3N4CA

6-phenyl-1h-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin s inhibitors
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title 6-Phenyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n4cA00
4BS5A 1BGOA 3OISA 5F02A 8PCHA 3B79A 1MHWA 2IPPB 1NQCA 9PAPA 3ZUAA 2AYOA 1MEGA 1DF0A 2ARYA 2XU3A 4RY2A 1PCIA 2HHNA 1Y4HA 3D6SA 1ICFA 4XUIA 2R6NA 1SP4B 2R9NA 4OEMA 4QBBA 2FRAA 4OELA 4FK5A 4YYUA 1QXPA 3WXGA 3CBJA 5CVOB 3IHPA 1KHPA 4PI3A 1YK8A 1PE6A 2P0RA 4DMYA 3OVZA 5CHVA 1AU4A 4MZSA 2FTDA 3I06A 2OZ2A 3BC3A 1M6DA 1BQIA 2VHFA 1QMYA 4CDEB 1AYWA 2B1MA 2DCCA 1F2AA 4PP2E 2FYEA 3V6CA 3V6EA 2DZZA 3HHAA 7PCKA 5JH3A 1DEUA 1YT7A 1NB5A 4G54A 2VHSA 1BP4A 1YALA 5CVMA 4HWYA 4P6EA 1SNKA 4PP1A 4FIPA 1NPZA 1ME4A 2E01A 1MIRA 1AU0A 1EWMA 3KW9A 3BCNA 1VSNA 1CSBB 1K3BB 3QSDA 3N3GA 4YYSA 2CB5A 1KHQA 4QH6A 2E00A 2R9CA 3DF0A 5CVNB 2GHUA 2HD5A 3IMAA 2DZYA 1ITOA 1FH0A 1NLJA 4BSQA 3N3KA 2BDLA 2E02A 1POPA 3LXSA 4N4ZA 1THEA 2XU1A 1QOLA 3S3QA 4P6GA 2DC6A 4YYWA 1EF7A 1GMYA 3WXFA 4YYQA 2P7UA 4CZWA 1CVZA 2AUZA 1TU6A 5EGWA 1AIMA 2XU4A 1CB5A 3IV2A 4CDCB 3KFQA 3HHIA 2PBHA 4W4UA 1Y08A 1KXRA 1QDQA 3KX1A 1ME3A 3H6SA 4BQVA 5FPWA 2DCDA 3QJ3A 3RVWA 1CPJA 1MS6A 1CQDA 4DMXA 2B1NA 1ATKA 3USVA 1IWDA 3BOWA 4XR7A 4Q8HA 1GECE 3PNRA 4X6IA 5EF4A 2DC9A 1CTEA 3HD3A 1AU3A 2YJBA 5PADA 2NQAA 2OP3A 4X6JA 3WXEA 3KKUA 2YJ8A 3MHHA 1PADA 4K7CA 3IOQA 1AYVA 5J94A 1BY8A 1TL9A 4YYVA 1GLOA 3S3RA 3P5VA 1CV8A 3AI8A 1EWOA 1TLOA 3PBHA 5K16A 1AECA 1PPPA 1MDWA 4W5BA 3P5UA 2AU1A 3HWNA 2HH5A 3RVVA 4QRGA 3KWZA 2O6XA 3CH3X 3K8UA 4WA6A 3OVXA 3MHSA 3C9EA 4CDFB 1EWLA 4YYRA 3H8CA 1PPDA 4I05A 3PDFA 1KFUL 2G8JA 3TNXA 3LFYA 1NL6A 4N8WA 3K24A 4AXMA 4FJCA 2G6DA 3BPFA 2PREA 3BPMA 2G8EA 1MEMA 2YJCA 3KWBX 3KSEA 1PPOA 3F5VA 3MTNA 1YVBA 4N79A 1KFXL 4YV8A 1YK7A 3IUTA 1U9WA 3H89A 2F1GA 1STFE 4YVAA 2AUXA 1NB3A 4BS6A 2DCAA 2YJ9A 1PPNA 1X9YA 4Q8GA 1U9QX 5CHTA 3H8BA 3O0UA 2Y6EA 1AU2A 2PADA 2YJ2A 3M99A 2JQFR 1VJVA 2GFOA 2R9OA 1JQPA 3OF9A 1PXVA 1U9VA 2FUDA 3BWKA 1A6RA 3K9MA 4X6HA 1HUCB 2R9MA 2PNSA 4CDDB 2E03A 2G7YA 2AYNA 3P5WA 1U9XA 3IEJA 3QT4A 4ZUXU 3I3TA 4QRXA 2NQGA 2FRQA 3CBKA 1PBHA 1U5IA 4I07A 2FT2A 4I04A 2FQ9A 3MORA 1F2BA 2Y5BA 2CIOA 3GCBA 1EWPA 3RVXA 2AVWA 2NQIA 4MSXA 3N4CA 1ZCMA 3OF8A 1F29A 4KLBA 2R9FA 3H7DA 2XU5A 4BPVA 1XKGA 2JQGR 3F75A 1AYUA 2DC7A 2P86A 5JA7A 3NHEA 2DJFB 2DCBA 5A24A 3ERVA 3O1GA 3PW3A 1CJLA 1PIPA 4QRVA 2ATOA 2OULA 2IBIA 4AXLA 2HXZA 3P5XA 1S4VA 1CS8A 6PADA 1O0EA 1F2CA 1GCBA 3CH2X 2H7JA 2NQDB 3E1ZB 2ACTA 2C0YA 2BDZA 2DJGB 1ZIVA 3U8EA 2F7DA 4MZOA 1Q6KA 2DC8A 4PADA 2FO5A 2WBFX 2AS8A 2AIMA 4W5CA
chains in the Genus database with same CATH superfamily
4BS5A 1BGOA 3OISA 5F02A 8PCHA 3B79A 1MHWA 2IPPB 1NQCA 9PAPA 3ZUAA 2AYOA 1MEGA 1DF0A 2ARYA 2XU3A 4RY2A 1PCIA 2HHNA 1Y4HA 3D6SA 1ICFA 3IFUA 4XUIA 2R6NA 1SP4B 2R9NA 4OEMA 4QBBA 2FRAA 4OELA 4FK5A 4YYUA 1QXPA 4A5UA 3WXGA 3CBJA 5CVOB 3IHPA 1KHPA 4PI3A 1YK8A 1PE6A 2P0RA 4DMYA 3OVZA 5CHVA 1AU4A 4MZSA 2FTDA 4ZTBA 3I06A 2OZ2A 3BC3A 1M6DA 1BQIA 3B21A 2VHFA 1QMYA 4CDEB 4HXDB 1AYWA 2B1MA 2DCCA 1F2AA 4PP2E 2FYEA 4PT5A 3V6CA 3V6EA 2DZZA 3HHAA 7PCKA 5JH3A 1DEUA 1YT7A 2AGAA 4G54A 4WURA 1NB5A 2VHSA 1BP4A 3MP2A 1YALA 5CVMA 4HWYA 3PSEA 4P6EA 1SNKA 4PP1A 4FIPA 1NPZA 3W30A 1ME4A 2E01A 1MIRA 1AU0A 1EWMA 3KW9A 3BCNA 1VSNA 1CSBB 1K3BB 3QSDA 3N3GA 3PHWA 4YYSA 2CB5A 1KHQA 3PHXA 4QH6A 2E00A 2R9CA 3DF0A 5CVNB 2GHUA 2HD5A 3IMAA 2DZYA 2BTWA 1ITOA 1FH0A 4D8IA 1NLJA 4BSQA 3N3KA 2BDLA 2E02A 1POPA 3LXSA 4N4ZA 1THEA 2XU1A 1QOLA 4MI7A 3S3QA 4P6GA 2DC6A 4YYWA 1EF7A 4R3DA 1GMYA 3WXFA 4YYQA 2P7UA 4CZWA 1CVZA 2AUZA 1TU6A 5EGWA 1PVJA 1AIMA 2J7QA 2XU4A 1CB5A 2UZJA 3IV2A 4CDCB 4D8BA 3KFQA 3HHIA 2JTCA 2PBHA 4W4UA 1Y08A 1KXRA 1QDQA 4OW0A 3KX1A 1ME3A 3H6SA 4BQVA 5FPWA 2DCDA 3QJ3A 3RVWA 1CPJA 1MS6A 1CQDA 4DMXA 1DKIA 2B1NA 3MJ5A 1ATKA 3USVA 1IWDA 3BOWA 4XR7A 4BOSA 4Q8HA 1GECE 3PNRA 4X6IA 5EF4A 2DC9A 1CTEA 3BBAA 5JZEA 3HD3A 2BU3A 1AU3A 2YJBA 5PADA 2NQAA 3PRMA 2OP3A 4X6JA 3WXEA 3KKUA 2YJ8A 3BY4A 3MHHA 1PADA 4OVZB 2J7QC 4K7CA 3C0RA 3IOQA 1AYVA 4RNAA 5J94A 1BY8A 1TL9A 4REZA 4YYVA 1GLOA 3S3RA 3P5VA 3TMPA 5EZSA 1CV8A 3PHUA 3AI8A 4M0WA 3OQCA 1EWOA 1TLOA 3PBHA 5K16A 1AECA 1PPPA 1MDWA 4BOQA 4MM3B 4W5BA 3P5UA 2AU1A 3HWNA 2HH5A 3RVVA 4QRGA 3KWZA 2O6XA 4RF1A 3CH3X 3K8UA 4WA6A 3OVXA 5E6JA 3MHSA 3C9EA 4CDFB 1EWLA 4D8EA 2DOSA 4YYRA 3H8CA 1PPDA 4I05A 3PDFA 1KFUL 2G8JA 3TNXA 3LFYA 1NL6A 4N8WA 3K24A 4AXMA 4FJCA 3ZNHA 3PRPA 2G6DA 3BPFA 2PREA 3BPMA 2G8EA 1MEMA 2YJCA 3PT2A 3KWBX 3KSEA 1PPOA 3F5VA 3MTNA 1YVBA 4RKXA 3RNVA 4N79A 1KFXL 4YV8A 1YK7A 3IUTA 1U9WA 3H89A 2F1GA 1STFE 4YVAA 2AUXA 3MTVA 1NB3A 5KO3A 4BS6A 2DCAA 2YJ9A 1PPNA 1X9YA 4Q8GA 1U9QX 5CHTA 3TRKA 3H8BA 3O0UA 2Y6EA 1AU2A 2PADA 2YJ2A 3M99A 2JQFR 1VJVA 2GFOA 4GUAA 2R9OA 1JQPA 3OF9A 1PXVA 1U9VA 2FUDA 3BWKA 4OVZA 1A6RA 3K9MA 4X6HA 1HUCB 2R9MA 2JRIA 2PNSA 4CDDB 2E03A 2G7YA 4P16A 2AYNA 3P5WA 1U9XA 3IEJA 3QT4A 4ZUXU 3I3TA 4QRXA 2NQGA 3E9SA 2FRQA 3CBKA 1PBHA 4BOUA 1U5IA 4I07A 2FT2A 4I04A 2FQ9A 3MORA 1F2BA 2Y5BA 4BOZA 2Z84A 2CIOA 3GCBA 1EWPA 3RVXA 2AVWA 2NQIA 4IUMA 4MSXA 3N4CA 1ZCMA 3OF8A 1F29A 4KLBA 2R9FA 3H7DA 5EZQA 3O65A 2XU5A 4BPVA 3W31A 1XKGA 2JQGR 3F75A 1AYUA 2DC7A 2P86A 5JA7A 3NHEA 4RF0A 2DJFB 2DCBA 1YZBA 2FE8A 5A24A 3ERVA 3O1GA 4XZXA 3PW3A 1CJLA 1PIPA 4QRVA 2ATOA 2OULA 2IBIA 4AXLA 2HXZA 3P5XA 1S4VA 1CS8A 6PADA 1O0EA 1F2CA 2HWKA 1GCBA 3CH2X 4BOPA 2H7JA 2NQDB 3E1ZB 2ACTA 2C0YA 2BDZA 2DJGB 1ZIVA 3BB7A 3U8EA 2F7DA 4MZOA 1Q6KA 1UKFA 2DC8A 4PADA 2FO5A 2WBFX 2AS8A 4IP3A 2AIMA 4W5CA 2BTWB
chains in the Genus database with same CATH topology
4BS5A 1BGOA 3OISA 4C5PA 5F02A 8PCHA 3B79A 1MHWA 2IPPB 1NQCA 9PAPA 3ZUAA 2AYOA 1MEGA 1DF0A 2ARYA 2XU3A 4RY2A 1PCIA 2HHNA 1Y4HA 3D6SA 1ICFA 4XUIA 2R6NA 1SP4B 2R9NA 4OEMA 4QBBA 2FRAA 4OELA 4FK5A 4YYUA 1QXPA 3WXGA 3CBJA 2VFCA 5CVOB 3IHPA 1KHPA 4PI3A 1YK8A 1PE6A 2P0RA 4DMYA 3OVZA 4BGFA 5CHVA 1AU4A 4GUZA 4MZSA 2FTDA 3I06A 2OZ2A 3BC3A 1M6DA 1BQIA 2VHFA 1QMYA 4CDEB 1AYWA 2B1MA 2DCCA 1F2AA 4PP2E 2FYEA 3V6CA 3V6EA 2DZZA 3HHAA 7PCKA 5JH3A 1DEUA 1YT7A 1NB5A 4G54A 2VHSA 1BP4A 1YALA 5CVMA 4HWYA 4P6EA 1SNKA 4PP1A 4FIPA 1NPZA 1ME4A 2E01A 1MIRA 1AU0A 4NV8A 1EWMA 3KW9A 3BCNA 1VSNA 1CSBB 1K3BB 3D9WA 3QSDA 3N3GA 4YYSA 2CB5A 1KHQA 4QH6A 2E00A 2R9CA 1W5RA 3DF0A 5CVNB 2GHUA 2HD5A 3IMAA 2DZYA 1ITOA 1FH0A 1NLJA 4BSQA 3N3KA 2BDLA 2E02A 1POPA 3LXSA 4N4ZA 1THEA 2XU1A 1QOLA 3S3QA 4P6GA 2DC6A 4YYWA 1EF7A 1GMYA 3WXFA 4YYQA 2P7UA 4CZWA 1CVZA 2AUZA 1TU6A 5EGWA 1AIMA 2XU4A 1CB5A 3IV2A 4CDCB 3KFQA 3HHIA 2PBHA 4W4UA 4B55A 1Y08A 1KXRA 1QDQA 3KX1A 1ME3A 3H6SA 4BQVA 5FPWA 2DCDA 3QJ3A 3RVWA 1CPJA 1MS6A 1CQDA 4DMXA 2B1NA 1ATKA 3USVA 1IWDA 3BOWA 4XR7A 4Q8HA 1GECE 3PNRA 4X6IA 5EF4A 2DC9A 1CTEA 3HD3A 1AU3A 2YJBA 5PADA 2NQAA 2OP3A 4X6JA 3WXEA 3KKUA 2YJ8A 3MHHA 1PADA 4K7CA 3IOQA 1AYVA 5J94A 1BY8A 1TL9A 4YYVA 1GLOA 3S3RA 3P5VA 1CV8A 2BSZA 3AI8A 1EWOA 1TLOA 3PBHA 5K16A 1AECA 1PPPA 1MDWA 4W5BA 3P5UA 2AU1A 3HWNA 2HH5A 3RVVA 4QRGA 1W4TA 3KWZA 2O6XA 3CH3X 3K8UA 4WA6A 3OVXA 3MHSA 3C9EA 4CDFB 1EWLA 1W6FA 4YYRA 3H8CA 1PPDA 4I05A 3PDFA 1KFUL 2G8JA 3TNXA 3LFYA 1NL6A 4N8WA 3K24A 4AXMA 4FJCA 2G6DA 3BPFA 2PREA 3BPMA 2G8EA 1MEMA 2YJCA 3KWBX 3KSEA 1PPOA 3F5VA 3MTNA 1YVBA 4N79A 1KFXL 4YV8A 1YK7A 3IUTA 1U9WA 3H89A 2F1GA 1STFE 4YVAA 2AUXA 1NB3A 3LTWA 4BS6A 2DCAA 2YJ9A 1PPNA 1X9YA 4Q8GA 1U9QX 5CHTA 1E2TA 3H8BA 3O0UA 2Y6EA 1AU2A 2PADA 2YJ2A 3M99A 2JQFR 1VJVA 2GFOA 2R9OA 1JQPA 3OF9A 1PXVA 1U9VA 2FUDA 3BWKA 1A6RA 3K9MA 4X6HA 1HUCB 2R9MA 2PNSA 4CDDB 2E03A 2G7YA 2AYNA 3P5WA 1U9XA 3IEJA 3QT4A 4ZUXU 3I3TA 4QRXA 2NQGA 2FRQA 3CBKA 1PBHA 1U5IA 4I07A 2FT2A 4I04A 2FQ9A 3MORA 1F2BA 2Y5BA 2CIOA 3GCBA 1EWPA 2VFBA 3RVXA 2AVWA 2NQIA 4MSXA 3N4CA 1ZCMA 3OF8A 1F29A 4KLBA 2R9FA 3H7DA 2XU5A 4BPVA 1XKGA 2JQGR 3F75A 1AYUA 2DC7A 2P86A 5JA7A 3NHEA 2DJFB 2DCBA 5A24A 3ERVA 3O1GA 3PW3A 1CJLA 1GX3A 1PIPA 4QRVA 2ATOA 2OULA 2IBIA 4AXLA 2HXZA 3P5XA 1S4VA 1CS8A 6PADA 1O0EA 1F2CA 1GCBA 4NV7A 3CH2X 2H7JA 2NQDB 3E1ZB 2ACTA 2C0YA 2BDZA 2DJGB 1ZIVA 3U8EA 2F7DA 4MZOA 1Q6KA 2DC8A 4PADA 2FO5A 2WBFX 2AS8A 2AIMA 4W5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BS5 A;  1BGO A;  3OIS A;  5F02 A;  8PCH A;  3B79 A;  1MHW A;  2IPP B;  1NQC A;  9PAP A;  3ZUA A;  2AYO A;  1MEG A;  1DF0 A;  2ARY A;  2XU3 A;  4RY2 A;  1PCI A;  2HHN A;  1Y4H A;  3D6S A;  1ICF A;  4XUI A;  2R6N A;  1SP4 B;  2R9N A;  4OEM A;  4QBB A;  2FRA A;  4OEL A;  4FK5 A;  4YYU A;  1QXP A;  3WXG A;  3CBJ A;  5CVO B;  3IHP A;  1KHP A;  4PI3 A;  1YK8 A;  1PE6 A;  2P0R A;  4DMY A;  3OVZ A;  5CHV A;  1AU4 A;  4MZS A;  2FTD A;  3I06 A;  2OZ2 A;  3BC3 A;  1M6D A;  1BQI A;  2VHF A;  1QMY A;  4CDE B;  1AYW A;  2B1M A;  2DCC A;  1F2A A;  4PP2 E;  2FYE A;  3V6C A;  3V6E A;  2DZZ A;  3HHA A;  7PCK A;  5JH3 A;  1DEU A;  1YT7 A;  1NB5 A;  4G54 A;  2VHS A;  1BP4 A;  1YAL A;  5CVM A;  4HWY A;  4P6E A;  1SNK A;  4PP1 A;  4FIP A;  1NPZ A;  1ME4 A;  2E01 A;  1MIR A;  1AU0 A;  1EWM A;  3KW9 A;  3BCN A;  1VSN A;  1CSB B;  1K3B B;  3QSD A;  3N3G A;  4YYS A;  2CB5 A;  1KHQ A;  4QH6 A;  2E00 A;  2R9C A;  3DF0 A;  5CVN B;  2GHU A;  2HD5 A;  3IMA A;  2DZY A;  1ITO A;  1FH0 A;  1NLJ A;  4BSQ A;  3N3K A;  2BDL A;  2E02 A;  1POP A;  3LXS A;  4N4Z A;  1THE A;  2XU1 A;  1QOL A;  3S3Q A;  4P6G A;  2DC6 A;  4YYW A;  1EF7 A;  1GMY A;  3WXF A;  4YYQ A;  2P7U A;  4CZW A;  1CVZ A;  2AUZ A;  1TU6 A;  5EGW A;  1AIM A;  2XU4 A;  1CB5 A;  3IV2 A;  4CDC B;  3KFQ A;  3HHI A;  2PBH A;  4W4U A;  1Y08 A;  1KXR A;  1QDQ A;  3KX1 A;  1ME3 A;  3H6S A;  4BQV A;  5FPW A;  2DCD A;  3QJ3 A;  3RVW A;  1CPJ A;  1MS6 A;  1CQD A;  4DMX A;  2B1N A;  1ATK A;  3USV A;  1IWD A;  3BOW A;  4XR7 A;  4Q8H A;  1GEC E;  3PNR A;  4X6I A;  5EF4 A;  2DC9 A;  1CTE A;  3HD3 A;  1AU3 A;  2YJB A;  5PAD A;  2NQA A;  2OP3 A;  4X6J A;  3WXE A;  3KKU A;  2YJ8 A;  3MHH A;  1PAD A;  4K7C A;  3IOQ A;  1AYV A;  5J94 A;  1BY8 A;  1TL9 A;  4YYV A;  1GLO A;  3S3R A;  3P5V A;  1CV8 A;  3AI8 A;  1EWO A;  1TLO A;  3PBH A;  5K16 A;  1AEC A;  1PPP A;  1MDW A;  4W5B A;  3P5U A;  2AU1 A;  3HWN A;  2HH5 A;  3RVV A;  4QRG A;  3KWZ A;  2O6X A;  3CH3 X;  3K8U A;  4WA6 A;  3OVX A;  3MHS A;  3C9E A;  4CDF B;  1EWL A;  4YYR A;  3H8C A;  1PPD A;  4I05 A;  3PDF A;  1KFU L;  2G8J A;  3TNX A;  3LFY A;  1NL6 A;  4N8W A;  3K24 A;  4AXM A;  4FJC A;  2G6D A;  3BPF A;  2PRE A;  3BPM A;  2G8E A;  1MEM A;  2YJC A;  3KWB X;  3KSE A;  1PPO A;  3F5V A;  3MTN A;  1YVB A;  4N79 A;  1KFX L;  4YV8 A;  1YK7 A;  3IUT A;  1U9W A;  3H89 A;  2F1G A;  1STF E;  4YVA A;  2AUX A;  1NB3 A;  4BS6 A;  2DCA A;  2YJ9 A;  1PPN A;  1X9Y A;  4Q8G A;  1U9Q X;  5CHT A;  3H8B A;  3O0U A;  2Y6E A;  1AU2 A;  2PAD A;  2YJ2 A;  3M99 A;  2JQF R;  1VJV A;  2GFO A;  2R9O A;  1JQP A;  3OF9 A;  1PXV A;  1U9V A;  2FUD A;  3BWK A;  1A6R A;  3K9M A;  4X6H A;  1HUC B;  2R9M A;  2PNS A;  4CDD B;  2E03 A;  2G7Y A;  2AYN A;  3P5W A;  1U9X A;  3IEJ A;  3QT4 A;  4ZUX U;  3I3T A;  4QRX A;  2NQG A;  2FRQ A;  3CBK A;  1PBH A;  1U5I A;  4I07 A;  2FT2 A;  4I04 A;  2FQ9 A;  3MOR A;  1F2B A;  2Y5B A;  2CIO A;  3GCB A;  1EWP A;  3RVX A;  2AVW A;  2NQI A;  4MSX A;  3N4C A;  1ZCM A;  3OF8 A;  1F29 A;  4KLB A;  2R9F A;  3H7D A;  2XU5 A;  4BPV A;  1XKG A;  2JQG R;  3F75 A;  1AYU A;  2DC7 A;  2P86 A;  5JA7 A;  3NHE A;  2DJF B;  2DCB A;  5A24 A;  3ERV A;  3O1G A;  3PW3 A;  1CJL A;  1PIP A;  4QRV A;  2ATO A;  2OUL A;  2IBI A;  4AXL A;  2HXZ A;  3P5X A;  1S4V A;  1CS8 A;  6PAD A;  1O0E A;  1F2C A;  1GCB A;  3CH2 X;  2H7J A;  2NQD B;  3E1Z B;  2ACT A;  2C0Y A;  2BDZ A;  2DJG B;  1ZIV A;  3U8E A;  2F7D A;  4MZO A;  1Q6K A;  2DC8 A;  4PAD A;  2FO5 A;  2WBF X;  2AS8 A;  2AIM A;  4W5C A; 
#chains in the Genus database with same CATH topology
 4BS5 A;  1BGO A;  3OIS A;  5F02 A;  8PCH A;  3B79 A;  1MHW A;  2IPP B;  1NQC A;  9PAP A;  3ZUA A;  2AYO A;  1MEG A;  1DF0 A;  2ARY A;  2XU3 A;  4RY2 A;  1PCI A;  2HHN A;  1Y4H A;  3D6S A;  1ICF A;  3IFU A;  4XUI A;  2R6N A;  1SP4 B;  2R9N A;  4OEM A;  4QBB A;  2FRA A;  4OEL A;  4FK5 A;  4YYU A;  1QXP A;  4A5U A;  3WXG A;  3CBJ A;  5CVO B;  3IHP A;  1KHP A;  4PI3 A;  1YK8 A;  1PE6 A;  2P0R A;  4DMY A;  3OVZ A;  5CHV A;  1AU4 A;  4MZS A;  2FTD A;  4ZTB A;  3I06 A;  2OZ2 A;  3BC3 A;  1M6D A;  1BQI A;  3B21 A;  2VHF A;  1QMY A;  4CDE B;  4HXD B;  1AYW A;  2B1M A;  2DCC A;  1F2A A;  4PP2 E;  2FYE A;  4PT5 A;  3V6C A;  3V6E A;  2DZZ A;  3HHA A;  7PCK A;  5JH3 A;  1DEU A;  1YT7 A;  2AGA A;  4G54 A;  4WUR A;  1NB5 A;  2VHS A;  1BP4 A;  3MP2 A;  1YAL A;  5CVM A;  4HWY A;  3PSE A;  4P6E A;  1SNK A;  4PP1 A;  4FIP A;  1NPZ A;  3W30 A;  1ME4 A;  2E01 A;  1MIR A;  1AU0 A;  1EWM A;  3KW9 A;  3BCN A;  1VSN A;  1CSB B;  1K3B B;  3QSD A;  3N3G A;  3PHW A;  4YYS A;  2CB5 A;  1KHQ A;  3PHX A;  4QH6 A;  2E00 A;  2R9C A;  3DF0 A;  5CVN B;  2GHU A;  2HD5 A;  3IMA A;  2DZY A;  2BTW A;  1ITO A;  1FH0 A;  4D8I A;  1NLJ A;  4BSQ A;  3N3K A;  2BDL A;  2E02 A;  1POP A;  3LXS A;  4N4Z A;  1THE A;  2XU1 A;  1QOL A;  4MI7 A;  3S3Q A;  4P6G A;  2DC6 A;  4YYW A;  1EF7 A;  4R3D A;  1GMY A;  3WXF A;  4YYQ A;  2P7U A;  4CZW A;  1CVZ A;  2AUZ A;  1TU6 A;  5EGW A;  1PVJ A;  1AIM A;  2J7Q A;  2XU4 A;  1CB5 A;  2UZJ A;  3IV2 A;  4CDC B;  4D8B A;  3KFQ A;  3HHI A;  2JTC A;  2PBH A;  4W4U A;  1Y08 A;  1KXR A;  1QDQ A;  4OW0 A;  3KX1 A;  1ME3 A;  3H6S A;  4BQV A;  5FPW A;  2DCD A;  3QJ3 A;  3RVW A;  1CPJ A;  1MS6 A;  1CQD A;  4DMX A;  1DKI A;  2B1N A;  3MJ5 A;  1ATK A;  3USV A;  1IWD A;  3BOW A;  4XR7 A;  4BOS A;  4Q8H A;  1GEC E;  3PNR A;  4X6I A;  5EF4 A;  2DC9 A;  1CTE A;  3BBA A;  5JZE A;  3HD3 A;  2BU3 A;  1AU3 A;  2YJB A;  5PAD A;  2NQA A;  3PRM A;  2OP3 A;  4X6J A;  3WXE A;  3KKU A;  2YJ8 A;  3BY4 A;  3MHH A;  1PAD A;  4OVZ B;  2J7Q C;  4K7C A;  3C0R A;  3IOQ A;  1AYV A;  4RNA A;  5J94 A;  1BY8 A;  1TL9 A;  4REZ A;  4YYV A;  1GLO A;  3S3R A;  3P5V A;  3TMP A;  5EZS A;  1CV8 A;  3PHU A;  3AI8 A;  4M0W A;  3OQC A;  1EWO A;  1TLO A;  3PBH A;  5K16 A;  1AEC A;  1PPP A;  1MDW A;  4BOQ A;  4MM3 B;  4W5B A;  3P5U A;  2AU1 A;  3HWN A;  2HH5 A;  3RVV A;  4QRG A;  3KWZ A;  2O6X A;  4RF1 A;  3CH3 X;  3K8U A;  4WA6 A;  3OVX A;  5E6J A;  3MHS A;  3C9E A;  4CDF B;  1EWL A;  4D8E A;  2DOS A;  4YYR A;  3H8C A;  1PPD A;  4I05 A;  3PDF A;  1KFU L;  2G8J A;  3TNX A;  3LFY A;  1NL6 A;  4N8W A;  3K24 A;  4AXM A;  4FJC A;  3ZNH A;  3PRP A;  2G6D A;  3BPF A;  2PRE A;  3BPM A;  2G8E A;  1MEM A;  2YJC A;  3PT2 A;  3KWB X;  3KSE A;  1PPO A;  3F5V A;  3MTN A;  1YVB A;  4RKX A;  3RNV A;  4N79 A;  1KFX L;  4YV8 A;  1YK7 A;  3IUT A;  1U9W A;  3H89 A;  2F1G A;  1STF E;  4YVA A;  2AUX A;  3MTV A;  1NB3 A;  5KO3 A;  4BS6 A;  2DCA A;  2YJ9 A;  1PPN A;  1X9Y A;  4Q8G A;  1U9Q X;  5CHT A;  3TRK A;  3H8B A;  3O0U A;  2Y6E A;  1AU2 A;  2PAD A;  2YJ2 A;  3M99 A;  2JQF R;  1VJV A;  2GFO A;  4GUA A;  2R9O A;  1JQP A;  3OF9 A;  1PXV A;  1U9V A;  2FUD A;  3BWK A;  4OVZ A;  1A6R A;  3K9M A;  4X6H A;  1HUC B;  2R9M A;  2JRI A;  2PNS A;  4CDD B;  2E03 A;  2G7Y A;  4P16 A;  2AYN A;  3P5W A;  1U9X A;  3IEJ A;  3QT4 A;  4ZUX U;  3I3T A;  4QRX A;  2NQG A;  3E9S A;  2FRQ A;  3CBK A;  1PBH A;  4BOU A;  1U5I A;  4I07 A;  2FT2 A;  4I04 A;  2FQ9 A;  3MOR A;  1F2B A;  2Y5B A;  4BOZ A;  2Z84 A;  2CIO A;  3GCB A;  1EWP A;  3RVX A;  2AVW A;  2NQI A;  4IUM A;  4MSX A;  3N4C A;  1ZCM A;  3OF8 A;  1F29 A;  4KLB A;  2R9F A;  3H7D A;  5EZQ A;  3O65 A;  2XU5 A;  4BPV A;  3W31 A;  1XKG A;  2JQG R;  3F75 A;  1AYU A;  2DC7 A;  2P86 A;  5JA7 A;  3NHE A;  4RF0 A;  2DJF B;  2DCB A;  1YZB A;  2FE8 A;  5A24 A;  3ERV A;  3O1G A;  4XZX A;  3PW3 A;  1CJL A;  1PIP A;  4QRV A;  2ATO A;  2OUL A;  2IBI A;  4AXL A;  2HXZ A;  3P5X A;  1S4V A;  1CS8 A;  6PAD A;  1O0E A;  1F2C A;  2HWK A;  1GCB A;  3CH2 X;  4BOP A;  2H7J A;  2NQD B;  3E1Z B;  2ACT A;  2C0Y A;  2BDZ A;  2DJG B;  1ZIV A;  3BB7 A;  3U8E A;  2F7D A;  4MZO A;  1Q6K A;  1UKF A;  2DC8 A;  4PAD A;  2FO5 A;  2WBF X;  2AS8 A;  4IP3 A;  2AIM A;  4W5C A;  2BTW B; 
#chains in the Genus database with same CATH homology
 4BS5 A;  1BGO A;  3OIS A;  4C5P A;  5F02 A;  8PCH A;  3B79 A;  1MHW A;  2IPP B;  1NQC A;  9PAP A;  3ZUA A;  2AYO A;  1MEG A;  1DF0 A;  2ARY A;  2XU3 A;  4RY2 A;  1PCI A;  2HHN A;  1Y4H A;  3D6S A;  1ICF A;  4XUI A;  2R6N A;  1SP4 B;  2R9N A;  4OEM A;  4QBB A;  2FRA A;  4OEL A;  4FK5 A;  4YYU A;  1QXP A;  3WXG A;  3CBJ A;  2VFC A;  5CVO B;  3IHP A;  1KHP A;  4PI3 A;  1YK8 A;  1PE6 A;  2P0R A;  4DMY A;  3OVZ A;  4BGF A;  5CHV A;  1AU4 A;  4GUZ A;  4MZS A;  2FTD A;  3I06 A;  2OZ2 A;  3BC3 A;  1M6D A;  1BQI A;  2VHF A;  1QMY A;  4CDE B;  1AYW A;  2B1M A;  2DCC A;  1F2A A;  4PP2 E;  2FYE A;  3V6C A;  3V6E A;  2DZZ A;  3HHA A;  7PCK A;  5JH3 A;  1DEU A;  1YT7 A;  1NB5 A;  4G54 A;  2VHS A;  1BP4 A;  1YAL A;  5CVM A;  4HWY A;  4P6E A;  1SNK A;  4PP1 A;  4FIP A;  1NPZ A;  1ME4 A;  2E01 A;  1MIR A;  1AU0 A;  4NV8 A;  1EWM A;  3KW9 A;  3BCN A;  1VSN A;  1CSB B;  1K3B B;  3D9W A;  3QSD A;  3N3G A;  4YYS A;  2CB5 A;  1KHQ A;  4QH6 A;  2E00 A;  2R9C A;  1W5R A;  3DF0 A;  5CVN B;  2GHU A;  2HD5 A;  3IMA A;  2DZY A;  1ITO A;  1FH0 A;  1NLJ A;  4BSQ A;  3N3K A;  2BDL A;  2E02 A;  1POP A;  3LXS A;  4N4Z A;  1THE A;  2XU1 A;  1QOL A;  3S3Q A;  4P6G A;  2DC6 A;  4YYW A;  1EF7 A;  1GMY A;  3WXF A;  4YYQ A;  2P7U A;  4CZW A;  1CVZ A;  2AUZ A;  1TU6 A;  5EGW A;  1AIM A;  2XU4 A;  1CB5 A;  3IV2 A;  4CDC B;  3KFQ A;  3HHI A;  2PBH A;  4W4U A;  4B55 A;  1Y08 A;  1KXR A;  1QDQ A;  3KX1 A;  1ME3 A;  3H6S A;  4BQV A;  5FPW A;  2DCD A;  3QJ3 A;  3RVW A;  1CPJ A;  1MS6 A;  1CQD A;  4DMX A;  2B1N A;  1ATK A;  3USV A;  1IWD A;  3BOW A;  4XR7 A;  4Q8H A;  1GEC E;  3PNR A;  4X6I A;  5EF4 A;  2DC9 A;  1CTE A;  3HD3 A;  1AU3 A;  2YJB A;  5PAD A;  2NQA A;  2OP3 A;  4X6J A;  3WXE A;  3KKU A;  2YJ8 A;  3MHH A;  1PAD A;  4K7C A;  3IOQ A;  1AYV A;  5J94 A;  1BY8 A;  1TL9 A;  4YYV A;  1GLO A;  3S3R A;  3P5V A;  1CV8 A;  2BSZ A;  3AI8 A;  1EWO A;  1TLO A;  3PBH A;  5K16 A;  1AEC A;  1PPP A;  1MDW A;  4W5B A;  3P5U A;  2AU1 A;  3HWN A;  2HH5 A;  3RVV A;  4QRG A;  1W4T A;  3KWZ A;  2O6X A;  3CH3 X;  3K8U A;  4WA6 A;  3OVX A;  3MHS A;  3C9E A;  4CDF B;  1EWL A;  1W6F A;  4YYR A;  3H8C A;  1PPD A;  4I05 A;  3PDF A;  1KFU L;  2G8J A;  3TNX A;  3LFY A;  1NL6 A;  4N8W A;  3K24 A;  4AXM A;  4FJC A;  2G6D A;  3BPF A;  2PRE A;  3BPM A;  2G8E A;  1MEM A;  2YJC A;  3KWB X;  3KSE A;  1PPO A;  3F5V A;  3MTN A;  1YVB A;  4N79 A;  1KFX L;  4YV8 A;  1YK7 A;  3IUT A;  1U9W A;  3H89 A;  2F1G A;  1STF E;  4YVA A;  2AUX A;  1NB3 A;  3LTW A;  4BS6 A;  2DCA A;  2YJ9 A;  1PPN A;  1X9Y A;  4Q8G A;  1U9Q X;  5CHT A;  1E2T A;  3H8B A;  3O0U A;  2Y6E A;  1AU2 A;  2PAD A;  2YJ2 A;  3M99 A;  2JQF R;  1VJV A;  2GFO A;  2R9O A;  1JQP A;  3OF9 A;  1PXV A;  1U9V A;  2FUD A;  3BWK A;  1A6R A;  3K9M A;  4X6H A;  1HUC B;  2R9M A;  2PNS A;  4CDD B;  2E03 A;  2G7Y A;  2AYN A;  3P5W A;  1U9X A;  3IEJ A;  3QT4 A;  4ZUX U;  3I3T A;  4QRX A;  2NQG A;  2FRQ A;  3CBK A;  1PBH A;  1U5I A;  4I07 A;  2FT2 A;  4I04 A;  2FQ9 A;  3MOR A;  1F2B A;  2Y5B A;  2CIO A;  3GCB A;  1EWP A;  2VFB A;  3RVX A;  2AVW A;  2NQI A;  4MSX A;  3N4C A;  1ZCM A;  3OF8 A;  1F29 A;  4KLB A;  2R9F A;  3H7D A;  2XU5 A;  4BPV A;  1XKG A;  2JQG R;  3F75 A;  1AYU A;  2DC7 A;  2P86 A;  5JA7 A;  3NHE A;  2DJF B;  2DCB A;  5A24 A;  3ERV A;  3O1G A;  3PW3 A;  1CJL A;  1GX3 A;  1PIP A;  4QRV A;  2ATO A;  2OUL A;  2IBI A;  4AXL A;  2HXZ A;  3P5X A;  1S4V A;  1CS8 A;  6PAD A;  1O0E A;  1F2C A;  1GCB A;  4NV7 A;  3CH2 X;  2H7J A;  2NQD B;  3E1Z B;  2ACT A;  2C0Y A;  2BDZ A;  2DJG B;  1ZIV A;  3U8E A;  2F7D A;  4MZO A;  1Q6K A;  2DC8 A;  4PAD A;  2FO5 A;  2WBF X;  2AS8 A;  2AIM A;  4W5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...