5PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5padA00
1KFUL 2DJGB 4Q8GA 4N79A 4MSXA 3RVWA 2AYNA 3B79A 1AU3A 5CVMA 1EWPA 2IBIA 2AYOA 1ZIVA 1BGOA 2P0RA 2YJCA 1ICFA 2FO5A 3U8EA 3IUTA 3H7DA 3CBJA 2XU5A 2AU1A 1BQIA 1TLOA 3BCNA 5K16A 3H8BA 3O1GA 1S4VA 2CIOA 1PPOA 2FUDA 3WXGA 3BPMA 4WA6A 4QH6A 1GECE 2JQGR 2Y5BA 1NB3A 2G8EA 2GHUA 2DC6A 1F29A 2DCBA 2OZ2A 1Q6KA 3GCBA 5PADA 1POPA 3BPFA 1STFE 4P6GA 1F2AA 4CZWA 1PPNA 2BDLA 2HD5A 2JQFR 4X6HA 3KWZA 4PI3A 1YVBA 2AIMA 1NLJA 1NB5A 3QT4A 4MZSA 3OVZA 1PIPA 3H6SA 5JH3A 1NQCA 4FK5A 1HUCB 1BP4A 2G8JA 2XU3A 4Q8HA 5CVNB 4BPVA 3WXFA 1AYUA 4I04A 4G54A 5F02A 2YJBA 4BS5A 3HD3A 2HXZA 4CDCB 1EWOA 4K7CA 3PDFA 1PADA 1EF7A 1QDQA 3BWKA 3P5WA 3V6EA 3OVXA 2NQGA 5J94A 3F75A 3MHSA 2P86A 3BOWA 2IPPB 2DC8A 2PREA 3RVXA 2C0YA 3PBHA 1K3BB 1MEMA 3USVA 2XU1A 1NPZA 2AUXA 2ACTA 1YK8A 3MORA 3M99A 3K24A 2FYEA 1A6RA 2O6XA 2YJ8A 4FIPA 9PAPA 4AXLA 3MHHA 3N3GA 1YK7A 2OULA 3IHPA 2CB5A 1KHQA 3D6SA 2YJ9A 1U5IA 1TL9A 4YV8A 8PCHA 1U9QX 2PBHA 2DJFB 3V6CA 1AU2A 1SNKA 5CVOB 5A24A 3NHEA 4W5CA 2GFOA 3IMAA 1GMYA 2FQ9A 3N4CA 4I05A 1MEGA 1Y08A 1ZCMA 2B1MA 2G7YA 1KFXL 2P7UA 2VHSA 4YYRA 2R9NA 2Y6EA 1GLOA 4QRVA 3PNRA 1YALA 3MTNA 4W5BA 3CBKA 4BQVA 3PW3A 1CQDA 1AYWA 5CHTA 4YYWA 3CH2X 1CS8A 2R9CA 3KX1A 2DCCA 3K9MA 1PCIA 4QBBA 1O0EA 2HH5A 2XU4A 1KXRA 2ATOA 1AU0A 1FH0A 4W4UA 2DZYA 4MZOA 4QRXA 1PPPA 2E00A 4BS6A 2F1GA 4ZUXU 2B1NA 3I06A 3KSEA 4YVAA 1YT7A 7PCKA 3H89A 1SP4B 2HHNA 2NQAA 1PBHA 2AUZA 4OEMA 3K8UA 2NQIA 2FT2A 4YYVA 1PPDA 3QJ3A 1VJVA 2PNSA 1QMYA 4I07A 1M6DA 3KKUA 1MDWA 2R6NA 1MHWA 1GCBA 4CDEB 2YJ2A 3OISA 2DC7A 2E02A 3HWNA 4PADA 4QRGA 4RY2A 4CDFB 4X6JA 1VSNA 5JA7A 3CH3X 3HHAA 1CV8A 1ME4A 2VHFA 3O0UA 2H7JA 5EF4A 3HHIA 1CVZA 4FJCA 1KHPA 1Y4HA 4BSQA 1BY8A 1ME3A 1ITOA 1AYVA 2FRQA 2R9FA 3LXSA 1ATKA 6PADA 3KW9A 3OF9A 3P5VA 1EWLA 3IOQA 1F2BA 3AI8A 1JQPA 1CSBB 3S3RA 3IV2A 1CB5A 3F5VA 4P6EA 3WXEA 4CDDB 1MIRA 3E1ZB 2NQDB 4HWYA 2E03A 1CJLA 4YYSA 2OP3A 2AVWA 3ZUAA 2DCAA 4DMXA 3TNXA 4XUIA 4YYQA 2E01A 4KLBA 3C9EA 1CPJA 2R9OA 2G6DA 1DEUA 4N4ZA 2PADA 3P5UA 1CTEA 3ERVA 1F2CA 4X6IA 1DF0A 1PXVA 1AIMA 5FPWA 3I3TA 3DF0A 1THEA 1PE6A 3S3QA 3BC3A 2F7DA 5EGWA 1NL6A 3QSDA 4PP2E 1U9WA 3N3KA 2BDZA 1XKGA 3LFYA 4PP1A 1X9YA 4AXMA 5CHVA 3OF8A 2ARYA 1QOLA 2WBFX 2DC9A 3H8CA 1TU6A 3P5XA 2DZZA 1QXPA 1U9XA 1IWDA 4XR7A 1AU4A 3KWBX 1U9VA 2DCDA 1MS6A 1AECA 2FRAA 3RVVA 1EWMA 2FTDA 4N8WA 3KFQA 4OELA 2AS8A 4DMYA 4YYUA 3IEJA 2R9MA
chains in the Genus database with same CATH superfamily
1KFUL 2DJGB 4Q8GA 4N79A 4MSXA 3RVWA 2AYNA 3B79A 1AU3A 5CVMA 1EWPA 2IBIA 2AYOA 1ZIVA 1BGOA 2P0RA 2YJCA 1ICFA 2FO5A 3U8EA 3IUTA 3H7DA 3CBJA 2XU5A 2AU1A 4MI7A 1BQIA 1TLOA 3BCNA 5K16A 5KO3A 3H8BA 3O1GA 1S4VA 2CIOA 1PPOA 2FUDA 4GUAA 3WXGA 3BPMA 4WA6A 4QH6A 1GECE 2JQGR 2Y5BA 1NB3A 2G8EA 2GHUA 2DC6A 4RF0A 1F29A 2DCBA 2OZ2A 1Q6KA 3GCBA 5PADA 1POPA 3W30A 3BPFA 1STFE 4P6GA 4D8BA 1F2AA 3PRMA 4CZWA 1PPNA 2BDLA 2HD5A 2JQFR 4X6HA 3KWZA 4PI3A 1YVBA 2AIMA 1NLJA 3RNVA 1NB5A 3QT4A 4MZSA 3OVZA 1PIPA 3H6SA 4RF1A 5JH3A 1NQCA 1YZBA 4FK5A 1HUCB 1BP4A 2G8JA 2XU3A 4Q8HA 4ZTBA 5CVNB 3O65A 4BPVA 3WXFA 1AYUA 4I04A 4G54A 5F02A 2YJBA 4BS5A 3HD3A 2HXZA 4CDCB 1EWOA 4K7CA 4BOSA 3PDFA 1PADA 1EF7A 1QDQA 3BWKA 3P5WA 3V6EA 3OVXA 2NQGA 5J94A 4A5UA 3F75A 3MHSA 2P86A 2HWKA 3BOWA 2IPPB 2DC8A 2PREA 3RVXA 2C0YA 3PBHA 1K3BB 1MEMA 2JTCA 3USVA 2XU1A 1NPZA 2AUXA 2ACTA 1YK8A 3MORA 3M99A 3K24A 2FYEA 1A6RA 2O6XA 2YJ8A 4FIPA 3B21A 3BY4A 9PAPA 4AXLA 3MHHA 3N3GA 1YK7A 2OULA 3IHPA 4BOUA 2CB5A 1KHQA 3D6SA 2YJ9A 1U5IA 1TL9A 5E6JA 4YV8A 8PCHA 1U9QX 3PHUA 2PBHA 4P16A 3PHXA 2DJFB 3V6CA 1AU2A 1SNKA 5CVOB 5A24A 3NHEA 4W5CA 2GFOA 3IMAA 5JZEA 1GMYA 2FQ9A 3N4CA 3C0RA 4I05A 1MEGA 1Y08A 1ZCMA 5EZSA 2B1MA 2G7YA 1KFXL 2P7UA 2VHSA 4YYRA 2R9NA 2Y6EA 1GLOA 4QRVA 3PNRA 1YALA 3MTNA 4W5BA 3CBKA 4BQVA 3PW3A 1CQDA 1AYWA 5CHTA 3ZNHA 4YYWA 3CH2X 1CS8A 2R9CA 3KX1A 2DCCA 3K9MA 1PCIA 4QBBA 3BBAA 1O0EA 2HH5A 2XU4A 1KXRA 2ATOA 1AU0A 1FH0A 4W4UA 2DZYA 4IUMA 4D8IA 3W31A 4MZOA 4QRXA 2DOSA 1PPPA 2E00A 5EZQA 4BS6A 2F1GA 4XZXA 4ZUXU 2B1NA 3I06A 3KSEA 4BOZA 4YVAA 4R3DA 1YT7A 4REZA 7PCKA 3H89A 1SP4B 2HHNA 2NQAA 1PBHA 4M0WA 2AUZA 4OEMA 3K8UA 4D8EA 2NQIA 4PT5A 2FT2A 4YYVA 2BTWA 1PPDA 3QJ3A 1VJVA 2PNSA 1QMYA 4RNAA 2AGAA 4I07A 1PVJA 1M6DA 3KKUA 1MDWA 2R6NA 3PSEA 3IFUA 1MHWA 1GCBA 2BU3A 4HXDB 3TRKA 4CDEB 2J7QA 2YJ2A 1DKIA 3OISA 4BOQA 2DC7A 2E02A 3HWNA 4PADA 4QRGA 4RY2A 4CDFB 4X6JA 3MP2A 1VSNA 3PT2A 4OVZB 5JA7A 3MTVA 4MM3B 3CH3X 3HHAA 1CV8A 3PHWA 1ME4A 2VHFA 3O0UA 4BOPA 3E9SA 2H7JA 5EF4A 3HHIA 2J7QC 1CVZA 4FJCA 1KHPA 1Y4HA 4BSQA 1BY8A 1ME3A 1ITOA 1AYVA 2FRQA 2R9FA 3LXSA 1ATKA 6PADA 3KW9A 3OF9A 3P5VA 1EWLA 3IOQA 1F2BA 3AI8A 1JQPA 1CSBB 3S3RA 3IV2A 1CB5A 3F5VA 4P6EA 3WXEA 4CDDB 1MIRA 3E1ZB 2NQDB 4HWYA 2E03A 1CJLA 4YYSA 2OP3A 2AVWA 3ZUAA 2FE8A 2DCAA 3TMPA 4DMXA 3TNXA 4XUIA 4YYQA 2E01A 4OVZA 4WURA 4RKXA 4KLBA 3C9EA 1CPJA 2R9OA 2G6DA 1DEUA 4N4ZA 2PADA 3P5UA 1CTEA 3ERVA 1F2CA 4OW0A 4X6IA 1DF0A 1PXVA 1AIMA 1UKFA 5FPWA 3I3TA 3DF0A 3MJ5A 1THEA 1PE6A 3S3QA 2JRIA 3BC3A 2F7DA 5EGWA 1NL6A 3QSDA 4IP3A 4PP2E 1U9WA 3N3KA 2BDZA 1XKGA 3LFYA 3BB7A 4PP1A 1X9YA 4AXMA 5CHVA 2UZJA 3OF8A 2ARYA 1QOLA 2WBFX 2BTWB 2DC9A 3H8CA 1TU6A 3P5XA 2DZZA 1QXPA 1U9XA 3PRPA 1IWDA 4XR7A 1AU4A 3KWBX 1U9VA 2DCDA 1MS6A 3OQCA 1AECA 2FRAA 3RVVA 1EWMA 2FTDA 4N8WA 3KFQA 4OELA 2Z84A 2AS8A 4DMYA 4YYUA 3IEJA 2R9MA
chains in the Genus database with same CATH topology
1KFUL 2DJGB 4Q8GA 4N79A 4MSXA 3RVWA 2AYNA 3B79A 1AU3A 5CVMA 1EWPA 2IBIA 2AYOA 1ZIVA 1BGOA 2P0RA 2YJCA 4C5PA 1ICFA 2FO5A 3U8EA 3IUTA 3H7DA 3CBJA 2XU5A 2AU1A 1BQIA 1TLOA 3BCNA 5K16A 3H8BA 3O1GA 1S4VA 2CIOA 1PPOA 2FUDA 3WXGA 3BPMA 4WA6A 4QH6A 1W5RA 1GECE 2JQGR 2Y5BA 1NB3A 2G8EA 2GHUA 2DC6A 1F29A 2DCBA 2OZ2A 1Q6KA 3GCBA 5PADA 1POPA 3BPFA 1STFE 4P6GA 1F2AA 4CZWA 1PPNA 2BDLA 2HD5A 2JQFR 4X6HA 3KWZA 4PI3A 1YVBA 2AIMA 1NLJA 1NB5A 3QT4A 4MZSA 3OVZA 1PIPA 3H6SA 5JH3A 1NQCA 4FK5A 1HUCB 1BP4A 2G8JA 2XU3A 4Q8HA 5CVNB 4BPVA 3WXFA 1AYUA 4I04A 4G54A 2VFBA 5F02A 2YJBA 4BS5A 3HD3A 2HXZA 4CDCB 1EWOA 4K7CA 3PDFA 1PADA 1EF7A 4GUZA 1QDQA 3BWKA 3P5WA 3V6EA 3OVXA 2NQGA 5J94A 3F75A 3MHSA 2P86A 3BOWA 2IPPB 2DC8A 2PREA 3RVXA 2C0YA 3PBHA 1K3BB 1MEMA 3USVA 2XU1A 1NPZA 2AUXA 2ACTA 1YK8A 3MORA 3M99A 3K24A 2FYEA 1A6RA 2O6XA 2YJ8A 4FIPA 9PAPA 4AXLA 3MHHA 3N3GA 1YK7A 2OULA 3IHPA 2CB5A 1KHQA 3D6SA 2YJ9A 1U5IA 1TL9A 4YV8A 8PCHA 1U9QX 2PBHA 2DJFB 3V6CA 1AU2A 1SNKA 5CVOB 5A24A 3D9WA 3NHEA 4W5CA 2GFOA 1E2TA 3IMAA 1GMYA 2FQ9A 3N4CA 4I05A 1MEGA 1Y08A 1ZCMA 2B1MA 2G7YA 1KFXL 2P7UA 2VHSA 4NV7A 2R9NA 4YYRA 2Y6EA 1GLOA 4QRVA 3PNRA 1YALA 3MTNA 4W5BA 3CBKA 4BQVA 3PW3A 1CQDA 1AYWA 5CHTA 4YYWA 3CH2X 1CS8A 2R9CA 3KX1A 2DCCA 3K9MA 1PCIA 4QBBA 1O0EA 2HH5A 2XU4A 1KXRA 2ATOA 1AU0A 1FH0A 4W4UA 2DZYA 4MZOA 4QRXA 1PPPA 2E00A 4BS6A 2F1GA 4ZUXU 2B1NA 3I06A 3KSEA 4YVAA 1YT7A 7PCKA 3H89A 1SP4B 2HHNA 2NQAA 1PBHA 2AUZA 4OEMA 3K8UA 2NQIA 2FT2A 4YYVA 1PPDA 3QJ3A 1VJVA 2PNSA 1QMYA 4I07A 1M6DA 3KKUA 1MDWA 2R6NA 1MHWA 1GCBA 4CDEB 2YJ2A 1W4TA 3OISA 2DC7A 2E02A 3HWNA 4PADA 4QRGA 4RY2A 4CDFB 4X6JA 1VSNA 5JA7A 3CH3X 3HHAA 1CV8A 1ME4A 2VHFA 3O0UA 2H7JA 5EF4A 3HHIA 1CVZA 4FJCA 1KHPA 1Y4HA 4BSQA 1BY8A 1ME3A 1ITOA 1AYVA 2FRQA 2R9FA 3LXSA 1GX3A 1ATKA 6PADA 3KW9A 3OF9A 3P5VA 1EWLA 3IOQA 1F2BA 3AI8A 1JQPA 3LTWA 1CSBB 3S3RA 3IV2A 1CB5A 3F5VA 4P6EA 3WXEA 4CDDB 1MIRA 3E1ZB 2NQDB 4HWYA 2E03A 1CJLA 4YYSA 2OP3A 2AVWA 3ZUAA 2DCAA 1W6FA 4DMXA 3TNXA 4XUIA 4YYQA 2E01A 4NV8A 4KLBA 4BGFA 3C9EA 1CPJA 2R9OA 2G6DA 1DEUA 4N4ZA 2PADA 3P5UA 1CTEA 3ERVA 1F2CA 4X6IA 1DF0A 1PXVA 1AIMA 5FPWA 3I3TA 3DF0A 1THEA 1PE6A 3S3QA 3BC3A 2F7DA 4B55A 5EGWA 1NL6A 3QSDA 4PP2E 1U9WA 3N3KA 2BDZA 1XKGA 3LFYA 4PP1A 1X9YA 4AXMA 2VFCA 5CHVA 3OF8A 2ARYA 1QOLA 2WBFX 2DC9A 3H8CA 1TU6A 3P5XA 2DZZA 1QXPA 1U9XA 1IWDA 4XR7A 1AU4A 3KWBX 1U9VA 2BSZA 2DCDA 1MS6A 1AECA 2FRAA 3RVVA 1EWMA 2FTDA 4N8WA 3KFQA 4OELA 2AS8A 4DMYA 4YYUA 3IEJA 2R9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFU L;  2DJG B;  4Q8G A;  4N79 A;  4MSX A;  3RVW A;  2AYN A;  3B79 A;  1AU3 A;  5CVM A;  1EWP A;  2IBI A;  2AYO A;  1ZIV A;  1BGO A;  2P0R A;  2YJC A;  1ICF A;  2FO5 A;  3U8E A;  3IUT A;  3H7D A;  3CBJ A;  2XU5 A;  2AU1 A;  1BQI A;  1TLO A;  3BCN A;  5K16 A;  3H8B A;  3O1G A;  1S4V A;  2CIO A;  1PPO A;  2FUD A;  3WXG A;  3BPM A;  4WA6 A;  4QH6 A;  1GEC E;  2JQG R;  2Y5B A;  1NB3 A;  2G8E A;  2GHU A;  2DC6 A;  1F29 A;  2DCB A;  2OZ2 A;  1Q6K A;  3GCB A;  5PAD A;  1POP A;  3BPF A;  1STF E;  4P6G A;  1F2A A;  4CZW A;  1PPN A;  2BDL A;  2HD5 A;  2JQF R;  4X6H A;  3KWZ A;  4PI3 A;  1YVB A;  2AIM A;  1NLJ A;  1NB5 A;  3QT4 A;  4MZS A;  3OVZ A;  1PIP A;  3H6S A;  5JH3 A;  1NQC A;  4FK5 A;  1HUC B;  1BP4 A;  2G8J A;  2XU3 A;  4Q8H A;  5CVN B;  4BPV A;  3WXF A;  1AYU A;  4I04 A;  4G54 A;  5F02 A;  2YJB A;  4BS5 A;  3HD3 A;  2HXZ A;  4CDC B;  1EWO A;  4K7C A;  3PDF A;  1PAD A;  1EF7 A;  1QDQ A;  3BWK A;  3P5W A;  3V6E A;  3OVX A;  2NQG A;  5J94 A;  3F75 A;  3MHS A;  2P86 A;  3BOW A;  2IPP B;  2DC8 A;  2PRE A;  3RVX A;  2C0Y A;  3PBH A;  1K3B B;  1MEM A;  3USV A;  2XU1 A;  1NPZ A;  2AUX A;  2ACT A;  1YK8 A;  3MOR A;  3M99 A;  3K24 A;  2FYE A;  1A6R A;  2O6X A;  2YJ8 A;  4FIP A;  9PAP A;  4AXL A;  3MHH A;  3N3G A;  1YK7 A;  2OUL A;  3IHP A;  2CB5 A;  1KHQ A;  3D6S A;  2YJ9 A;  1U5I A;  1TL9 A;  4YV8 A;  8PCH A;  1U9Q X;  2PBH A;  2DJF B;  3V6C A;  1AU2 A;  1SNK A;  5CVO B;  5A24 A;  3NHE A;  4W5C A;  2GFO A;  3IMA A;  1GMY A;  2FQ9 A;  3N4C A;  4I05 A;  1MEG A;  1Y08 A;  1ZCM A;  2B1M A;  2G7Y A;  1KFX L;  2P7U A;  2VHS A;  4YYR A;  2R9N A;  2Y6E A;  1GLO A;  4QRV A;  3PNR A;  1YAL A;  3MTN A;  4W5B A;  3CBK A;  4BQV A;  3PW3 A;  1CQD A;  1AYW A;  5CHT A;  4YYW A;  3CH2 X;  1CS8 A;  2R9C A;  3KX1 A;  2DCC A;  3K9M A;  1PCI A;  4QBB A;  1O0E A;  2HH5 A;  2XU4 A;  1KXR A;  2ATO A;  1AU0 A;  1FH0 A;  4W4U A;  2DZY A;  4MZO A;  4QRX A;  1PPP A;  2E00 A;  4BS6 A;  2F1G A;  4ZUX U;  2B1N A;  3I06 A;  3KSE A;  4YVA A;  1YT7 A;  7PCK A;  3H89 A;  1SP4 B;  2HHN A;  2NQA A;  1PBH A;  2AUZ A;  4OEM A;  3K8U A;  2NQI A;  2FT2 A;  4YYV A;  1PPD A;  3QJ3 A;  1VJV A;  2PNS A;  1QMY A;  4I07 A;  1M6D A;  3KKU A;  1MDW A;  2R6N A;  1MHW A;  1GCB A;  4CDE B;  2YJ2 A;  3OIS A;  2DC7 A;  2E02 A;  3HWN A;  4PAD A;  4QRG A;  4RY2 A;  4CDF B;  4X6J A;  1VSN A;  5JA7 A;  3CH3 X;  3HHA A;  1CV8 A;  1ME4 A;  2VHF A;  3O0U A;  2H7J A;  5EF4 A;  3HHI A;  1CVZ A;  4FJC A;  1KHP A;  1Y4H A;  4BSQ A;  1BY8 A;  1ME3 A;  1ITO A;  1AYV A;  2FRQ A;  2R9F A;  3LXS A;  1ATK A;  6PAD A;  3KW9 A;  3OF9 A;  3P5V A;  1EWL A;  3IOQ A;  1F2B A;  3AI8 A;  1JQP A;  1CSB B;  3S3R A;  3IV2 A;  1CB5 A;  3F5V A;  4P6E A;  3WXE A;  4CDD B;  1MIR A;  3E1Z B;  2NQD B;  4HWY A;  2E03 A;  1CJL A;  4YYS A;  2OP3 A;  2AVW A;  3ZUA A;  2DCA A;  4DMX A;  3TNX A;  4XUI A;  4YYQ A;  2E01 A;  4KLB A;  3C9E A;  1CPJ A;  2R9O A;  2G6D A;  1DEU A;  4N4Z A;  2PAD A;  3P5U A;  1CTE A;  3ERV A;  1F2C A;  4X6I A;  1DF0 A;  1PXV A;  1AIM A;  5FPW A;  3I3T A;  3DF0 A;  1THE A;  1PE6 A;  3S3Q A;  3BC3 A;  2F7D A;  5EGW A;  1NL6 A;  3QSD A;  4PP2 E;  1U9W A;  3N3K A;  2BDZ A;  1XKG A;  3LFY A;  4PP1 A;  1X9Y A;  4AXM A;  5CHV A;  3OF8 A;  2ARY A;  1QOL A;  2WBF X;  2DC9 A;  3H8C A;  1TU6 A;  3P5X A;  2DZZ A;  1QXP A;  1U9X A;  1IWD A;  4XR7 A;  1AU4 A;  3KWB X;  1U9V A;  2DCD A;  1MS6 A;  1AEC A;  2FRA A;  3RVV A;  1EWM A;  2FTD A;  4N8W A;  3KFQ A;  4OEL A;  2AS8 A;  4DMY A;  4YYU A;  3IEJ A;  2R9M A; 
#chains in the Genus database with same CATH topology
 1KFU L;  2DJG B;  4Q8G A;  4N79 A;  4MSX A;  3RVW A;  2AYN A;  3B79 A;  1AU3 A;  5CVM A;  1EWP A;  2IBI A;  2AYO A;  1ZIV A;  1BGO A;  2P0R A;  2YJC A;  1ICF A;  2FO5 A;  3U8E A;  3IUT A;  3H7D A;  3CBJ A;  2XU5 A;  2AU1 A;  4MI7 A;  1BQI A;  1TLO A;  3BCN A;  5K16 A;  5KO3 A;  3H8B A;  3O1G A;  1S4V A;  2CIO A;  1PPO A;  2FUD A;  4GUA A;  3WXG A;  3BPM A;  4WA6 A;  4QH6 A;  1GEC E;  2JQG R;  2Y5B A;  1NB3 A;  2G8E A;  2GHU A;  2DC6 A;  4RF0 A;  1F29 A;  2DCB A;  2OZ2 A;  1Q6K A;  3GCB A;  5PAD A;  1POP A;  3W30 A;  3BPF A;  1STF E;  4P6G A;  4D8B A;  1F2A A;  3PRM A;  4CZW A;  1PPN A;  2BDL A;  2HD5 A;  2JQF R;  4X6H A;  3KWZ A;  4PI3 A;  1YVB A;  2AIM A;  1NLJ A;  3RNV A;  1NB5 A;  3QT4 A;  4MZS A;  3OVZ A;  1PIP A;  3H6S A;  4RF1 A;  5JH3 A;  1NQC A;  1YZB A;  4FK5 A;  1HUC B;  1BP4 A;  2G8J A;  2XU3 A;  4Q8H A;  4ZTB A;  5CVN B;  3O65 A;  4BPV A;  3WXF A;  1AYU A;  4I04 A;  4G54 A;  5F02 A;  2YJB A;  4BS5 A;  3HD3 A;  2HXZ A;  4CDC B;  1EWO A;  4K7C A;  4BOS A;  3PDF A;  1PAD A;  1EF7 A;  1QDQ A;  3BWK A;  3P5W A;  3V6E A;  3OVX A;  2NQG A;  5J94 A;  4A5U A;  3F75 A;  3MHS A;  2P86 A;  2HWK A;  3BOW A;  2IPP B;  2DC8 A;  2PRE A;  3RVX A;  2C0Y A;  3PBH A;  1K3B B;  1MEM A;  2JTC A;  3USV A;  2XU1 A;  1NPZ A;  2AUX A;  2ACT A;  1YK8 A;  3MOR A;  3M99 A;  3K24 A;  2FYE A;  1A6R A;  2O6X A;  2YJ8 A;  4FIP A;  3B21 A;  3BY4 A;  9PAP A;  4AXL A;  3MHH A;  3N3G A;  1YK7 A;  2OUL A;  3IHP A;  4BOU A;  2CB5 A;  1KHQ A;  3D6S A;  2YJ9 A;  1U5I A;  1TL9 A;  5E6J A;  4YV8 A;  8PCH A;  1U9Q X;  3PHU A;  2PBH A;  4P16 A;  3PHX A;  2DJF B;  3V6C A;  1AU2 A;  1SNK A;  5CVO B;  5A24 A;  3NHE A;  4W5C A;  2GFO A;  3IMA A;  5JZE A;  1GMY A;  2FQ9 A;  3N4C A;  3C0R A;  4I05 A;  1MEG A;  1Y08 A;  1ZCM A;  5EZS A;  2B1M A;  2G7Y A;  1KFX L;  2P7U A;  2VHS A;  4YYR A;  2R9N A;  2Y6E A;  1GLO A;  4QRV A;  3PNR A;  1YAL A;  3MTN A;  4W5B A;  3CBK A;  4BQV A;  3PW3 A;  1CQD A;  1AYW A;  5CHT A;  3ZNH A;  4YYW A;  3CH2 X;  1CS8 A;  2R9C A;  3KX1 A;  2DCC A;  3K9M A;  1PCI A;  4QBB A;  3BBA A;  1O0E A;  2HH5 A;  2XU4 A;  1KXR A;  2ATO A;  1AU0 A;  1FH0 A;  4W4U A;  2DZY A;  4IUM A;  4D8I A;  3W31 A;  4MZO A;  4QRX A;  2DOS A;  1PPP A;  2E00 A;  5EZQ A;  4BS6 A;  2F1G A;  4XZX A;  4ZUX U;  2B1N A;  3I06 A;  3KSE A;  4BOZ A;  4YVA A;  4R3D A;  1YT7 A;  4REZ A;  7PCK A;  3H89 A;  1SP4 B;  2HHN A;  2NQA A;  1PBH A;  4M0W A;  2AUZ A;  4OEM A;  3K8U A;  4D8E A;  2NQI A;  4PT5 A;  2FT2 A;  4YYV A;  2BTW A;  1PPD A;  3QJ3 A;  1VJV A;  2PNS A;  1QMY A;  4RNA A;  2AGA A;  4I07 A;  1PVJ A;  1M6D A;  3KKU A;  1MDW A;  2R6N A;  3PSE A;  3IFU A;  1MHW A;  1GCB A;  2BU3 A;  4HXD B;  3TRK A;  4CDE B;  2J7Q A;  2YJ2 A;  1DKI A;  3OIS A;  4BOQ A;  2DC7 A;  2E02 A;  3HWN A;  4PAD A;  4QRG A;  4RY2 A;  4CDF B;  4X6J A;  3MP2 A;  1VSN A;  3PT2 A;  4OVZ B;  5JA7 A;  3MTV A;  4MM3 B;  3CH3 X;  3HHA A;  1CV8 A;  3PHW A;  1ME4 A;  2VHF A;  3O0U A;  4BOP A;  3E9S A;  2H7J A;  5EF4 A;  3HHI A;  2J7Q C;  1CVZ A;  4FJC A;  1KHP A;  1Y4H A;  4BSQ A;  1BY8 A;  1ME3 A;  1ITO A;  1AYV A;  2FRQ A;  2R9F A;  3LXS A;  1ATK A;  6PAD A;  3KW9 A;  3OF9 A;  3P5V A;  1EWL A;  3IOQ A;  1F2B A;  3AI8 A;  1JQP A;  1CSB B;  3S3R A;  3IV2 A;  1CB5 A;  3F5V A;  4P6E A;  3WXE A;  4CDD B;  1MIR A;  3E1Z B;  2NQD B;  4HWY A;  2E03 A;  1CJL A;  4YYS A;  2OP3 A;  2AVW A;  3ZUA A;  2FE8 A;  2DCA A;  3TMP A;  4DMX A;  3TNX A;  4XUI A;  4YYQ A;  2E01 A;  4OVZ A;  4WUR A;  4RKX A;  4KLB A;  3C9E A;  1CPJ A;  2R9O A;  2G6D A;  1DEU A;  4N4Z A;  2PAD A;  3P5U A;  1CTE A;  3ERV A;  1F2C A;  4OW0 A;  4X6I A;  1DF0 A;  1PXV A;  1AIM A;  1UKF A;  5FPW A;  3I3T A;  3DF0 A;  3MJ5 A;  1THE A;  1PE6 A;  3S3Q A;  2JRI A;  3BC3 A;  2F7D A;  5EGW A;  1NL6 A;  3QSD A;  4IP3 A;  4PP2 E;  1U9W A;  3N3K A;  2BDZ A;  1XKG A;  3LFY A;  3BB7 A;  4PP1 A;  1X9Y A;  4AXM A;  5CHV A;  2UZJ A;  3OF8 A;  2ARY A;  1QOL A;  2WBF X;  2BTW B;  2DC9 A;  3H8C A;  1TU6 A;  3P5X A;  2DZZ A;  1QXP A;  1U9X A;  3PRP A;  1IWD A;  4XR7 A;  1AU4 A;  3KWB X;  1U9V A;  2DCD A;  1MS6 A;  3OQC A;  1AEC A;  2FRA A;  3RVV A;  1EWM A;  2FTD A;  4N8W A;  3KFQ A;  4OEL A;  2Z84 A;  2AS8 A;  4DMY A;  4YYU A;  3IEJ A;  2R9M A; 
#chains in the Genus database with same CATH homology
 1KFU L;  2DJG B;  4Q8G A;  4N79 A;  4MSX A;  3RVW A;  2AYN A;  3B79 A;  1AU3 A;  5CVM A;  1EWP A;  2IBI A;  2AYO A;  1ZIV A;  1BGO A;  2P0R A;  2YJC A;  4C5P A;  1ICF A;  2FO5 A;  3U8E A;  3IUT A;  3H7D A;  3CBJ A;  2XU5 A;  2AU1 A;  1BQI A;  1TLO A;  3BCN A;  5K16 A;  3H8B A;  3O1G A;  1S4V A;  2CIO A;  1PPO A;  2FUD A;  3WXG A;  3BPM A;  4WA6 A;  4QH6 A;  1W5R A;  1GEC E;  2JQG R;  2Y5B A;  1NB3 A;  2G8E A;  2GHU A;  2DC6 A;  1F29 A;  2DCB A;  2OZ2 A;  1Q6K A;  3GCB A;  5PAD A;  1POP A;  3BPF A;  1STF E;  4P6G A;  1F2A A;  4CZW A;  1PPN A;  2BDL A;  2HD5 A;  2JQF R;  4X6H A;  3KWZ A;  4PI3 A;  1YVB A;  2AIM A;  1NLJ A;  1NB5 A;  3QT4 A;  4MZS A;  3OVZ A;  1PIP A;  3H6S A;  5JH3 A;  1NQC A;  4FK5 A;  1HUC B;  1BP4 A;  2G8J A;  2XU3 A;  4Q8H A;  5CVN B;  4BPV A;  3WXF A;  1AYU A;  4I04 A;  4G54 A;  2VFB A;  5F02 A;  2YJB A;  4BS5 A;  3HD3 A;  2HXZ A;  4CDC B;  1EWO A;  4K7C A;  3PDF A;  1PAD A;  1EF7 A;  4GUZ A;  1QDQ A;  3BWK A;  3P5W A;  3V6E A;  3OVX A;  2NQG A;  5J94 A;  3F75 A;  3MHS A;  2P86 A;  3BOW A;  2IPP B;  2DC8 A;  2PRE A;  3RVX A;  2C0Y A;  3PBH A;  1K3B B;  1MEM A;  3USV A;  2XU1 A;  1NPZ A;  2AUX A;  2ACT A;  1YK8 A;  3MOR A;  3M99 A;  3K24 A;  2FYE A;  1A6R A;  2O6X A;  2YJ8 A;  4FIP A;  9PAP A;  4AXL A;  3MHH A;  3N3G A;  1YK7 A;  2OUL A;  3IHP A;  2CB5 A;  1KHQ A;  3D6S A;  2YJ9 A;  1U5I A;  1TL9 A;  4YV8 A;  8PCH A;  1U9Q X;  2PBH A;  2DJF B;  3V6C A;  1AU2 A;  1SNK A;  5CVO B;  5A24 A;  3D9W A;  3NHE A;  4W5C A;  2GFO A;  1E2T A;  3IMA A;  1GMY A;  2FQ9 A;  3N4C A;  4I05 A;  1MEG A;  1Y08 A;  1ZCM A;  2B1M A;  2G7Y A;  1KFX L;  2P7U A;  2VHS A;  4NV7 A;  2R9N A;  4YYR A;  2Y6E A;  1GLO A;  4QRV A;  3PNR A;  1YAL A;  3MTN A;  4W5B A;  3CBK A;  4BQV A;  3PW3 A;  1CQD A;  1AYW A;  5CHT A;  4YYW A;  3CH2 X;  1CS8 A;  2R9C A;  3KX1 A;  2DCC A;  3K9M A;  1PCI A;  4QBB A;  1O0E A;  2HH5 A;  2XU4 A;  1KXR A;  2ATO A;  1AU0 A;  1FH0 A;  4W4U A;  2DZY A;  4MZO A;  4QRX A;  1PPP A;  2E00 A;  4BS6 A;  2F1G A;  4ZUX U;  2B1N A;  3I06 A;  3KSE A;  4YVA A;  1YT7 A;  7PCK A;  3H89 A;  1SP4 B;  2HHN A;  2NQA A;  1PBH A;  2AUZ A;  4OEM A;  3K8U A;  2NQI A;  2FT2 A;  4YYV A;  1PPD A;  3QJ3 A;  1VJV A;  2PNS A;  1QMY A;  4I07 A;  1M6D A;  3KKU A;  1MDW A;  2R6N A;  1MHW A;  1GCB A;  4CDE B;  2YJ2 A;  1W4T A;  3OIS A;  2DC7 A;  2E02 A;  3HWN A;  4PAD A;  4QRG A;  4RY2 A;  4CDF B;  4X6J A;  1VSN A;  5JA7 A;  3CH3 X;  3HHA A;  1CV8 A;  1ME4 A;  2VHF A;  3O0U A;  2H7J A;  5EF4 A;  3HHI A;  1CVZ A;  4FJC A;  1KHP A;  1Y4H A;  4BSQ A;  1BY8 A;  1ME3 A;  1ITO A;  1AYV A;  2FRQ A;  2R9F A;  3LXS A;  1GX3 A;  1ATK A;  6PAD A;  3KW9 A;  3OF9 A;  3P5V A;  1EWL A;  3IOQ A;  1F2B A;  3AI8 A;  1JQP A;  3LTW A;  1CSB B;  3S3R A;  3IV2 A;  1CB5 A;  3F5V A;  4P6E A;  3WXE A;  4CDD B;  1MIR A;  3E1Z B;  2NQD B;  4HWY A;  2E03 A;  1CJL A;  4YYS A;  2OP3 A;  2AVW A;  3ZUA A;  2DCA A;  1W6F A;  4DMX A;  3TNX A;  4XUI A;  4YYQ A;  2E01 A;  4NV8 A;  4KLB A;  4BGF A;  3C9E A;  1CPJ A;  2R9O A;  2G6D A;  1DEU A;  4N4Z A;  2PAD A;  3P5U A;  1CTE A;  3ERV A;  1F2C A;  4X6I A;  1DF0 A;  1PXV A;  1AIM A;  5FPW A;  3I3T A;  3DF0 A;  1THE A;  1PE6 A;  3S3Q A;  3BC3 A;  2F7D A;  4B55 A;  5EGW A;  1NL6 A;  3QSD A;  4PP2 E;  1U9W A;  3N3K A;  2BDZ A;  1XKG A;  3LFY A;  4PP1 A;  1X9Y A;  4AXM A;  2VFC A;  5CHV A;  3OF8 A;  2ARY A;  1QOL A;  2WBF X;  2DC9 A;  3H8C A;  1TU6 A;  3P5X A;  2DZZ A;  1QXP A;  1U9X A;  1IWD A;  4XR7 A;  1AU4 A;  3KWB X;  1U9V A;  2BSZ A;  2DCD A;  1MS6 A;  1AEC A;  2FRA A;  3RVV A;  1EWM A;  2FTD A;  4N8W A;  3KFQ A;  4OEL A;  2AS8 A;  4DMY A;  4YYU A;  3IEJ A;  2R9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...