3N4CA

6-phenyl-1h-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin s inhibitors
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title 6-Phenyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin S inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n4cA00
4PI3A 2E02A 4W5BA 1X9YA 3QT4A 2YJ9A 4W4UA 2P86A 1BQIA 4HWYA 3P5UA 5CVOB 1ME3A 1F2BA 3P5XA 1U9XA 1MEGA 1Y08A 4YVAA 1M6DA 1TLOA 2G8EA 3IUTA 3OF9A 1DEUA 8PCHA 3PNRA 3MORA 4YYRA 1FH0A 3KKUA 1K3BB 4I07A 1AECA 1CJLA 3BPMA 1CVZA 2PADA 2AS8A 1ICFA 1BP4A 1EWMA 4RY2A 2AU1A 3KW9A 3P5VA 1AU3A 3DF0A 4DMXA 2YJCA 2NQAA 1CPJA 2DCDA 3O0UA 5CHTA 2WBFX 4G54A 1CV8A 1STFE 1IWDA 1F2AA 1AU2A 2HXZA 3C9EA 3IMAA 2AIMA 1Q6KA 2FRAA 1NB5A 4Q8HA 4XR7A 2BDLA 2P0RA 3WXGA 1Y4HA 2BDZA 2ARYA 3BOWA 1JQPA 1PCIA 2B1MA 3N4CA 4P6GA 7PCKA 4BSQA 1GCBA 1ZCMA 3CBJA 2AVWA 2E01A 2G7YA 1GLOA 4YV8A 1BY8A 1AU0A 1F2CA 1U9WA 4YYVA 3V6EA 4PP1A 1DF0A 1KHQA 2PREA 1YK8A 2XU5A 3OVZA 1ITOA 2IPPB 1GECE 4QH6A 2ATOA 2XU4A 4CDEB 2DC7A 2Y6EA 4PADA 1CSBB 4Q8GA 1QOLA 2Y5BA 1CQDA 1BGOA 4OELA 3H8BA 1O0EA 3P5WA 3MTNA 4YYQA 1PBHA 2F7DA 3AI8A 4MZOA 3I06A 2F1GA 3NHEA 3O1GA 1SNKA 5A24A 3KX1A 2HD5A 1KXRA 2G8JA 5PADA 4ZUXU 4X6IA 1NLJA 2OZ2A 3OISA 2DC9A 2R9NA 4CDDB 3USVA 2DZZA 3LFYA 3TNXA 2HHNA 2G6DA 5K16A 2YJ8A 4OEMA 2VHSA 3ERVA 2FO5A 3BPFA 2E03A 2FQ9A 2NQIA 2FYEA 4DMYA 4P6EA 1KFUL 2VHFA 3CH3X 4KLBA 4W5CA 1AU4A 1QDQA 4CZWA 1EWPA 4QRXA 3LXSA 3RVWA 1XKGA 2XU1A 1TL9A 1GMYA 3H6SA 4N79A 1MEMA 2B1NA 4BQVA 4FJCA 2DCBA 2GHUA 3HHIA 2NQGA 2H7JA 3U8EA 1MS6A 3PDFA 3HWNA 1U9VA 5J94A 3WXFA 4K7CA 2DC6A 3BWKA 2R9CA 3F75A 1PE6A 3H7DA 2FT2A 4I04A 2C0YA 2HH5A 3KFQA 5CVMA 1PPOA 1THEA 3K8UA 3KWZA 2CIOA 4QRVA 2DZYA 2JQFR 3F5VA 4WA6A 3KSEA 3CH2X 4BS5A 1CTEA 3ZUAA 2AYNA 5EF4A 3N3KA 1ME4A 3HHAA 9PAPA 1HUCB 1PXVA 1NPZA 4QBBA 2O6XA 1NB3A 3V6CA 3IHPA 1EWLA 2GFOA 1YT7A 3D6SA 4QRGA 2YJBA 3WXEA 4X6JA 2FRQA 2IBIA 3OF8A 2XU3A 4FK5A 2NQDB 4YYWA 4I05A 3HD3A 4N8WA 4MSXA 3IEJA 3RVXA 2DJGB 4MZSA 1CS8A 2PNSA 1MHWA 2R9FA 3KWBX 1A6RA 1AYWA 1NQCA 4BS6A 5JA7A 4AXLA 2DC8A 4BPVA 5F02A 3BCNA 2P7UA 3K9MA 1ATKA 1YALA 2R9MA 2AUXA 1F29A 1YVBA 2JQGR 5EGWA 1QMYA 3CBKA 3S3QA 1AYUA 1NL6A 4FIPA 1QXPA 4CDCB 2R6NA 2CB5A 1MIRA 1EF7A 1TU6A 1VSNA 3OVXA 1S4VA 1KFXL 2FUDA 1CB5A 3MHSA 1PPPA 3QJ3A 1SP4B 1U5IA 4CDFB 3B79A 3M99A 3PW3A 1PADA 3I3TA 1VJVA 2DCAA 3N3GA 1YK7A 2YJ2A 3IV2A 3PBHA 1ZIVA 3E1ZB 3K24A 1AYVA 3BC3A 1MDWA 2AUZA 5CVNB 3MHHA 2OP3A 2OULA 5CHVA 1PPNA 3GCBA 4X6HA 2FTDA 1PIPA 4AXMA 1PPDA 1POPA 2PBHA 4N4ZA 4YYSA 3IOQA 2DCCA 1U9QX 4XUIA 5JH3A 2DJFB 4YYUA 1AIMA 6PADA 1KHPA 2ACTA 1EWOA 3H8CA 3QSDA 2AYOA 2R9OA 5FPWA 4PP2E 2E00A 3H89A 3RVVA 3S3RA
chains in the Genus database with same CATH superfamily
4PI3A 2E02A 4W5BA 1X9YA 3QT4A 2YJ9A 4W4UA 2P86A 1BQIA 4HWYA 3P5UA 5CVOB 1ME3A 1F2BA 3P5XA 1U9XA 2HWKA 1MEGA 1Y08A 4YVAA 1UKFA 1M6DA 1TLOA 2G8EA 4BOSA 3IUTA 3OF9A 2J7QA 4HXDB 4A5UA 4BOPA 1DEUA 8PCHA 4D8IA 4OW0A 3PNRA 3MORA 4YYRA 1FH0A 2FE8A 3KKUA 1K3BB 4I07A 1AECA 1CJLA 3BPMA 1CVZA 2PADA 2Z84A 4RNAA 2AS8A 1ICFA 1BP4A 1EWMA 4RY2A 5E6JA 2AU1A 3KW9A 3P5VA 1AU3A 3DF0A 3MP2A 4DMXA 2YJCA 2NQAA 1CPJA 2DCDA 3O0UA 3E9SA 5CHTA 2WBFX 4G54A 1CV8A 1STFE 4IUMA 1IWDA 1F2AA 1AU2A 2HXZA 3C9EA 3IMAA 2AIMA 1Q6KA 2FRAA 1NB5A 4Q8HA 4XR7A 2BDLA 2P0RA 3WXGA 4WURA 1Y4HA 2BDZA 2ARYA 3BOWA 4RF1A 1JQPA 1PCIA 2B1MA 3N4CA 4P6GA 4OVZB 4BSQA 1GCBA 7PCKA 3PHWA 1ZCMA 3CBJA 2AVWA 2E01A 2G7YA 4RF0A 1GLOA 4YV8A 1BY8A 1AU0A 1F2CA 1U9WA 4YYVA 3V6EA 4PP1A 1DF0A 1KHQA 2PREA 1YK8A 2XU5A 3OVZA 1ITOA 2IPPB 1GECE 4QH6A 2ATOA 2XU4A 4GUAA 4CDEB 2DC7A 2Y6EA 4PADA 4P16A 2BTWA 1CSBB 4Q8GA 1QOLA 2Y5BA 1CQDA 1BGOA 4OELA 3H8BA 1O0EA 3P5WA 3MTNA 4YYQA 1PBHA 2F7DA 3AI8A 4MZOA 3I06A 2F1GA 3NHEA 3O1GA 1SNKA 5A24A 3KX1A 2HD5A 1KXRA 2G8JA 5PADA 4ZUXU 4R3DA 4X6IA 1NLJA 2OZ2A 3OISA 3BY4A 2DC9A 2R9NA 4RKXA 4CDDB 3USVA 5JZEA 2DZZA 3LFYA 3MTVA 5EZQA 3TNXA 2HHNA 2G6DA 5K16A 2YJ8A 4OEMA 5KO3A 2VHSA 3IFUA 3ERVA 2FO5A 3BPFA 2E03A 2FQ9A 2NQIA 2FYEA 4DMYA 4P6EA 1KFUL 2VHFA 3CH3X 4KLBA 4W5CA 4IP3A 1AU4A 1QDQA 4CZWA 1EWPA 4QRXA 3LXSA 3RVWA 1XKGA 2XU1A 2BTWB 1TL9A 1GMYA 2UZJA 3H6SA 4N79A 1MEMA 2B1NA 4BQVA 4FJCA 2DCBA 2GHUA 1DKIA 3HHIA 2NQGA 2H7JA 3U8EA 1MS6A 3PDFA 3HWNA 1U9VA 5J94A 3WXFA 4K7CA 2DC6A 3BWKA 2R9CA 3C0RA 3F75A 1PE6A 3H7DA 2FT2A 3TRKA 4I04A 2C0YA 2HH5A 3KFQA 3PHUA 5CVMA 1PPOA 1THEA 3K8UA 3KWZA 5EZSA 1YZBA 3ZNHA 2CIOA 4D8BA 3PRMA 4QRVA 2J7QC 2DOSA 2DZYA 2JQFR 3F5VA 4WA6A 3KSEA 3CH2X 4BS5A 1CTEA 3ZUAA 2AYNA 4PT5A 5EF4A 3N3KA 3HHAA 1ME4A 4MM3B 9PAPA 1HUCB 3BBAA 1PXVA 3TMPA 2JRIA 1NPZA 4QBBA 2O6XA 1NB3A 3V6CA 4XZXA 3IHPA 1EWLA 3PRPA 2GFOA 1YT7A 3D6SA 4QRGA 2YJBA 3PHXA 3WXEA 4BOUA 4X6JA 2FRQA 2IBIA 3OF8A 2XU3A 4FK5A 2NQDB 4YYWA 4I05A 3HD3A 4N8WA 4MSXA 3IEJA 3RVXA 2DJGB 4MZSA 3BB7A 1CS8A 2PNSA 1MHWA 2R9FA 3KWBX 1A6RA 1AYWA 3S3RA 1NQCA 3OQCA 4BS6A 5JA7A 4AXLA 2DC8A 4BPVA 5F02A 3BCNA 3RNVA 3MJ5A 2P7UA 4MI7A 3K9MA 1ATKA 1YALA 4BOQA 2R9MA 2AUXA 2AGAA 1F29A 1YVBA 3O65A 2JQGR 5EGWA 1QMYA 3CBKA 4REZA 3S3QA 1AYUA 1NL6A 4OVZA 4FIPA 1QXPA 4CDCB 2R6NA 2CB5A 3PT2A 1MIRA 1EF7A 1TU6A 1VSNA 4ZTBA 3OVXA 1S4VA 1KFXL 2FUDA 1PVJA 1CB5A 3MHSA 1PPPA 3QJ3A 1SP4B 1U5IA 4CDFB 3PSEA 3B79A 4D8EA 3M99A 3PW3A 1PADA 3I3TA 1VJVA 2DCAA 3N3GA 1YK7A 2YJ2A 3IV2A 3PBHA 1ZIVA 3E1ZB 4BOZA 3K24A 1AYVA 3BC3A 1MDWA 2BU3A 2AUZA 5CVNB 3W31A 3MHHA 2OP3A 2OULA 5CHVA 1PPNA 3GCBA 4X6HA 2FTDA 3W30A 4M0WA 1PIPA 4AXMA 1PPDA 1POPA 2PBHA 4N4ZA 4YYSA 3IOQA 2DCCA 1U9QX 4XUIA 5JH3A 2DJFB 4YYUA 1AIMA 6PADA 1KHPA 2ACTA 1EWOA 3H8CA 3B21A 3QSDA 2AYOA 2R9OA 5FPWA 4PP2E 2E00A 3H89A 3RVVA 2JTCA
chains in the Genus database with same CATH topology
4PI3A 2E02A 4C5PA 4W5BA 1X9YA 3QT4A 2YJ9A 4W4UA 2P86A 1BQIA 4HWYA 3P5UA 5CVOB 1ME3A 1F2BA 3P5XA 1U9XA 1MEGA 1Y08A 4YVAA 1M6DA 1TLOA 2G8EA 4B55A 3IUTA 3OF9A 1DEUA 8PCHA 3PNRA 3MORA 4YYRA 1FH0A 3KKUA 1K3BB 4I07A 1AECA 1CJLA 3BPMA 1CVZA 2PADA 2AS8A 1E2TA 1ICFA 1BP4A 1EWMA 4RY2A 2AU1A 3KW9A 4NV8A 3P5VA 1AU3A 3DF0A 4DMXA 2YJCA 2NQAA 1CPJA 2DCDA 3O0UA 5CHTA 2WBFX 4G54A 1CV8A 1STFE 1IWDA 1F2AA 1AU2A 2HXZA 3C9EA 3IMAA 2AIMA 1Q6KA 1W4TA 2FRAA 1NB5A 4Q8HA 4XR7A 2BDLA 2P0RA 3WXGA 1Y4HA 2BDZA 2ARYA 3BOWA 1JQPA 1PCIA 2B1MA 3N4CA 4P6GA 7PCKA 4BSQA 1GCBA 1ZCMA 3CBJA 2AVWA 2E01A 2G7YA 1GLOA 4YV8A 1GX3A 1BY8A 1AU0A 1F2CA 1U9WA 4YYVA 3V6EA 4PP1A 1DF0A 1KHQA 2PREA 1YK8A 2XU5A 3OVZA 1ITOA 2IPPB 1GECE 4QH6A 2ATOA 2XU4A 4CDEB 2DC7A 2Y6EA 4PADA 1CSBB 4Q8GA 1QOLA 2Y5BA 1CQDA 1BGOA 1W5RA 4OELA 3H8BA 1O0EA 3P5WA 3MTNA 4YYQA 1PBHA 2F7DA 3AI8A 4MZOA 3I06A 2F1GA 3NHEA 3O1GA 1SNKA 5A24A 3KX1A 2HD5A 1KXRA 2VFBA 2G8JA 5PADA 4ZUXU 4X6IA 1NLJA 2OZ2A 3OISA 2DC9A 2R9NA 4CDDB 3USVA 2DZZA 3LFYA 3TNXA 2HHNA 2G6DA 5K16A 2YJ8A 4OEMA 2VHSA 3ERVA 2FO5A 3BPFA 2BSZA 2E03A 2FQ9A 2NQIA 2FYEA 4DMYA 4P6EA 1KFUL 2VHFA 3CH3X 4KLBA 4W5CA 1AU4A 1QDQA 4CZWA 1EWPA 4QRXA 3LXSA 3RVWA 1XKGA 3LTWA 2XU1A 1TL9A 1GMYA 3H6SA 4N79A 1MEMA 2B1NA 4BQVA 4FJCA 2DCBA 2GHUA 3HHIA 2NQGA 2H7JA 3U8EA 1MS6A 3PDFA 3HWNA 1U9VA 4NV7A 5J94A 3WXFA 4K7CA 2DC6A 3BWKA 2R9CA 3F75A 4GUZA 1PE6A 3H7DA 2FT2A 4I04A 2C0YA 2HH5A 3KFQA 5CVMA 1PPOA 1THEA 3K8UA 3KWZA 2CIOA 3D9WA 4QRVA 2DZYA 2JQFR 3F5VA 4WA6A 3KSEA 3CH2X 4BS5A 1CTEA 3ZUAA 2VFCA 2AYNA 5EF4A 3N3KA 1ME4A 3HHAA 9PAPA 1HUCB 1PXVA 1NPZA 4QBBA 2O6XA 1NB3A 3V6CA 3IHPA 1EWLA 2GFOA 1YT7A 3D6SA 4QRGA 2YJBA 3WXEA 4X6JA 2FRQA 2IBIA 3OF8A 2XU3A 4FK5A 2NQDB 4YYWA 4I05A 3HD3A 4N8WA 4MSXA 3IEJA 3RVXA 2DJGB 4MZSA 1CS8A 2PNSA 1MHWA 2R9FA 3KWBX 1A6RA 1AYWA 1NQCA 4BS6A 5JA7A 4AXLA 2DC8A 4BPVA 5F02A 3BCNA 2P7UA 3K9MA 1ATKA 1YALA 2R9MA 2AUXA 1F29A 1YVBA 2JQGR 5EGWA 1QMYA 3CBKA 3S3QA 1AYUA 1NL6A 4FIPA 1QXPA 4CDCB 2R6NA 2CB5A 1MIRA 1EF7A 1TU6A 1VSNA 3OVXA 1S4VA 1KFXL 2FUDA 1CB5A 3MHSA 1PPPA 3QJ3A 1SP4B 1U5IA 4CDFB 3B79A 3M99A 3PW3A 1PADA 3I3TA 1VJVA 2DCAA 3N3GA 4BGFA 1YK7A 2YJ2A 3IV2A 3PBHA 1ZIVA 3E1ZB 3K24A 1AYVA 3BC3A 1MDWA 2AUZA 5CVNB 3MHHA 2OP3A 2OULA 5CHVA 1PPNA 3GCBA 4X6HA 2FTDA 1PIPA 4AXMA 1PPDA 1POPA 2PBHA 1W6FA 4N4ZA 4YYSA 3IOQA 2DCCA 1U9QX 4XUIA 5JH3A 2DJFB 4YYUA 1AIMA 6PADA 1KHPA 2ACTA 1EWOA 3H8CA 3QSDA 2AYOA 2R9OA 5FPWA 4PP2E 2E00A 3H89A 3RVVA 3S3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI3 A;  2E02 A;  4W5B A;  1X9Y A;  3QT4 A;  2YJ9 A;  4W4U A;  2P86 A;  1BQI A;  4HWY A;  3P5U A;  5CVO B;  1ME3 A;  1F2B A;  3P5X A;  1U9X A;  1MEG A;  1Y08 A;  4YVA A;  1M6D A;  1TLO A;  2G8E A;  3IUT A;  3OF9 A;  1DEU A;  8PCH A;  3PNR A;  3MOR A;  4YYR A;  1FH0 A;  3KKU A;  1K3B B;  4I07 A;  1AEC A;  1CJL A;  3BPM A;  1CVZ A;  2PAD A;  2AS8 A;  1ICF A;  1BP4 A;  1EWM A;  4RY2 A;  2AU1 A;  3KW9 A;  3P5V A;  1AU3 A;  3DF0 A;  4DMX A;  2YJC A;  2NQA A;  1CPJ A;  2DCD A;  3O0U A;  5CHT A;  2WBF X;  4G54 A;  1CV8 A;  1STF E;  1IWD A;  1F2A A;  1AU2 A;  2HXZ A;  3C9E A;  3IMA A;  2AIM A;  1Q6K A;  2FRA A;  1NB5 A;  4Q8H A;  4XR7 A;  2BDL A;  2P0R A;  3WXG A;  1Y4H A;  2BDZ A;  2ARY A;  3BOW A;  1JQP A;  1PCI A;  2B1M A;  3N4C A;  4P6G A;  7PCK A;  4BSQ A;  1GCB A;  1ZCM A;  3CBJ A;  2AVW A;  2E01 A;  2G7Y A;  1GLO A;  4YV8 A;  1BY8 A;  1AU0 A;  1F2C A;  1U9W A;  4YYV A;  3V6E A;  4PP1 A;  1DF0 A;  1KHQ A;  2PRE A;  1YK8 A;  2XU5 A;  3OVZ A;  1ITO A;  2IPP B;  1GEC E;  4QH6 A;  2ATO A;  2XU4 A;  4CDE B;  2DC7 A;  2Y6E A;  4PAD A;  1CSB B;  4Q8G A;  1QOL A;  2Y5B A;  1CQD A;  1BGO A;  4OEL A;  3H8B A;  1O0E A;  3P5W A;  3MTN A;  4YYQ A;  1PBH A;  2F7D A;  3AI8 A;  4MZO A;  3I06 A;  2F1G A;  3NHE A;  3O1G A;  1SNK A;  5A24 A;  3KX1 A;  2HD5 A;  1KXR A;  2G8J A;  5PAD A;  4ZUX U;  4X6I A;  1NLJ A;  2OZ2 A;  3OIS A;  2DC9 A;  2R9N A;  4CDD B;  3USV A;  2DZZ A;  3LFY A;  3TNX A;  2HHN A;  2G6D A;  5K16 A;  2YJ8 A;  4OEM A;  2VHS A;  3ERV A;  2FO5 A;  3BPF A;  2E03 A;  2FQ9 A;  2NQI A;  2FYE A;  4DMY A;  4P6E A;  1KFU L;  2VHF A;  3CH3 X;  4KLB A;  4W5C A;  1AU4 A;  1QDQ A;  4CZW A;  1EWP A;  4QRX A;  3LXS A;  3RVW A;  1XKG A;  2XU1 A;  1TL9 A;  1GMY A;  3H6S A;  4N79 A;  1MEM A;  2B1N A;  4BQV A;  4FJC A;  2DCB A;  2GHU A;  3HHI A;  2NQG A;  2H7J A;  3U8E A;  1MS6 A;  3PDF A;  3HWN A;  1U9V A;  5J94 A;  3WXF A;  4K7C A;  2DC6 A;  3BWK A;  2R9C A;  3F75 A;  1PE6 A;  3H7D A;  2FT2 A;  4I04 A;  2C0Y A;  2HH5 A;  3KFQ A;  5CVM A;  1PPO A;  1THE A;  3K8U A;  3KWZ A;  2CIO A;  4QRV A;  2DZY A;  2JQF R;  3F5V A;  4WA6 A;  3KSE A;  3CH2 X;  4BS5 A;  1CTE A;  3ZUA A;  2AYN A;  5EF4 A;  3N3K A;  1ME4 A;  3HHA A;  9PAP A;  1HUC B;  1PXV A;  1NPZ A;  4QBB A;  2O6X A;  1NB3 A;  3V6C A;  3IHP A;  1EWL A;  2GFO A;  1YT7 A;  3D6S A;  4QRG A;  2YJB A;  3WXE A;  4X6J A;  2FRQ A;  2IBI A;  3OF8 A;  2XU3 A;  4FK5 A;  2NQD B;  4YYW A;  4I05 A;  3HD3 A;  4N8W A;  4MSX A;  3IEJ A;  3RVX A;  2DJG B;  4MZS A;  1CS8 A;  2PNS A;  1MHW A;  2R9F A;  3KWB X;  1A6R A;  1AYW A;  1NQC A;  4BS6 A;  5JA7 A;  4AXL A;  2DC8 A;  4BPV A;  5F02 A;  3BCN A;  2P7U A;  3K9M A;  1ATK A;  1YAL A;  2R9M A;  2AUX A;  1F29 A;  1YVB A;  2JQG R;  5EGW A;  1QMY A;  3CBK A;  3S3Q A;  1AYU A;  1NL6 A;  4FIP A;  1QXP A;  4CDC B;  2R6N A;  2CB5 A;  1MIR A;  1EF7 A;  1TU6 A;  1VSN A;  3OVX A;  1S4V A;  1KFX L;  2FUD A;  1CB5 A;  3MHS A;  1PPP A;  3QJ3 A;  1SP4 B;  1U5I A;  4CDF B;  3B79 A;  3M99 A;  3PW3 A;  1PAD A;  3I3T A;  1VJV A;  2DCA A;  3N3G A;  1YK7 A;  2YJ2 A;  3IV2 A;  3PBH A;  1ZIV A;  3E1Z B;  3K24 A;  1AYV A;  3BC3 A;  1MDW A;  2AUZ A;  5CVN B;  3MHH A;  2OP3 A;  2OUL A;  5CHV A;  1PPN A;  3GCB A;  4X6H A;  2FTD A;  1PIP A;  4AXM A;  1PPD A;  1POP A;  2PBH A;  4N4Z A;  4YYS A;  3IOQ A;  2DCC A;  1U9Q X;  4XUI A;  5JH3 A;  2DJF B;  4YYU A;  1AIM A;  6PAD A;  1KHP A;  2ACT A;  1EWO A;  3H8C A;  3QSD A;  2AYO A;  2R9O A;  5FPW A;  4PP2 E;  2E00 A;  3H89 A;  3RVV A;  3S3R A; 
#chains in the Genus database with same CATH topology
 4PI3 A;  2E02 A;  4W5B A;  1X9Y A;  3QT4 A;  2YJ9 A;  4W4U A;  2P86 A;  1BQI A;  4HWY A;  3P5U A;  5CVO B;  1ME3 A;  1F2B A;  3P5X A;  1U9X A;  2HWK A;  1MEG A;  1Y08 A;  4YVA A;  1UKF A;  1M6D A;  1TLO A;  2G8E A;  4BOS A;  3IUT A;  3OF9 A;  2J7Q A;  4HXD B;  4A5U A;  4BOP A;  1DEU A;  8PCH A;  4D8I A;  4OW0 A;  3PNR A;  3MOR A;  4YYR A;  1FH0 A;  2FE8 A;  3KKU A;  1K3B B;  4I07 A;  1AEC A;  1CJL A;  3BPM A;  1CVZ A;  2PAD A;  2Z84 A;  4RNA A;  2AS8 A;  1ICF A;  1BP4 A;  1EWM A;  4RY2 A;  5E6J A;  2AU1 A;  3KW9 A;  3P5V A;  1AU3 A;  3DF0 A;  3MP2 A;  4DMX A;  2YJC A;  2NQA A;  1CPJ A;  2DCD A;  3O0U A;  3E9S A;  5CHT A;  2WBF X;  4G54 A;  1CV8 A;  1STF E;  4IUM A;  1IWD A;  1F2A A;  1AU2 A;  2HXZ A;  3C9E A;  3IMA A;  2AIM A;  1Q6K A;  2FRA A;  1NB5 A;  4Q8H A;  4XR7 A;  2BDL A;  2P0R A;  3WXG A;  4WUR A;  1Y4H A;  2BDZ A;  2ARY A;  3BOW A;  4RF1 A;  1JQP A;  1PCI A;  2B1M A;  3N4C A;  4P6G A;  4OVZ B;  4BSQ A;  1GCB A;  7PCK A;  3PHW A;  1ZCM A;  3CBJ A;  2AVW A;  2E01 A;  2G7Y A;  4RF0 A;  1GLO A;  4YV8 A;  1BY8 A;  1AU0 A;  1F2C A;  1U9W A;  4YYV A;  3V6E A;  4PP1 A;  1DF0 A;  1KHQ A;  2PRE A;  1YK8 A;  2XU5 A;  3OVZ A;  1ITO A;  2IPP B;  1GEC E;  4QH6 A;  2ATO A;  2XU4 A;  4GUA A;  4CDE B;  2DC7 A;  2Y6E A;  4PAD A;  4P16 A;  2BTW A;  1CSB B;  4Q8G A;  1QOL A;  2Y5B A;  1CQD A;  1BGO A;  4OEL A;  3H8B A;  1O0E A;  3P5W A;  3MTN A;  4YYQ A;  1PBH A;  2F7D A;  3AI8 A;  4MZO A;  3I06 A;  2F1G A;  3NHE A;  3O1G A;  1SNK A;  5A24 A;  3KX1 A;  2HD5 A;  1KXR A;  2G8J A;  5PAD A;  4ZUX U;  4R3D A;  4X6I A;  1NLJ A;  2OZ2 A;  3OIS A;  3BY4 A;  2DC9 A;  2R9N A;  4RKX A;  4CDD B;  3USV A;  5JZE A;  2DZZ A;  3LFY A;  3MTV A;  5EZQ A;  3TNX A;  2HHN A;  2G6D A;  5K16 A;  2YJ8 A;  4OEM A;  5KO3 A;  2VHS A;  3IFU A;  3ERV A;  2FO5 A;  3BPF A;  2E03 A;  2FQ9 A;  2NQI A;  2FYE A;  4DMY A;  4P6E A;  1KFU L;  2VHF A;  3CH3 X;  4KLB A;  4W5C A;  4IP3 A;  1AU4 A;  1QDQ A;  4CZW A;  1EWP A;  4QRX A;  3LXS A;  3RVW A;  1XKG A;  2XU1 A;  2BTW B;  1TL9 A;  1GMY A;  2UZJ A;  3H6S A;  4N79 A;  1MEM A;  2B1N A;  4BQV A;  4FJC A;  2DCB A;  2GHU A;  1DKI A;  3HHI A;  2NQG A;  2H7J A;  3U8E A;  1MS6 A;  3PDF A;  3HWN A;  1U9V A;  5J94 A;  3WXF A;  4K7C A;  2DC6 A;  3BWK A;  2R9C A;  3C0R A;  3F75 A;  1PE6 A;  3H7D A;  2FT2 A;  3TRK A;  4I04 A;  2C0Y A;  2HH5 A;  3KFQ A;  3PHU A;  5CVM A;  1PPO A;  1THE A;  3K8U A;  3KWZ A;  5EZS A;  1YZB A;  3ZNH A;  2CIO A;  4D8B A;  3PRM A;  4QRV A;  2J7Q C;  2DOS A;  2DZY A;  2JQF R;  3F5V A;  4WA6 A;  3KSE A;  3CH2 X;  4BS5 A;  1CTE A;  3ZUA A;  2AYN A;  4PT5 A;  5EF4 A;  3N3K A;  3HHA A;  1ME4 A;  4MM3 B;  9PAP A;  1HUC B;  3BBA A;  1PXV A;  3TMP A;  2JRI A;  1NPZ A;  4QBB A;  2O6X A;  1NB3 A;  3V6C A;  4XZX A;  3IHP A;  1EWL A;  3PRP A;  2GFO A;  1YT7 A;  3D6S A;  4QRG A;  2YJB A;  3PHX A;  3WXE A;  4BOU A;  4X6J A;  2FRQ A;  2IBI A;  3OF8 A;  2XU3 A;  4FK5 A;  2NQD B;  4YYW A;  4I05 A;  3HD3 A;  4N8W A;  4MSX A;  3IEJ A;  3RVX A;  2DJG B;  4MZS A;  3BB7 A;  1CS8 A;  2PNS A;  1MHW A;  2R9F A;  3KWB X;  1A6R A;  1AYW A;  3S3R A;  1NQC A;  3OQC A;  4BS6 A;  5JA7 A;  4AXL A;  2DC8 A;  4BPV A;  5F02 A;  3BCN A;  3RNV A;  3MJ5 A;  2P7U A;  4MI7 A;  3K9M A;  1ATK A;  1YAL A;  4BOQ A;  2R9M A;  2AUX A;  2AGA A;  1F29 A;  1YVB A;  3O65 A;  2JQG R;  5EGW A;  1QMY A;  3CBK A;  4REZ A;  3S3Q A;  1AYU A;  1NL6 A;  4OVZ A;  4FIP A;  1QXP A;  4CDC B;  2R6N A;  2CB5 A;  3PT2 A;  1MIR A;  1EF7 A;  1TU6 A;  1VSN A;  4ZTB A;  3OVX A;  1S4V A;  1KFX L;  2FUD A;  1PVJ A;  1CB5 A;  3MHS A;  1PPP A;  3QJ3 A;  1SP4 B;  1U5I A;  4CDF B;  3PSE A;  3B79 A;  4D8E A;  3M99 A;  3PW3 A;  1PAD A;  3I3T A;  1VJV A;  2DCA A;  3N3G A;  1YK7 A;  2YJ2 A;  3IV2 A;  3PBH A;  1ZIV A;  3E1Z B;  4BOZ A;  3K24 A;  1AYV A;  3BC3 A;  1MDW A;  2BU3 A;  2AUZ A;  5CVN B;  3W31 A;  3MHH A;  2OP3 A;  2OUL A;  5CHV A;  1PPN A;  3GCB A;  4X6H A;  2FTD A;  3W30 A;  4M0W A;  1PIP A;  4AXM A;  1PPD A;  1POP A;  2PBH A;  4N4Z A;  4YYS A;  3IOQ A;  2DCC A;  1U9Q X;  4XUI A;  5JH3 A;  2DJF B;  4YYU A;  1AIM A;  6PAD A;  1KHP A;  2ACT A;  1EWO A;  3H8C A;  3B21 A;  3QSD A;  2AYO A;  2R9O A;  5FPW A;  4PP2 E;  2E00 A;  3H89 A;  3RVV A;  2JTC A; 
#chains in the Genus database with same CATH homology
 4PI3 A;  2E02 A;  4C5P A;  4W5B A;  1X9Y A;  3QT4 A;  2YJ9 A;  4W4U A;  2P86 A;  1BQI A;  4HWY A;  3P5U A;  5CVO B;  1ME3 A;  1F2B A;  3P5X A;  1U9X A;  1MEG A;  1Y08 A;  4YVA A;  1M6D A;  1TLO A;  2G8E A;  4B55 A;  3IUT A;  3OF9 A;  1DEU A;  8PCH A;  3PNR A;  3MOR A;  4YYR A;  1FH0 A;  3KKU A;  1K3B B;  4I07 A;  1AEC A;  1CJL A;  3BPM A;  1CVZ A;  2PAD A;  2AS8 A;  1E2T A;  1ICF A;  1BP4 A;  1EWM A;  4RY2 A;  2AU1 A;  3KW9 A;  4NV8 A;  3P5V A;  1AU3 A;  3DF0 A;  4DMX A;  2YJC A;  2NQA A;  1CPJ A;  2DCD A;  3O0U A;  5CHT A;  2WBF X;  4G54 A;  1CV8 A;  1STF E;  1IWD A;  1F2A A;  1AU2 A;  2HXZ A;  3C9E A;  3IMA A;  2AIM A;  1Q6K A;  1W4T A;  2FRA A;  1NB5 A;  4Q8H A;  4XR7 A;  2BDL A;  2P0R A;  3WXG A;  1Y4H A;  2BDZ A;  2ARY A;  3BOW A;  1JQP A;  1PCI A;  2B1M A;  3N4C A;  4P6G A;  7PCK A;  4BSQ A;  1GCB A;  1ZCM A;  3CBJ A;  2AVW A;  2E01 A;  2G7Y A;  1GLO A;  4YV8 A;  1GX3 A;  1BY8 A;  1AU0 A;  1F2C A;  1U9W A;  4YYV A;  3V6E A;  4PP1 A;  1DF0 A;  1KHQ A;  2PRE A;  1YK8 A;  2XU5 A;  3OVZ A;  1ITO A;  2IPP B;  1GEC E;  4QH6 A;  2ATO A;  2XU4 A;  4CDE B;  2DC7 A;  2Y6E A;  4PAD A;  1CSB B;  4Q8G A;  1QOL A;  2Y5B A;  1CQD A;  1BGO A;  1W5R A;  4OEL A;  3H8B A;  1O0E A;  3P5W A;  3MTN A;  4YYQ A;  1PBH A;  2F7D A;  3AI8 A;  4MZO A;  3I06 A;  2F1G A;  3NHE A;  3O1G A;  1SNK A;  5A24 A;  3KX1 A;  2HD5 A;  1KXR A;  2VFB A;  2G8J A;  5PAD A;  4ZUX U;  4X6I A;  1NLJ A;  2OZ2 A;  3OIS A;  2DC9 A;  2R9N A;  4CDD B;  3USV A;  2DZZ A;  3LFY A;  3TNX A;  2HHN A;  2G6D A;  5K16 A;  2YJ8 A;  4OEM A;  2VHS A;  3ERV A;  2FO5 A;  3BPF A;  2BSZ A;  2E03 A;  2FQ9 A;  2NQI A;  2FYE A;  4DMY A;  4P6E A;  1KFU L;  2VHF A;  3CH3 X;  4KLB A;  4W5C A;  1AU4 A;  1QDQ A;  4CZW A;  1EWP A;  4QRX A;  3LXS A;  3RVW A;  1XKG A;  3LTW A;  2XU1 A;  1TL9 A;  1GMY A;  3H6S A;  4N79 A;  1MEM A;  2B1N A;  4BQV A;  4FJC A;  2DCB A;  2GHU A;  3HHI A;  2NQG A;  2H7J A;  3U8E A;  1MS6 A;  3PDF A;  3HWN A;  1U9V A;  4NV7 A;  5J94 A;  3WXF A;  4K7C A;  2DC6 A;  3BWK A;  2R9C A;  3F75 A;  4GUZ A;  1PE6 A;  3H7D A;  2FT2 A;  4I04 A;  2C0Y A;  2HH5 A;  3KFQ A;  5CVM A;  1PPO A;  1THE A;  3K8U A;  3KWZ A;  2CIO A;  3D9W A;  4QRV A;  2DZY A;  2JQF R;  3F5V A;  4WA6 A;  3KSE A;  3CH2 X;  4BS5 A;  1CTE A;  3ZUA A;  2VFC A;  2AYN A;  5EF4 A;  3N3K A;  1ME4 A;  3HHA A;  9PAP A;  1HUC B;  1PXV A;  1NPZ A;  4QBB A;  2O6X A;  1NB3 A;  3V6C A;  3IHP A;  1EWL A;  2GFO A;  1YT7 A;  3D6S A;  4QRG A;  2YJB A;  3WXE A;  4X6J A;  2FRQ A;  2IBI A;  3OF8 A;  2XU3 A;  4FK5 A;  2NQD B;  4YYW A;  4I05 A;  3HD3 A;  4N8W A;  4MSX A;  3IEJ A;  3RVX A;  2DJG B;  4MZS A;  1CS8 A;  2PNS A;  1MHW A;  2R9F A;  3KWB X;  1A6R A;  1AYW A;  1NQC A;  4BS6 A;  5JA7 A;  4AXL A;  2DC8 A;  4BPV A;  5F02 A;  3BCN A;  2P7U A;  3K9M A;  1ATK A;  1YAL A;  2R9M A;  2AUX A;  1F29 A;  1YVB A;  2JQG R;  5EGW A;  1QMY A;  3CBK A;  3S3Q A;  1AYU A;  1NL6 A;  4FIP A;  1QXP A;  4CDC B;  2R6N A;  2CB5 A;  1MIR A;  1EF7 A;  1TU6 A;  1VSN A;  3OVX A;  1S4V A;  1KFX L;  2FUD A;  1CB5 A;  3MHS A;  1PPP A;  3QJ3 A;  1SP4 B;  1U5I A;  4CDF B;  3B79 A;  3M99 A;  3PW3 A;  1PAD A;  3I3T A;  1VJV A;  2DCA A;  3N3G A;  4BGF A;  1YK7 A;  2YJ2 A;  3IV2 A;  3PBH A;  1ZIV A;  3E1Z B;  3K24 A;  1AYV A;  3BC3 A;  1MDW A;  2AUZ A;  5CVN B;  3MHH A;  2OP3 A;  2OUL A;  5CHV A;  1PPN A;  3GCB A;  4X6H A;  2FTD A;  1PIP A;  4AXM A;  1PPD A;  1POP A;  2PBH A;  1W6F A;  4N4Z A;  4YYS A;  3IOQ A;  2DCC A;  1U9Q X;  4XUI A;  5JH3 A;  2DJF B;  4YYU A;  1AIM A;  6PAD A;  1KHP A;  2ACT A;  1EWO A;  3H8C A;  3QSD A;  2AYO A;  2R9O A;  5FPW A;  4PP2 E;  2E00 A;  3H89 A;  3RVV A;  3S3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...