1MHWA

Design of non-covalent inhibitors of human cathepsin l. from the 96-residue proregion to optimized tripeptides
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
173
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L
publication title Design of non-covalent inhibitors of human cathepsin L. From the 96-residue proregion to optimized tripeptides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 173
sequence length 174
chains with identical sequence B
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2002-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1mhwA00
3F75A 4QH6A 4HWYA 4Q8HA 2GFOA 1YVBA 3K8UA 4MZOA 2F7DA 4PI3A 1S4VA 1K3BB 2OP3A 3H8CA 1CTEA 3MORA 4XUIA 1VJVA 1JQPA 1CVZA 3O1GA 1DF0A 2YJBA 1NQCA 2PADA 3H89A 3WXEA 1TU6A 1AU2A 3ERVA 1PADA 3N3KA 1X9YA 2XU4A 3IOQA 4QRGA 3DF0A 1BQIA 3BC3A 1YK7A 2FQ9A 1O0EA 2E03A 4BS5A 2DC8A 3BPMA 3CBKA 3QSDA 3KX1A 9PAPA 3I3TA 2AUZA 4W5BA 1EWMA 3O0UA 4I05A 1GMYA 5EF4A 3P5WA 4I04A 4AXMA 2DJGB 4YYRA 1ME4A 1PPDA 4YYVA 3KWZA 5EGWA 3ZUAA 2B1NA 3PDFA 4X6HA 3C9EA 3MHHA 1MEGA 2AYNA 2ATOA 2HD5A 1ITOA 2BDZA 1CB5A 1THEA 4DMXA 4X6IA 3KWBX 2FRAA 1NB3A 5PADA 2NQIA 2ARYA 2R6NA 3CH2X 2NQDB 1KHQA 2R9NA 1DEUA 1CPJA 2Y6EA 4ZUXU 3K9MA 3CBJA 5CVMA 3MTNA 5K16A 1NL6A 1SP4B 1YALA 2E00A 3TNXA 2FO5A 3KSEA 1Q6KA 3E1ZB 1CV8A 3CH3X 2YJ9A 1NLJA 1FH0A 2DCBA 2CIOA 1F2AA 3H6SA 3P5UA 5CVNB 4YV8A 1A6RA 3OVXA 3PBHA 3IV2A 1MHWA 2Y5BA 4G54A 4RY2A 4W5CA 1AYVA 2P7UA 1CSBB 3IHPA 3S3QA 1EWOA 1QOLA 2HH5A 4MZSA 2G8JA 3N3GA 1GCBA 1NB5A 2G8EA 3WXGA 2AVWA 1PE6A 2G6DA 3QT4A 3P5XA 2DC7A 1QMYA 2DC6A 1KHPA 1TLOA 3S3RA 1PBHA 1XKGA 3LXSA 2YJ2A 4I07A 2IBIA 3BPFA 1AIMA 1NPZA 4XR7A 3HD3A 1U9XA 3OISA 2DCAA 1EWPA 2FUDA 2PNSA 1GLOA 2FTDA 2XU5A 3RVWA 8PCHA 3PW3A 3K24A 5CHVA 5JA7A 7PCKA 4FIPA 4BSQA 4W4UA 4OELA 2C0YA 2AU1A 2B1MA 2R9MA 1ATKA 1YT7A 2DZZA 4N8WA 1MEMA 2BDLA 4KLBA 3U8EA 5A24A 1AECA 1BY8A 4YYUA 1F2BA 2PBHA 4BS6A 4X6JA 4QRXA 1HUCB 2AUXA 1SNKA 2YJ8A 3HHIA 2AIMA 2G7YA 4YYWA 2WBFX 2NQAA 3M99A 2P86A 3IEJA 1Y08A 2NQGA 4K7CA 1PPOA 1VSNA 3OF9A 2AS8A 2JQFR 2E02A 5JH3A 3OVZA 4MSXA 4YVAA 1ZCMA 1PCIA 1CQDA 3RVVA 3HWNA 5F02A 1BGOA 1YK8A 3V6CA 2HXZA 3OF8A 2GHUA 1STFE 2HHNA 1ME3A 1GECE 3IMAA 2XU1A 4BQVA 2PREA 3F5VA 4QRVA 2P0RA 3KW9A 1ZIVA 4YYSA 2DJFB 3GCBA 4WA6A 3KKUA 1PPNA 2ACTA 1PXVA 4CDDB 2DC9A 4CDFB 4BPVA 2XU3A 3H7DA 2DCCA 3HHAA 4CDEB 2FRQA 2R9CA 3BWKA 2VHSA 2YJCA 4P6EA 2H7JA 4OEMA 4Q8GA 1EWLA 2R9OA 4QBBA 4YYQA 2IPPB 4P6GA 1AU3A 1ICFA 1CJLA 1AYUA 4N79A 2OULA 4DMYA 1PPPA 1MIRA 3P5VA 1TL9A 3BCNA 3LFYA 4CDCB 2FYEA 3MHSA 3WXFA 2DZYA 1KFXL 3RVXA 1EF7A 1AU4A 1MS6A 3KFQA 3BOWA 1BP4A 1U9WA 1POPA 5FPWA 2OZ2A 1QXPA 1KXRA 3N4CA 2F1GA 1U9VA 4N4ZA 1U5IA 3V6EA 3NHEA 6PADA 1QDQA 1M6DA 3QJ3A 1F2CA 3IUTA 4PADA 2CB5A 1PIPA 4CZWA 3AI8A 2FT2A 3PNRA 1F29A 2DCDA 2O6XA 5CVOB 1U9QX 2R9FA 4FK5A 5CHTA 1MDWA 4PP2E 5J94A 2JQGR 1Y4HA 2AYOA 2E01A 3USVA 4AXLA 3H8BA 3I06A 1KFUL 1CS8A 3B79A 1AYWA 1IWDA 3D6SA 4FJCA 2VHFA 1AU0A 4PP1A
chains in the Genus database with same CATH superfamily
3F75A 4QH6A 4HWYA 4HXDB 2GFOA 4Q8HA 1YVBA 4MI7A 3K8UA 4MZOA 2F7DA 4PI3A 4D8BA 1S4VA 1K3BB 2OP3A 3H8CA 1CTEA 3MORA 4XUIA 4XZXA 1VJVA 1JQPA 1CVZA 3O1GA 1DF0A 2YJBA 1NQCA 2PADA 3H89A 3WXEA 1TU6A 1AU2A 3ERVA 4A5UA 1PADA 3BB7A 3N3KA 1X9YA 2XU4A 3IOQA 4OW0A 4QRGA 3DF0A 1BQIA 3BC3A 1YK7A 3MJ5A 2FQ9A 3PHWA 1O0EA 2E03A 4BS5A 2DC8A 3BPMA 3CBKA 3QSDA 4BOUA 3KX1A 9PAPA 3I3TA 2AUZA 4W5BA 3RNVA 1EWMA 3O0UA 4I05A 1GMYA 5EF4A 3P5WA 4I04A 4AXMA 2DJGB 4YYRA 1ME4A 1PPDA 4YYVA 3KWZA 5EGWA 3O65A 3ZUAA 2B1NA 3PDFA 4X6HA 3C9EA 3MHHA 1MEGA 3ZNHA 2AYNA 2ATOA 2HD5A 1ITOA 2BDZA 1CB5A 1THEA 4DMXA 4X6IA 3KWBX 2FRAA 4RNAA 1NB3A 5PADA 2NQIA 2ARYA 2R6NA 3CH2X 2NQDB 1KHQA 4PT5A 2R9NA 1DEUA 1CPJA 2Y6EA 4ZUXU 3K9MA 4MM3B 3CBJA 5CVMA 3TMPA 3MTNA 5K16A 2BTWB 1NL6A 1SP4B 1YALA 2E00A 3TNXA 2FO5A 3KSEA 4RF0A 1Q6KA 3E1ZB 1CV8A 3B21A 2FE8A 5EZQA 3CH3X 2YJ9A 1NLJA 1FH0A 2DCBA 2CIOA 1F2AA 3H6SA 3P5UA 5CVNB 4YV8A 1A6RA 3OVXA 3PBHA 3IV2A 4OVZB 1MHWA 2Y5BA 4G54A 4RY2A 4W5CA 1AYVA 2P7UA 1CSBB 3IHPA 4BOZA 4GUAA 3S3QA 1EWOA 1QOLA 2HH5A 4MZSA 2G8JA 3N3GA 3PRMA 1GCBA 1NB5A 2G8EA 3WXGA 2AVWA 1PE6A 2G6DA 3QT4A 3P5XA 2DC7A 1QMYA 2DC6A 4D8EA 1KHPA 1TLOA 3S3RA 1PBHA 4BOQA 1XKGA 3LXSA 2YJ2A 4I07A 2IBIA 3BPFA 1AIMA 1NPZA 4XR7A 3HD3A 2JRIA 1U9XA 3OISA 5JZEA 2DCAA 1EWPA 2FUDA 2PNSA 1GLOA 2FTDA 2XU5A 3RVWA 8PCHA 2BU3A 3PW3A 3K24A 5CHVA 5JA7A 7PCKA 4FIPA 4BSQA 4W4UA 4OELA 2C0YA 2AU1A 2B1MA 2R9MA 1ATKA 1YT7A 2DZZA 3PT2A 4N8WA 1MEMA 2BDLA 4KLBA 3U8EA 5A24A 1AECA 1BY8A 4YYUA 1F2BA 1UKFA 2PBHA 4BS6A 4X6JA 4QRXA 1HUCB 4R3DA 2AUXA 1SNKA 2YJ8A 3HHIA 2AIMA 2G7YA 4YYWA 2WBFX 2NQAA 3M99A 2P86A 3IEJA 1Y08A 3PHXA 2NQGA 4K7CA 1PPOA 3MP2A 1VSNA 5KO3A 3OF9A 2AS8A 4REZA 2JQFR 2E02A 5JH3A 3OVZA 4MSXA 4BOSA 4YVAA 4WURA 2BTWA 4D8IA 3OQCA 1ZCMA 1PCIA 1CQDA 3RVVA 3HWNA 5F02A 4RF1A 1BGOA 1YK8A 2Z84A 3V6CA 2HXZA 3OF8A 2GHUA 1STFE 2HHNA 1ME3A 1GECE 3TRKA 2DOSA 3IMAA 2XU1A 4BQVA 2PREA 3F5VA 5EZSA 1DKIA 3PRPA 4QRVA 2P0RA 3KW9A 1ZIVA 4OVZA 4YYSA 2DJFB 3GCBA 4WA6A 3KKUA 1PPNA 2ACTA 1PXVA 4CDDB 2DC9A 4CDFB 4BPVA 2XU3A 4ZTBA 3H7DA 2DCCA 3HHAA 4CDEB 2FRQA 2R9CA 2UZJA 3BWKA 2VHSA 2YJCA 4P6EA 2H7JA 4OEMA 3W30A 4Q8GA 1EWLA 2R9OA 4QBBA 4YYQA 2IPPB 4P6GA 1AU3A 1ICFA 2J7QA 4M0WA 1CJLA 1AYUA 4N79A 2OULA 4DMYA 3BY4A 2AGAA 1PPPA 1MIRA 3P5VA 1TL9A 3BCNA 3LFYA 4CDCB 2FYEA 3MHSA 3WXFA 3PSEA 3BBAA 2DZYA 1KFXL 3RVXA 1EF7A 1AU4A 1MS6A 3KFQA 3BOWA 1BP4A 1U9WA 1POPA 5FPWA 3W31A 4RKXA 2OZ2A 2J7QC 1QXPA 1KXRA 3N4CA 4IUMA 2F1GA 1U9VA 3MTVA 4N4ZA 1U5IA 3V6EA 4IP3A 2HWKA 3NHEA 1PVJA 6PADA 3E9SA 1QDQA 1M6DA 3QJ3A 1F2CA 3IUTA 4PADA 4P16A 2CB5A 2JTCA 1PIPA 4CZWA 3AI8A 2FT2A 3PHUA 3PNRA 1F29A 2DCDA 5E6JA 2O6XA 5CVOB 4BOPA 1U9QX 2R9FA 4FK5A 5CHTA 1MDWA 3C0RA 4PP2E 5J94A 2JQGR 1Y4HA 2AYOA 2E01A 3USVA 4AXLA 3H8BA 3I06A 1KFUL 1CS8A 3B79A 1AYWA 1IWDA 3D6SA 3IFUA 1YZBA 4FJCA 2VHFA 1AU0A 4PP1A
chains in the Genus database with same CATH topology
3F75A 4QH6A 4HWYA 4Q8HA 2GFOA 1YVBA 3K8UA 4MZOA 2F7DA 4PI3A 1S4VA 1K3BB 2OP3A 3H8CA 1CTEA 3MORA 4B55A 4XUIA 1VJVA 1JQPA 1CVZA 3O1GA 1DF0A 2YJBA 1NQCA 2PADA 3H89A 3WXEA 1TU6A 1AU2A 3ERVA 1PADA 3N3KA 1X9YA 2XU4A 3IOQA 4QRGA 3DF0A 1BQIA 3BC3A 1YK7A 2FQ9A 1E2TA 1O0EA 2E03A 4BS5A 2DC8A 3BPMA 3CBKA 3QSDA 3KX1A 9PAPA 3I3TA 2AUZA 4W5BA 1EWMA 3O0UA 4I05A 1GMYA 5EF4A 4C5PA 3P5WA 4I04A 4AXMA 2DJGB 4YYRA 1ME4A 1PPDA 4YYVA 3KWZA 5EGWA 3ZUAA 2B1NA 3PDFA 4X6HA 3C9EA 3MHHA 1MEGA 2AYNA 2ATOA 2HD5A 1ITOA 2BDZA 1CB5A 1THEA 4DMXA 4X6IA 3KWBX 2FRAA 1NB3A 5PADA 2NQIA 3D9WA 2ARYA 2R6NA 3CH2X 2NQDB 1KHQA 2R9NA 1DEUA 1CPJA 2Y6EA 4ZUXU 3K9MA 3CBJA 5CVMA 3MTNA 2BSZA 5K16A 1NL6A 1SP4B 1YALA 2E00A 3TNXA 2FO5A 3KSEA 1Q6KA 3E1ZB 1CV8A 3CH3X 2YJ9A 1NLJA 1FH0A 2DCBA 2CIOA 1F2AA 3H6SA 3P5UA 5CVNB 4YV8A 1A6RA 3OVXA 3PBHA 3IV2A 1MHWA 2Y5BA 4G54A 4RY2A 4W5CA 1AYVA 2P7UA 1CSBB 3IHPA 3S3QA 1EWOA 1QOLA 2HH5A 4MZSA 2G8JA 3N3GA 4GUZA 1GCBA 1NB5A 2G8EA 3WXGA 2AVWA 1PE6A 2G6DA 3QT4A 3P5XA 2DC7A 3LTWA 1QMYA 2DC6A 1KHPA 1TLOA 3S3RA 1PBHA 1XKGA 3LXSA 2YJ2A 4I07A 2IBIA 3BPFA 1AIMA 1NPZA 4XR7A 3HD3A 1U9XA 4NV8A 3OISA 4NV7A 2DCAA 1EWPA 2FUDA 2PNSA 1GLOA 2FTDA 2XU5A 3RVWA 8PCHA 3PW3A 3K24A 5CHVA 5JA7A 7PCKA 4FIPA 4BSQA 4W4UA 4OELA 2C0YA 2AU1A 2B1MA 2R9MA 1ATKA 1YT7A 2DZZA 4N8WA 1MEMA 2BDLA 4KLBA 3U8EA 5A24A 1AECA 1BY8A 4YYUA 1F2BA 2PBHA 4BS6A 4X6JA 4QRXA 1HUCB 2AUXA 1SNKA 2YJ8A 3HHIA 2AIMA 1W6FA 2G7YA 4YYWA 2WBFX 2NQAA 3M99A 2P86A 3IEJA 1Y08A 2NQGA 4K7CA 1PPOA 1VSNA 3OF9A 2AS8A 2VFBA 2JQFR 2E02A 5JH3A 3OVZA 4MSXA 4YVAA 1ZCMA 1PCIA 1CQDA 3RVVA 3HWNA 2VFCA 5F02A 1BGOA 1YK8A 3V6CA 2HXZA 3OF8A 2GHUA 1STFE 2HHNA 1ME3A 1GECE 3IMAA 2XU1A 4BQVA 2PREA 3F5VA 4QRVA 2P0RA 3KW9A 1ZIVA 4YYSA 2DJFB 3GCBA 4WA6A 3KKUA 1PPNA 2ACTA 1PXVA 4CDDB 2DC9A 4CDFB 4BPVA 2XU3A 3H7DA 2DCCA 3HHAA 4CDEB 2FRQA 2R9CA 3BWKA 2VHSA 2YJCA 4P6EA 2H7JA 4OEMA 4Q8GA 1EWLA 2R9OA 4QBBA 4YYQA 2IPPB 4P6GA 1AU3A 1ICFA 1CJLA 1AYUA 4N79A 2OULA 4DMYA 1PPPA 1MIRA 3P5VA 1TL9A 3BCNA 3LFYA 4CDCB 2FYEA 3MHSA 3WXFA 4BGFA 2DZYA 1KFXL 3RVXA 1EF7A 1AU4A 1MS6A 3KFQA 3BOWA 1BP4A 1U9WA 1POPA 5FPWA 2OZ2A 1QXPA 1KXRA 3N4CA 2F1GA 1U9VA 4N4ZA 1U5IA 1W4TA 3V6EA 3NHEA 6PADA 1QDQA 1M6DA 3QJ3A 1F2CA 3IUTA 4PADA 2CB5A 1PIPA 4CZWA 3AI8A 2FT2A 3PNRA 1F29A 2DCDA 1GX3A 2O6XA 5CVOB 1U9QX 2R9FA 4FK5A 5CHTA 1MDWA 1W5RA 4PP2E 5J94A 2JQGR 1Y4HA 2AYOA 2E01A 3USVA 4AXLA 3H8BA 3I06A 1KFUL 1CS8A 3B79A 1AYWA 1IWDA 3D6SA 4FJCA 2VHFA 1AU0A 4PP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F75 A;  4QH6 A;  4HWY A;  4Q8H A;  2GFO A;  1YVB A;  3K8U A;  4MZO A;  2F7D A;  4PI3 A;  1S4V A;  1K3B B;  2OP3 A;  3H8C A;  1CTE A;  3MOR A;  4XUI A;  1VJV A;  1JQP A;  1CVZ A;  3O1G A;  1DF0 A;  2YJB A;  1NQC A;  2PAD A;  3H89 A;  3WXE A;  1TU6 A;  1AU2 A;  3ERV A;  1PAD A;  3N3K A;  1X9Y A;  2XU4 A;  3IOQ A;  4QRG A;  3DF0 A;  1BQI A;  3BC3 A;  1YK7 A;  2FQ9 A;  1O0E A;  2E03 A;  4BS5 A;  2DC8 A;  3BPM A;  3CBK A;  3QSD A;  3KX1 A;  9PAP A;  3I3T A;  2AUZ A;  4W5B A;  1EWM A;  3O0U A;  4I05 A;  1GMY A;  5EF4 A;  3P5W A;  4I04 A;  4AXM A;  2DJG B;  4YYR A;  1ME4 A;  1PPD A;  4YYV A;  3KWZ A;  5EGW A;  3ZUA A;  2B1N A;  3PDF A;  4X6H A;  3C9E A;  3MHH A;  1MEG A;  2AYN A;  2ATO A;  2HD5 A;  1ITO A;  2BDZ A;  1CB5 A;  1THE A;  4DMX A;  4X6I A;  3KWB X;  2FRA A;  1NB3 A;  5PAD A;  2NQI A;  2ARY A;  2R6N A;  3CH2 X;  2NQD B;  1KHQ A;  2R9N A;  1DEU A;  1CPJ A;  2Y6E A;  4ZUX U;  3K9M A;  3CBJ A;  5CVM A;  3MTN A;  5K16 A;  1NL6 A;  1SP4 B;  1YAL A;  2E00 A;  3TNX A;  2FO5 A;  3KSE A;  1Q6K A;  3E1Z B;  1CV8 A;  3CH3 X;  2YJ9 A;  1NLJ A;  1FH0 A;  2DCB A;  2CIO A;  1F2A A;  3H6S A;  3P5U A;  5CVN B;  4YV8 A;  1A6R A;  3OVX A;  3PBH A;  3IV2 A;  1MHW A;  2Y5B A;  4G54 A;  4RY2 A;  4W5C A;  1AYV A;  2P7U A;  1CSB B;  3IHP A;  3S3Q A;  1EWO A;  1QOL A;  2HH5 A;  4MZS A;  2G8J A;  3N3G A;  1GCB A;  1NB5 A;  2G8E A;  3WXG A;  2AVW A;  1PE6 A;  2G6D A;  3QT4 A;  3P5X A;  2DC7 A;  1QMY A;  2DC6 A;  1KHP A;  1TLO A;  3S3R A;  1PBH A;  1XKG A;  3LXS A;  2YJ2 A;  4I07 A;  2IBI A;  3BPF A;  1AIM A;  1NPZ A;  4XR7 A;  3HD3 A;  1U9X A;  3OIS A;  2DCA A;  1EWP A;  2FUD A;  2PNS A;  1GLO A;  2FTD A;  2XU5 A;  3RVW A;  8PCH A;  3PW3 A;  3K24 A;  5CHV A;  5JA7 A;  7PCK A;  4FIP A;  4BSQ A;  4W4U A;  4OEL A;  2C0Y A;  2AU1 A;  2B1M A;  2R9M A;  1ATK A;  1YT7 A;  2DZZ A;  4N8W A;  1MEM A;  2BDL A;  4KLB A;  3U8E A;  5A24 A;  1AEC A;  1BY8 A;  4YYU A;  1F2B A;  2PBH A;  4BS6 A;  4X6J A;  4QRX A;  1HUC B;  2AUX A;  1SNK A;  2YJ8 A;  3HHI A;  2AIM A;  2G7Y A;  4YYW A;  2WBF X;  2NQA A;  3M99 A;  2P86 A;  3IEJ A;  1Y08 A;  2NQG A;  4K7C A;  1PPO A;  1VSN A;  3OF9 A;  2AS8 A;  2JQF R;  2E02 A;  5JH3 A;  3OVZ A;  4MSX A;  4YVA A;  1ZCM A;  1PCI A;  1CQD A;  3RVV A;  3HWN A;  5F02 A;  1BGO A;  1YK8 A;  3V6C A;  2HXZ A;  3OF8 A;  2GHU A;  1STF E;  2HHN A;  1ME3 A;  1GEC E;  3IMA A;  2XU1 A;  4BQV A;  2PRE A;  3F5V A;  4QRV A;  2P0R A;  3KW9 A;  1ZIV A;  4YYS A;  2DJF B;  3GCB A;  4WA6 A;  3KKU A;  1PPN A;  2ACT A;  1PXV A;  4CDD B;  2DC9 A;  4CDF B;  4BPV A;  2XU3 A;  3H7D A;  2DCC A;  3HHA A;  4CDE B;  2FRQ A;  2R9C A;  3BWK A;  2VHS A;  2YJC A;  4P6E A;  2H7J A;  4OEM A;  4Q8G A;  1EWL A;  2R9O A;  4QBB A;  4YYQ A;  2IPP B;  4P6G A;  1AU3 A;  1ICF A;  1CJL A;  1AYU A;  4N79 A;  2OUL A;  4DMY A;  1PPP A;  1MIR A;  3P5V A;  1TL9 A;  3BCN A;  3LFY A;  4CDC B;  2FYE A;  3MHS A;  3WXF A;  2DZY A;  1KFX L;  3RVX A;  1EF7 A;  1AU4 A;  1MS6 A;  3KFQ A;  3BOW A;  1BP4 A;  1U9W A;  1POP A;  5FPW A;  2OZ2 A;  1QXP A;  1KXR A;  3N4C A;  2F1G A;  1U9V A;  4N4Z A;  1U5I A;  3V6E A;  3NHE A;  6PAD A;  1QDQ A;  1M6D A;  3QJ3 A;  1F2C A;  3IUT A;  4PAD A;  2CB5 A;  1PIP A;  4CZW A;  3AI8 A;  2FT2 A;  3PNR A;  1F29 A;  2DCD A;  2O6X A;  5CVO B;  1U9Q X;  2R9F A;  4FK5 A;  5CHT A;  1MDW A;  4PP2 E;  5J94 A;  2JQG R;  1Y4H A;  2AYO A;  2E01 A;  3USV A;  4AXL A;  3H8B A;  3I06 A;  1KFU L;  1CS8 A;  3B79 A;  1AYW A;  1IWD A;  3D6S A;  4FJC A;  2VHF A;  1AU0 A;  4PP1 A; 
#chains in the Genus database with same CATH topology
 3F75 A;  4QH6 A;  4HWY A;  4HXD B;  2GFO A;  4Q8H A;  1YVB A;  4MI7 A;  3K8U A;  4MZO A;  2F7D A;  4PI3 A;  4D8B A;  1S4V A;  1K3B B;  2OP3 A;  3H8C A;  1CTE A;  3MOR A;  4XUI A;  4XZX A;  1VJV A;  1JQP A;  1CVZ A;  3O1G A;  1DF0 A;  2YJB A;  1NQC A;  2PAD A;  3H89 A;  3WXE A;  1TU6 A;  1AU2 A;  3ERV A;  4A5U A;  1PAD A;  3BB7 A;  3N3K A;  1X9Y A;  2XU4 A;  3IOQ A;  4OW0 A;  4QRG A;  3DF0 A;  1BQI A;  3BC3 A;  1YK7 A;  3MJ5 A;  2FQ9 A;  3PHW A;  1O0E A;  2E03 A;  4BS5 A;  2DC8 A;  3BPM A;  3CBK A;  3QSD A;  4BOU A;  3KX1 A;  9PAP A;  3I3T A;  2AUZ A;  4W5B A;  3RNV A;  1EWM A;  3O0U A;  4I05 A;  1GMY A;  5EF4 A;  3P5W A;  4I04 A;  4AXM A;  2DJG B;  4YYR A;  1ME4 A;  1PPD A;  4YYV A;  3KWZ A;  5EGW A;  3O65 A;  3ZUA A;  2B1N A;  3PDF A;  4X6H A;  3C9E A;  3MHH A;  1MEG A;  3ZNH A;  2AYN A;  2ATO A;  2HD5 A;  1ITO A;  2BDZ A;  1CB5 A;  1THE A;  4DMX A;  4X6I A;  3KWB X;  2FRA A;  4RNA A;  1NB3 A;  5PAD A;  2NQI A;  2ARY A;  2R6N A;  3CH2 X;  2NQD B;  1KHQ A;  4PT5 A;  2R9N A;  1DEU A;  1CPJ A;  2Y6E A;  4ZUX U;  3K9M A;  4MM3 B;  3CBJ A;  5CVM A;  3TMP A;  3MTN A;  5K16 A;  2BTW B;  1NL6 A;  1SP4 B;  1YAL A;  2E00 A;  3TNX A;  2FO5 A;  3KSE A;  4RF0 A;  1Q6K A;  3E1Z B;  1CV8 A;  3B21 A;  2FE8 A;  5EZQ A;  3CH3 X;  2YJ9 A;  1NLJ A;  1FH0 A;  2DCB A;  2CIO A;  1F2A A;  3H6S A;  3P5U A;  5CVN B;  4YV8 A;  1A6R A;  3OVX A;  3PBH A;  3IV2 A;  4OVZ B;  1MHW A;  2Y5B A;  4G54 A;  4RY2 A;  4W5C A;  1AYV A;  2P7U A;  1CSB B;  3IHP A;  4BOZ A;  4GUA A;  3S3Q A;  1EWO A;  1QOL A;  2HH5 A;  4MZS A;  2G8J A;  3N3G A;  3PRM A;  1GCB A;  1NB5 A;  2G8E A;  3WXG A;  2AVW A;  1PE6 A;  2G6D A;  3QT4 A;  3P5X A;  2DC7 A;  1QMY A;  2DC6 A;  4D8E A;  1KHP A;  1TLO A;  3S3R A;  1PBH A;  4BOQ A;  1XKG A;  3LXS A;  2YJ2 A;  4I07 A;  2IBI A;  3BPF A;  1AIM A;  1NPZ A;  4XR7 A;  3HD3 A;  2JRI A;  1U9X A;  3OIS A;  5JZE A;  2DCA A;  1EWP A;  2FUD A;  2PNS A;  1GLO A;  2FTD A;  2XU5 A;  3RVW A;  8PCH A;  2BU3 A;  3PW3 A;  3K24 A;  5CHV A;  5JA7 A;  7PCK A;  4FIP A;  4BSQ A;  4W4U A;  4OEL A;  2C0Y A;  2AU1 A;  2B1M A;  2R9M A;  1ATK A;  1YT7 A;  2DZZ A;  3PT2 A;  4N8W A;  1MEM A;  2BDL A;  4KLB A;  3U8E A;  5A24 A;  1AEC A;  1BY8 A;  4YYU A;  1F2B A;  1UKF A;  2PBH A;  4BS6 A;  4X6J A;  4QRX A;  1HUC B;  4R3D A;  2AUX A;  1SNK A;  2YJ8 A;  3HHI A;  2AIM A;  2G7Y A;  4YYW A;  2WBF X;  2NQA A;  3M99 A;  2P86 A;  3IEJ A;  1Y08 A;  3PHX A;  2NQG A;  4K7C A;  1PPO A;  3MP2 A;  1VSN A;  5KO3 A;  3OF9 A;  2AS8 A;  4REZ A;  2JQF R;  2E02 A;  5JH3 A;  3OVZ A;  4MSX A;  4BOS A;  4YVA A;  4WUR A;  2BTW A;  4D8I A;  3OQC A;  1ZCM A;  1PCI A;  1CQD A;  3RVV A;  3HWN A;  5F02 A;  4RF1 A;  1BGO A;  1YK8 A;  2Z84 A;  3V6C A;  2HXZ A;  3OF8 A;  2GHU A;  1STF E;  2HHN A;  1ME3 A;  1GEC E;  3TRK A;  2DOS A;  3IMA A;  2XU1 A;  4BQV A;  2PRE A;  3F5V A;  5EZS A;  1DKI A;  3PRP A;  4QRV A;  2P0R A;  3KW9 A;  1ZIV A;  4OVZ A;  4YYS A;  2DJF B;  3GCB A;  4WA6 A;  3KKU A;  1PPN A;  2ACT A;  1PXV A;  4CDD B;  2DC9 A;  4CDF B;  4BPV A;  2XU3 A;  4ZTB A;  3H7D A;  2DCC A;  3HHA A;  4CDE B;  2FRQ A;  2R9C A;  2UZJ A;  3BWK A;  2VHS A;  2YJC A;  4P6E A;  2H7J A;  4OEM A;  3W30 A;  4Q8G A;  1EWL A;  2R9O A;  4QBB A;  4YYQ A;  2IPP B;  4P6G A;  1AU3 A;  1ICF A;  2J7Q A;  4M0W A;  1CJL A;  1AYU A;  4N79 A;  2OUL A;  4DMY A;  3BY4 A;  2AGA A;  1PPP A;  1MIR A;  3P5V A;  1TL9 A;  3BCN A;  3LFY A;  4CDC B;  2FYE A;  3MHS A;  3WXF A;  3PSE A;  3BBA A;  2DZY A;  1KFX L;  3RVX A;  1EF7 A;  1AU4 A;  1MS6 A;  3KFQ A;  3BOW A;  1BP4 A;  1U9W A;  1POP A;  5FPW A;  3W31 A;  4RKX A;  2OZ2 A;  2J7Q C;  1QXP A;  1KXR A;  3N4C A;  4IUM A;  2F1G A;  1U9V A;  3MTV A;  4N4Z A;  1U5I A;  3V6E A;  4IP3 A;  2HWK A;  3NHE A;  1PVJ A;  6PAD A;  3E9S A;  1QDQ A;  1M6D A;  3QJ3 A;  1F2C A;  3IUT A;  4PAD A;  4P16 A;  2CB5 A;  2JTC A;  1PIP A;  4CZW A;  3AI8 A;  2FT2 A;  3PHU A;  3PNR A;  1F29 A;  2DCD A;  5E6J A;  2O6X A;  5CVO B;  4BOP A;  1U9Q X;  2R9F A;  4FK5 A;  5CHT A;  1MDW A;  3C0R A;  4PP2 E;  5J94 A;  2JQG R;  1Y4H A;  2AYO A;  2E01 A;  3USV A;  4AXL A;  3H8B A;  3I06 A;  1KFU L;  1CS8 A;  3B79 A;  1AYW A;  1IWD A;  3D6S A;  3IFU A;  1YZB A;  4FJC A;  2VHF A;  1AU0 A;  4PP1 A; 
#chains in the Genus database with same CATH homology
 3F75 A;  4QH6 A;  4HWY A;  4Q8H A;  2GFO A;  1YVB A;  3K8U A;  4MZO A;  2F7D A;  4PI3 A;  1S4V A;  1K3B B;  2OP3 A;  3H8C A;  1CTE A;  3MOR A;  4B55 A;  4XUI A;  1VJV A;  1JQP A;  1CVZ A;  3O1G A;  1DF0 A;  2YJB A;  1NQC A;  2PAD A;  3H89 A;  3WXE A;  1TU6 A;  1AU2 A;  3ERV A;  1PAD A;  3N3K A;  1X9Y A;  2XU4 A;  3IOQ A;  4QRG A;  3DF0 A;  1BQI A;  3BC3 A;  1YK7 A;  2FQ9 A;  1E2T A;  1O0E A;  2E03 A;  4BS5 A;  2DC8 A;  3BPM A;  3CBK A;  3QSD A;  3KX1 A;  9PAP A;  3I3T A;  2AUZ A;  4W5B A;  1EWM A;  3O0U A;  4I05 A;  1GMY A;  5EF4 A;  4C5P A;  3P5W A;  4I04 A;  4AXM A;  2DJG B;  4YYR A;  1ME4 A;  1PPD A;  4YYV A;  3KWZ A;  5EGW A;  3ZUA A;  2B1N A;  3PDF A;  4X6H A;  3C9E A;  3MHH A;  1MEG A;  2AYN A;  2ATO A;  2HD5 A;  1ITO A;  2BDZ A;  1CB5 A;  1THE A;  4DMX A;  4X6I A;  3KWB X;  2FRA A;  1NB3 A;  5PAD A;  2NQI A;  3D9W A;  2ARY A;  2R6N A;  3CH2 X;  2NQD B;  1KHQ A;  2R9N A;  1DEU A;  1CPJ A;  2Y6E A;  4ZUX U;  3K9M A;  3CBJ A;  5CVM A;  3MTN A;  2BSZ A;  5K16 A;  1NL6 A;  1SP4 B;  1YAL A;  2E00 A;  3TNX A;  2FO5 A;  3KSE A;  1Q6K A;  3E1Z B;  1CV8 A;  3CH3 X;  2YJ9 A;  1NLJ A;  1FH0 A;  2DCB A;  2CIO A;  1F2A A;  3H6S A;  3P5U A;  5CVN B;  4YV8 A;  1A6R A;  3OVX A;  3PBH A;  3IV2 A;  1MHW A;  2Y5B A;  4G54 A;  4RY2 A;  4W5C A;  1AYV A;  2P7U A;  1CSB B;  3IHP A;  3S3Q A;  1EWO A;  1QOL A;  2HH5 A;  4MZS A;  2G8J A;  3N3G A;  4GUZ A;  1GCB A;  1NB5 A;  2G8E A;  3WXG A;  2AVW A;  1PE6 A;  2G6D A;  3QT4 A;  3P5X A;  2DC7 A;  3LTW A;  1QMY A;  2DC6 A;  1KHP A;  1TLO A;  3S3R A;  1PBH A;  1XKG A;  3LXS A;  2YJ2 A;  4I07 A;  2IBI A;  3BPF A;  1AIM A;  1NPZ A;  4XR7 A;  3HD3 A;  1U9X A;  4NV8 A;  3OIS A;  4NV7 A;  2DCA A;  1EWP A;  2FUD A;  2PNS A;  1GLO A;  2FTD A;  2XU5 A;  3RVW A;  8PCH A;  3PW3 A;  3K24 A;  5CHV A;  5JA7 A;  7PCK A;  4FIP A;  4BSQ A;  4W4U A;  4OEL A;  2C0Y A;  2AU1 A;  2B1M A;  2R9M A;  1ATK A;  1YT7 A;  2DZZ A;  4N8W A;  1MEM A;  2BDL A;  4KLB A;  3U8E A;  5A24 A;  1AEC A;  1BY8 A;  4YYU A;  1F2B A;  2PBH A;  4BS6 A;  4X6J A;  4QRX A;  1HUC B;  2AUX A;  1SNK A;  2YJ8 A;  3HHI A;  2AIM A;  1W6F A;  2G7Y A;  4YYW A;  2WBF X;  2NQA A;  3M99 A;  2P86 A;  3IEJ A;  1Y08 A;  2NQG A;  4K7C A;  1PPO A;  1VSN A;  3OF9 A;  2AS8 A;  2VFB A;  2JQF R;  2E02 A;  5JH3 A;  3OVZ A;  4MSX A;  4YVA A;  1ZCM A;  1PCI A;  1CQD A;  3RVV A;  3HWN A;  2VFC A;  5F02 A;  1BGO A;  1YK8 A;  3V6C A;  2HXZ A;  3OF8 A;  2GHU A;  1STF E;  2HHN A;  1ME3 A;  1GEC E;  3IMA A;  2XU1 A;  4BQV A;  2PRE A;  3F5V A;  4QRV A;  2P0R A;  3KW9 A;  1ZIV A;  4YYS A;  2DJF B;  3GCB A;  4WA6 A;  3KKU A;  1PPN A;  2ACT A;  1PXV A;  4CDD B;  2DC9 A;  4CDF B;  4BPV A;  2XU3 A;  3H7D A;  2DCC A;  3HHA A;  4CDE B;  2FRQ A;  2R9C A;  3BWK A;  2VHS A;  2YJC A;  4P6E A;  2H7J A;  4OEM A;  4Q8G A;  1EWL A;  2R9O A;  4QBB A;  4YYQ A;  2IPP B;  4P6G A;  1AU3 A;  1ICF A;  1CJL A;  1AYU A;  4N79 A;  2OUL A;  4DMY A;  1PPP A;  1MIR A;  3P5V A;  1TL9 A;  3BCN A;  3LFY A;  4CDC B;  2FYE A;  3MHS A;  3WXF A;  4BGF A;  2DZY A;  1KFX L;  3RVX A;  1EF7 A;  1AU4 A;  1MS6 A;  3KFQ A;  3BOW A;  1BP4 A;  1U9W A;  1POP A;  5FPW A;  2OZ2 A;  1QXP A;  1KXR A;  3N4C A;  2F1G A;  1U9V A;  4N4Z A;  1U5I A;  1W4T A;  3V6E A;  3NHE A;  6PAD A;  1QDQ A;  1M6D A;  3QJ3 A;  1F2C A;  3IUT A;  4PAD A;  2CB5 A;  1PIP A;  4CZW A;  3AI8 A;  2FT2 A;  3PNR A;  1F29 A;  2DCD A;  1GX3 A;  2O6X A;  5CVO B;  1U9Q X;  2R9F A;  4FK5 A;  5CHT A;  1MDW A;  1W5R A;  4PP2 E;  5J94 A;  2JQG R;  1Y4H A;  2AYO A;  2E01 A;  3USV A;  4AXL A;  3H8B A;  3I06 A;  1KFU L;  1CS8 A;  3B79 A;  1AYW A;  1IWD A;  3D6S A;  4FJC A;  2VHF A;  1AU0 A;  4PP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...