP B;  4I05 A;  3F5V A;  1U9X A;  2BDL A;  1GEC E;  3BPM A;  1AU3 A;  3BPF A;  1YK7 A;  4XUI A;  4KLB A;  2P0R A;  4YYQ A;  4FIP A;  1THE A;  3K24 A;  3QSD A;  4W5C A;  2R9F A;  2FTD A;  1KFX L;  3E1Z B;  2B1N A;  2DCD A;  1MDW A;  2FUD A;  1KXR A;  1AIM A;  2ACT A;  4AXM A;  2O6X A;  4X6H A;  3LFY A;  3KKU A;  3H6S A;  3S3R A;  1PBH A;  1CS8 A;  2AUX A;  1YK8 A;  1NQC A;  2NQI A;  3WXE A;  1EWP A;  2Y5B A;  2FRQ A;  4QH6 A;  4PP2 E;  2OP3 A;  3K9M A;  3IUT A;  4N8W A;  2NQD B;  2E01 A;  3WXF A;  3BCN A;  1KHQ A;  3H7D A;  3WXG A;  3IHP A;  1NLJ A;  2VHS A;  3OF8 A;  1MEM A;  4BS5 A;  1BGO A;  2GFO A;  5CVO B;  3U8E A;  3F75 A;  1U9W A;  4DMY A;  2JQF R;  1NB3 A;  1M6D A;  2HH5 A;  4PAD A;  2ATO A;  4AXL A;  3CBJ A;  3OVZ A;  3H8B A;  5CVM A;  1CTE A;  2CIO A;  2FYE A;  3P5U A;  1ITO A;  4QRX A;  1EF7 A;  6PAD A;  1FH0 A;  2P86 A;  2DC6 A;  1Y4H A;  2WBF X;  3PDF A;  1ZCM A;  3I3T A;  2OUL A;  2BDZ A;  2DC7 A;  5F02 A;  3RVW A;  3N3G A;  1POP A;  4OEM A;  3OF9 A;  1SP4 B;  2FO5 A;  1U9V A;  3MHS A;  3ERV A;  1PXV A;  4YYS A;  1KFU L;  2FQ9 A;  3IEJ A;  1EWM A;  4X6I A;  3D6S A;  3MOR A;  3CBK A;  3GCB A;  2CB5 A;  1NB5 A;  1KHP A;  2GHU A;  1PPN A;  2H7J A;  2E00 A;  1DEU A;  1Q6K A;  2G6D A;  1GLO A;  1U5I A;  2HD5 A;  3IV2 A;  4CDF B;  2AIM A;  1CQD A;  1ATK A;  4YYV A;  4BQV A;  3NHE A;  1AYW A;  1CJL A;  1AYU A;  1YT7 A;  1GCB A;  1ZIV A;  1PPP A;  2IBI A;  1Y08 A;  2PRE A;  2R6N A;  3QJ3 A;  3N4C A;  5FPW A;  3PW3 A;  5CHV A;  1ICF A;  1MEG A;  2JQG R;  4CZW A;  3P5V A;  2F1G A;  3RVV A;  2R9N A;  5CVN B;  2FRA A;  3K8U A;  3CH2 X;  2DJF B;  2R9O A;  3MTN A;  3PNR A;  3KSE A;  1CV8 A;  1ME3 A;  1AYV A;  3BC3 A;  3OVX A;  3IMA A;  2DC8 A;  1K3B B;  2DC9 A;  1PPO A;  1F29 A;  2NQA A;  2R9C A;  4W4U A;  3C9E A;  2VHF A;  3P5W A;  2G7Y A;  4MZS A;  2XU3 A;  4W5B A;  2PNS A;  3O0U A;  4BSQ A;  1TLO A;  3M99 A;  1U9Q X;  4CDC B;  4G54 A;  4X6J A;  2PBH A;  2E02 A;  1EWO A;  2Y6E A;  3QT4 A;  4XR7 A; 
#chains in the Genus database with same CATH topology
 1MHW A;  2B1M A;  1PPD A;  2AYO A;  4A5U A;  8PCH A;  4N4Z A;  4CDD B;  3I06 A;  3KW9 A;  1BQI A;  4OW0 A;  1MIR A;  1QXP A;  4PI3 A;  5EZS A;  2PAD A;  1O0E A;  3TRK A;  3PHX A;  1PE6 A;  4QBB A;  3S3Q A;  2DJG B;  1NL6 A;  3KWB X;  1MS6 A;  3HHI A;  3RNV A;  1QOL A;  2XU1 A;  1PAD A;  2DCB A;  2HHN A;  3LXS A;  1HUC B;  4IUM A;  4FK5 A;  3PT2 A;  4K7C A;  4XZX A;  5A24 A;  2YJC A;  2DCC A;  3HHA A;  3PBH A;  5CHT A;  4RY2 A;  1QDQ A;  1ME4 A;  4MZO A;  3IOQ A;  5JA7 A;  1F2C A;  2NQG A;  5PAD A;  3BOW A;  1PIP A;  3P5X A;  2DZY A;  4ZUX U;  2AU1 A;  4MSX A;  2C0Y A;  3V6E A;  4Q8G A;  2FT2 A;  4RF0 A;  4I04 A;  4CDE B;  4RKX A;  4Q8H A;  2YJ8 A;  4YYW A;  3OIS A;  3KWZ A;  2ARY A;  1JQP A;  1TL9 A;  1XKG A;  2E03 A;  2AYN A;  3B79 A;  1QMY A;  3AI8 A;  2F7D A;  3RVX A;  1NPZ A;  4WUR A;  1CSB B;  5EGW A;  2P7U A;  1TU6 A;  1CB5 A;  1F2A A;  1AU0 A;  1DF0 A;  2DCA A;  1EWL A;  2HXZ A;  1S4V A;  4QRG A;  3E9S A;  3HD3 A;  1X9Y A;  2AVW A;  4WA6 A;  1BP4 A;  3CH3 X;  3N3K A;  3MHH A;  1F2B A;  2J7Q C;  3H8C A;  2G8E A;  4I07 A;  3MTV A;  4N79 A;  4HWY A;  3C0R A;  3KX1 A;  5JH3 A;  3ZUA A;  4OVZ B;  4P6E A;  7PCK A;  1VJV A;  3MP2 A;  4DMX A;  1SNK A;  2HWK A;  1CPJ A;  3BBA A;  2AS8 A;  4BPV A;  2G8J A;  3PRM A;  1YVB A;  5K16 A;  2AGA A;  1AU2 A;  5EF4 A;  3DF0 A;  1VSN A;  3BWK A;  4RNA A;  3TNX A;  1IWD A;  2YJ9 A;  3KFQ A;  4BS6 A;  1GMY A;  3H89 A;  4P6G A;  3V6C A;  4FJC A;  4MI7 A;  1PCI A;  4YV8 A;  3HWN A;  2XU4 A;  1STF E;  5J94 A;  2YJB A;  1AEC A;  4YYU A;  2R9M A;  4QRV A;  4YYR A;  9PAP A;  1CVZ A;  1A6R A;  4PP1 A;  2OZ2 A;  1AU4 A;  2DZZ A;  2YJ2 A;  3USV A;  4M0W A;  3O1G A;  1YAL A;  4YVA A;  4OEL A;  1BY8 A;  2AUZ A;  2IPP B;  4I05 A;  3F5V A;  4GUA A;  1U9X A;  2JRI A;  3O65 A;  3W31 A;  2BDL A;  1GEC E;  3BPM A;  1AU3 A;  3BPF A;  1YK7 A;  4XUI A;  4KLB A;  2P0R A;  4YYQ A;  4FIP A;  1THE A;  3K24 A;  3QSD A;  2R9F A;  4W5C A;  3BY4 A;  2FTD A;  1KFX L;  3E1Z B;  3OQC A;  2B1N A;  2DCD A;  1MDW A;  2FUD A;  1KXR A;  1AIM A;  2ACT A;  4AXM A;  2O6X A;  4X6H A;  3LFY A;  3KKU A;  3H6S A;  5JZE A;  3S3R A;  1PBH A;  1CS8 A;  2JTC A;  4IP3 A;  2AUX A;  1YK8 A;  1DKI A;  1NQC A;  2NQI A;  3WXE A;  1EWP A;  2Y5B A;  2FRQ A;  4QH6 A;  4PP2 E;  2OP3 A;  3K9M A;  3IUT A;  3PSE A;  4N8W A;  2NQD B;  2E01 A;  5E6J A;  3ZNH A;  3WXF A;  3BCN A;  1KHQ A;  3H7D A;  4D8E A;  3PRP A;  3WXG A;  3IHP A;  1NLJ A;  2VHS A;  3OF8 A;  4ZTB A;  1MEM A;  4BS5 A;  1BGO A;  2GFO A;  1YZB A;  3MJ5 A;  5CVO B;  3U8E A;  4BOQ A;  3F75 A;  1U9W A;  4DMY A;  2JQF R;  1NB3 A;  1M6D A;  2HH5 A;  4PAD A;  2ATO A;  4AXL A;  3CBJ A;  3OVZ A;  3H8B A;  5CVM A;  1CTE A;  2CIO A;  2DOS A;  2FYE A;  3P5U A;  1ITO A;  4QRX A;  1EF7 A;  3IFU A;  6PAD A;  1FH0 A;  4HXD B;  2P86 A;  3PHU A;  2DC6 A;  1Y4H A;  4R3D A;  4D8B A;  2WBF X;  3PDF A;  4REZ A;  1ZCM A;  3I3T A;  4BOS A;  2OUL A;  2BDZ A;  2DC7 A;  5F02 A;  3RVW A;  3N3G A;  1POP A;  4OEM A;  3OF9 A;  1SP4 B;  2FO5 A;  1U9V A;  3MHS A;  3ERV A;  1PXV A;  4YYS A;  1KFU L;  2FQ9 A;  3IEJ A;  1EWM A;  5KO3 A;  4X6I A;  3D6S A;  1PVJ A;  3MOR A;  2UZJ A;  4XR7 A;  3W30 A;  4PT5 A;  3CBK A;  3GCB A;  2CB5 A;  1NB5 A;  1KHP A;  2GHU A;  4RF1 A;  1PPN A;  2H7J A;  2E00 A;  1DEU A;  1Q6K A;  2G6D A;  1GLO A;  1U5I A;  2HD5 A;  3IV2 A;  4CDF B;  2AIM A;  1CQD A;  2Z84 A;  1ATK A;  4MM3 B;  4BQV A;  4YYV A;  3NHE A;  1UKF A;  1AYW A;  1CJL A;  1AYU A;  1YT7 A;  4BOU A;  4OVZ A;  3TMP A;  1GCB A;  4D8I A;  1ZIV A;  1PPP A;  2IBI A;  1Y08 A;  2PRE A;  2R6N A;  3QJ3 A;  3N4C A;  2BTW B;  5FPW A;  3PW3 A;  5CHV A;  1ICF A;  1MEG A;  2JQG R;  3B21 A;  4CZW A;  2FE8 A;  3P5V A;  2F1G A;  3RVV A;  2R9N A;  5CVN B;  2FRA A;  3K8U A;  3CH2 X;  2DJF B;  4BOP A;  2R9O A;  3MTN A;  3PNR A;  3KSE A;  1CV8 A;  1ME3 A;  1AYV A;  3BC3 A;  3OVX A;  3IMA A;  2DC8 A;  2BU3 A;  3PHW A;  4BOZ A;  1K3B B;  2DC9 A;  1PPO A;  3BB7 A;  1F29 A;  2BTW A;  2NQA A;  2R9C A;  4W4U A;  3C9E A;  2VHF A;  3P5W A;  2G7Y A;  4MZS A;  2XU3 A;  4W5B A;  2PNS A;  2J7Q A;  3O0U A;  4BSQ A;  1TLO A;  4P16 A;  3M99 A;  1U9Q X;  4CDC B;  4G54 A;  4X6J A;  2PBH A;  2E02 A;  5EZQ A;  1EWO A;  2Y6E A;  3QT4 A;  2XU5 A; 
#chains in the Genus database with same CATH homology
 1MHW A;  2B1M A;  1PPD A;  2AYO A;  8PCH A;  4N4Z A;  4CDD B;  3I06 A;  3KW9 A;  1BQI A;  1MIR A;  1QXP A;  4PI3 A;  2PAD A;  1O0E A;  1PE6 A;  4QBB A;  3S3Q A;  2DJG B;  1NL6 A;  3KWB X;  1MS6 A;  3HHI A;  1QOL A;  2XU1 A;  1PAD A;  2DCB A;  2HHN A;  4GUZ A;  3LXS A;  1HUC B;  4FK5 A;  4K7C A;  5A24 A;  2YJC A;  2DCC A;  3HHA A;  3PBH A;  5CHT A;  4RY2 A;  1QDQ A;  1ME4 A;  4MZO A;  3IOQ A;  5JA7 A;  1F2C A;  2NQG A;  5PAD A;  3BOW A;  1PIP A;  3P5X A;  2DZY A;  4ZUX U;  2AU1 A;  4MSX A;  2C0Y A;  3V6E A;  4Q8G A;  2FT2 A;  4I04 A;  4CDE B;  4Q8H A;  2YJ8 A;  4YYW A;  3OIS A;  3KWZ A;  2ARY A;  1JQP A;  1TL9 A;  1XKG A;  2E03 A;  2AYN A;  3B79 A;  1QMY A;  3AI8 A;  2F7D A;  2XU5 A;  3RVX A;  1NPZ A;  1CSB B;  5EGW A;  2P7U A;  1TU6 A;  1CB5 A;  1F2A A;  1AU0 A;  1DF0 A;  2DCA A;  1EWL A;  2HXZ A;  1S4V A;  4QRG A;  3HD3 A;  1X9Y A;  2AVW A;  4WA6 A;  1BP4 A;  3CH3 X;  3N3K A;  3MHH A;  1F2B A;  3H8C A;  2G8E A;  4I07 A;  4N79 A;  4HWY A;  3KX1 A;  5JH3 A;  3ZUA A;  4P6E A;  7PCK A;  1VJV A;  4DMX A;  1SNK A;  1CPJ A;  2AS8 A;  4BPV A;  2G8J A;  1YVB A;  5K16 A;  1AU2 A;  5EF4 A;  3DF0 A;  1VSN A;  3BWK A;  3TNX A;  1IWD A;  2YJ9 A;  3KFQ A;  4NV7 A;  4BS6 A;  1GX3 A;  1GMY A;  3H89 A;  4P6G A;  3V6C A;  4FJC A;  1PCI A;  4YV8 A;  3HWN A;  2XU4 A;  1STF E;  5J94 A;  2YJB A;  1AEC A;  4YYU A;  2R9M A;  4QRV A;  4YYR A;  9PAP A;  1CVZ A;  1A6R A;  4PP1 A;  2OZ2 A;  1AU4 A;  2DZZ A;  2YJ2 A;  3USV A;  3O1G A;  1YAL A;  4YVA A;  4OEL A;  1BY8 A;  2AUZ A;  2IPP B;  4I05 A;  4BGF A;  3F5V A;  1U9X A;  2BDL A;  1GEC E;  3BPM A;  2VFB A;  1AU3 A;  3BPF A;  1YK7 A;  4XUI A;  4KLB A;  2P0R A;  4YYQ A;  4FIP A;  2BSZ A;  1THE A;  3K24 A;  3QSD A;  4W5C A;  2R9F A;  2FTD A;  1KFX L;  3E1Z B;  2B1N A;  2DCD A;  1MDW A;  2FUD A;  1KXR A;  1AIM A;  2ACT A;  4AXM A;  2O6X A;  4X6H A;  3LFY A;  3KKU A;  3H6S A;  3S3R A;  1PBH A;  1CS8 A;  2AUX A;  1YK8 A;  1NQC A;  2NQI A;  3WXE A;  1EWP A;  2Y5B A;  2FRQ A;  4QH6 A;  4PP2 E;  2OP3 A;  3K9M A;  3IUT A;  4N8W A;  2NQD B;  2E01 A;  3WXF A;  3BCN A;  1KHQ A;  3H7D A;  3WXG A;  3IHP A;  1NLJ A;  2VHS A;  3OF8 A;  1MEM A;  4BS5 A;  1BGO A;  2GFO A;  5CVO B;  3U8E A;  3F75 A;  1U9W A;  4DMY A;  2JQF R;  1NB3 A;  1M6D A;  2HH5 A;  4PAD A;  2ATO A;  4AXL A;  3CBJ A;  3OVZ A;  3H8B A;  5CVM A;  1CTE A;  2CIO A;  2FYE A;  3P5U A;  1ITO A;  4QRX A;  1EF7 A;  6PAD A;  1FH0 A;  2P86 A;  2DC6 A;  1Y4H A;  2WBF X;  3PDF A;  1ZCM A;  1W4T A;  3I3T A;  2OUL A;  2BDZ A;  2DC7 A;  5F02 A;  4B55 A;  3RVW A;  3N3G A;  1POP A;  4OEM A;  3OF9 A;  1SP4 B;  2FO5 A;  1U9V A;  3MHS A;  3ERV A;  1PXV A;  4YYS A;  1KFU L;  2FQ9 A;  3IEJ A;  1EWM A;  3LTW A;  4X6I A;  3D6S A;  3MOR A;  2VFC A;  3CBK A;  3GCB A;  2CB5 A;  1NB5 A;  1KHP A;  2GHU A;  4C5P A;  1PPN A;  2H7J A;  2E00 A;  1DEU A;  1Q6K A;  3D9W A;  2G6D A;  1GLO A;  1U5I A;  2HD5 A;  3IV2 A;  4CDF B;  2AIM A;  1CQD A;  1ATK A;  4YYV A;  4BQV A;  3NHE A;  1AYW A;  1CJL A;  1AYU A;  1YT7 A;  1GCB A;  1ZIV A;  1PPP A;  2IBI A;  1Y08 A;  2PRE A;  2R6N A;  3QJ3 A;  3N4C A;  1W5R A;  5FPW A;  3PW3 A;  5CHV A;  1ICF A;  1MEG A;  2JQG R;  4CZW A;  3P5V A;  2F1G A;  3RVV A;  2R9N A;  1W6F A;  5CVN B;  2FRA A;  3K8U A;  3CH2 X;  2DJF B;  2R9O A;  3MTN A;  3PNR A;  3KSE A;  1CV8 A;  1ME3 A;  1AYV A;  3BC3 A;  3OVX A;  3IMA A;  2DC8 A;  1K3B B;  2DC9 A;  1E2T A;  1PPO A;  1F29 A;  2NQA A;  4W4U A;  2R9C A;  3C9E A;  2VHF A;  3P5W A;  4NV8 A;  2G7Y A;  4MZS A;  2XU3 A;  4W5B A;  2PNS A;  3O0U A;  4BSQ A;  1TLO A;  3M99 A;  1U9Q X;  4CDC B;  4G54 A;  4X6J A;  2PBH A;  2E02 A;  1EWO A;  2Y6E A;  3QT4 A;  4XR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...