1BY8A

The crystal structure of human procathepsin k
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
EILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PROCATHEPSIN K)
publication title The crystal structure of human procathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 82
structure length 310
sequence length 310
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1998-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1by8A00
2ATOA 2F7DA 3PBHA 1F2CA 1STFE 4QRVA 2YJBA 3N3KA 3IUTA 1PXVA 2OULA 1YK7A 1EWOA 4CDCB 4QRXA 3LXSA 2FT2A 1GMYA 1KXRA 2GFOA 1VSNA 1SP4B 3N4CA 2B1NA 1NL6A 1PPOA 2F1GA 2XU3A 2NQDB 3NHEA 5JA7A 4YYSA 3BOWA 4Q8GA 1CQDA 2IPPB 1K3BB 1Y4HA 8PCHA 5K16A 1BY8A 1VJVA 2FUDA 2FTDA 4Q8HA 3K9MA 5CHVA 2FYEA 2DJGB 4AXMA 4QH6A 4MZSA 2DC9A 1ME4A 2DZYA 1AECA 1GCBA 2WBFX 2YJ8A 3U8EA 4BSQA 1CPJA 4G54A 4RY2A 2C0YA 3BPFA 1CSBB 1ME3A 1AYWA 2BDLA 4KLBA 4W5CA 3ERVA 4YVAA 2E01A 4WA6A 3O0UA 1CS8A 4AXLA 3DF0A 3IEJA 4K7CA 3D6SA 2R9CA 1KFUL 3P5UA 5FPWA 4ZUXU 1F2AA 4YYRA 2YJ2A 4QBBA 1AU3A 3MHSA 2Y6EA 2DC8A 3S3QA 1F2BA 1ZIVA 2NQGA 3P5VA 4X6HA 1A6RA 2DZZA 3H6SA 2AIMA 3RVWA 3H8CA 2G8EA 4DMYA 3N3GA 2VHFA 4X6IA 3V6EA 1BP4A 1IWDA 2PBHA 5CHTA 2FQ9A 2AS8A 1ICFA 4CZWA 1AU0A 4PP1A 4DMXA 1EWPA 1U9WA 1NLJA 3AI8A 4P6EA 3KW9A 3HHIA 2HXZA 3O1GA 3KKUA 2BDZA 1AYUA 2AYOA 2OZ2A 3MTNA 4N79A 2DCDA 2PNSA 2FO5A 2B1MA 3OF9A 3OVZA 2XU5A 1KFXL 1PBHA 4HWYA 3H8BA 4YYVA 1DF0A 2H7JA 2YJ9A 3CBJA 3IV2A 1KHQA 2DCAA 3HHAA 3KWBX 2AYNA 1GLOA 3PDFA 2HHNA 1TLOA 1EWLA 1AU4A 1YALA 2DCCA 1AIMA 3BCNA 9PAPA 3IMAA 4CDDB 2NQAA 3S3RA 2PREA 2XU4A 4P6GA 3BWKA 2AUXA 1QXPA 3OF8A 1CTEA 1NPZA 1HUCB 4PI3A 6PADA 3V6CA 2IBIA 5JH3A 3H7DA 3P5WA 3OISA 1MEMA 2E00A 5PADA 2AU1A 2DC7A 1AU2A 3MORA 4BS5A 2R6NA 3I3TA 3M99A 5CVNB 3ZUAA 1SNKA 1Q6KA 2ARYA 1CVZA 4OELA 1PIPA 4MSXA 1F29A 4OEMA 2JQFR 2AVWA 2CIOA 4BS6A 1NB5A 1QDQA 4I04A 3RVXA 3K8UA 1BQIA 2FRAA 4PADA 2ACTA 3PW3A 3CBKA 2XU1A 3QJ3A 1O0EA 4YYQA 3B79A 3USVA 3F5VA 1U5IA 1PPPA 1NQCA 1YT7A 2P0RA 2P7UA 2OP3A 4FIPA 3WXGA 2DJFB 1Y08A 4W5BA 4I07A 1U9QX 4YV8A 1QOLA 4XR7A 1XKGA 4X6JA 1NB3A 1U9XA 5F02A 1X9YA 3HWNA 1EF7A 1POPA 4QRGA 5EF4A 3BPMA 4W4UA 1BGOA 1ZCMA 1YVBA 2NQIA 1M6DA 3OVXA 3BC3A 4I05A 2R9OA 2R9FA 4BPVA 1ATKA 3C9EA 5CVOB 2CB5A 2G6DA 2DC6A 2P86A 1PCIA 3IOQA 3RVVA 3HD3A 1THEA 2FRQA 1JQPA 1CJLA 3TNXA 1EWMA 1CB5A 1ITOA 1MDWA 3KFQA 4CDFB 4FJCA 3E1ZB 5J94A 1PE6A 2GHUA 1FH0A 4CDEB 2R9MA 1MIRA 1GECE 3QSDA 3MHHA 2VHSA 3IHPA 2O6XA 3P5XA 2G8JA 3GCBA 2Y5BA 4N4ZA 2HD5A 3F75A 4PP2E 2AUZA 1U9VA 5A24A 3H89A 2E02A 3CH2X 1PPDA 3CH3X 5CVMA 3QT4A 1PADA 3KWZA 1QMYA 2DCBA 1MHWA 4BQVA 2E03A 4N8WA 3K24A 1YK8A 3I06A 2YJCA 3KX1A 1DEUA 7PCKA 4MZOA 2R9NA 1S4VA 3KSEA 2G7YA 1TL9A 1KHPA 1CV8A 2HH5A 1TU6A 4XUIA 1MEGA 3WXEA 1AYVA 4FK5A 3WXFA 1MS6A 4YYUA 3LFYA 3PNRA 4YYWA 1PPNA 5EGWA 2PADA 2JQGR
chains in the Genus database with same CATH superfamily
2ATOA 2F7DA 3PBHA 1F2CA 1STFE 4QRVA 2YJBA 3N3KA 2J7QA 1PXVA 3IUTA 2OULA 1YK7A 1EWOA 4CDCB 4QRXA 3LXSA 2FT2A 1GMYA 1KXRA 2GFOA 1VSNA 1SP4B 3N4CA 2B1NA 1NL6A 4D8BA 1PPOA 2F1GA 2XU3A 4BOPA 2NQDB 3NHEA 5JA7A 4YYSA 3BOWA 4Q8GA 1CQDA 2IPPB 2AGAA 1K3BB 1Y4HA 5EZQA 8PCHA 5K16A 1BY8A 3MJ5A 1VJVA 2FUDA 2FTDA 4IUMA 4Q8HA 3K9MA 5CHVA 3O65A 2FYEA 2DJGB 3C0RA 4AXMA 4QH6A 4MZSA 2DC9A 1ME4A 2DZYA 1AECA 1GCBA 2WBFX 2YJ8A 4RKXA 3U8EA 1CPJA 4G54A 4RY2A 4BSQA 2C0YA 3BPFA 1CSBB 1ME3A 1AYWA 2BDLA 4KLBA 3TRKA 4W5CA 5KO3A 3E9SA 3ERVA 4YVAA 2E01A 3PRPA 4WA6A 3O0UA 1CS8A 4AXLA 3DF0A 3IEJA 4K7CA 3D6SA 2R9CA 1KFUL 4BOUA 3PSEA 3P5UA 5FPWA 4ZUXU 1F2AA 4YYRA 2YJ2A 4QBBA 1AU3A 4MM3B 4PT5A 3MHSA 2Y6EA 2DC8A 3S3QA 1F2BA 1ZIVA 2NQGA 3P5VA 4X6HA 3W30A 1A6RA 2DZZA 3H6SA 2AIMA 3RVWA 3H8CA 2G8EA 4DMYA 3N3GA 4BOSA 2VHFA 4X6IA 3V6EA 1BP4A 1IWDA 3PT2A 3IFUA 2PBHA 5CHTA 2FQ9A 2AS8A 1ICFA 4CZWA 1AU0A 4PP1A 4DMXA 1EWPA 4RF0A 1U9WA 1NLJA 3AI8A 3MTVA 4P6EA 3ZNHA 3KW9A 3HHIA 2HXZA 3O1GA 3KKUA 2BDZA 1AYUA 2AYOA 4BOQA 2OZ2A 2BTWA 3MTNA 4N79A 2DCDA 2PNSA 2FO5A 2B1MA 3OF9A 3OVZA 2XU5A 5E6JA 1KFXL 1PBHA 4HWYA 3H8BA 4YYVA 1DF0A 2H7JA 2YJ9A 3CBJA 2BTWB 3IV2A 1KHQA 2DCAA 3HHAA 3PHUA 3KWBX 2AYNA 1GLOA 4GUAA 3PDFA 2DOSA 2HHNA 1TLOA 1EWLA 1AU4A 1YALA 2DCCA 1AIMA 3BCNA 9PAPA 3IMAA 4CDDB 2NQAA 3S3RA 2PREA 2XU4A 4P6GA 3BWKA 2AUXA 1QXPA 3OF8A 1CTEA 1NPZA 1HUCB 4PI3A 6PADA 3V6CA 3PHXA 2IBIA 5JH3A 3H7DA 3P5WA 3OISA 1MEMA 2E00A 5PADA 2AU1A 2DC7A 2FE8A 1AU2A 3MORA 4BS5A 2JTCA 2R6NA 3I3TA 3M99A 5CVNB 3ZUAA 1SNKA 1Q6KA 2ARYA 1CVZA 4OELA 1PIPA 4MSXA 1F29A 4OEMA 1YZBA 2JQFR 2AVWA 2J7QC 3OQCA 2CIOA 4BS6A 1NB5A 1QDQA 4I04A 3BY4A 3RVXA 3K8UA 1BQIA 2FRAA 2Z84A 4PADA 2ACTA 4HXDB 3PW3A 3CBKA 2BU3A 2XU1A 3QJ3A 1O0EA 4YYQA 3B79A 4BOZA 3USVA 3F5VA 1U5IA 1PPPA 1NQCA 1YT7A 2P0RA 4IP3A 2P7UA 2OP3A 4FIPA 3WXGA 2DJFB 1Y08A 4W5BA 1UKFA 4I07A 1U9QX 4RF1A 4YV8A 1DKIA 1QOLA 4XR7A 1XKGA 4X6JA 1NB3A 1U9XA 5F02A 1X9YA 3MP2A 3HWNA 1EF7A 1POPA 4QRGA 3B21A 4A5UA 5EF4A 3BPMA 3BB7A 1BGOA 4W4UA 2HWKA 1ZCMA 1YVBA 2NQIA 1M6DA 2JRIA 3OVXA 3BC3A 4I05A 2R9OA 2R9FA 4BPVA 3BBAA 1ATKA 5EZSA 3C9EA 5CVOB 2CB5A 2G6DA 2DC6A 2P86A 2UZJA 1PCIA 3IOQA 3RVVA 4RNAA 3HD3A 1THEA 2FRQA 1JQPA 1CJLA 4XZXA 3TNXA 1EWMA 4D8IA 1CB5A 3PHWA 1ITOA 1MDWA 4OVZA 4WURA 3KFQA 4CDFB 4FJCA 3E1ZB 5J94A 1PE6A 2GHUA 1FH0A 4OW0A 4CDEB 2R9MA 1MIRA 1GECE 3QSDA 3MHHA 2VHSA 3IHPA 3RNVA 2O6XA 3P5XA 2G8JA 3GCBA 2Y5BA 4N4ZA 2HD5A 3F75A 4PP2E 2AUZA 1U9VA 4OVZB 4REZA 1PVJA 4P16A 4ZTBA 5A24A 3H89A 2E02A 4D8EA 3CH2X 1PPDA 3CH3X 5CVMA 3QT4A 1PADA 3KWZA 1QMYA 2DCBA 1MHWA 3PRMA 4BQVA 2E03A 4N8WA 3K24A 1YK8A 3I06A 2YJCA 3KX1A 1DEUA 7PCKA 4M0WA 4MZOA 5JZEA 2R9NA 1S4VA 3KSEA 2G7YA 1TL9A 1KHPA 1CV8A 2HH5A 1TU6A 3W31A 4XUIA 1MEGA 3WXEA 3TMPA 1AYVA 4FK5A 3WXFA 1MS6A 4YYUA 4MI7A 3LFYA 4R3DA 3PNRA 4YYWA 1PPNA 5EGWA 2PADA 2JQGR
chains in the Genus database with same CATH topology
2ATOA 2F7DA 3PBHA 1F2CA 1STFE 4QRVA 2YJBA 3N3KA 3IUTA 1PXVA 2OULA 1YK7A 1EWOA 4CDCB 4QRXA 3LXSA 2FT2A 1GMYA 1KXRA 2GFOA 1VSNA 1SP4B 3N4CA 2B1NA 1NL6A 1PPOA 2F1GA 2XU3A 1E2TA 2NQDB 3NHEA 5JA7A 4YYSA 3BOWA 4Q8GA 1CQDA 2IPPB 1K3BB 1Y4HA 8PCHA 5K16A 1BY8A 1VJVA 2FUDA 2FTDA 4Q8HA 3K9MA 5CHVA 2FYEA 2DJGB 4AXMA 4QH6A 4MZSA 2DC9A 1ME4A 1W5RA 2DZYA 1AECA 1GCBA 2WBFX 2YJ8A 3U8EA 4BSQA 1CPJA 4G54A 4RY2A 2C0YA 3BPFA 1CSBB 1ME3A 1AYWA 2BDLA 4KLBA 4W5CA 3ERVA 4YVAA 2E01A 4WA6A 3O0UA 1CS8A 4AXLA 3DF0A 3IEJA 4K7CA 3D6SA 2R9CA 1KFUL 3P5UA 5FPWA 4ZUXU 1F2AA 4YYRA 2YJ2A 4QBBA 1AU3A 3MHSA 2Y6EA 2DC8A 3S3QA 1F2BA 4C5PA 1ZIVA 2NQGA 3P5VA 4X6HA 1A6RA 2DZZA 3H6SA 2AIMA 3RVWA 3H8CA 2G8EA 4DMYA 3N3GA 2VHFA 4X6IA 3V6EA 1BP4A 1IWDA 2PBHA 5CHTA 2FQ9A 2AS8A 1ICFA 4CZWA 1AU0A 4PP1A 4DMXA 1EWPA 1U9WA 1NLJA 3AI8A 4P6EA 3KW9A 3HHIA 2HXZA 3O1GA 3KKUA 2BDZA 1AYUA 2AYOA 2OZ2A 3MTNA 4N79A 2DCDA 2PNSA 2FO5A 2B1MA 3OF9A 3OVZA 2XU5A 1KFXL 1PBHA 4HWYA 3H8BA 4YYVA 1DF0A 2H7JA 2YJ9A 3CBJA 3IV2A 1KHQA 2DCAA 2VFCA 3HHAA 3KWBX 2AYNA 1GLOA 3PDFA 2HHNA 1TLOA 1EWLA 4GUZA 1AU4A 1YALA 2DCCA 1AIMA 3BCNA 9PAPA 3IMAA 4CDDB 2NQAA 3S3RA 2PREA 2XU4A 4P6GA 3BWKA 2AUXA 1QXPA 3OF8A 1CTEA 1NPZA 1HUCB 4PI3A 6PADA 3V6CA 2IBIA 5JH3A 3H7DA 3P5WA 3OISA 1MEMA 2BSZA 2E00A 5PADA 2AU1A 2DC7A 1AU2A 3MORA 4BS5A 2R6NA 3I3TA 3M99A 5CVNB 3ZUAA 1SNKA 1Q6KA 2ARYA 1CVZA 4OELA 1PIPA 4MSXA 1F29A 4OEMA 2JQFR 2AVWA 2CIOA 4BS6A 1NB5A 1QDQA 4I04A 3RVXA 1W6FA 3K8UA 1BQIA 2FRAA 4PADA 2ACTA 3PW3A 3CBKA 2XU1A 3QJ3A 1O0EA 4YYQA 3B79A 3USVA 3F5VA 1U5IA 1PPPA 1NQCA 1YT7A 2P0RA 2P7UA 2OP3A 4FIPA 3WXGA 2DJFB 1Y08A 4W5BA 4I07A 1U9QX 4YV8A 1QOLA 4XR7A 1XKGA 3D9WA 4X6JA 1NB3A 1U9XA 5F02A 1X9YA 3HWNA 1EF7A 1POPA 4QRGA 5EF4A 3BPMA 4W4UA 1BGOA 1ZCMA 1YVBA 2NQIA 4NV8A 1M6DA 3OVXA 3BC3A 4I05A 2R9OA 2R9FA 4BPVA 1ATKA 3C9EA 5CVOB 2CB5A 2G6DA 2DC6A 2P86A 1W4TA 4B55A 1PCIA 3IOQA 3RVVA 3HD3A 1THEA 2FRQA 4NV7A 1JQPA 1CJLA 3TNXA 1EWMA 1CB5A 1ITOA 1MDWA 3KFQA 4CDFB 4FJCA 3E1ZB 5J94A 1PE6A 2GHUA 1FH0A 4CDEB 2R9MA 1GX3A 1MIRA 1GECE 3QSDA 3MHHA 2VHSA 3IHPA 2O6XA 3P5XA 2G8JA 3GCBA 2Y5BA 4N4ZA 2HD5A 3F75A 4PP2E 2AUZA 1U9VA 5A24A 3H89A 2E02A 3CH2X 1PPDA 3CH3X 5CVMA 4BGFA 3QT4A 1PADA 3KWZA 1QMYA 2DCBA 1MHWA 4BQVA 2E03A 4N8WA 3K24A 1YK8A 3I06A 2YJCA 3KX1A 1DEUA 7PCKA 3LTWA 4MZOA 2R9NA 1S4VA 3KSEA 2G7YA 1TL9A 1KHPA 1CV8A 2HH5A 1TU6A 4XUIA 1MEGA 3WXEA 1AYVA 4FK5A 3WXFA 2VFBA 1MS6A 4YYUA 3LFYA 3PNRA 4YYWA 1PPNA 5EGWA 2PADA 2JQGR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATO A;  2F7D A;  3PBH A;  1F2C A;  1STF E;  4QRV A;  2YJB A;  3N3K A;  3IUT A;  1PXV A;  2OUL A;  1YK7 A;  1EWO A;  4CDC B;  4QRX A;  3LXS A;  2FT2 A;  1GMY A;  1KXR A;  2GFO A;  1VSN A;  1SP4 B;  3N4C A;  2B1N A;  1NL6 A;  1PPO A;  2F1G A;  2XU3 A;  2NQD B;  3NHE A;  5JA7 A;  4YYS A;  3BOW A;  4Q8G A;  1CQD A;  2IPP B;  1K3B B;  1Y4H A;  8PCH A;  5K16 A;  1BY8 A;  1VJV A;  2FUD A;  2FTD A;  4Q8H A;  3K9M A;  5CHV A;  2FYE A;  2DJG B;  4AXM A;  4QH6 A;  4MZS A;  2DC9 A;  1ME4 A;  2DZY A;  1AEC A;  1GCB A;  2WBF X;  2YJ8 A;  3U8E A;  4BSQ A;  1CPJ A;  4G54 A;  4RY2 A;  2C0Y A;  3BPF A;  1CSB B;  1ME3 A;  1AYW A;  2BDL A;  4KLB A;  4W5C A;  3ERV A;  4YVA A;  2E01 A;  4WA6 A;  3O0U A;  1CS8 A;  4AXL A;  3DF0 A;  3IEJ A;  4K7C A;  3D6S A;  2R9C A;  1KFU L;  3P5U A;  5FPW A;  4ZUX U;  1F2A A;  4YYR A;  2YJ2 A;  4QBB A;  1AU3 A;  3MHS A;  2Y6E A;  2DC8 A;  3S3Q A;  1F2B A;  1ZIV A;  2NQG A;  3P5V A;  4X6H A;  1A6R A;  2DZZ A;  3H6S A;  2AIM A;  3RVW A;  3H8C A;  2G8E A;  4DMY A;  3N3G A;  2VHF A;  4X6I A;  3V6E A;  1BP4 A;  1IWD A;  2PBH A;  5CHT A;  2FQ9 A;  2AS8 A;  1ICF A;  4CZW A;  1AU0 A;  4PP1 A;  4DMX A;  1EWP A;  1U9W A;  1NLJ A;  3AI8 A;  4P6E A;  3KW9 A;  3HHI A;  2HXZ A;  3O1G A;  3KKU A;  2BDZ A;  1AYU A;  2AYO A;  2OZ2 A;  3MTN A;  4N79 A;  2DCD A;  2PNS A;  2FO5 A;  2B1M A;  3OF9 A;  3OVZ A;  2XU5 A;  1KFX L;  1PBH A;  4HWY A;  3H8B A;  4YYV A;  1DF0 A;  2H7J A;  2YJ9 A;  3CBJ A;  3IV2 A;  1KHQ A;  2DCA A;  3HHA A;  3KWB X;  2AYN A;  1GLO A;  3PDF A;  2HHN A;  1TLO A;  1EWL A;  1AU4 A;  1YAL A;  2DCC A;  1AIM A;  3BCN A;  9PAP A;  3IMA A;  4CDD B;  2NQA A;  3S3R A;  2PRE A;  2XU4 A;  4P6G A;  3BWK A;  2AUX A;  1QXP A;  3OF8 A;  1CTE A;  1NPZ A;  1HUC B;  4PI3 A;  6PAD A;  3V6C A;  2IBI A;  5JH3 A;  3H7D A;  3P5W A;  3OIS A;  1MEM A;  2E00 A;  5PAD A;  2AU1 A;  2DC7 A;  1AU2 A;  3MOR A;  4BS5 A;  2R6N A;  3I3T A;  3M99 A;  5CVN B;  3ZUA A;  1SNK A;  1Q6K A;  2ARY A;  1CVZ A;  4OEL A;  1PIP A;  4MSX A;  1F29 A;  4OEM A;  2JQF R;  2AVW A;  2CIO A;  4BS6 A;  1NB5 A;  1QDQ A;  4I04 A;  3RVX A;  3K8U A;  1BQI A;  2FRA A;  4PAD A;  2ACT A;  3PW3 A;  3CBK A;  2XU1 A;  3QJ3 A;  1O0E A;  4YYQ A;  3B79 A;  3USV A;  3F5V A;  1U5I A;  1PPP A;  1NQC A;  1YT7 A;  2P0R A;  2P7U A;  2OP3 A;  4FIP A;  3WXG A;  2DJF B;  1Y08 A;  4W5B A;  4I07 A;  1U9Q X;  4YV8 A;  1QOL A;  4XR7 A;  1XKG A;  4X6J A;  1NB3 A;  1U9X A;  5F02 A;  1X9Y A;  3HWN A;  1EF7 A;  1POP A;  4QRG A;  5EF4 A;  3BPM A;  4W4U A;  1BGO A;  1ZCM A;  1YVB A;  2NQI A;  1M6D A;  3OVX A;  3BC3 A;  4I05 A;  2R9O A;  2R9F A;  4BPV A;  1ATK A;  3C9E A;  5CVO B;  2CB5 A;  2G6D A;  2DC6 A;  2P86 A;  1PCI A;  3IOQ A;  3RVV A;  3HD3 A;  1THE A;  2FRQ A;  1JQP A;  1CJL A;  3TNX A;  1EWM A;  1CB5 A;  1ITO A;  1MDW A;  3KFQ A;  4CDF B;  4FJC A;  3E1Z B;  5J94 A;  1PE6 A;  2GHU A;  1FH0 A;  4CDE B;  2R9M A;  1MIR A;  1GEC E;  3QSD A;  3MHH A;  2VHS A;  3IHP A;  2O6X A;  3P5X A;  2G8J A;  3GCB A;  2Y5B A;  4N4Z A;  2HD5 A;  3F75 A;  4PP2 E;  2AUZ A;  1U9V A;  5A24 A;  3H89 A;  2E02 A;  3CH2 X;  1PPD A;  3CH3 X;  5CVM A;  3QT4 A;  1PAD A;  3KWZ A;  1QMY A;  2DCB A;  1MHW A;  4BQV A;  2E03 A;  4N8W A;  3K24 A;  1YK8 A;  3I06 A;  2YJC A;  3KX1 A;  1DEU A;  7PCK A;  4MZO A;  2R9N A;  1S4V A;  3KSE A;  2G7Y A;  1TL9 A;  1KHP A;  1CV8 A;  2HH5 A;  1TU6 A;  4XUI A;  1MEG A;  3WXE A;  1AYV A;  4FK5 A;  3WXF A;  1MS6 A;  4YYU A;  3LFY A;  3PNR A;  4YYW A;  1PPN A;  5EGW A;  2PAD A;  2JQG R; 
#chains in the Genus database with same CATH topology
 2ATO A;  2F7D A;  3PBH A;  1F2C A;  1STF E;  4QRV A;  2YJB A;  3N3K A;  2J7Q A;  1PXV A;  3IUT A;  2OUL A;  1YK7 A;  1EWO A;  4CDC B;  4QRX A;  3LXS A;  2FT2 A;  1GMY A;  1KXR A;  2GFO A;  1VSN A;  1SP4 B;  3N4C A;  2B1N A;  1NL6 A;  4D8B A;  1PPO A;  2F1G A;  2XU3 A;  4BOP A;  2NQD B;  3NHE A;  5JA7 A;  4YYS A;  3BOW A;  4Q8G A;  1CQD A;  2IPP B;  2AGA A;  1K3B B;  1Y4H A;  5EZQ A;  8PCH A;  5K16 A;  1BY8 A;  3MJ5 A;  1VJV A;  2FUD A;  2FTD A;  4IUM A;  4Q8H A;  3K9M A;  5CHV A;  3O65 A;  2FYE A;  2DJG B;  3C0R A;  4AXM A;  4QH6 A;  4MZS A;  2DC9 A;  1ME4 A;  2DZY A;  1AEC A;  1GCB A;  2WBF X;  2YJ8 A;  4RKX A;  3U8E A;  1CPJ A;  4G54 A;  4RY2 A;  4BSQ A;  2C0Y A;  3BPF A;  1CSB B;  1ME3 A;  1AYW A;  2BDL A;  4KLB A;  3TRK A;  4W5C A;  5KO3 A;  3E9S A;  3ERV A;  4YVA A;  2E01 A;  3PRP A;  4WA6 A;  3O0U A;  1CS8 A;  4AXL A;  3DF0 A;  3IEJ A;  4K7C A;  3D6S A;  2R9C A;  1KFU L;  4BOU A;  3PSE A;  3P5U A;  5FPW A;  4ZUX U;  1F2A A;  4YYR A;  2YJ2 A;  4QBB A;  1AU3 A;  4MM3 B;  4PT5 A;  3MHS A;  2Y6E A;  2DC8 A;  3S3Q A;  1F2B A;  1ZIV A;  2NQG A;  3P5V A;  4X6H A;  3W30 A;  1A6R A;  2DZZ A;  3H6S A;  2AIM A;  3RVW A;  3H8C A;  2G8E A;  4DMY A;  3N3G A;  4BOS A;  2VHF A;  4X6I A;  3V6E A;  1BP4 A;  1IWD A;  3PT2 A;  3IFU A;  2PBH A;  5CHT A;  2FQ9 A;  2AS8 A;  1ICF A;  4CZW A;  1AU0 A;  4PP1 A;  4DMX A;  1EWP A;  4RF0 A;  1U9W A;  1NLJ A;  3AI8 A;  3MTV A;  4P6E A;  3ZNH A;  3KW9 A;  3HHI A;  2HXZ A;  3O1G A;  3KKU A;  2BDZ A;  1AYU A;  2AYO A;  4BOQ A;  2OZ2 A;  2BTW A;  3MTN A;  4N79 A;  2DCD A;  2PNS A;  2FO5 A;  2B1M A;  3OF9 A;  3OVZ A;  2XU5 A;  5E6J A;  1KFX L;  1PBH A;  4HWY A;  3H8B A;  4YYV A;  1DF0 A;  2H7J A;  2YJ9 A;  3CBJ A;  2BTW B;  3IV2 A;  1KHQ A;  2DCA A;  3HHA A;  3PHU A;  3KWB X;  2AYN A;  1GLO A;  4GUA A;  3PDF A;  2DOS A;  2HHN A;  1TLO A;  1EWL A;  1AU4 A;  1YAL A;  2DCC A;  1AIM A;  3BCN A;  9PAP A;  3IMA A;  4CDD B;  2NQA A;  3S3R A;  2PRE A;  2XU4 A;  4P6G A;  3BWK A;  2AUX A;  1QXP A;  3OF8 A;  1CTE A;  1NPZ A;  1HUC B;  4PI3 A;  6PAD A;  3V6C A;  3PHX A;  2IBI A;  5JH3 A;  3H7D A;  3P5W A;  3OIS A;  1MEM A;  2E00 A;  5PAD A;  2AU1 A;  2DC7 A;  2FE8 A;  1AU2 A;  3MOR A;  4BS5 A;  2JTC A;  2R6N A;  3I3T A;  3M99 A;  5CVN B;  3ZUA A;  1SNK A;  1Q6K A;  2ARY A;  1CVZ A;  4OEL A;  1PIP A;  4MSX A;  1F29 A;  4OEM A;  1YZB A;  2JQF R;  2AVW A;  2J7Q C;  3OQC A;  2CIO A;  4BS6 A;  1NB5 A;  1QDQ A;  4I04 A;  3BY4 A;  3RVX A;  3K8U A;  1BQI A;  2FRA A;  2Z84 A;  4PAD A;  2ACT A;  4HXD B;  3PW3 A;  3CBK A;  2BU3 A;  2XU1 A;  3QJ3 A;  1O0E A;  4YYQ A;  3B79 A;  4BOZ A;  3USV A;  3F5V A;  1U5I A;  1PPP A;  1NQC A;  1YT7 A;  2P0R A;  4IP3 A;  2P7U A;  2OP3 A;  4FIP A;  3WXG A;  2DJF B;  1Y08 A;  4W5B A;  1UKF A;  4I07 A;  1U9Q X;  4RF1 A;  4YV8 A;  1DKI A;  1QOL A;  4XR7 A;  1XKG A;  4X6J A;  1NB3 A;  1U9X A;  5F02 A;  1X9Y A;  3MP2 A;  3HWN A;  1EF7 A;  1POP A;  4QRG A;  3B21 A;  4A5U A;  5EF4 A;  3BPM A;  3BB7 A;  1BGO A;  4W4U A;  2HWK A;  1ZCM A;  1YVB A;  2NQI A;  1M6D A;  2JRI A;  3OVX A;  3BC3 A;  4I05 A;  2R9O A;  2R9F A;  4BPV A;  3BBA A;  1ATK A;  5EZS A;  3C9E A;  5CVO B;  2CB5 A;  2G6D A;  2DC6 A;  2P86 A;  2UZJ A;  1PCI A;  3IOQ A;  3RVV A;  4RNA A;  3HD3 A;  1THE A;  2FRQ A;  1JQP A;  1CJL A;  4XZX A;  3TNX A;  1EWM A;  4D8I A;  1CB5 A;  3PHW A;  1ITO A;  1MDW A;  4OVZ A;  4WUR A;  3KFQ A;  4CDF B;  4FJC A;  3E1Z B;  5J94 A;  1PE6 A;  2GHU A;  1FH0 A;  4OW0 A;  4CDE B;  2R9M A;  1MIR A;  1GEC E;  3QSD A;  3MHH A;  2VHS A;  3IHP A;  3RNV A;  2O6X A;  3P5X A;  2G8J A;  3GCB A;  2Y5B A;  4N4Z A;  2HD5 A;  3F75 A;  4PP2 E;  2AUZ A;  1U9V A;  4OVZ B;  4REZ A;  1PVJ A;  4P16 A;  4ZTB A;  5A24 A;  3H89 A;  2E02 A;  4D8E A;  3CH2 X;  1PPD A;  3CH3 X;  5CVM A;  3QT4 A;  1PAD A;  3KWZ A;  1QMY A;  2DCB A;  1MHW A;  3PRM A;  4BQV A;  2E03 A;  4N8W A;  3K24 A;  1YK8 A;  3I06 A;  2YJC A;  3KX1 A;  1DEU A;  7PCK A;  4M0W A;  4MZO A;  5JZE A;  2R9N A;  1S4V A;  3KSE A;  2G7Y A;  1TL9 A;  1KHP A;  1CV8 A;  2HH5 A;  1TU6 A;  3W31 A;  4XUI A;  1MEG A;  3WXE A;  3TMP A;  1AYV A;  4FK5 A;  3WXF A;  1MS6 A;  4YYU A;  4MI7 A;  3LFY A;  4R3D A;  3PNR A;  4YYW A;  1PPN A;  5EGW A;  2PAD A;  2JQG R; 
#chains in the Genus database with same CATH homology
 2ATO A;  2F7D A;  3PBH A;  1F2C A;  1STF E;  4QRV A;  2YJB A;  3N3K A;  3IUT A;  1PXV A;  2OUL A;  1YK7 A;  1EWO A;  4CDC B;  4QRX A;  3LXS A;  2FT2 A;  1GMY A;  1KXR A;  2GFO A;  1VSN A;  1SP4 B;  3N4C A;  2B1N A;  1NL6 A;  1PPO A;  2F1G A;  2XU3 A;  1E2T A;  2NQD B;  3NHE A;  5JA7 A;  4YYS A;  3BOW A;  4Q8G A;  1CQD A;  2IPP B;  1K3B B;  1Y4H A;  8PCH A;  5K16 A;  1BY8 A;  1VJV A;  2FUD A;  2FTD A;  4Q8H A;  3K9M A;  5CHV A;  2FYE A;  2DJG B;  4AXM A;  4QH6 A;  4MZS A;  2DC9 A;  1ME4 A;  1W5R A;  2DZY A;  1AEC A;  1GCB A;  2WBF X;  2YJ8 A;  3U8E A;  4BSQ A;  1CPJ A;  4G54 A;  4RY2 A;  2C0Y A;  3BPF A;  1CSB B;  1ME3 A;  1AYW A;  2BDL A;  4KLB A;  4W5C A;  3ERV A;  4YVA A;  2E01 A;  4WA6 A;  3O0U A;  1CS8 A;  4AXL A;  3DF0 A;  3IEJ A;  4K7C A;  3D6S A;  2R9C A;  1KFU L;  3P5U A;  5FPW A;  4ZUX U;  1F2A A;  4YYR A;  2YJ2 A;  4QBB A;  1AU3 A;  3MHS A;  2Y6E A;  2DC8 A;  3S3Q A;  1F2B A;  4C5P A;  1ZIV A;  2NQG A;  3P5V A;  4X6H A;  1A6R A;  2DZZ A;  3H6S A;  2AIM A;  3RVW A;  3H8C A;  2G8E A;  4DMY A;  3N3G A;  2VHF A;  4X6I A;  3V6E A;  1BP4 A;  1IWD A;  2PBH A;  5CHT A;  2FQ9 A;  2AS8 A;  1ICF A;  4CZW A;  1AU0 A;  4PP1 A;  4DMX A;  1EWP A;  1U9W A;  1NLJ A;  3AI8 A;  4P6E A;  3KW9 A;  3HHI A;  2HXZ A;  3O1G A;  3KKU A;  2BDZ A;  1AYU A;  2AYO A;  2OZ2 A;  3MTN A;  4N79 A;  2DCD A;  2PNS A;  2FO5 A;  2B1M A;  3OF9 A;  3OVZ A;  2XU5 A;  1KFX L;  1PBH A;  4HWY A;  3H8B A;  4YYV A;  1DF0 A;  2H7J A;  2YJ9 A;  3CBJ A;  3IV2 A;  1KHQ A;  2DCA A;  2VFC A;  3HHA A;  3KWB X;  2AYN A;  1GLO A;  3PDF A;  2HHN A;  1TLO A;  1EWL A;  4GUZ A;  1AU4 A;  1YAL A;  2DCC A;  1AIM A;  3BCN A;  9PAP A;  3IMA A;  4CDD B;  2NQA A;  3S3R A;  2PRE A;  2XU4 A;  4P6G A;  3BWK A;  2AUX A;  1QXP A;  3OF8 A;  1CTE A;  1NPZ A;  1HUC B;  4PI3 A;  6PAD A;  3V6C A;  2IBI A;  5JH3 A;  3H7D A;  3P5W A;  3OIS A;  1MEM A;  2BSZ A;  2E00 A;  5PAD A;  2AU1 A;  2DC7 A;  1AU2 A;  3MOR A;  4BS5 A;  2R6N A;  3I3T A;  3M99 A;  5CVN B;  3ZUA A;  1SNK A;  1Q6K A;  2ARY A;  1CVZ A;  4OEL A;  1PIP A;  4MSX A;  1F29 A;  4OEM A;  2JQF R;  2AVW A;  2CIO A;  4BS6 A;  1NB5 A;  1QDQ A;  4I04 A;  3RVX A;  1W6F A;  3K8U A;  1BQI A;  2FRA A;  4PAD A;  2ACT A;  3PW3 A;  3CBK A;  2XU1 A;  3QJ3 A;  1O0E A;  4YYQ A;  3B79 A;  3USV A;  3F5V A;  1U5I A;  1PPP A;  1NQC A;  1YT7 A;  2P0R A;  2P7U A;  2OP3 A;  4FIP A;  3WXG A;  2DJF B;  1Y08 A;  4W5B A;  4I07 A;  1U9Q X;  4YV8 A;  1QOL A;  4XR7 A;  1XKG A;  3D9W A;  4X6J A;  1NB3 A;  1U9X A;  5F02 A;  1X9Y A;  3HWN A;  1EF7 A;  1POP A;  4QRG A;  5EF4 A;  3BPM A;  4W4U A;  1BGO A;  1ZCM A;  1YVB A;  2NQI A;  4NV8 A;  1M6D A;  3OVX A;  3BC3 A;  4I05 A;  2R9O A;  2R9F A;  4BPV A;  1ATK A;  3C9E A;  5CVO B;  2CB5 A;  2G6D A;  2DC6 A;  2P86 A;  1W4T A;  4B55 A;  1PCI A;  3IOQ A;  3RVV A;  3HD3 A;  1THE A;  2FRQ A;  4NV7 A;  1JQP A;  1CJL A;  3TNX A;  1EWM A;  1CB5 A;  1ITO A;  1MDW A;  3KFQ A;  4CDF B;  4FJC A;  3E1Z B;  5J94 A;  1PE6 A;  2GHU A;  1FH0 A;  4CDE B;  2R9M A;  1GX3 A;  1MIR A;  1GEC E;  3QSD A;  3MHH A;  2VHS A;  3IHP A;  2O6X A;  3P5X A;  2G8J A;  3GCB A;  2Y5B A;  4N4Z A;  2HD5 A;  3F75 A;  4PP2 E;  2AUZ A;  1U9V A;  5A24 A;  3H89 A;  2E02 A;  3CH2 X;  1PPD A;  3CH3 X;  5CVM A;  4BGF A;  3QT4 A;  1PAD A;  3KWZ A;  1QMY A;  2DCB A;  1MHW A;  4BQV A;  2E03 A;  4N8W A;  3K24 A;  1YK8 A;  3I06 A;  2YJC A;  3KX1 A;  1DEU A;  7PCK A;  3LTW A;  4MZO A;  2R9N A;  1S4V A;  3KSE A;  2G7Y A;  1TL9 A;  1KHP A;  1CV8 A;  2HH5 A;  1TU6 A;  4XUI A;  1MEG A;  3WXE A;  1AYV A;  4FK5 A;  3WXF A;  2VFB A;  1MS6 A;  4YYU A;  3LFY A;  3PNR A;  4YYW A;  1PPN A;  5EGW A;  2PAD A;  2JQG R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...