5PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5padA00
1VJVA 2G8EA 1U9VA 2GHUA 4HWYA 4QRGA 3KWBX 2O6XA 1PPNA 4P6GA 5CVOB 1AU2A 2FQ9A 2XU5A 3K9MA 1SNKA 1CSBB 3CBKA 3LFYA 3H8BA 4CDFB 2BDLA 2DCCA 2IBIA 3M99A 3CBJA 3DF0A 3O1GA 4YYRA 4YV8A 4X6JA 4FIPA 2IPPB 1CQDA 2R9MA 1CTEA 8PCHA 2DC7A 2PNSA 2ARYA 2G8JA 4ZUXU 4W4UA 2PREA 5JH3A 1YK7A 2AS8A 2E03A 1AYUA 4YYVA 4KLBA 3IHPA 1QDQA 3OVZA 2FT2A 3S3QA 3PDFA 1KHQA 3BCNA 3C9EA 1ZCMA 4FK5A 1NLJA 4PI3A 2YJ8A 4QBBA 4YYWA 1MHWA 2PADA 3WXFA 4AXMA 1DEUA 2AYOA 2BDZA 2R6NA 3GCBA 4X6HA 1F2BA 2PBHA 1ICFA 4PP1A 5FPWA 3KSEA 1DF0A 2HH5A 3F75A 5J94A 4YYUA 3BC3A 1ME3A 1SP4B 3HWNA 4MZSA 1ITOA 2XU4A 4CDEB 5K16A 1BQIA 6PADA 2B1MA 1GLOA 3U8EA 3S3RA 1PPPA 2P86A 1CV8A 1YT7A 2AVWA 1U9WA 3V6CA 3I3TA 3OISA 1AIMA 3QT4A 2F7DA 1EWMA 5F02A 2AUZA 2DC9A 2R9FA 1GMYA 1KFXL 1THEA 4PP2E 5CVNB 3BPMA 2YJCA 3CH2X 9PAPA 1AU4A 5CHVA 2DCAA 2DCDA 3IV2A 4BS6A 1PADA 2F1GA 3RVXA 3O0UA 2R9OA 2HHNA 4QRVA 1NB5A 1O0EA 2DZZA 3TNXA 2AUXA 4OEMA 3HHIA 1YVBA 3BOWA 1QXPA 2P7UA 1EF7A 3KW9A 4AXLA 4BSQA 1Q6KA 1VSNA 1BP4A 1X9YA 2JQFR 1AYVA 1MEMA 2AIMA 1PBHA 4BS5A 4Q8GA 4CDDB 4BQVA 2NQGA 4N4ZA 3H6SA 3PBHA 3N3KA 1S4VA 3F5VA 3I06A 3ZUAA 1M6DA 3OF8A 2AYNA 3WXGA 2NQIA 1GCBA 3IMAA 2VHSA 1TU6A 2Y5BA 2CB5A 3IEJA 4P6EA 3RVWA 4PADA 2XU1A 2DCBA 1MIRA 2P0RA 2VHFA 4WA6A 3RVVA 1F29A 1AYWA 2OZ2A 1EWOA 2E02A 1AU0A 3IUTA 1U9QX 4XR7A 1A6RA 3OF9A 1MS6A 4XUIA 1NB3A 3USVA 2JQGR 2AU1A 1CB5A 4RY2A 3LXSA 2HD5A 3BWKA 3H89A 3HHAA 3MHSA 3PW3A 2FYEA 2OP3A 2DC8A 3H8CA 1CPJA 4N8WA 2Y6EA 2ACTA 3V6EA 4I07A 1PIPA 1AECA 1EWLA 1PPOA 1FH0A 4W5BA 1CVZA 1PXVA 2DZYA 1BY8A 3MTNA 3MHHA 2G7YA 2R9NA 1CS8A 2C0YA 3N3GA 4MSXA 2YJBA 2GFOA 1MEGA 5EGWA 2WBFX 3WXEA 1PCIA 2DJGB 3P5VA 5EF4A 2B1NA 4I05A 2R9CA 1TLOA 1PE6A 3D6SA 1U5IA 4YYSA 3AI8A 1TL9A 5CHTA 2H7JA 3ERVA 1POPA 2DJFB 2E01A 4W5CA 3PNRA 4OELA 2XU3A 1GECE 3P5WA 2ATOA 2FO5A 1EWPA 2FUDA 2NQDB 1U9XA 1BGOA 2YJ2A 1QOLA 4YYQA 5PADA 1QMYA 1JQPA 3QSDA 5A24A 4K7CA 4N79A 1ME4A 1PPDA 3B79A 1NQCA 4MZOA 2YJ9A 3MORA 3E1ZB 1Y4HA 1KXRA 4CZWA 1F2CA 1AU3A 4QRXA 1XKGA 1ZIVA 3NHEA 3CH3X 3KFQA 4G54A 4I04A 1CJLA 4DMYA 4YVAA 2FRAA 1YALA 4DMXA 2HXZA 3P5XA 2E00A 2FTDA 3IOQA 3OVXA 4BPVA 7PCKA 1HUCB 3KKUA 1YK8A 2DC6A 1Y08A 3H7DA 1ATKA 1K3BB 1MDWA 5JA7A 3HD3A 1F2AA 3K8UA 3KX1A 2CIOA 2NQAA 1STFE 4Q8HA 5CVMA 4FJCA 4CDCB 4QH6A 1NL6A 2OULA 4X6IA 1IWDA 2G6DA 1KFUL 3N4CA 2FRQA 3KWZA 1NPZA 3P5UA 1KHPA 3QJ3A 3K24A 3BPFA
chains in the Genus database with same CATH superfamily
1VJVA 2G8EA 1U9VA 2GHUA 4HWYA 4QRGA 3KWBX 2O6XA 1PPNA 4P6GA 5CVOB 3C0RA 1AU2A 3O65A 2FQ9A 2XU5A 3K9MA 1SNKA 1CSBB 3CBKA 3LFYA 4OVZB 3H8BA 4CDFB 2BDLA 2DCCA 2IBIA 3M99A 3CBJA 3DF0A 3O1GA 3W30A 2J7QC 4YYRA 4YV8A 4X6JA 4FIPA 4BOUA 2IPPB 1CQDA 2R9MA 1CTEA 3PHUA 2DC7A 8PCHA 2PNSA 4ZTBA 2ARYA 2G8JA 4ZUXU 4OVZA 4W4UA 2PREA 5JH3A 1YK7A 2AS8A 2E03A 1AYUA 4YYVA 4KLBA 3IHPA 1QDQA 3OVZA 2FT2A 3S3QA 3PDFA 1KHQA 3BCNA 3C9EA 1ZCMA 4FK5A 1NLJA 4PI3A 2YJ8A 4QBBA 5EZQA 4YYWA 1MHWA 2JRIA 2PADA 3WXFA 4AXMA 1DEUA 2AYOA 2BDZA 4P16A 2R6NA 2Z84A 4IUMA 3GCBA 3PRPA 4X6HA 1F2BA 2PBHA 1ICFA 4PP1A 4BOQA 5FPWA 3KSEA 1DF0A 2HH5A 3F75A 3MP2A 5J94A 4YYUA 3BC3A 1ME3A 1SP4B 3HWNA 4MZSA 1ITOA 2XU4A 4CDEB 5K16A 1BQIA 6PADA 2B1MA 1GLOA 4D8BA 3IFUA 3U8EA 3RNVA 3S3RA 1PPPA 2P86A 1CV8A 1YT7A 2AVWA 3MTVA 1U9WA 3V6CA 3I3TA 3OISA 1AIMA 3QT4A 2F7DA 1EWMA 3W31A 5F02A 2AUZA 2DC9A 2R9FA 4RF1A 1GMYA 1KFXL 1THEA 4PP2E 5CVNB 3BPMA 2YJCA 3CH2X 9PAPA 1AU4A 5CHVA 4WURA 2DCAA 2DCDA 3IV2A 4BS6A 1PADA 2F1GA 3RVXA 3O0UA 2R9OA 3TMPA 2HHNA 3ZNHA 4QRVA 1NB5A 1O0EA 2DZZA 3TNXA 5KO3A 3E9SA 2FE8A 4D8EA 2AUXA 4OEMA 5JZEA 3HHIA 1YVBA 3BOWA 1QXPA 2P7UA 1EF7A 3KW9A 3OQCA 4AXLA 4BSQA 1Q6KA 4BOZA 1VSNA 2BU3A 1BP4A 1X9YA 2JQFR 1AYVA 1MEMA 2AIMA 1PBHA 4BS5A 4Q8GA 4CDDB 4BQVA 2NQGA 4N4ZA 3H6SA 3PBHA 3N3KA 3TRKA 1S4VA 3F5VA 3I06A 3ZUAA 1M6DA 3OF8A 4R3DA 2AYNA 3WXGA 1UKFA 2UZJA 2NQIA 1GCBA 3PT2A 3IMAA 2VHSA 4MI7A 1TU6A 2Y5BA 2CB5A 3IEJA 1DKIA 4P6EA 3RVWA 4PADA 2XU1A 2DCBA 1MIRA 2P0RA 2VHFA 4WA6A 5EZSA 3RVVA 1F29A 1AYWA 2OZ2A 1EWOA 2E02A 1AU0A 3IUTA 1U9QX 3PHXA 4XR7A 1A6RA 3OF9A 2BTWB 1MS6A 4XUIA 1NB3A 4MM3B 3USVA 2JQGR 2AU1A 3PRMA 1CB5A 4RY2A 3LXSA 4PT5A 2HD5A 5E6JA 3BWKA 3H89A 4RF0A 2AGAA 3HHAA 3MHSA 3PW3A 2FYEA 2OP3A 2DC8A 3H8CA 1CPJA 4N8WA 2Y6EA 2ACTA 4BOPA 2BTWA 3V6EA 2J7QA 4I07A 1PIPA 1AECA 1EWLA 1PPOA 1FH0A 4W5BA 1CVZA 1PXVA 2DZYA 1BY8A 3MTNA 3MHHA 2G7YA 2R9NA 1CS8A 2C0YA 3N3GA 4MSXA 2YJBA 2GFOA 1MEGA 5EGWA 2WBFX 3WXEA 1PCIA 2DJGB 4D8IA 3P5VA 5EF4A 2B1NA 4I05A 2R9CA 1TLOA 4REZA 1PE6A 3D6SA 4RNAA 1PVJA 1U5IA 4YYSA 3AI8A 1TL9A 5CHTA 2H7JA 3ERVA 1POPA 4M0WA 2DJFB 2E01A 4W5CA 3PNRA 4OELA 2XU3A 1GECE 3P5WA 2ATOA 3MJ5A 2FO5A 4HXDB 1EWPA 2FUDA 2NQDB 3B21A 1U9XA 1BGOA 2YJ2A 2DOSA 1QOLA 2HWKA 4YYQA 5PADA 1QMYA 1JQPA 3QSDA 5A24A 4K7CA 4N79A 1ME4A 1PPDA 3B79A 1NQCA 4MZOA 2YJ9A 3BBAA 3MORA 3E1ZB 4XZXA 1Y4HA 1KXRA 4CZWA 1F2CA 4OW0A 1AU3A 4QRXA 1XKGA 1ZIVA 3NHEA 3BB7A 3CH3X 3KFQA 4G54A 4I04A 1CJLA 4DMYA 4YVAA 2FRAA 1YALA 4DMXA 2HXZA 3P5XA 4BOSA 2E00A 4GUAA 3PHWA 2FTDA 4A5UA 3IOQA 3OVXA 4BPVA 7PCKA 1HUCB 3KKUA 1YK8A 2DC6A 1Y08A 3H7DA 1ATKA 1K3BB 1MDWA 5JA7A 3HD3A 1F2AA 3K8UA 4IP3A 3KX1A 1YZBA 2CIOA 2NQAA 1STFE 3BY4A 4Q8HA 5CVMA 4FJCA 4RKXA 4CDCB 4QH6A 1NL6A 2OULA 4X6IA 2JTCA 1IWDA 2G6DA 3PSEA 1KFUL 3N4CA 2FRQA 3KWZA 3P5UA 1NPZA 1KHPA 3QJ3A 3K24A 3BPFA
chains in the Genus database with same CATH topology
1VJVA 2G8EA 1U9VA 2GHUA 4HWYA 4QRGA 1W6FA 3KWBX 2O6XA 1PPNA 4P6GA 5CVOB 1AU2A 2FQ9A 2XU5A 3K9MA 1SNKA 1CSBB 3CBKA 3LFYA 1W5RA 3H8BA 4CDFB 2BDLA 2DCCA 2IBIA 3M99A 3CBJA 3DF0A 3O1GA 4YYRA 4YV8A 4X6JA 4FIPA 2IPPB 3D9WA 1CQDA 2R9MA 1CTEA 8PCHA 2DC7A 2PNSA 2ARYA 2G8JA 4ZUXU 4W4UA 2PREA 5JH3A 1YK7A 2AS8A 2E03A 1AYUA 1E2TA 4YYVA 4KLBA 3IHPA 1QDQA 3OVZA 2FT2A 3S3QA 3PDFA 1KHQA 3BCNA 3C9EA 1ZCMA 4FK5A 1NLJA 4PI3A 2YJ8A 4QBBA 4YYWA 1MHWA 2PADA 3WXFA 4AXMA 1DEUA 2AYOA 2BDZA 2R6NA 3GCBA 4X6HA 1F2BA 2PBHA 1ICFA 4PP1A 5FPWA 3KSEA 1DF0A 2HH5A 3F75A 5J94A 4YYUA 3BC3A 1ME3A 1SP4B 3HWNA 4MZSA 1ITOA 2XU4A 4CDEB 5K16A 1BQIA 6PADA 2B1MA 1GLOA 3U8EA 3S3RA 1PPPA 2P86A 1CV8A 1YT7A 2AVWA 1U9WA 3V6CA 3I3TA 3OISA 1AIMA 3QT4A 2F7DA 1EWMA 5F02A 2AUZA 2DC9A 2R9FA 2VFCA 1GMYA 1KFXL 1THEA 4PP2E 5CVNB 3BPMA 2YJCA 3CH2X 9PAPA 1AU4A 4GUZA 5CHVA 2DCAA 2DCDA 3IV2A 4BS6A 1PADA 2F1GA 3RVXA 3O0UA 2R9OA 4B55A 2HHNA 4QRVA 1W4TA 1NB5A 1O0EA 2DZZA 3TNXA 2AUXA 4OEMA 3HHIA 1YVBA 3BOWA 1QXPA 2P7UA 1EF7A 3KW9A 4AXLA 4BSQA 1Q6KA 1VSNA 1BP4A 1X9YA 2JQFR 1AYVA 1MEMA 2AIMA 1PBHA 4BS5A 4Q8GA 4CDDB 4BQVA 2NQGA 4N4ZA 3H6SA 3PBHA 3N3KA 1S4VA 3F5VA 4NV8A 3I06A 3ZUAA 1M6DA 3OF8A 2AYNA 3WXGA 2NQIA 1GCBA 3IMAA 2VHSA 1TU6A 2Y5BA 2CB5A 3IEJA 1GX3A 4P6EA 3RVWA 4PADA 2XU1A 2DCBA 1MIRA 2P0RA 2VHFA 4WA6A 3RVVA 1F29A 1AYWA 2OZ2A 1EWOA 2E02A 1AU0A 3IUTA 1U9QX 4XR7A 1A6RA 3OF9A 1MS6A 4XUIA 1NB3A 3USVA 2JQGR 2AU1A 1CB5A 4RY2A 2VFBA 3LXSA 2HD5A 3BWKA 3H89A 3HHAA 3MHSA 3PW3A 2FYEA 4BGFA 3LTWA 2OP3A 2DC8A 3H8CA 1CPJA 4N8WA 2Y6EA 2ACTA 3V6EA 4I07A 1PIPA 1AECA 1EWLA 1PPOA 1FH0A 4W5BA 1CVZA 1PXVA 2DZYA 1BY8A 3MTNA 4C5PA 3MHHA 2G7YA 2R9NA 1CS8A 2C0YA 3N3GA 4MSXA 2YJBA 2GFOA 1MEGA 5EGWA 2WBFX 3WXEA 2BSZA 1PCIA 2DJGB 3P5VA 5EF4A 2B1NA 4I05A 2R9CA 1TLOA 1PE6A 3D6SA 1U5IA 4YYSA 3AI8A 1TL9A 5CHTA 2H7JA 3ERVA 1POPA 2DJFB 2E01A 4W5CA 3PNRA 4OELA 2XU3A 1GECE 3P5WA 2ATOA 2FO5A 1EWPA 2FUDA 2NQDB 1U9XA 1BGOA 2YJ2A 1QOLA 4YYQA 5PADA 1QMYA 4NV7A 1JQPA 3QSDA 5A24A 4K7CA 4N79A 1ME4A 1PPDA 3B79A 1NQCA 4MZOA 2YJ9A 3MORA 3E1ZB 1Y4HA 1KXRA 4CZWA 1F2CA 1AU3A 4QRXA 1XKGA 1ZIVA 3NHEA 3CH3X 3KFQA 4G54A 4I04A 1CJLA 4DMYA 4YVAA 2FRAA 1YALA 4DMXA 2HXZA 3P5XA 2E00A 2FTDA 3IOQA 3OVXA 4BPVA 7PCKA 1HUCB 3KKUA 1YK8A 2DC6A 1Y08A 3H7DA 1ATKA 1K3BB 1MDWA 5JA7A 3HD3A 1F2AA 3K8UA 3KX1A 2CIOA 2NQAA 1STFE 4Q8HA 5CVMA 4FJCA 4CDCB 4QH6A 1NL6A 2OULA 4X6IA 1IWDA 2G6DA 1KFUL 3N4CA 2FRQA 3KWZA 1NPZA 3P5UA 1KHPA 3QJ3A 3K24A 3BPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJV A;  2G8E A;  1U9V A;  2GHU A;  4HWY A;  4QRG A;  3KWB X;  2O6X A;  1PPN A;  4P6G A;  5CVO B;  1AU2 A;  2FQ9 A;  2XU5 A;  3K9M A;  1SNK A;  1CSB B;  3CBK A;  3LFY A;  3H8B A;  4CDF B;  2BDL A;  2DCC A;  2IBI A;  3M99 A;  3CBJ A;  3DF0 A;  3O1G A;  4YYR A;  4YV8 A;  4X6J A;  4FIP A;  2IPP B;  1CQD A;  2R9M A;  1CTE A;  8PCH A;  2DC7 A;  2PNS A;  2ARY A;  2G8J A;  4ZUX U;  4W4U A;  2PRE A;  5JH3 A;  1YK7 A;  2AS8 A;  2E03 A;  1AYU A;  4YYV A;  4KLB A;  3IHP A;  1QDQ A;  3OVZ A;  2FT2 A;  3S3Q A;  3PDF A;  1KHQ A;  3BCN A;  3C9E A;  1ZCM A;  4FK5 A;  1NLJ A;  4PI3 A;  2YJ8 A;  4QBB A;  4YYW A;  1MHW A;  2PAD A;  3WXF A;  4AXM A;  1DEU A;  2AYO A;  2BDZ A;  2R6N A;  3GCB A;  4X6H A;  1F2B A;  2PBH A;  1ICF A;  4PP1 A;  5FPW A;  3KSE A;  1DF0 A;  2HH5 A;  3F75 A;  5J94 A;  4YYU A;  3BC3 A;  1ME3 A;  1SP4 B;  3HWN A;  4MZS A;  1ITO A;  2XU4 A;  4CDE B;  5K16 A;  1BQI A;  6PAD A;  2B1M A;  1GLO A;  3U8E A;  3S3R A;  1PPP A;  2P86 A;  1CV8 A;  1YT7 A;  2AVW A;  1U9W A;  3V6C A;  3I3T A;  3OIS A;  1AIM A;  3QT4 A;  2F7D A;  1EWM A;  5F02 A;  2AUZ A;  2DC9 A;  2R9F A;  1GMY A;  1KFX L;  1THE A;  4PP2 E;  5CVN B;  3BPM A;  2YJC A;  3CH2 X;  9PAP A;  1AU4 A;  5CHV A;  2DCA A;  2DCD A;  3IV2 A;  4BS6 A;  1PAD A;  2F1G A;  3RVX A;  3O0U A;  2R9O A;  2HHN A;  4QRV A;  1NB5 A;  1O0E A;  2DZZ A;  3TNX A;  2AUX A;  4OEM A;  3HHI A;  1YVB A;  3BOW A;  1QXP A;  2P7U A;  1EF7 A;  3KW9 A;  4AXL A;  4BSQ A;  1Q6K A;  1VSN A;  1BP4 A;  1X9Y A;  2JQF R;  1AYV A;  1MEM A;  2AIM A;  1PBH A;  4BS5 A;  4Q8G A;  4CDD B;  4BQV A;  2NQG A;  4N4Z A;  3H6S A;  3PBH A;  3N3K A;  1S4V A;  3F5V A;  3I06 A;  3ZUA A;  1M6D A;  3OF8 A;  2AYN A;  3WXG A;  2NQI A;  1GCB A;  3IMA A;  2VHS A;  1TU6 A;  2Y5B A;  2CB5 A;  3IEJ A;  4P6E A;  3RVW A;  4PAD A;  2XU1 A;  2DCB A;  1MIR A;  2P0R A;  2VHF A;  4WA6 A;  3RVV A;  1F29 A;  1AYW A;  2OZ2 A;  1EWO A;  2E02 A;  1AU0 A;  3IUT A;  1U9Q X;  4XR7 A;  1A6R A;  3OF9 A;  1MS6 A;  4XUI A;  1NB3 A;  3USV A;  2JQG R;  2AU1 A;  1CB5 A;  4RY2 A;  3LXS A;  2HD5 A;  3BWK A;  3H89 A;  3HHA A;  3MHS A;  3PW3 A;  2FYE A;  2OP3 A;  2DC8 A;  3H8C A;  1CPJ A;  4N8W A;  2Y6E A;  2ACT A;  3V6E A;  4I07 A;  1PIP A;  1AEC A;  1EWL A;  1PPO A;  1FH0 A;  4W5B A;  1CVZ A;  1PXV A;  2DZY A;  1BY8 A;  3MTN A;  3MHH A;  2G7Y A;  2R9N A;  1CS8 A;  2C0Y A;  3N3G A;  4MSX A;  2YJB A;  2GFO A;  1MEG A;  5EGW A;  2WBF X;  3WXE A;  1PCI A;  2DJG B;  3P5V A;  5EF4 A;  2B1N A;  4I05 A;  2R9C A;  1TLO A;  1PE6 A;  3D6S A;  1U5I A;  4YYS A;  3AI8 A;  1TL9 A;  5CHT A;  2H7J A;  3ERV A;  1POP A;  2DJF B;  2E01 A;  4W5C A;  3PNR A;  4OEL A;  2XU3 A;  1GEC E;  3P5W A;  2ATO A;  2FO5 A;  1EWP A;  2FUD A;  2NQD B;  1U9X A;  1BGO A;  2YJ2 A;  1QOL A;  4YYQ A;  5PAD A;  1QMY A;  1JQP A;  3QSD A;  5A24 A;  4K7C A;  4N79 A;  1ME4 A;  1PPD A;  3B79 A;  1NQC A;  4MZO A;  2YJ9 A;  3MOR A;  3E1Z B;  1Y4H A;  1KXR A;  4CZW A;  1F2C A;  1AU3 A;  4QRX A;  1XKG A;  1ZIV A;  3NHE A;  3CH3 X;  3KFQ A;  4G54 A;  4I04 A;  1CJL A;  4DMY A;  4YVA A;  2FRA A;  1YAL A;  4DMX A;  2HXZ A;  3P5X A;  2E00 A;  2FTD A;  3IOQ A;  3OVX A;  4BPV A;  7PCK A;  1HUC B;  3KKU A;  1YK8 A;  2DC6 A;  1Y08 A;  3H7D A;  1ATK A;  1K3B B;  1MDW A;  5JA7 A;  3HD3 A;  1F2A A;  3K8U A;  3KX1 A;  2CIO A;  2NQA A;  1STF E;  4Q8H A;  5CVM A;  4FJC A;  4CDC B;  4QH6 A;  1NL6 A;  2OUL A;  4X6I A;  1IWD A;  2G6D A;  1KFU L;  3N4C A;  2FRQ A;  3KWZ A;  1NPZ A;  3P5U A;  1KHP A;  3QJ3 A;  3K24 A;  3BPF A; 
#chains in the Genus database with same CATH topology
 1VJV A;  2G8E A;  1U9V A;  2GHU A;  4HWY A;  4QRG A;  3KWB X;  2O6X A;  1PPN A;  4P6G A;  5CVO B;  3C0R A;  1AU2 A;  3O65 A;  2FQ9 A;  2XU5 A;  3K9M A;  1SNK A;  1CSB B;  3CBK A;  3LFY A;  4OVZ B;  3H8B A;  4CDF B;  2BDL A;  2DCC A;  2IBI A;  3M99 A;  3CBJ A;  3DF0 A;  3O1G A;  3W30 A;  2J7Q C;  4YYR A;  4YV8 A;  4X6J A;  4FIP A;  4BOU A;  2IPP B;  1CQD A;  2R9M A;  1CTE A;  3PHU A;  2DC7 A;  8PCH A;  2PNS A;  4ZTB A;  2ARY A;  2G8J A;  4ZUX U;  4OVZ A;  4W4U A;  2PRE A;  5JH3 A;  1YK7 A;  2AS8 A;  2E03 A;  1AYU A;  4YYV A;  4KLB A;  3IHP A;  1QDQ A;  3OVZ A;  2FT2 A;  3S3Q A;  3PDF A;  1KHQ A;  3BCN A;  3C9E A;  1ZCM A;  4FK5 A;  1NLJ A;  4PI3 A;  2YJ8 A;  4QBB A;  5EZQ A;  4YYW A;  1MHW A;  2JRI A;  2PAD A;  3WXF A;  4AXM A;  1DEU A;  2AYO A;  2BDZ A;  4P16 A;  2R6N A;  2Z84 A;  4IUM A;  3GCB A;  3PRP A;  4X6H A;  1F2B A;  2PBH A;  1ICF A;  4PP1 A;  4BOQ A;  5FPW A;  3KSE A;  1DF0 A;  2HH5 A;  3F75 A;  3MP2 A;  5J94 A;  4YYU A;  3BC3 A;  1ME3 A;  1SP4 B;  3HWN A;  4MZS A;  1ITO A;  2XU4 A;  4CDE B;  5K16 A;  1BQI A;  6PAD A;  2B1M A;  1GLO A;  4D8B A;  3IFU A;  3U8E A;  3RNV A;  3S3R A;  1PPP A;  2P86 A;  1CV8 A;  1YT7 A;  2AVW A;  3MTV A;  1U9W A;  3V6C A;  3I3T A;  3OIS A;  1AIM A;  3QT4 A;  2F7D A;  1EWM A;  3W31 A;  5F02 A;  2AUZ A;  2DC9 A;  2R9F A;  4RF1 A;  1GMY A;  1KFX L;  1THE A;  4PP2 E;  5CVN B;  3BPM A;  2YJC A;  3CH2 X;  9PAP A;  1AU4 A;  5CHV A;  4WUR A;  2DCA A;  2DCD A;  3IV2 A;  4BS6 A;  1PAD A;  2F1G A;  3RVX A;  3O0U A;  2R9O A;  3TMP A;  2HHN A;  3ZNH A;  4QRV A;  1NB5 A;  1O0E A;  2DZZ A;  3TNX A;  5KO3 A;  3E9S A;  2FE8 A;  4D8E A;  2AUX A;  4OEM A;  5JZE A;  3HHI A;  1YVB A;  3BOW A;  1QXP A;  2P7U A;  1EF7 A;  3KW9 A;  3OQC A;  4AXL A;  4BSQ A;  1Q6K A;  4BOZ A;  1VSN A;  2BU3 A;  1BP4 A;  1X9Y A;  2JQF R;  1AYV A;  1MEM A;  2AIM A;  1PBH A;  4BS5 A;  4Q8G A;  4CDD B;  4BQV A;  2NQG A;  4N4Z A;  3H6S A;  3PBH A;  3N3K A;  3TRK A;  1S4V A;  3F5V A;  3I06 A;  3ZUA A;  1M6D A;  3OF8 A;  4R3D A;  2AYN A;  3WXG A;  1UKF A;  2UZJ A;  2NQI A;  1GCB A;  3PT2 A;  3IMA A;  2VHS A;  4MI7 A;  1TU6 A;  2Y5B A;  2CB5 A;  3IEJ A;  1DKI A;  4P6E A;  3RVW A;  4PAD A;  2XU1 A;  2DCB A;  1MIR A;  2P0R A;  2VHF A;  4WA6 A;  5EZS A;  3RVV A;  1F29 A;  1AYW A;  2OZ2 A;  1EWO A;  2E02 A;  1AU0 A;  3IUT A;  1U9Q X;  3PHX A;  4XR7 A;  1A6R A;  3OF9 A;  2BTW B;  1MS6 A;  4XUI A;  1NB3 A;  4MM3 B;  3USV A;  2JQG R;  2AU1 A;  3PRM A;  1CB5 A;  4RY2 A;  3LXS A;  4PT5 A;  2HD5 A;  5E6J A;  3BWK A;  3H89 A;  4RF0 A;  2AGA A;  3HHA A;  3MHS A;  3PW3 A;  2FYE A;  2OP3 A;  2DC8 A;  3H8C A;  1CPJ A;  4N8W A;  2Y6E A;  2ACT A;  4BOP A;  2BTW A;  3V6E A;  2J7Q A;  4I07 A;  1PIP A;  1AEC A;  1EWL A;  1PPO A;  1FH0 A;  4W5B A;  1CVZ A;  1PXV A;  2DZY A;  1BY8 A;  3MTN A;  3MHH A;  2G7Y A;  2R9N A;  1CS8 A;  2C0Y A;  3N3G A;  4MSX A;  2YJB A;  2GFO A;  1MEG A;  5EGW A;  2WBF X;  3WXE A;  1PCI A;  2DJG B;  4D8I A;  3P5V A;  5EF4 A;  2B1N A;  4I05 A;  2R9C A;  1TLO A;  4REZ A;  1PE6 A;  3D6S A;  4RNA A;  1PVJ A;  1U5I A;  4YYS A;  3AI8 A;  1TL9 A;  5CHT A;  2H7J A;  3ERV A;  1POP A;  4M0W A;  2DJF B;  2E01 A;  4W5C A;  3PNR A;  4OEL A;  2XU3 A;  1GEC E;  3P5W A;  2ATO A;  3MJ5 A;  2FO5 A;  4HXD B;  1EWP A;  2FUD A;  2NQD B;  3B21 A;  1U9X A;  1BGO A;  2YJ2 A;  2DOS A;  1QOL A;  2HWK A;  4YYQ A;  5PAD A;  1QMY A;  1JQP A;  3QSD A;  5A24 A;  4K7C A;  4N79 A;  1ME4 A;  1PPD A;  3B79 A;  1NQC A;  4MZO A;  2YJ9 A;  3BBA A;  3MOR A;  3E1Z B;  4XZX A;  1Y4H A;  1KXR A;  4CZW A;  1F2C A;  4OW0 A;  1AU3 A;  4QRX A;  1XKG A;  1ZIV A;  3NHE A;  3BB7 A;  3CH3 X;  3KFQ A;  4G54 A;  4I04 A;  1CJL A;  4DMY A;  4YVA A;  2FRA A;  1YAL A;  4DMX A;  2HXZ A;  3P5X A;  4BOS A;  2E00 A;  4GUA A;  3PHW A;  2FTD A;  4A5U A;  3IOQ A;  3OVX A;  4BPV A;  7PCK A;  1HUC B;  3KKU A;  1YK8 A;  2DC6 A;  1Y08 A;  3H7D A;  1ATK A;  1K3B B;  1MDW A;  5JA7 A;  3HD3 A;  1F2A A;  3K8U A;  4IP3 A;  3KX1 A;  1YZB A;  2CIO A;  2NQA A;  1STF E;  3BY4 A;  4Q8H A;  5CVM A;  4FJC A;  4RKX A;  4CDC B;  4QH6 A;  1NL6 A;  2OUL A;  4X6I A;  2JTC A;  1IWD A;  2G6D A;  3PSE A;  1KFU L;  3N4C A;  2FRQ A;  3KWZ A;  3P5U A;  1NPZ A;  1KHP A;  3QJ3 A;  3K24 A;  3BPF A; 
#chains in the Genus database with same CATH homology
 1VJV A;  2G8E A;  1U9V A;  2GHU A;  4HWY A;  4QRG A;  1W6F A;  3KWB X;  2O6X A;  1PPN A;  4P6G A;  5CVO B;  1AU2 A;  2FQ9 A;  2XU5 A;  3K9M A;  1SNK A;  1CSB B;  3CBK A;  3LFY A;  1W5R A;  3H8B A;  4CDF B;  2BDL A;  2DCC A;  2IBI A;  3M99 A;  3CBJ A;  3DF0 A;  3O1G A;  4YYR A;  4YV8 A;  4X6J A;  4FIP A;  2IPP B;  3D9W A;  1CQD A;  2R9M A;  1CTE A;  8PCH A;  2DC7 A;  2PNS A;  2ARY A;  2G8J A;  4ZUX U;  4W4U A;  2PRE A;  5JH3 A;  1YK7 A;  2AS8 A;  2E03 A;  1AYU A;  1E2T A;  4YYV A;  4KLB A;  3IHP A;  1QDQ A;  3OVZ A;  2FT2 A;  3S3Q A;  3PDF A;  1KHQ A;  3BCN A;  3C9E A;  1ZCM A;  4FK5 A;  1NLJ A;  4PI3 A;  2YJ8 A;  4QBB A;  4YYW A;  1MHW A;  2PAD A;  3WXF A;  4AXM A;  1DEU A;  2AYO A;  2BDZ A;  2R6N A;  3GCB A;  4X6H A;  1F2B A;  2PBH A;  1ICF A;  4PP1 A;  5FPW A;  3KSE A;  1DF0 A;  2HH5 A;  3F75 A;  5J94 A;  4YYU A;  3BC3 A;  1ME3 A;  1SP4 B;  3HWN A;  4MZS A;  1ITO A;  2XU4 A;  4CDE B;  5K16 A;  1BQI A;  6PAD A;  2B1M A;  1GLO A;  3U8E A;  3S3R A;  1PPP A;  2P86 A;  1CV8 A;  1YT7 A;  2AVW A;  1U9W A;  3V6C A;  3I3T A;  3OIS A;  1AIM A;  3QT4 A;  2F7D A;  1EWM A;  5F02 A;  2AUZ A;  2DC9 A;  2R9F A;  2VFC A;  1GMY A;  1KFX L;  1THE A;  4PP2 E;  5CVN B;  3BPM A;  2YJC A;  3CH2 X;  9PAP A;  1AU4 A;  4GUZ A;  5CHV A;  2DCA A;  2DCD A;  3IV2 A;  4BS6 A;  1PAD A;  2F1G A;  3RVX A;  3O0U A;  2R9O A;  4B55 A;  2HHN A;  4QRV A;  1W4T A;  1NB5 A;  1O0E A;  2DZZ A;  3TNX A;  2AUX A;  4OEM A;  3HHI A;  1YVB A;  3BOW A;  1QXP A;  2P7U A;  1EF7 A;  3KW9 A;  4AXL A;  4BSQ A;  1Q6K A;  1VSN A;  1BP4 A;  1X9Y A;  2JQF R;  1AYV A;  1MEM A;  2AIM A;  1PBH A;  4BS5 A;  4Q8G A;  4CDD B;  4BQV A;  2NQG A;  4N4Z A;  3H6S A;  3PBH A;  3N3K A;  1S4V A;  3F5V A;  4NV8 A;  3I06 A;  3ZUA A;  1M6D A;  3OF8 A;  2AYN A;  3WXG A;  2NQI A;  1GCB A;  3IMA A;  2VHS A;  1TU6 A;  2Y5B A;  2CB5 A;  3IEJ A;  1GX3 A;  4P6E A;  3RVW A;  4PAD A;  2XU1 A;  2DCB A;  1MIR A;  2P0R A;  2VHF A;  4WA6 A;  3RVV A;  1F29 A;  1AYW A;  2OZ2 A;  1EWO A;  2E02 A;  1AU0 A;  3IUT A;  1U9Q X;  4XR7 A;  1A6R A;  3OF9 A;  1MS6 A;  4XUI A;  1NB3 A;  3USV A;  2JQG R;  2AU1 A;  1CB5 A;  4RY2 A;  2VFB A;  3LXS A;  2HD5 A;  3BWK A;  3H89 A;  3HHA A;  3MHS A;  3PW3 A;  2FYE A;  4BGF A;  3LTW A;  2OP3 A;  2DC8 A;  3H8C A;  1CPJ A;  4N8W A;  2Y6E A;  2ACT A;  3V6E A;  4I07 A;  1PIP A;  1AEC A;  1EWL A;  1PPO A;  1FH0 A;  4W5B A;  1CVZ A;  1PXV A;  2DZY A;  1BY8 A;  3MTN A;  4C5P A;  3MHH A;  2G7Y A;  2R9N A;  1CS8 A;  2C0Y A;  3N3G A;  4MSX A;  2YJB A;  2GFO A;  1MEG A;  5EGW A;  2WBF X;  3WXE A;  2BSZ A;  1PCI A;  2DJG B;  3P5V A;  5EF4 A;  2B1N A;  4I05 A;  2R9C A;  1TLO A;  1PE6 A;  3D6S A;  1U5I A;  4YYS A;  3AI8 A;  1TL9 A;  5CHT A;  2H7J A;  3ERV A;  1POP A;  2DJF B;  2E01 A;  4W5C A;  3PNR A;  4OEL A;  2XU3 A;  1GEC E;  3P5W A;  2ATO A;  2FO5 A;  1EWP A;  2FUD A;  2NQD B;  1U9X A;  1BGO A;  2YJ2 A;  1QOL A;  4YYQ A;  5PAD A;  1QMY A;  4NV7 A;  1JQP A;  3QSD A;  5A24 A;  4K7C A;  4N79 A;  1ME4 A;  1PPD A;  3B79 A;  1NQC A;  4MZO A;  2YJ9 A;  3MOR A;  3E1Z B;  1Y4H A;  1KXR A;  4CZW A;  1F2C A;  1AU3 A;  4QRX A;  1XKG A;  1ZIV A;  3NHE A;  3CH3 X;  3KFQ A;  4G54 A;  4I04 A;  1CJL A;  4DMY A;  4YVA A;  2FRA A;  1YAL A;  4DMX A;  2HXZ A;  3P5X A;  2E00 A;  2FTD A;  3IOQ A;  3OVX A;  4BPV A;  7PCK A;  1HUC B;  3KKU A;  1YK8 A;  2DC6 A;  1Y08 A;  3H7D A;  1ATK A;  1K3B B;  1MDW A;  5JA7 A;  3HD3 A;  1F2A A;  3K8U A;  3KX1 A;  2CIO A;  2NQA A;  1STF E;  4Q8H A;  5CVM A;  4FJC A;  4CDC B;  4QH6 A;  1NL6 A;  2OUL A;  4X6I A;  1IWD A;  2G6D A;  1KFU L;  3N4C A;  2FRQ A;  3KWZ A;  1NPZ A;  3P5U A;  1KHP A;  3QJ3 A;  3K24 A;  3BPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...