1BY8A

The crystal structure of human procathepsin k
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
EILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human procathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (PROCATHEPSIN K)
total genus 82
structure length 310
sequence length 310
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1998-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1by8A00
3K24A 4QRVA 3N3GA 1CJLA 2Y5BA 2ARYA 3GCBA 1ME4A 1PBHA 3F75A 1NPZA 2G7YA 3O1GA 1PXVA 2DZZA 2HXZA 2YJ2A 3USVA 2PADA 3QJ3A 2F1GA 3BC3A 2AU1A 3P5UA 3O0UA 1CVZA 4PI3A 3N3KA 2AUXA 5CHTA 3N4CA 3QSDA 2IBIA 3K9MA 1A6RA 2FRAA 2FRQA 3KWZA 1MIRA 3H6SA 4XR7A 1QOLA 2AYNA 3HD3A 4PP2E 1TU6A 3IEJA 1AU4A 3KFQA 7PCKA 1MDWA 3KX1A 1NL6A 2R6NA 3OVZA 4X6HA 4YYQA 4QH6A 3NHEA 1F2AA 5EGWA 2DC7A 3KKUA 1PPOA 1GCBA 1F29A 2XU5A 1U9QX 5JH3A 1YALA 1ZCMA 1Y4HA 1BY8A 1U9VA 4X6IA 4QBBA 1KHPA 4FK5A 3LFYA 3I06A 3OF8A 3KSEA 3WXEA 4MZOA 1KFXL 4BPVA 4YV8A 2FTDA 1AU3A 1ITOA 4OEMA 1X9YA 2R9NA 3F5VA 2XU1A 1PIPA 1BP4A 3HHAA 3H8BA 1THEA 2JQFR 3OF9A 4FIPA 3LXSA 3P5WA 1QXPA 3CBJA 4OELA 3IUTA 4AXMA 1F2CA 2IPPB 1Y08A 5K16A 4BS6A 2PBHA 2NQDB 4CZWA 2OP3A 2R9FA 2CIOA 4I05A 4X6JA 1AYWA 1CV8A 4YYWA 1TLOA 4P6EA 1FH0A 1M6DA 2VHFA 2BDZA 1O0EA 2AS8A 1BQIA 1NLJA 1GECE 1U5IA 1VSNA 4CDFB 2PREA 3IMAA 3PNRA 1KXRA 4RY2A 5JA7A 3H8CA 1SP4B 2DJFB 2DCDA 3AI8A 1HUCB 4Q8HA 3ZUAA 3S3QA 5CVMA 2NQGA 5F02A 2NQIA 3OISA 1GMYA 2FT2A 1MHWA 5CHVA 1MS6A 3CH3X 4BS5A 3RVWA 4I07A 3I3TA 6PADA 3S3RA 4DMYA 1EWOA 4YYRA 3RVXA 2FYEA 4K7CA 1NQCA 3KWBX 1EWPA 1PPPA 3BOWA 2R9MA 4MZSA 1GLOA 2G6DA 1EF7A 1STFE 1KHQA 5CVNB 1F2BA 1S4VA 5A24A 3IHPA 2FQ9A 3RVVA 3MHHA 2DC9A 3PDFA 2YJ8A 3H89A 4MSXA 2P0RA 4W5CA 3DF0A 2YJ9A 4P6GA 1BGOA 3WXGA 2AIMA 1AU0A 2XU4A 2Y6EA 2E02A 1QDQA 1NB5A 2OULA 4Q8GA 3K8UA 3QT4A 3B79A 4YVAA 4YYVA 1AIMA 2BDLA 4N8WA 1AU2A 2YJCA 2JQGR 4CDCB 1YVBA 2HH5A 3V6CA 2E03A 2B1MA 2WBFX 3TNXA 1IWDA 4HWYA 4N4ZA 2GHUA 2DC6A 3BPFA 3MHSA 3WXFA 2FO5A 1AECA 2FUDA 1U9WA 1JQPA 4FJCA 5J94A 2R9CA 2R9OA 2VHSA 9PAPA 1PPDA 1ATKA 1DF0A 1PADA 2DZYA 4WA6A 1MEMA 3U8EA 2O6XA 1NB3A 2G8EA 2YJBA 1CPJA 2F7DA 3ERVA 4CDEB 1ICFA 1EWMA 4ZUXU 2DCBA 1TL9A 8PCHA 2ATOA 3D6SA 3PBHA 2NQAA 4YYSA 4AXLA 2XU3A 1PPNA 1U9XA 4I04A 3OVXA 2E00A 3HWNA 3BPMA 4PP1A 1DEUA 3P5VA 1MEGA 1CSBB 2ACTA 3V6EA 1ZIVA 1PE6A 1KFUL 3E1ZB 4BQVA 1CQDA 2DC8A 2G8JA 3IV2A 4CDDB 1YT7A 3M99A 4W5BA 3MORA 3KW9A 2AYOA 2CB5A 3CBKA 4KLBA 2DJGB 2B1NA 3BWKA 4XUIA 4W4UA 1EWLA 1CTEA 5PADA 1YK7A 1VJVA 2E01A 1Q6KA 4BSQA 2AUZA 1YK8A 2DCCA 2H7JA 3P5XA 3BCNA 1CB5A 1XKGA 3MTNA 2DCAA 3HHIA 2P7UA 5CVOB 4DMXA 3IOQA 5FPWA 3CH2X 2P86A 2C0YA 2HD5A 4N79A 1ME3A 1QMYA 3C9EA 3H7DA 1CS8A 2OZ2A 4QRXA 2AVWA 4PADA 1AYUA 1AYVA 2HHNA 2PNSA 1PCIA 4QRGA 4G54A 4YYUA 1K3BB 3PW3A 1SNKA 1POPA 5EF4A 2GFOA
chains in the Genus database with same CATH superfamily
4HXDB 3K24A 4QRVA 4ZTBA 3N3GA 1CJLA 4M0WA 2J7QA 2Y5BA 2ARYA 3GCBA 1ME4A 1PBHA 3F75A 1NPZA 2G7YA 3O1GA 3E9SA 1PXVA 2DZZA 2HXZA 2YJ2A 3USVA 2PADA 3QJ3A 2F1GA 3BC3A 3C0RA 2AU1A 3P5UA 3O0UA 1CVZA 4PI3A 3N3KA 2AUXA 5CHTA 4MI7A 3N4CA 3QSDA 2IBIA 3K9MA 1A6RA 2FRAA 2FRQA 3KWZA 1MIRA 3OQCA 3H6SA 4XR7A 1QOLA 2AYNA 3HD3A 4PP2E 1TU6A 3IEJA 1AU4A 4WURA 3KFQA 7PCKA 1MDWA 3KX1A 1NL6A 2R6NA 3OVZA 4X6HA 4YYQA 4QH6A 3NHEA 1F2AA 1PVJA 2DC7A 5EGWA 3KKUA 1PPOA 1GCBA 1F29A 2XU5A 1U9QX 5JH3A 1YALA 1ZCMA 1Y4HA 1BY8A 1U9VA 4X6IA 4QBBA 1KHPA 4FK5A 3PT2A 3LFYA 4D8EA 3I06A 4REZA 4BOZA 3OF8A 3KSEA 3WXEA 3TRKA 4MZOA 1KFXL 4BPVA 4YV8A 2FTDA 4GUAA 1AU3A 2UZJA 1ITOA 4OEMA 4BOQA 1X9YA 2R9NA 3F5VA 2XU1A 1PIPA 1BP4A 3HHAA 3H8BA 1THEA 2JQFR 3OF9A 4FIPA 3LXSA 3P5WA 1QXPA 3CBJA 1UKFA 4OELA 3IUTA 3PRPA 3IFUA 4AXMA 1F2CA 2IPPB 1Y08A 5K16A 4BS6A 2PBHA 2NQDB 4CZWA 2OP3A 4XZXA 2R9FA 2CIOA 4I05A 1AYWA 1CV8A 4X6JA 4YYWA 1TLOA 4P6EA 2DOSA 1FH0A 1M6DA 2VHFA 4PT5A 2BDZA 1O0EA 2AS8A 1BQIA 1NLJA 1GECE 1U5IA 1VSNA 4CDFB 2PREA 2Z84A 3IMAA 3PNRA 1KXRA 4RY2A 2HWKA 5JA7A 4RF1A 4RKXA 2JTCA 3H8CA 1SP4B 2DJFB 2DCDA 3AI8A 3MP2A 1HUCB 4Q8HA 3ZUAA 3S3QA 5CVMA 2NQGA 5F02A 2NQIA 3OISA 1GMYA 2FT2A 4OVZA 5E6JA 1MHWA 5CHVA 1MS6A 3CH3X 4BS5A 3RVWA 4I07A 3PHWA 3I3TA 6PADA 3S3RA 4DMYA 1EWOA 4YYRA 2BU3A 3RVXA 2FYEA 4K7CA 3B21A 1NQCA 3KWBX 1EWPA 1PPPA 3BOWA 2R9MA 4MZSA 1GLOA 2G6DA 1EF7A 1STFE 1KHQA 5CVNB 1F2BA 1S4VA 5A24A 3IHPA 2FQ9A 3RVVA 3MHHA 2DC9A 4RF0A 3PDFA 2YJ8A 3H89A 4MSXA 2P0RA 4W5CA 3DF0A 2YJ9A 4P6GA 1BGOA 3WXGA 2AIMA 1AU0A 2XU4A 2Y6EA 2E02A 1QDQA 1NB5A 2OULA 4Q8GA 3K8UA 3QT4A 3B79A 4YVAA 4IUMA 4YYVA 1AIMA 2BDLA 4N8WA 1AU2A 2YJCA 2JQGR 4CDCB 1YVBA 2HH5A 3V6CA 2E03A 2B1MA 2WBFX 3RNVA 1DKIA 3TNXA 1IWDA 4HWYA 4N4ZA 5EZSA 4OW0A 2GHUA 2DC6A 4BOUA 3BPFA 3MHSA 3WXFA 2FO5A 1AECA 2FUDA 1U9WA 1JQPA 2BTWA 4FJCA 2FE8A 5J94A 2R9CA 3MTVA 2R9OA 2VHSA 3BB7A 4D8IA 9PAPA 1PPDA 3MJ5A 1ATKA 4A5UA 1DF0A 1PADA 2DZYA 4WA6A 4OVZB 1YZBA 1MEMA 3U8EA 2O6XA 1NB3A 5JZEA 2G8EA 2YJBA 1CPJA 4IP3A 2F7DA 3ERVA 4CDEB 1ICFA 1EWMA 4ZUXU 3PSEA 2DCBA 1TL9A 8PCHA 2ATOA 3D6SA 3PBHA 4MM3B 2NQAA 2BTWB 4YYSA 4AXLA 2XU3A 1PPNA 1U9XA 4I04A 3OVXA 2E00A 3HWNA 3BPMA 4PP1A 1DEUA 3P5VA 1MEGA 3PRMA 3BY4A 1CSBB 2ACTA 3V6EA 1ZIVA 1PE6A 1KFUL 3E1ZB 4BQVA 1CQDA 2DC8A 2G8JA 3IV2A 4CDDB 4D8BA 1YT7A 3M99A 4W5BA 3MORA 3KW9A 2AGAA 4RNAA 4BOPA 2AYOA 2J7QC 2CB5A 3CBKA 4BOSA 4KLBA 2DJGB 2B1NA 3BWKA 4XUIA 4W4UA 1EWLA 1CTEA 3O65A 5PADA 1YK7A 1VJVA 2E01A 5KO3A 1Q6KA 4BSQA 2AUZA 1YK8A 2DCCA 2H7JA 3PHUA 3P5XA 3BCNA 3PHXA 1CB5A 1XKGA 3MTNA 2DCAA 3HHIA 4R3DA 2P7UA 3BBAA 3W31A 5CVOB 5EZQA 3ZNHA 4DMXA 3IOQA 5FPWA 3CH2X 2P86A 2C0YA 2HD5A 4N79A 1ME3A 1QMYA 3C9EA 3H7DA 1CS8A 2OZ2A 4QRXA 2AVWA 4PADA 1AYUA 1AYVA 2HHNA 2PNSA 3W30A 1PCIA 4QRGA 4G54A 4YYUA 1K3BB 2JRIA 3PW3A 1SNKA 3TMPA 1POPA 5EF4A 4P16A 2GFOA
chains in the Genus database with same CATH topology
3K24A 4QRVA 3N3GA 1CJLA 2Y5BA 2ARYA 3GCBA 1ME4A 1PBHA 3F75A 1NPZA 2G7YA 3O1GA 2VFCA 1PXVA 2DZZA 2HXZA 2YJ2A 3USVA 2PADA 3QJ3A 2F1GA 3BC3A 2AU1A 3P5UA 3O0UA 1CVZA 4PI3A 3N3KA 4BGFA 2AUXA 5CHTA 2VFBA 3N4CA 3QSDA 2IBIA 3K9MA 1A6RA 3D9WA 2FRAA 2FRQA 3KWZA 1MIRA 3LTWA 3H6SA 4XR7A 1QOLA 2AYNA 3HD3A 4PP2E 1TU6A 3IEJA 4GUZA 1AU4A 3KFQA 7PCKA 1MDWA 3KX1A 1NL6A 2R6NA 3OVZA 4X6HA 4YYQA 4QH6A 3NHEA 1F2AA 5EGWA 2DC7A 3KKUA 1PPOA 1GCBA 1F29A 2XU5A 1U9QX 5JH3A 1YALA 1ZCMA 1Y4HA 1BY8A 1U9VA 4X6IA 4QBBA 1KHPA 4FK5A 3LFYA 3I06A 3OF8A 3KSEA 3WXEA 4MZOA 1KFXL 4BPVA 4YV8A 2FTDA 1AU3A 1ITOA 4OEMA 1X9YA 2R9NA 3F5VA 2XU1A 1PIPA 1BP4A 3HHAA 3H8BA 1THEA 2JQFR 3OF9A 4FIPA 3LXSA 3P5WA 1QXPA 3CBJA 4OELA 3IUTA 4AXMA 1F2CA 2IPPB 1Y08A 5K16A 4BS6A 2PBHA 2NQDB 4CZWA 2OP3A 2R9FA 2CIOA 4I05A 4X6JA 1AYWA 1CV8A 4YYWA 1TLOA 4P6EA 1FH0A 1M6DA 2VHFA 2BDZA 1O0EA 2AS8A 1BQIA 1NLJA 1GECE 1U5IA 1VSNA 4CDFB 2PREA 3IMAA 3PNRA 1KXRA 4RY2A 5JA7A 3H8CA 1SP4B 2DJFB 2DCDA 3AI8A 1HUCB 4Q8HA 3ZUAA 3S3QA 5CVMA 2NQGA 5F02A 2NQIA 3OISA 1GMYA 2FT2A 1MHWA 5CHVA 1MS6A 3CH3X 4BS5A 3RVWA 4I07A 3I3TA 6PADA 3S3RA 4DMYA 1EWOA 4YYRA 3RVXA 2FYEA 4K7CA 1NQCA 3KWBX 1EWPA 1PPPA 3BOWA 2R9MA 4MZSA 1GLOA 2G6DA 1EF7A 1GX3A 1STFE 1KHQA 5CVNB 1F2BA 1S4VA 5A24A 3IHPA 2FQ9A 3RVVA 3MHHA 2DC9A 3PDFA 2YJ8A 3H89A 4MSXA 2P0RA 4W5CA 3DF0A 2YJ9A 4P6GA 4NV7A 1BGOA 3WXGA 2AIMA 1AU0A 2XU4A 2Y6EA 2E02A 1QDQA 1NB5A 2OULA 4Q8GA 3K8UA 3QT4A 3B79A 4YVAA 4YYVA 1AIMA 2BDLA 4N8WA 4C5PA 1AU2A 2YJCA 2JQGR 4CDCB 1YVBA 2HH5A 3V6CA 2E03A 2B1MA 2WBFX 3TNXA 1IWDA 4HWYA 4N4ZA 2GHUA 2DC6A 3BPFA 3MHSA 3WXFA 2FO5A 1AECA 2FUDA 1U9WA 1JQPA 4FJCA 5J94A 2R9CA 2R9OA 2VHSA 9PAPA 1PPDA 1ATKA 1E2TA 1DF0A 1PADA 2DZYA 4WA6A 1MEMA 3U8EA 2O6XA 1NB3A 2G8EA 2YJBA 1CPJA 2F7DA 3ERVA 4CDEB 1ICFA 1EWMA 4ZUXU 2DCBA 1TL9A 8PCHA 2ATOA 3D6SA 3PBHA 2NQAA 1W4TA 4NV8A 4YYSA 4AXLA 2XU3A 1PPNA 1U9XA 4I04A 3OVXA 2E00A 3HWNA 3BPMA 4PP1A 1DEUA 3P5VA 1MEGA 1CSBB 2ACTA 3V6EA 1ZIVA 1PE6A 1KFUL 3E1ZB 4BQVA 1CQDA 2DC8A 2G8JA 3IV2A 4CDDB 2BSZA 1YT7A 3M99A 4W5BA 3MORA 3KW9A 2AYOA 2CB5A 3CBKA 4KLBA 2DJGB 1W5RA 2B1NA 3BWKA 4XUIA 4W4UA 1EWLA 1CTEA 5PADA 1YK7A 1VJVA 2E01A 1Q6KA 4BSQA 2AUZA 1YK8A 2DCCA 2H7JA 3P5XA 3BCNA 1CB5A 1XKGA 3MTNA 1W6FA 4B55A 2DCAA 3HHIA 2P7UA 5CVOB 4DMXA 3IOQA 5FPWA 3CH2X 2P86A 2C0YA 2HD5A 4N79A 1ME3A 1QMYA 3C9EA 3H7DA 1CS8A 2OZ2A 4QRXA 2AVWA 4PADA 1AYUA 1AYVA 2HHNA 2PNSA 1PCIA 4QRGA 4G54A 4YYUA 1K3BB 3PW3A 1SNKA 1POPA 5EF4A 2GFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K24 A;  4QRV A;  3N3G A;  1CJL A;  2Y5B A;  2ARY A;  3GCB A;  1ME4 A;  1PBH A;  3F75 A;  1NPZ A;  2G7Y A;  3O1G A;  1PXV A;  2DZZ A;  2HXZ A;  2YJ2 A;  3USV A;  2PAD A;  3QJ3 A;  2F1G A;  3BC3 A;  2AU1 A;  3P5U A;  3O0U A;  1CVZ A;  4PI3 A;  3N3K A;  2AUX A;  5CHT A;  3N4C A;  3QSD A;  2IBI A;  3K9M A;  1A6R A;  2FRA A;  2FRQ A;  3KWZ A;  1MIR A;  3H6S A;  4XR7 A;  1QOL A;  2AYN A;  3HD3 A;  4PP2 E;  1TU6 A;  3IEJ A;  1AU4 A;  3KFQ A;  7PCK A;  1MDW A;  3KX1 A;  1NL6 A;  2R6N A;  3OVZ A;  4X6H A;  4YYQ A;  4QH6 A;  3NHE A;  1F2A A;  5EGW A;  2DC7 A;  3KKU A;  1PPO A;  1GCB A;  1F29 A;  2XU5 A;  1U9Q X;  5JH3 A;  1YAL A;  1ZCM A;  1Y4H A;  1BY8 A;  1U9V A;  4X6I A;  4QBB A;  1KHP A;  4FK5 A;  3LFY A;  3I06 A;  3OF8 A;  3KSE A;  3WXE A;  4MZO A;  1KFX L;  4BPV A;  4YV8 A;  2FTD A;  1AU3 A;  1ITO A;  4OEM A;  1X9Y A;  2R9N A;  3F5V A;  2XU1 A;  1PIP A;  1BP4 A;  3HHA A;  3H8B A;  1THE A;  2JQF R;  3OF9 A;  4FIP A;  3LXS A;  3P5W A;  1QXP A;  3CBJ A;  4OEL A;  3IUT A;  4AXM A;  1F2C A;  2IPP B;  1Y08 A;  5K16 A;  4BS6 A;  2PBH A;  2NQD B;  4CZW A;  2OP3 A;  2R9F A;  2CIO A;  4I05 A;  4X6J A;  1AYW A;  1CV8 A;  4YYW A;  1TLO A;  4P6E A;  1FH0 A;  1M6D A;  2VHF A;  2BDZ A;  1O0E A;  2AS8 A;  1BQI A;  1NLJ A;  1GEC E;  1U5I A;  1VSN A;  4CDF B;  2PRE A;  3IMA A;  3PNR A;  1KXR A;  4RY2 A;  5JA7 A;  3H8C A;  1SP4 B;  2DJF B;  2DCD A;  3AI8 A;  1HUC B;  4Q8H A;  3ZUA A;  3S3Q A;  5CVM A;  2NQG A;  5F02 A;  2NQI A;  3OIS A;  1GMY A;  2FT2 A;  1MHW A;  5CHV A;  1MS6 A;  3CH3 X;  4BS5 A;  3RVW A;  4I07 A;  3I3T A;  6PAD A;  3S3R A;  4DMY A;  1EWO A;  4YYR A;  3RVX A;  2FYE A;  4K7C A;  1NQC A;  3KWB X;  1EWP A;  1PPP A;  3BOW A;  2R9M A;  4MZS A;  1GLO A;  2G6D A;  1EF7 A;  1STF E;  1KHQ A;  5CVN B;  1F2B A;  1S4V A;  5A24 A;  3IHP A;  2FQ9 A;  3RVV A;  3MHH A;  2DC9 A;  3PDF A;  2YJ8 A;  3H89 A;  4MSX A;  2P0R A;  4W5C A;  3DF0 A;  2YJ9 A;  4P6G A;  1BGO A;  3WXG A;  2AIM A;  1AU0 A;  2XU4 A;  2Y6E A;  2E02 A;  1QDQ A;  1NB5 A;  2OUL A;  4Q8G A;  3K8U A;  3QT4 A;  3B79 A;  4YVA A;  4YYV A;  1AIM A;  2BDL A;  4N8W A;  1AU2 A;  2YJC A;  2JQG R;  4CDC B;  1YVB A;  2HH5 A;  3V6C A;  2E03 A;  2B1M A;  2WBF X;  3TNX A;  1IWD A;  4HWY A;  4N4Z A;  2GHU A;  2DC6 A;  3BPF A;  3MHS A;  3WXF A;  2FO5 A;  1AEC A;  2FUD A;  1U9W A;  1JQP A;  4FJC A;  5J94 A;  2R9C A;  2R9O A;  2VHS A;  9PAP A;  1PPD A;  1ATK A;  1DF0 A;  1PAD A;  2DZY A;  4WA6 A;  1MEM A;  3U8E A;  2O6X A;  1NB3 A;  2G8E A;  2YJB A;  1CPJ A;  2F7D A;  3ERV A;  4CDE B;  1ICF A;  1EWM A;  4ZUX U;  2DCB A;  1TL9 A;  8PCH A;  2ATO A;  3D6S A;  3PBH A;  2NQA A;  4YYS A;  4AXL A;  2XU3 A;  1PPN A;  1U9X A;  4I04 A;  3OVX A;  2E00 A;  3HWN A;  3BPM A;  4PP1 A;  1DEU A;  3P5V A;  1MEG A;  1CSB B;  2ACT A;  3V6E A;  1ZIV A;  1PE6 A;  1KFU L;  3E1Z B;  4BQV A;  1CQD A;  2DC8 A;  2G8J A;  3IV2 A;  4CDD B;  1YT7 A;  3M99 A;  4W5B A;  3MOR A;  3KW9 A;  2AYO A;  2CB5 A;  3CBK A;  4KLB A;  2DJG B;  2B1N A;  3BWK A;  4XUI A;  4W4U A;  1EWL A;  1CTE A;  5PAD A;  1YK7 A;  1VJV A;  2E01 A;  1Q6K A;  4BSQ A;  2AUZ A;  1YK8 A;  2DCC A;  2H7J A;  3P5X A;  3BCN A;  1CB5 A;  1XKG A;  3MTN A;  2DCA A;  3HHI A;  2P7U A;  5CVO B;  4DMX A;  3IOQ A;  5FPW A;  3CH2 X;  2P86 A;  2C0Y A;  2HD5 A;  4N79 A;  1ME3 A;  1QMY A;  3C9E A;  3H7D A;  1CS8 A;  2OZ2 A;  4QRX A;  2AVW A;  4PAD A;  1AYU A;  1AYV A;  2HHN A;  2PNS A;  1PCI A;  4QRG A;  4G54 A;  4YYU A;  1K3B B;  3PW3 A;  1SNK A;  1POP A;  5EF4 A;  2GFO A; 
#chains in the Genus database with same CATH topology
 4HXD B;  3K24 A;  4QRV A;  4ZTB A;  3N3G A;  1CJL A;  4M0W A;  2J7Q A;  2Y5B A;  2ARY A;  3GCB A;  1ME4 A;  1PBH A;  3F75 A;  1NPZ A;  2G7Y A;  3O1G A;  3E9S A;  1PXV A;  2DZZ A;  2HXZ A;  2YJ2 A;  3USV A;  2PAD A;  3QJ3 A;  2F1G A;  3BC3 A;  3C0R A;  2AU1 A;  3P5U A;  3O0U A;  1CVZ A;  4PI3 A;  3N3K A;  2AUX A;  5CHT A;  4MI7 A;  3N4C A;  3QSD A;  2IBI A;  3K9M A;  1A6R A;  2FRA A;  2FRQ A;  3KWZ A;  1MIR A;  3OQC A;  3H6S A;  4XR7 A;  1QOL A;  2AYN A;  3HD3 A;  4PP2 E;  1TU6 A;  3IEJ A;  1AU4 A;  4WUR A;  3KFQ A;  7PCK A;  1MDW A;  3KX1 A;  1NL6 A;  2R6N A;  3OVZ A;  4X6H A;  4YYQ A;  4QH6 A;  3NHE A;  1F2A A;  1PVJ A;  2DC7 A;  5EGW A;  3KKU A;  1PPO A;  1GCB A;  1F29 A;  2XU5 A;  1U9Q X;  5JH3 A;  1YAL A;  1ZCM A;  1Y4H A;  1BY8 A;  1U9V A;  4X6I A;  4QBB A;  1KHP A;  4FK5 A;  3PT2 A;  3LFY A;  4D8E A;  3I06 A;  4REZ A;  4BOZ A;  3OF8 A;  3KSE A;  3WXE A;  3TRK A;  4MZO A;  1KFX L;  4BPV A;  4YV8 A;  2FTD A;  4GUA A;  1AU3 A;  2UZJ A;  1ITO A;  4OEM A;  4BOQ A;  1X9Y A;  2R9N A;  3F5V A;  2XU1 A;  1PIP A;  1BP4 A;  3HHA A;  3H8B A;  1THE A;  2JQF R;  3OF9 A;  4FIP A;  3LXS A;  3P5W A;  1QXP A;  3CBJ A;  1UKF A;  4OEL A;  3IUT A;  3PRP A;  3IFU A;  4AXM A;  1F2C A;  2IPP B;  1Y08 A;  5K16 A;  4BS6 A;  2PBH A;  2NQD B;  4CZW A;  2OP3 A;  4XZX A;  2R9F A;  2CIO A;  4I05 A;  1AYW A;  1CV8 A;  4X6J A;  4YYW A;  1TLO A;  4P6E A;  2DOS A;  1FH0 A;  1M6D A;  2VHF A;  4PT5 A;  2BDZ A;  1O0E A;  2AS8 A;  1BQI A;  1NLJ A;  1GEC E;  1U5I A;  1VSN A;  4CDF B;  2PRE A;  2Z84 A;  3IMA A;  3PNR A;  1KXR A;  4RY2 A;  2HWK A;  5JA7 A;  4RF1 A;  4RKX A;  2JTC A;  3H8C A;  1SP4 B;  2DJF B;  2DCD A;  3AI8 A;  3MP2 A;  1HUC B;  4Q8H A;  3ZUA A;  3S3Q A;  5CVM A;  2NQG A;  5F02 A;  2NQI A;  3OIS A;  1GMY A;  2FT2 A;  4OVZ A;  5E6J A;  1MHW A;  5CHV A;  1MS6 A;  3CH3 X;  4BS5 A;  3RVW A;  4I07 A;  3PHW A;  3I3T A;  6PAD A;  3S3R A;  4DMY A;  1EWO A;  4YYR A;  2BU3 A;  3RVX A;  2FYE A;  4K7C A;  3B21 A;  1NQC A;  3KWB X;  1EWP A;  1PPP A;  3BOW A;  2R9M A;  4MZS A;  1GLO A;  2G6D A;  1EF7 A;  1STF E;  1KHQ A;  5CVN B;  1F2B A;  1S4V A;  5A24 A;  3IHP A;  2FQ9 A;  3RVV A;  3MHH A;  2DC9 A;  4RF0 A;  3PDF A;  2YJ8 A;  3H89 A;  4MSX A;  2P0R A;  4W5C A;  3DF0 A;  2YJ9 A;  4P6G A;  1BGO A;  3WXG A;  2AIM A;  1AU0 A;  2XU4 A;  2Y6E A;  2E02 A;  1QDQ A;  1NB5 A;  2OUL A;  4Q8G A;  3K8U A;  3QT4 A;  3B79 A;  4YVA A;  4IUM A;  4YYV A;  1AIM A;  2BDL A;  4N8W A;  1AU2 A;  2YJC A;  2JQG R;  4CDC B;  1YVB A;  2HH5 A;  3V6C A;  2E03 A;  2B1M A;  2WBF X;  3RNV A;  1DKI A;  3TNX A;  1IWD A;  4HWY A;  4N4Z A;  5EZS A;  4OW0 A;  2GHU A;  2DC6 A;  4BOU A;  3BPF A;  3MHS A;  3WXF A;  2FO5 A;  1AEC A;  2FUD A;  1U9W A;  1JQP A;  2BTW A;  4FJC A;  2FE8 A;  5J94 A;  2R9C A;  3MTV A;  2R9O A;  2VHS A;  3BB7 A;  4D8I A;  9PAP A;  1PPD A;  3MJ5 A;  1ATK A;  4A5U A;  1DF0 A;  1PAD A;  2DZY A;  4WA6 A;  4OVZ B;  1YZB A;  1MEM A;  3U8E A;  2O6X A;  1NB3 A;  5JZE A;  2G8E A;  2YJB A;  1CPJ A;  4IP3 A;  2F7D A;  3ERV A;  4CDE B;  1ICF A;  1EWM A;  4ZUX U;  3PSE A;  2DCB A;  1TL9 A;  8PCH A;  2ATO A;  3D6S A;  3PBH A;  4MM3 B;  2NQA A;  2BTW B;  4YYS A;  4AXL A;  2XU3 A;  1PPN A;  1U9X A;  4I04 A;  3OVX A;  2E00 A;  3HWN A;  3BPM A;  4PP1 A;  1DEU A;  3P5V A;  1MEG A;  3PRM A;  3BY4 A;  1CSB B;  2ACT A;  3V6E A;  1ZIV A;  1PE6 A;  1KFU L;  3E1Z B;  4BQV A;  1CQD A;  2DC8 A;  2G8J A;  3IV2 A;  4CDD B;  4D8B A;  1YT7 A;  3M99 A;  4W5B A;  3MOR A;  3KW9 A;  2AGA A;  4RNA A;  4BOP A;  2AYO A;  2J7Q C;  2CB5 A;  3CBK A;  4BOS A;  4KLB A;  2DJG B;  2B1N A;  3BWK A;  4XUI A;  4W4U A;  1EWL A;  1CTE A;  3O65 A;  5PAD A;  1YK7 A;  1VJV A;  2E01 A;  5KO3 A;  1Q6K A;  4BSQ A;  2AUZ A;  1YK8 A;  2DCC A;  2H7J A;  3PHU A;  3P5X A;  3BCN A;  3PHX A;  1CB5 A;  1XKG A;  3MTN A;  2DCA A;  3HHI A;  4R3D A;  2P7U A;  3BBA A;  3W31 A;  5CVO B;  5EZQ A;  3ZNH A;  4DMX A;  3IOQ A;  5FPW A;  3CH2 X;  2P86 A;  2C0Y A;  2HD5 A;  4N79 A;  1ME3 A;  1QMY A;  3C9E A;  3H7D A;  1CS8 A;  2OZ2 A;  4QRX A;  2AVW A;  4PAD A;  1AYU A;  1AYV A;  2HHN A;  2PNS A;  3W30 A;  1PCI A;  4QRG A;  4G54 A;  4YYU A;  1K3B B;  2JRI A;  3PW3 A;  1SNK A;  3TMP A;  1POP A;  5EF4 A;  4P16 A;  2GFO A; 
#chains in the Genus database with same CATH homology
 3K24 A;  4QRV A;  3N3G A;  1CJL A;  2Y5B A;  2ARY A;  3GCB A;  1ME4 A;  1PBH A;  3F75 A;  1NPZ A;  2G7Y A;  3O1G A;  2VFC A;  1PXV A;  2DZZ A;  2HXZ A;  2YJ2 A;  3USV A;  2PAD A;  3QJ3 A;  2F1G A;  3BC3 A;  2AU1 A;  3P5U A;  3O0U A;  1CVZ A;  4PI3 A;  3N3K A;  4BGF A;  2AUX A;  5CHT A;  2VFB A;  3N4C A;  3QSD A;  2IBI A;  3K9M A;  1A6R A;  3D9W A;  2FRA A;  2FRQ A;  3KWZ A;  1MIR A;  3LTW A;  3H6S A;  4XR7 A;  1QOL A;  2AYN A;  3HD3 A;  4PP2 E;  1TU6 A;  3IEJ A;  4GUZ A;  1AU4 A;  3KFQ A;  7PCK A;  1MDW A;  3KX1 A;  1NL6 A;  2R6N A;  3OVZ A;  4X6H A;  4YYQ A;  4QH6 A;  3NHE A;  1F2A A;  5EGW A;  2DC7 A;  3KKU A;  1PPO A;  1GCB A;  1F29 A;  2XU5 A;  1U9Q X;  5JH3 A;  1YAL A;  1ZCM A;  1Y4H A;  1BY8 A;  1U9V A;  4X6I A;  4QBB A;  1KHP A;  4FK5 A;  3LFY A;  3I06 A;  3OF8 A;  3KSE A;  3WXE A;  4MZO A;  1KFX L;  4BPV A;  4YV8 A;  2FTD A;  1AU3 A;  1ITO A;  4OEM A;  1X9Y A;  2R9N A;  3F5V A;  2XU1 A;  1PIP A;  1BP4 A;  3HHA A;  3H8B A;  1THE A;  2JQF R;  3OF9 A;  4FIP A;  3LXS A;  3P5W A;  1QXP A;  3CBJ A;  4OEL A;  3IUT A;  4AXM A;  1F2C A;  2IPP B;  1Y08 A;  5K16 A;  4BS6 A;  2PBH A;  2NQD B;  4CZW A;  2OP3 A;  2R9F A;  2CIO A;  4I05 A;  4X6J A;  1AYW A;  1CV8 A;  4YYW A;  1TLO A;  4P6E A;  1FH0 A;  1M6D A;  2VHF A;  2BDZ A;  1O0E A;  2AS8 A;  1BQI A;  1NLJ A;  1GEC E;  1U5I A;  1VSN A;  4CDF B;  2PRE A;  3IMA A;  3PNR A;  1KXR A;  4RY2 A;  5JA7 A;  3H8C A;  1SP4 B;  2DJF B;  2DCD A;  3AI8 A;  1HUC B;  4Q8H A;  3ZUA A;  3S3Q A;  5CVM A;  2NQG A;  5F02 A;  2NQI A;  3OIS A;  1GMY A;  2FT2 A;  1MHW A;  5CHV A;  1MS6 A;  3CH3 X;  4BS5 A;  3RVW A;  4I07 A;  3I3T A;  6PAD A;  3S3R A;  4DMY A;  1EWO A;  4YYR A;  3RVX A;  2FYE A;  4K7C A;  1NQC A;  3KWB X;  1EWP A;  1PPP A;  3BOW A;  2R9M A;  4MZS A;  1GLO A;  2G6D A;  1EF7 A;  1GX3 A;  1STF E;  1KHQ A;  5CVN B;  1F2B A;  1S4V A;  5A24 A;  3IHP A;  2FQ9 A;  3RVV A;  3MHH A;  2DC9 A;  3PDF A;  2YJ8 A;  3H89 A;  4MSX A;  2P0R A;  4W5C A;  3DF0 A;  2YJ9 A;  4P6G A;  4NV7 A;  1BGO A;  3WXG A;  2AIM A;  1AU0 A;  2XU4 A;  2Y6E A;  2E02 A;  1QDQ A;  1NB5 A;  2OUL A;  4Q8G A;  3K8U A;  3QT4 A;  3B79 A;  4YVA A;  4YYV A;  1AIM A;  2BDL A;  4N8W A;  4C5P A;  1AU2 A;  2YJC A;  2JQG R;  4CDC B;  1YVB A;  2HH5 A;  3V6C A;  2E03 A;  2B1M A;  2WBF X;  3TNX A;  1IWD A;  4HWY A;  4N4Z A;  2GHU A;  2DC6 A;  3BPF A;  3MHS A;  3WXF A;  2FO5 A;  1AEC A;  2FUD A;  1U9W A;  1JQP A;  4FJC A;  5J94 A;  2R9C A;  2R9O A;  2VHS A;  9PAP A;  1PPD A;  1ATK A;  1E2T A;  1DF0 A;  1PAD A;  2DZY A;  4WA6 A;  1MEM A;  3U8E A;  2O6X A;  1NB3 A;  2G8E A;  2YJB A;  1CPJ A;  2F7D A;  3ERV A;  4CDE B;  1ICF A;  1EWM A;  4ZUX U;  2DCB A;  1TL9 A;  8PCH A;  2ATO A;  3D6S A;  3PBH A;  2NQA A;  1W4T A;  4NV8 A;  4YYS A;  4AXL A;  2XU3 A;  1PPN A;  1U9X A;  4I04 A;  3OVX A;  2E00 A;  3HWN A;  3BPM A;  4PP1 A;  1DEU A;  3P5V A;  1MEG A;  1CSB B;  2ACT A;  3V6E A;  1ZIV A;  1PE6 A;  1KFU L;  3E1Z B;  4BQV A;  1CQD A;  2DC8 A;  2G8J A;  3IV2 A;  4CDD B;  2BSZ A;  1YT7 A;  3M99 A;  4W5B A;  3MOR A;  3KW9 A;  2AYO A;  2CB5 A;  3CBK A;  4KLB A;  2DJG B;  1W5R A;  2B1N A;  3BWK A;  4XUI A;  4W4U A;  1EWL A;  1CTE A;  5PAD A;  1YK7 A;  1VJV A;  2E01 A;  1Q6K A;  4BSQ A;  2AUZ A;  1YK8 A;  2DCC A;  2H7J A;  3P5X A;  3BCN A;  1CB5 A;  1XKG A;  3MTN A;  1W6F A;  4B55 A;  2DCA A;  3HHI A;  2P7U A;  5CVO B;  4DMX A;  3IOQ A;  5FPW A;  3CH2 X;  2P86 A;  2C0Y A;  2HD5 A;  4N79 A;  1ME3 A;  1QMY A;  3C9E A;  3H7D A;  1CS8 A;  2OZ2 A;  4QRX A;  2AVW A;  4PAD A;  1AYU A;  1AYV A;  2HHN A;  2PNS A;  1PCI A;  4QRG A;  4G54 A;  4YYU A;  1K3B B;  3PW3 A;  1SNK A;  1POP A;  5EF4 A;  2GFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...