1MHWA

Design of non-covalent inhibitors of human cathepsin l. from the 96-residue proregion to optimized tripeptides
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
173
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L
publication title Design of non-covalent inhibitors of human cathepsin L. From the 96-residue proregion to optimized tripeptides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 173
sequence length 174
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2002-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1mhwA00
4CZWA 3U8EA 1F2BA 3QT4A 1GMYA 1KFUL 1AU3A 3TNXA 5K16A 1SP4B 2GFOA 2DJFB 1CB5A 2P86A 3WXEA 4OELA 1CSBB 3MHSA 1BQIA 3PBHA 4W5CA 1CVZA 2YJBA 4PP2E 4Q8HA 4X6HA 2BDLA 1PPDA 2B1NA 1Y08A 2F7DA 3OF8A 2YJCA 1KHQA 4PADA 3OVXA 2XU4A 1VSNA 3HD3A 3MHHA 2OZ2A 3C9EA 3BOWA 1EWLA 2PREA 4YV8A 2NQIA 4QH6A 4PI3A 1ZIVA 2WBFX 1YT7A 3RVWA 1PIPA 1AYWA 2R9NA 3IUTA 1AU4A 4DMYA 2E00A 5CVOB 3ZUAA 3N4CA 3BPFA 2GHUA 1NQCA 1YALA 4G54A 3K9MA 1BY8A 2DC7A 2DCBA 1O0EA 3H6SA 4FK5A 4OEMA 1STFE 1CQDA 1Q6KA 1YK8A 1CJLA 1VJVA 4BPVA 4AXLA 3K24A 4QRGA 2G6DA 1K3BB 3GCBA 2CIOA 4AXMA 4QRVA 2DC9A 2CB5A 2YJ8A 3OISA 4N79A 2AUXA 3H89A 4QRXA 1F2AA 4BQVA 3V6EA 1CV8A 4CDEB 2HXZA 1AU0A 3HHIA 1BGOA 2AVWA 2DZZA 2NQDB 3CBKA 3KKUA 1TU6A 3LFYA 4ZUXU 4HWYA 3N3KA 3LXSA 1PPPA 2FTDA 3IOQA 1EWOA 1GLOA 1POPA 1IWDA 2E02A 1QMYA 2B1MA 5A24A 1AYUA 2DCDA 4W4UA 1TLOA 3BPMA 1MEGA 1AU2A 4MSXA 3KFQA 1S4VA 4X6JA 4I05A 4XUIA 3M99A 1DEUA 2JQFR 3USVA 3K8UA 3V6CA 1EWPA 2FUDA 4YYQA 3O1GA 9PAPA 3MTNA 1MEMA 4P6EA 1PPOA 2NQAA 3PNRA 2AU1A 3PW3A 3KWBX 3H8BA 5EF4A 3IHPA 1CTEA 2DCAA 1MIRA 2HD5A 1U9VA 1GCBA 2G8EA 2PADA 5CVMA 1ICFA 1XKGA 1KFXL 1PADA 4Q8GA 2PBHA 4KLBA 4CDDB 1MS6A 3P5XA 2BDZA 1F2CA 3CH2X 4YYWA 2PNSA 5CHVA 1MDWA 2R9MA 3P5WA 2DC8A 2Y6EA 2AIMA 2Y5BA 4YVAA 1M6DA 3IMAA 4P6GA 1KXRA 2XU1A 3AI8A 2AYOA 2FRAA 3P5UA 4PP1A 1DF0A 5JA7A 1U9WA 4BSQA 4I07A 1X9YA 4X6IA 3HWNA 5F02A 1QOLA 3I06A 1ME4A 1A6RA 2G8JA 3I3TA 3MORA 2G7YA 1NB3A 3H8CA 2R9CA 1PE6A 1QXPA 1JQPA 1U9QX 1NB5A 3S3QA 3H7DA 3S3RA 5CHTA 2XU5A 2AUZA 3KWZA 3BWKA 2DJGB 4BS6A 4FIPA 4FJCA 3IEJA 1ZCMA 7PCKA 5EGWA 1F29A 3KX1A 2DCCA 1NLJA 2JQGR 3KSEA 1KHPA 1MHWA 4CDCB 4DMXA 3P5VA 1HUCB 1EF7A 3IV2A 1AECA 1PPNA 2P0RA 1PBHA 2R9OA 1FH0A 6PADA 1ATKA 2IPPB 3RVXA 3OF9A 3B79A 3DF0A 3F5VA 8PCHA 1THEA 2IBIA 2DC6A 5FPWA 2FT2A 3D6SA 2VHFA 5JH3A 3CH3X 3HHAA 4WA6A 2H7JA 1Y4HA 5PADA 2R6NA 3QSDA 2VHSA 4CDFB 3RVVA 2HH5A 4W5BA 2F1GA 1TL9A 3OVZA 3N3GA 2FRQA 2AYNA 4MZOA 3O0UA 3KW9A 3QJ3A 1EWMA 3WXGA 4XR7A 4YYSA 3F75A 2YJ9A 4QBBA 2OP3A 1AIMA 1QDQA 1YVBA 4RY2A 4BS5A 4N8WA 3PDFA 2ACTA 2E03A 2ARYA 2R9FA 1NL6A 4YYRA 1U5IA 2OULA 1NPZA 2DZYA 2FQ9A 1SNKA 2NQGA 3ERVA 3WXFA 2O6XA 2AS8A 2YJ2A 2HHNA 1PCIA 3BC3A 1CPJA 4YYUA 2FO5A 2XU3A 1BP4A 1CS8A 3BCNA 1ITOA 5CVNB 4I04A 1GECE 1PXVA 2FYEA 4N4ZA 4MZSA 4K7CA 3NHEA 5J94A 3E1ZB 2E01A 2C0YA 3CBJA 1YK7A 1ME3A 1U9XA 2P7UA 1AYVA 4YYVA 2ATOA
chains in the Genus database with same CATH superfamily
4CZWA 3U8EA 1F2BA 3QT4A 1GMYA 1KFUL 3O65A 1AU3A 3TNXA 3PRMA 5K16A 4BOSA 1SP4B 2GFOA 2DJFB 1CB5A 3PT2A 2P86A 3WXEA 4OELA 1CSBB 3RNVA 3MHSA 1BQIA 3PBHA 2FE8A 4W5CA 1CVZA 2YJBA 4PP2E 4Q8HA 4X6HA 2BDLA 1PPDA 2B1NA 1Y08A 2F7DA 3OF8A 2YJCA 5EZSA 1KHQA 4PADA 3OVXA 2XU4A 1VSNA 3HD3A 4RF0A 3MHHA 3E9SA 2OZ2A 3C9EA 3BOWA 3PRPA 1EWLA 4XZXA 2PREA 4YV8A 2NQIA 4QH6A 4PI3A 1ZIVA 3TMPA 2WBFX 1YT7A 3RVWA 1PIPA 1AYWA 2R9NA 3IUTA 1AU4A 4DMYA 2E00A 5CVOB 3ZUAA 3N4CA 3BPFA 2GHUA 4MM3B 1NQCA 1YALA 4G54A 3K9MA 2HWKA 1BY8A 2DC7A 2DCBA 1O0EA 3BY4A 3PSEA 3H6SA 4FK5A 4OEMA 1STFE 1CQDA 4BOZA 1Q6KA 1YK8A 3W30A 1CJLA 1VJVA 2J7QA 4REZA 4BPVA 4AXLA 4MI7A 3K24A 4QRGA 2G6DA 1K3BB 1DKIA 4R3DA 3GCBA 2CIOA 4RF1A 3MTVA 4AXMA 4QRVA 2DC9A 2CB5A 4PT5A 2YJ8A 3OISA 4N79A 2AUXA 3H89A 4QRXA 1F2AA 4BQVA 3V6EA 1CV8A 4CDEB 2HXZA 1AU0A 3HHIA 1BGOA 2AVWA 2DZZA 2NQDB 3CBKA 3KKUA 1TU6A 4RKXA 2Z84A 3LFYA 4ZUXU 4HWYA 3N3KA 2JRIA 3LXSA 1PPPA 2FTDA 3IOQA 1EWOA 1GLOA 1POPA 1IWDA 2E02A 1QMYA 2B1MA 5A24A 1AYUA 2DCDA 4W4UA 1TLOA 3BPMA 1MEGA 1AU2A 4MSXA 3KFQA 1S4VA 4X6JA 4I05A 4XUIA 3IFUA 4A5UA 3M99A 1DEUA 2JQFR 3USVA 3K8UA 3V6CA 1EWPA 2FUDA 4YYQA 3O1GA 9PAPA 3MTNA 1MEMA 4P6EA 1PPOA 5JZEA 2NQAA 3PNRA 2AU1A 3PW3A 3KWBX 3H8BA 5EF4A 3IHPA 1CTEA 2DCAA 1MIRA 2DOSA 2HD5A 2AGAA 1U9VA 1GCBA 2G8EA 2PADA 4BOQA 5CVMA 4IUMA 1ICFA 1XKGA 3PHXA 1KFXL 1PADA 4Q8GA 2PBHA 4KLBA 4CDDB 1MS6A 3P5XA 2BDZA 3MJ5A 1F2CA 3CH2X 4YYWA 2PNSA 5CHVA 5EZQA 1MDWA 2R9MA 3P5WA 4D8EA 2DC8A 2Y6EA 2AIMA 2Y5BA 4YVAA 1M6DA 3IMAA 4P6GA 1KXRA 4BOPA 2XU1A 3AI8A 2AYOA 3B21A 2J7QC 2FRAA 3P5UA 4PP1A 1DF0A 5JA7A 1U9WA 4BSQA 4I07A 1X9YA 4X6IA 3ZNHA 4P16A 3HWNA 5F02A 1QOLA 3I06A 1ME4A 1A6RA 2G8JA 3I3TA 3MORA 2G7YA 1NB3A 3H8CA 2R9CA 1PE6A 1QXPA 1JQPA 1U9QX 1NB5A 3S3QA 3H7DA 3S3RA 5CHTA 2XU5A 2AUZA 3KWZA 3BWKA 2DJGB 4BS6A 4FIPA 3TRKA 4HXDB 4FJCA 3IEJA 1ZCMA 7PCKA 5EGWA 1F29A 3KX1A 2DCCA 2JTCA 1NLJA 2JQGR 3KSEA 4D8IA 1KHPA 2BTWA 1MHWA 4CDCB 4OW0A 4BOUA 4DMXA 3P5VA 1HUCB 1EF7A 3IV2A 4IP3A 1AECA 1PPNA 5E6JA 2P0RA 1PBHA 2R9OA 1FH0A 6PADA 1ATKA 2IPPB 3RVXA 3OF9A 3B79A 3DF0A 3F5VA 8PCHA 1THEA 2BTWB 2IBIA 4ZTBA 2DC6A 4D8BA 5FPWA 3PHWA 2FT2A 1UKFA 3D6SA 2VHFA 5JH3A 3CH3X 3HHAA 4WA6A 2H7JA 1Y4HA 5PADA 2R6NA 3QSDA 2VHSA 4CDFB 3RVVA 2HH5A 4W5BA 2F1GA 1TL9A 3OVZA 3N3GA 2FRQA 2UZJA 2AYNA 4MZOA 3O0UA 3KW9A 3QJ3A 1EWMA 3MP2A 3WXGA 4XR7A 4OVZA 4YYSA 3F75A 2YJ9A 3BB7A 4QBBA 2OP3A 1AIMA 1QDQA 1YVBA 4RY2A 4BS5A 4N8WA 3PDFA 4OVZB 2ACTA 2E03A 2ARYA 2R9FA 4GUAA 1NL6A 4YYRA 1U5IA 2OULA 4RNAA 1YZBA 1NPZA 2DZYA 2BU3A 2FQ9A 1SNKA 2NQGA 3ERVA 3WXFA 2O6XA 2AS8A 2YJ2A 2HHNA 1PCIA 3BC3A 1CPJA 4YYUA 2FO5A 3BBAA 2XU3A 1BP4A 1CS8A 4M0WA 5KO3A 3BCNA 1ITOA 3OQCA 5CVNB 4I04A 1GECE 1PXVA 2FYEA 1PVJA 3PHUA 4N4ZA 3W31A 4MZSA 4K7CA 3NHEA 5J94A 3E1ZB 2E01A 2C0YA 3CBJA 1YK7A 3C0RA 4WURA 1ME3A 1U9XA 2P7UA 1AYVA 4YYVA 2ATOA
chains in the Genus database with same CATH topology
4CZWA 3U8EA 1F2BA 3QT4A 1GMYA 1KFUL 1AU3A 3TNXA 5K16A 1SP4B 2GFOA 2DJFB 1CB5A 2P86A 3WXEA 4OELA 1CSBB 3MHSA 1BQIA 3PBHA 4W5CA 1CVZA 2YJBA 4PP2E 4Q8HA 4X6HA 2BDLA 1PPDA 2B1NA 1Y08A 2F7DA 3OF8A 4GUZA 2YJCA 1KHQA 4PADA 3OVXA 2XU4A 1VSNA 3HD3A 3MHHA 2OZ2A 3C9EA 3BOWA 1EWLA 2PREA 3LTWA 4YV8A 2NQIA 4QH6A 4PI3A 1ZIVA 2WBFX 1YT7A 3RVWA 1PIPA 1AYWA 2R9NA 3IUTA 4B55A 1AU4A 4DMYA 2E00A 5CVOB 3ZUAA 3N4CA 3BPFA 2GHUA 1NQCA 1YALA 4G54A 3K9MA 1BY8A 2DC7A 2DCBA 1O0EA 3H6SA 4FK5A 4OEMA 1STFE 1CQDA 1Q6KA 1YK8A 1CJLA 1VJVA 4BPVA 4AXLA 3K24A 4QRGA 2G6DA 1K3BB 3GCBA 2CIOA 4AXMA 4QRVA 2DC9A 3D9WA 2CB5A 2YJ8A 3OISA 4N79A 2AUXA 3H89A 4QRXA 1F2AA 4BQVA 3V6EA 1CV8A 4CDEB 2HXZA 1AU0A 3HHIA 1BGOA 2AVWA 2DZZA 2NQDB 3CBKA 3KKUA 1TU6A 3LFYA 4ZUXU 4HWYA 3N3KA 3LXSA 1PPPA 2FTDA 3IOQA 1EWOA 1GLOA 1POPA 1IWDA 2E02A 1QMYA 2B1MA 5A24A 1AYUA 2DCDA 4W4UA 1TLOA 3BPMA 1MEGA 1AU2A 4MSXA 3KFQA 1S4VA 4X6JA 4I05A 4XUIA 3M99A 1DEUA 2JQFR 3USVA 3K8UA 3V6CA 1EWPA 2FUDA 4YYQA 3O1GA 9PAPA 3MTNA 1MEMA 4P6EA 1PPOA 2NQAA 3PNRA 2AU1A 3PW3A 3KWBX 3H8BA 5EF4A 3IHPA 1CTEA 2DCAA 1MIRA 2HD5A 1U9VA 1GCBA 2G8EA 2PADA 5CVMA 1ICFA 1XKGA 1KFXL 1PADA 4Q8GA 2PBHA 4KLBA 4CDDB 1MS6A 3P5XA 2BDZA 1F2CA 3CH2X 4YYWA 2PNSA 5CHVA 2BSZA 1MDWA 2R9MA 3P5WA 4NV8A 2DC8A 2Y6EA 2AIMA 2Y5BA 4YVAA 1M6DA 3IMAA 4P6GA 1KXRA 2XU1A 3AI8A 2AYOA 2FRAA 3P5UA 4PP1A 1DF0A 5JA7A 1U9WA 4BSQA 4I07A 1X9YA 4X6IA 3HWNA 5F02A 1QOLA 3I06A 1ME4A 1A6RA 2G8JA 3I3TA 3MORA 2G7YA 1W5RA 1NB3A 3H8CA 2R9CA 1PE6A 1QXPA 1JQPA 1U9QX 1NB5A 3S3QA 3H7DA 3S3RA 5CHTA 2XU5A 1GX3A 2AUZA 3KWZA 3BWKA 2DJGB 4BS6A 4FIPA 4FJCA 3IEJA 1ZCMA 7PCKA 5EGWA 1F29A 3KX1A 2DCCA 1NLJA 2JQGR 3KSEA 1KHPA 1MHWA 4CDCB 4DMXA 3P5VA 1HUCB 1EF7A 1W4TA 3IV2A 1AECA 1PPNA 2P0RA 1PBHA 2R9OA 1FH0A 6PADA 1ATKA 2IPPB 3RVXA 3OF9A 3B79A 3DF0A 3F5VA 8PCHA 1THEA 2IBIA 4BGFA 2DC6A 5FPWA 1W6FA 2FT2A 3D6SA 2VHFA 5JH3A 3CH3X 3HHAA 4WA6A 2H7JA 1Y4HA 5PADA 2R6NA 3QSDA 2VHSA 4CDFB 3RVVA 2HH5A 4W5BA 2F1GA 1TL9A 3OVZA 3N3GA 2FRQA 4C5PA 2AYNA 2VFCA 2VFBA 4MZOA 3O0UA 3KW9A 3QJ3A 1EWMA 3WXGA 4XR7A 4YYSA 3F75A 2YJ9A 4QBBA 2OP3A 1AIMA 1QDQA 1YVBA 4RY2A 4BS5A 4N8WA 3PDFA 2ACTA 2E03A 2ARYA 2R9FA 1NL6A 4YYRA 1U5IA 2OULA 1NPZA 4NV7A 2DZYA 2FQ9A 1SNKA 2NQGA 3ERVA 3WXFA 2O6XA 2AS8A 2YJ2A 2HHNA 1PCIA 3BC3A 1CPJA 4YYUA 2FO5A 2XU3A 1BP4A 1CS8A 3BCNA 1ITOA 5CVNB 4I04A 1GECE 1PXVA 2FYEA 4N4ZA 4MZSA 4K7CA 1E2TA 3NHEA 5J94A 3E1ZB 2E01A 2C0YA 3CBJA 1YK7A 1ME3A 1U9XA 2P7UA 1AYVA 4YYVA 2ATOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZW A;  3U8E A;  1F2B A;  3QT4 A;  1GMY A;  1KFU L;  1AU3 A;  3TNX A;  5K16 A;  1SP4 B;  2GFO A;  2DJF B;  1CB5 A;  2P86 A;  3WXE A;  4OEL A;  1CSB B;  3MHS A;  1BQI A;  3PBH A;  4W5C A;  1CVZ A;  2YJB A;  4PP2 E;  4Q8H A;  4X6H A;  2BDL A;  1PPD A;  2B1N A;  1Y08 A;  2F7D A;  3OF8 A;  2YJC A;  1KHQ A;  4PAD A;  3OVX A;  2XU4 A;  1VSN A;  3HD3 A;  3MHH A;  2OZ2 A;  3C9E A;  3BOW A;  1EWL A;  2PRE A;  4YV8 A;  2NQI A;  4QH6 A;  4PI3 A;  1ZIV A;  2WBF X;  1YT7 A;  3RVW A;  1PIP A;  1AYW A;  2R9N A;  3IUT A;  1AU4 A;  4DMY A;  2E00 A;  5CVO B;  3ZUA A;  3N4C A;  3BPF A;  2GHU A;  1NQC A;  1YAL A;  4G54 A;  3K9M A;  1BY8 A;  2DC7 A;  2DCB A;  1O0E A;  3H6S A;  4FK5 A;  4OEM A;  1STF E;  1CQD A;  1Q6K A;  1YK8 A;  1CJL A;  1VJV A;  4BPV A;  4AXL A;  3K24 A;  4QRG A;  2G6D A;  1K3B B;  3GCB A;  2CIO A;  4AXM A;  4QRV A;  2DC9 A;  2CB5 A;  2YJ8 A;  3OIS A;  4N79 A;  2AUX A;  3H89 A;  4QRX A;  1F2A A;  4BQV A;  3V6E A;  1CV8 A;  4CDE B;  2HXZ A;  1AU0 A;  3HHI A;  1BGO A;  2AVW A;  2DZZ A;  2NQD B;  3CBK A;  3KKU A;  1TU6 A;  3LFY A;  4ZUX U;  4HWY A;  3N3K A;  3LXS A;  1PPP A;  2FTD A;  3IOQ A;  1EWO A;  1GLO A;  1POP A;  1IWD A;  2E02 A;  1QMY A;  2B1M A;  5A24 A;  1AYU A;  2DCD A;  4W4U A;  1TLO A;  3BPM A;  1MEG A;  1AU2 A;  4MSX A;  3KFQ A;  1S4V A;  4X6J A;  4I05 A;  4XUI A;  3M99 A;  1DEU A;  2JQF R;  3USV A;  3K8U A;  3V6C A;  1EWP A;  2FUD A;  4YYQ A;  3O1G A;  9PAP A;  3MTN A;  1MEM A;  4P6E A;  1PPO A;  2NQA A;  3PNR A;  2AU1 A;  3PW3 A;  3KWB X;  3H8B A;  5EF4 A;  3IHP A;  1CTE A;  2DCA A;  1MIR A;  2HD5 A;  1U9V A;  1GCB A;  2G8E A;  2PAD A;  5CVM A;  1ICF A;  1XKG A;  1KFX L;  1PAD A;  4Q8G A;  2PBH A;  4KLB A;  4CDD B;  1MS6 A;  3P5X A;  2BDZ A;  1F2C A;  3CH2 X;  4YYW A;  2PNS A;  5CHV A;  1MDW A;  2R9M A;  3P5W A;  2DC8 A;  2Y6E A;  2AIM A;  2Y5B A;  4YVA A;  1M6D A;  3IMA A;  4P6G A;  1KXR A;  2XU1 A;  3AI8 A;  2AYO A;  2FRA A;  3P5U A;  4PP1 A;  1DF0 A;  5JA7 A;  1U9W A;  4BSQ A;  4I07 A;  1X9Y A;  4X6I A;  3HWN A;  5F02 A;  1QOL A;  3I06 A;  1ME4 A;  1A6R A;  2G8J A;  3I3T A;  3MOR A;  2G7Y A;  1NB3 A;  3H8C A;  2R9C A;  1PE6 A;  1QXP A;  1JQP A;  1U9Q X;  1NB5 A;  3S3Q A;  3H7D A;  3S3R A;  5CHT A;  2XU5 A;  2AUZ A;  3KWZ A;  3BWK A;  2DJG B;  4BS6 A;  4FIP A;  4FJC A;  3IEJ A;  1ZCM A;  7PCK A;  5EGW A;  1F29 A;  3KX1 A;  2DCC A;  1NLJ A;  2JQG R;  3KSE A;  1KHP A;  1MHW A;  4CDC B;  4DMX A;  3P5V A;  1HUC B;  1EF7 A;  3IV2 A;  1AEC A;  1PPN A;  2P0R A;  1PBH A;  2R9O A;  1FH0 A;  6PAD A;  1ATK A;  2IPP B;  3RVX A;  3OF9 A;  3B79 A;  3DF0 A;  3F5V A;  8PCH A;  1THE A;  2IBI A;  2DC6 A;  5FPW A;  2FT2 A;  3D6S A;  2VHF A;  5JH3 A;  3CH3 X;  3HHA A;  4WA6 A;  2H7J A;  1Y4H A;  5PAD A;  2R6N A;  3QSD A;  2VHS A;  4CDF B;  3RVV A;  2HH5 A;  4W5B A;  2F1G A;  1TL9 A;  3OVZ A;  3N3G A;  2FRQ A;  2AYN A;  4MZO A;  3O0U A;  3KW9 A;  3QJ3 A;  1EWM A;  3WXG A;  4XR7 A;  4YYS A;  3F75 A;  2YJ9 A;  4QBB A;  2OP3 A;  1AIM A;  1QDQ A;  1YVB A;  4RY2 A;  4BS5 A;  4N8W A;  3PDF A;  2ACT A;  2E03 A;  2ARY A;  2R9F A;  1NL6 A;  4YYR A;  1U5I A;  2OUL A;  1NPZ A;  2DZY A;  2FQ9 A;  1SNK A;  2NQG A;  3ERV A;  3WXF A;  2O6X A;  2AS8 A;  2YJ2 A;  2HHN A;  1PCI A;  3BC3 A;  1CPJ A;  4YYU A;  2FO5 A;  2XU3 A;  1BP4 A;  1CS8 A;  3BCN A;  1ITO A;  5CVN B;  4I04 A;  1GEC E;  1PXV A;  2FYE A;  4N4Z A;  4MZS A;  4K7C A;  3NHE A;  5J94 A;  3E1Z B;  2E01 A;  2C0Y A;  3CBJ A;  1YK7 A;  1ME3 A;  1U9X A;  2P7U A;  1AYV A;  4YYV A;  2ATO A; 
#chains in the Genus database with same CATH topology
 4CZW A;  3U8E A;  1F2B A;  3QT4 A;  1GMY A;  1KFU L;  3O65 A;  1AU3 A;  3TNX A;  3PRM A;  5K16 A;  4BOS A;  1SP4 B;  2GFO A;  2DJF B;  1CB5 A;  3PT2 A;  2P86 A;  3WXE A;  4OEL A;  1CSB B;  3RNV A;  3MHS A;  1BQI A;  3PBH A;  2FE8 A;  4W5C A;  1CVZ A;  2YJB A;  4PP2 E;  4Q8H A;  4X6H A;  2BDL A;  1PPD A;  2B1N A;  1Y08 A;  2F7D A;  3OF8 A;  2YJC A;  5EZS A;  1KHQ A;  4PAD A;  3OVX A;  2XU4 A;  1VSN A;  3HD3 A;  4RF0 A;  3MHH A;  3E9S A;  2OZ2 A;  3C9E A;  3BOW A;  3PRP A;  1EWL A;  4XZX A;  2PRE A;  4YV8 A;  2NQI A;  4QH6 A;  4PI3 A;  1ZIV A;  3TMP A;  2WBF X;  1YT7 A;  3RVW A;  1PIP A;  1AYW A;  2R9N A;  3IUT A;  1AU4 A;  4DMY A;  2E00 A;  5CVO B;  3ZUA A;  3N4C A;  3BPF A;  2GHU A;  4MM3 B;  1NQC A;  1YAL A;  4G54 A;  3K9M A;  2HWK A;  1BY8 A;  2DC7 A;  2DCB A;  1O0E A;  3BY4 A;  3PSE A;  3H6S A;  4FK5 A;  4OEM A;  1STF E;  1CQD A;  4BOZ A;  1Q6K A;  1YK8 A;  3W30 A;  1CJL A;  1VJV A;  2J7Q A;  4REZ A;  4BPV A;  4AXL A;  4MI7 A;  3K24 A;  4QRG A;  2G6D A;  1K3B B;  1DKI A;  4R3D A;  3GCB A;  2CIO A;  4RF1 A;  3MTV A;  4AXM A;  4QRV A;  2DC9 A;  2CB5 A;  4PT5 A;  2YJ8 A;  3OIS A;  4N79 A;  2AUX A;  3H89 A;  4QRX A;  1F2A A;  4BQV A;  3V6E A;  1CV8 A;  4CDE B;  2HXZ A;  1AU0 A;  3HHI A;  1BGO A;  2AVW A;  2DZZ A;  2NQD B;  3CBK A;  3KKU A;  1TU6 A;  4RKX A;  2Z84 A;  3LFY A;  4ZUX U;  4HWY A;  3N3K A;  2JRI A;  3LXS A;  1PPP A;  2FTD A;  3IOQ A;  1EWO A;  1GLO A;  1POP A;  1IWD A;  2E02 A;  1QMY A;  2B1M A;  5A24 A;  1AYU A;  2DCD A;  4W4U A;  1TLO A;  3BPM A;  1MEG A;  1AU2 A;  4MSX A;  3KFQ A;  1S4V A;  4X6J A;  4I05 A;  4XUI A;  3IFU A;  4A5U A;  3M99 A;  1DEU A;  2JQF R;  3USV A;  3K8U A;  3V6C A;  1EWP A;  2FUD A;  4YYQ A;  3O1G A;  9PAP A;  3MTN A;  1MEM A;  4P6E A;  1PPO A;  5JZE A;  2NQA A;  3PNR A;  2AU1 A;  3PW3 A;  3KWB X;  3H8B A;  5EF4 A;  3IHP A;  1CTE A;  2DCA A;  1MIR A;  2DOS A;  2HD5 A;  2AGA A;  1U9V A;  1GCB A;  2G8E A;  2PAD A;  4BOQ A;  5CVM A;  4IUM A;  1ICF A;  1XKG A;  3PHX A;  1KFX L;  1PAD A;  4Q8G A;  2PBH A;  4KLB A;  4CDD B;  1MS6 A;  3P5X A;  2BDZ A;  3MJ5 A;  1F2C A;  3CH2 X;  4YYW A;  2PNS A;  5CHV A;  5EZQ A;  1MDW A;  2R9M A;  3P5W A;  4D8E A;  2DC8 A;  2Y6E A;  2AIM A;  2Y5B A;  4YVA A;  1M6D A;  3IMA A;  4P6G A;  1KXR A;  4BOP A;  2XU1 A;  3AI8 A;  2AYO A;  3B21 A;  2J7Q C;  2FRA A;  3P5U A;  4PP1 A;  1DF0 A;  5JA7 A;  1U9W A;  4BSQ A;  4I07 A;  1X9Y A;  4X6I A;  3ZNH A;  4P16 A;  3HWN A;  5F02 A;  1QOL A;  3I06 A;  1ME4 A;  1A6R A;  2G8J A;  3I3T A;  3MOR A;  2G7Y A;  1NB3 A;  3H8C A;  2R9C A;  1PE6 A;  1QXP A;  1JQP A;  1U9Q X;  1NB5 A;  3S3Q A;  3H7D A;  3S3R A;  5CHT A;  2XU5 A;  2AUZ A;  3KWZ A;  3BWK A;  2DJG B;  4BS6 A;  4FIP A;  3TRK A;  4HXD B;  4FJC A;  3IEJ A;  1ZCM A;  7PCK A;  5EGW A;  1F29 A;  3KX1 A;  2DCC A;  2JTC A;  1NLJ A;  2JQG R;  3KSE A;  4D8I A;  1KHP A;  2BTW A;  1MHW A;  4CDC B;  4OW0 A;  4BOU A;  4DMX A;  3P5V A;  1HUC B;  1EF7 A;  3IV2 A;  4IP3 A;  1AEC A;  1PPN A;  5E6J A;  2P0R A;  1PBH A;  2R9O A;  1FH0 A;  6PAD A;  1ATK A;  2IPP B;  3RVX A;  3OF9 A;  3B79 A;  3DF0 A;  3F5V A;  8PCH A;  1THE A;  2BTW B;  2IBI A;  4ZTB A;  2DC6 A;  4D8B A;  5FPW A;  3PHW A;  2FT2 A;  1UKF A;  3D6S A;  2VHF A;  5JH3 A;  3CH3 X;  3HHA A;  4WA6 A;  2H7J A;  1Y4H A;  5PAD A;  2R6N A;  3QSD A;  2VHS A;  4CDF B;  3RVV A;  2HH5 A;  4W5B A;  2F1G A;  1TL9 A;  3OVZ A;  3N3G A;  2FRQ A;  2UZJ A;  2AYN A;  4MZO A;  3O0U A;  3KW9 A;  3QJ3 A;  1EWM A;  3MP2 A;  3WXG A;  4XR7 A;  4OVZ A;  4YYS A;  3F75 A;  2YJ9 A;  3BB7 A;  4QBB A;  2OP3 A;  1AIM A;  1QDQ A;  1YVB A;  4RY2 A;  4BS5 A;  4N8W A;  3PDF A;  4OVZ B;  2ACT A;  2E03 A;  2ARY A;  2R9F A;  4GUA A;  1NL6 A;  4YYR A;  1U5I A;  2OUL A;  4RNA A;  1YZB A;  1NPZ A;  2DZY A;  2BU3 A;  2FQ9 A;  1SNK A;  2NQG A;  3ERV A;  3WXF A;  2O6X A;  2AS8 A;  2YJ2 A;  2HHN A;  1PCI A;  3BC3 A;  1CPJ A;  4YYU A;  2FO5 A;  3BBA A;  2XU3 A;  1BP4 A;  1CS8 A;  4M0W A;  5KO3 A;  3BCN A;  1ITO A;  3OQC A;  5CVN B;  4I04 A;  1GEC E;  1PXV A;  2FYE A;  1PVJ A;  3PHU A;  4N4Z A;  3W31 A;  4MZS A;  4K7C A;  3NHE A;  5J94 A;  3E1Z B;  2E01 A;  2C0Y A;  3CBJ A;  1YK7 A;  3C0R A;  4WUR A;  1ME3 A;  1U9X A;  2P7U A;  1AYV A;  4YYV A;  2ATO A; 
#chains in the Genus database with same CATH homology
 4CZW A;  3U8E A;  1F2B A;  3QT4 A;  1GMY A;  1KFU L;  1AU3 A;  3TNX A;  5K16 A;  1SP4 B;  2GFO A;  2DJF B;  1CB5 A;  2P86 A;  3WXE A;  4OEL A;  1CSB B;  3MHS A;  1BQI A;  3PBH A;  4W5C A;  1CVZ A;  2YJB A;  4PP2 E;  4Q8H A;  4X6H A;  2BDL A;  1PPD A;  2B1N A;  1Y08 A;  2F7D A;  3OF8 A;  4GUZ A;  2YJC A;  1KHQ A;  4PAD A;  3OVX A;  2XU4 A;  1VSN A;  3HD3 A;  3MHH A;  2OZ2 A;  3C9E A;  3BOW A;  1EWL A;  2PRE A;  3LTW A;  4YV8 A;  2NQI A;  4QH6 A;  4PI3 A;  1ZIV A;  2WBF X;  1YT7 A;  3RVW A;  1PIP A;  1AYW A;  2R9N A;  3IUT A;  4B55 A;  1AU4 A;  4DMY A;  2E00 A;  5CVO B;  3ZUA A;  3N4C A;  3BPF A;  2GHU A;  1NQC A;  1YAL A;  4G54 A;  3K9M A;  1BY8 A;  2DC7 A;  2DCB A;  1O0E A;  3H6S A;  4FK5 A;  4OEM A;  1STF E;  1CQD A;  1Q6K A;  1YK8 A;  1CJL A;  1VJV A;  4BPV A;  4AXL A;  3K24 A;  4QRG A;  2G6D A;  1K3B B;  3GCB A;  2CIO A;  4AXM A;  4QRV A;  2DC9 A;  3D9W A;  2CB5 A;  2YJ8 A;  3OIS A;  4N79 A;  2AUX A;  3H89 A;  4QRX A;  1F2A A;  4BQV A;  3V6E A;  1CV8 A;  4CDE B;  2HXZ A;  1AU0 A;  3HHI A;  1BGO A;  2AVW A;  2DZZ A;  2NQD B;  3CBK A;  3KKU A;  1TU6 A;  3LFY A;  4ZUX U;  4HWY A;  3N3K A;  3LXS A;  1PPP A;  2FTD A;  3IOQ A;  1EWO A;  1GLO A;  1POP A;  1IWD A;  2E02 A;  1QMY A;  2B1M A;  5A24 A;  1AYU A;  2DCD A;  4W4U A;  1TLO A;  3BPM A;  1MEG A;  1AU2 A;  4MSX A;  3KFQ A;  1S4V A;  4X6J A;  4I05 A;  4XUI A;  3M99 A;  1DEU A;  2JQF R;  3USV A;  3K8U A;  3V6C A;  1EWP A;  2FUD A;  4YYQ A;  3O1G A;  9PAP A;  3MTN A;  1MEM A;  4P6E A;  1PPO A;  2NQA A;  3PNR A;  2AU1 A;  3PW3 A;  3KWB X;  3H8B A;  5EF4 A;  3IHP A;  1CTE A;  2DCA A;  1MIR A;  2HD5 A;  1U9V A;  1GCB A;  2G8E A;  2PAD A;  5CVM A;  1ICF A;  1XKG A;  1KFX L;  1PAD A;  4Q8G A;  2PBH A;  4KLB A;  4CDD B;  1MS6 A;  3P5X A;  2BDZ A;  1F2C A;  3CH2 X;  4YYW A;  2PNS A;  5CHV A;  2BSZ A;  1MDW A;  2R9M A;  3P5W A;  4NV8 A;  2DC8 A;  2Y6E A;  2AIM A;  2Y5B A;  4YVA A;  1M6D A;  3IMA A;  4P6G A;  1KXR A;  2XU1 A;  3AI8 A;  2AYO A;  2FRA A;  3P5U A;  4PP1 A;  1DF0 A;  5JA7 A;  1U9W A;  4BSQ A;  4I07 A;  1X9Y A;  4X6I A;  3HWN A;  5F02 A;  1QOL A;  3I06 A;  1ME4 A;  1A6R A;  2G8J A;  3I3T A;  3MOR A;  2G7Y A;  1W5R A;  1NB3 A;  3H8C A;  2R9C A;  1PE6 A;  1QXP A;  1JQP A;  1U9Q X;  1NB5 A;  3S3Q A;  3H7D A;  3S3R A;  5CHT A;  2XU5 A;  1GX3 A;  2AUZ A;  3KWZ A;  3BWK A;  2DJG B;  4BS6 A;  4FIP A;  4FJC A;  3IEJ A;  1ZCM A;  7PCK A;  5EGW A;  1F29 A;  3KX1 A;  2DCC A;  1NLJ A;  2JQG R;  3KSE A;  1KHP A;  1MHW A;  4CDC B;  4DMX A;  3P5V A;  1HUC B;  1EF7 A;  1W4T A;  3IV2 A;  1AEC A;  1PPN A;  2P0R A;  1PBH A;  2R9O A;  1FH0 A;  6PAD A;  1ATK A;  2IPP B;  3RVX A;  3OF9 A;  3B79 A;  3DF0 A;  3F5V A;  8PCH A;  1THE A;  2IBI A;  4BGF A;  2DC6 A;  5FPW A;  1W6F A;  2FT2 A;  3D6S A;  2VHF A;  5JH3 A;  3CH3 X;  3HHA A;  4WA6 A;  2H7J A;  1Y4H A;  5PAD A;  2R6N A;  3QSD A;  2VHS A;  4CDF B;  3RVV A;  2HH5 A;  4W5B A;  2F1G A;  1TL9 A;  3OVZ A;  3N3G A;  2FRQ A;  4C5P A;  2AYN A;  2VFC A;  2VFB A;  4MZO A;  3O0U A;  3KW9 A;  3QJ3 A;  1EWM A;  3WXG A;  4XR7 A;  4YYS A;  3F75 A;  2YJ9 A;  4QBB A;  2OP3 A;  1AIM A;  1QDQ A;  1YVB A;  4RY2 A;  4BS5 A;  4N8W A;  3PDF A;  2ACT A;  2E03 A;  2ARY A;  2R9F A;  1NL6 A;  4YYR A;  1U5I A;  2OUL A;  1NPZ A;  4NV7 A;  2DZY A;  2FQ9 A;  1SNK A;  2NQG A;  3ERV A;  3WXF A;  2O6X A;  2AS8 A;  2YJ2 A;  2HHN A;  1PCI A;  3BC3 A;  1CPJ A;  4YYU A;  2FO5 A;  2XU3 A;  1BP4 A;  1CS8 A;  3BCN A;  1ITO A;  5CVN B;  4I04 A;  1GEC E;  1PXV A;  2FYE A;  4N4Z A;  4MZS A;  4K7C A;  1E2T A;  3NHE A;  5J94 A;  3E1Z B;  2E01 A;  2C0Y A;  3CBJ A;  1YK7 A;  1ME3 A;  1U9X A;  2P7U A;  1AYV A;  4YYV A;  2ATO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...