3P5VA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
molecule tags Hydrolase
total genus 69
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5vA00
1MEGA 1CTEA 1KFUL 2AVWA 1F2AA 1DEUA 3RVXA 5CHVA 4YVAA 1CQDA 2NQIA 2R9CA 1KFXL 3KX1A 1ZIVA 2P86A 4X6HA 2YJ8A 2CB5A 3PW3A 2FTDA 1CV8A 2R9OA 2DJFB 1AYUA 1STFE 5J94A 4CDCB 1PPOA 2DC8A 4P6EA 2G6DA 4G54A 3HHAA 3K8UA 3K24A 1F2CA 3H7DA 1YVBA 4X6IA 2DC6A 3S3RA 1BQIA 1QDQA 4W4UA 6PADA 3CBJA 5EGWA 3IUTA 3IHPA 2FT2A 5CVMA 4YYWA 1ME3A 3IMAA 1PBHA 3E1ZB 9PAPA 1F29A 2FO5A 1CS8A 4PP1A 2R9FA 2FQ9A 4OEMA 1IWDA 3H8CA 1MEMA 2DZZA 1EF7A 1AYWA 1XKGA 1K3BB 2DCCA 4YYQA 3WXEA 3QT4A 2NQAA 2GHUA 3LFYA 3N3GA 3RVWA 2AS8A 3QJ3A 3O0UA 2AYOA 3N4CA 2AUZA 4PP2E 4YV8A 1F2BA 2DCBA 2B1MA 1POPA 4XR7A 4P6GA 1PADA 2YJ9A 2OP3A 5K16A 1CJLA 4I07A 1BP4A 3N3KA 2R6NA 1YK7A 1ATKA 1S4VA 2JQFR 5PADA 1AU4A 1AU2A 3NHEA 1PPDA 1PPPA 3BWKA 3OF8A 1VSNA 4DMYA 3WXFA 3GCBA 4K7CA 4N8WA 4QH6A 2AIMA 1PPNA 1FH0A 1NB3A 3U8EA 2YJCA 1MS6A 3V6EA 4N4ZA 2VHSA 3HD3A 1TU6A 4Q8GA 2Y6EA 3KKUA 1NPZA 5FPWA 2YJ2A 1ITOA 3RVVA 2XU4A 4FJCA 2O6XA 1QXPA 2E00A 3BPFA 1TL9A 2PNSA 5CVOB 1GLOA 2OULA 2BDZA 1KXRA 3QSDA 2XU3A 4CZWA 3IV2A 1ME4A 3OISA 3KW9A 3OVXA 3DF0A 3HWNA 2JQGR 2B1NA 2FUDA 3MTNA 1EWLA 3H8BA 3IOQA 2P0RA 3USVA 2WBFX 3H6SA 3I3TA 3BC3A 2OZ2A 2YJBA 2E02A 3ZUAA 2FRQA 3LXSA 3MHSA 4PADA 1Y4HA 1KHQA 4CDDB 2E03A 1AIMA 4RY2A 4QRXA 1KHPA 4CDEB 4MZSA 1HUCB 1U5IA 2IBIA 2E01A 2DJGB 3BOWA 1U9VA 4BS6A 3MORA 1CB5A 3HHIA 1YALA 4WA6A 1Q6KA 5F02A 4MZOA 1DF0A 2BDLA 3PBHA 1CPJA 2DCDA 4YYUA 3MHHA 2AYNA 2PADA 4BPVA 1ICFA 1GECE 3M99A 3O1GA 3PNRA 1U9WA 1Y08A 1PXVA 4N79A 1QOLA 5A24A 3I06A 2ACTA 2G8EA 4PI3A 3P5WA 2F1GA 2H7JA 1NLJA 2XU1A 1ZCMA 1CSBB 4XUIA 3CH3X 3K9MA 2NQDB 5JH3A 1EWOA 1NL6A 3V6CA 1MDWA 3BPMA 3ERVA 1PE6A 4YYVA 3S3QA 1VJVA 4HWYA 4QRGA 2ATOA 1AECA 4FIPA 4OELA 3OVZA 2XU5A 1YK8A 2HHNA 2DZYA 4YYRA 2PREA 1CVZA 1TLOA 4CDFB 1AU0A 3D6SA 4ZUXU 2ARYA 4KLBA 3B79A 1BY8A 4QRVA 1BGOA 3H89A 1O0EA 3KFQA 4I04A 1AYVA 1A6RA 4BQVA 2C0YA 2DC7A 2G8JA 2PBHA 2HH5A 3F5VA 2IPPB 4W5CA 4YYSA 1MHWA 2DCAA 3BCNA 1MIRA 1NQCA 1GCBA 4DMXA 1PCIA 2DC9A 1AU3A 1EWPA 3CBKA 3PDFA 3P5XA 2HD5A 7PCKA 1QMYA 4BS5A 1U9QX 4QBBA 2HXZA 4X6JA 3KWBX 8PCHA 1YT7A 1PIPA 2F7DA 1JQPA 2Y5BA 3IEJA 1U9XA 1THEA 3WXGA 2FYEA 2VHFA 2FRAA 4MSXA 3TNXA 1EWMA 2R9MA 5EF4A 2AU1A 3CH2X 3C9EA 2P7UA 2G7YA 3P5VA 2R9NA 3OF9A 4I05A 4Q8HA 3P5UA 1GMYA 2NQGA 3KSEA 1M6DA 1SP4B 3AI8A 5JA7A 1SNKA 4W5BA 2GFOA 2AUXA 5CVNB 4FK5A 1X9YA 5CHTA 2CIOA 4AXMA 1NB5A 3KWZA 4BSQA 3F75A 4AXLA
chains in the Genus database with same CATH superfamily
1MEGA 1CTEA 1KFUL 2AVWA 1F2AA 1DEUA 3RVXA 5CHVA 4YVAA 1CQDA 3TMPA 2NQIA 2R9CA 3OQCA 1KFXL 3KX1A 1ZIVA 2P86A 5KO3A 3BBAA 3IFUA 4X6HA 2YJ8A 2CB5A 3PW3A 2FTDA 1CV8A 4BOSA 2R9OA 2DJFB 1AYUA 1STFE 5J94A 4CDCB 1PPOA 2DC8A 5E6JA 4P6EA 2G6DA 4G54A 3HHAA 3K8UA 4OVZB 3K24A 1F2CA 3H7DA 1YVBA 4X6IA 2DC6A 3S3RA 1BQIA 1QDQA 2Z84A 4W4UA 6PADA 3CBJA 5EGWA 3IUTA 3E9SA 3IHPA 2FT2A 4M0WA 5CVMA 1ME3A 4YYWA 3IMAA 3PSEA 1PBHA 3E1ZB 2UZJA 9PAPA 1F29A 2AGAA 2FO5A 1CS8A 4PP1A 3B21A 2R9FA 2FQ9A 4OEMA 1IWDA 3H8CA 1MEMA 2DZZA 1EF7A 4BOUA 1AYWA 1XKGA 1K3BB 2DCCA 4YYQA 3WXEA 3QT4A 2NQAA 2GHUA 3LFYA 3N3GA 3RVWA 2AS8A 3QJ3A 4ZTBA 3O0UA 2AYOA 3N4CA 2AUZA 4PP2E 4YV8A 1F2BA 2BTWA 2DCBA 2B1MA 1POPA 4XR7A 4P6GA 1PADA 2YJ9A 2OP3A 5K16A 1CJLA 4D8BA 4I07A 1BP4A 3N3KA 2R6NA 1YK7A 1ATKA 3MJ5A 1S4VA 2JQFR 3MTVA 5PADA 1AU4A 1AU2A 4D8IA 3NHEA 1PPDA 1PPPA 3BWKA 3OF8A 1VSNA 4DMYA 3PRPA 3WXFA 3GCBA 4K7CA 4N8WA 4QH6A 2AIMA 1PPNA 4BOPA 1FH0A 1NB3A 3BY4A 2YJCA 3U8EA 1MS6A 3V6EA 3W30A 4N4ZA 2VHSA 2FE8A 3HD3A 1TU6A 4Q8GA 2Y6EA 3KKUA 1NPZA 5FPWA 2YJ2A 1ITOA 3RVVA 2XU4A 4MM3B 4FJCA 2O6XA 1QXPA 2E00A 4RF0A 3BPFA 1TL9A 2PNSA 5CVOB 3ZNHA 1GLOA 2OULA 2BDZA 4XZXA 4RF1A 1KXRA 3QSDA 2XU3A 4CZWA 3IV2A 1ME4A 3OISA 3KW9A 3OVXA 3DF0A 2BU3A 3HWNA 2JQGR 2B1NA 4BOQA 2FUDA 3MTNA 1DKIA 1EWLA 3H8BA 3IOQA 2P0RA 3USVA 4MI7A 2WBFX 3PHWA 3H6SA 3I3TA 3BC3A 2OZ2A 2YJBA 4HXDB 2E02A 3ZUAA 2FRQA 3LXSA 2J7QC 4P16A 3W31A 3MHSA 4PADA 1Y4HA 1KHQA 4CDDB 2E03A 1AIMA 4RY2A 4QRXA 1KHPA 4CDEB 4MZSA 1HUCB 1U5IA 2JTCA 2IBIA 2E01A 4RNAA 2DJGB 3BOWA 1U9VA 4BS6A 3MORA 1CB5A 2JRIA 3HHIA 5EZQA 1YALA 4WA6A 1Q6KA 5F02A 4MZOA 4OW0A 1DF0A 2BDLA 3PBHA 1CPJA 2DCDA 4YYUA 3MHHA 2AYNA 2PADA 3RNVA 4BPVA 1ICFA 1GECE 3M99A 3O1GA 3PNRA 1U9WA 1Y08A 1PXVA 4N79A 1QOLA 3PHXA 5A24A 3I06A 2ACTA 2G8EA 4PI3A 3P5WA 2BTWB 5JZEA 2F1GA 4GUAA 2H7JA 1NLJA 3TRKA 2XU1A 1ZCMA 3C0RA 1CSBB 4XUIA 1YZBA 3CH3X 3K9MA 2NQDB 5JH3A 1EWOA 1NL6A 4WURA 3V6CA 1MDWA 3BPMA 3ERVA 1PE6A 4OVZA 4YYVA 3S3QA 1VJVA 4HWYA 4QRGA 2ATOA 1AECA 2DOSA 4FIPA 4OELA 3OVZA 4IP3A 2XU5A 1YK8A 2HHNA 2DZYA 4YYRA 2PREA 1CVZA 1TLOA 4CDFB 1AU0A 3D6SA 4ZUXU 4REZA 2ARYA 4KLBA 3BB7A 3B79A 1BY8A 4QRVA 4R3DA 1BGOA 3H89A 5EZSA 4D8EA 1O0EA 3KFQA 4I04A 1AYVA 1A6RA 2HWKA 4BQVA 2C0YA 3MP2A 2DC7A 2G8JA 2PBHA 4BOZA 2HH5A 1PVJA 3F5VA 2IPPB 4W5CA 4YYSA 1MHWA 2DCAA 3BCNA 1MIRA 1NQCA 1GCBA 4DMXA 1PCIA 2DC9A 1AU3A 1EWPA 3CBKA 3PDFA 3P5XA 2HD5A 7PCKA 1QMYA 3PRMA 4BS5A 1U9QX 4QBBA 2HXZA 4X6JA 4A5UA 3KWBX 8PCHA 1YT7A 1PIPA 2F7DA 1JQPA 2Y5BA 3IEJA 1U9XA 1THEA 3WXGA 2FYEA 2VHFA 4PT5A 2FRAA 4MSXA 3TNXA 1EWMA 2R9MA 5EF4A 4RKXA 4IUMA 2AU1A 3CH2X 3C9EA 2P7UA 2G7YA 3P5VA 2R9NA 3OF9A 4I05A 4Q8HA 3P5UA 1GMYA 2NQGA 3KSEA 1M6DA 1SP4B 3PT2A 3AI8A 5JA7A 1SNKA 4W5BA 2J7QA 2GFOA 2AUXA 5CVNB 3PHUA 4FK5A 1X9YA 3O65A 5CHTA 2CIOA 4AXMA 1NB5A 1UKFA 3KWZA 4BSQA 3F75A 4AXLA
chains in the Genus database with same CATH topology
1MEGA 1CTEA 1KFUL 2AVWA 1F2AA 1DEUA 3RVXA 5CHVA 3LTWA 4YVAA 1CQDA 2NQIA 2R9CA 1KFXL 3KX1A 1ZIVA 2P86A 4X6HA 2YJ8A 2CB5A 3PW3A 2FTDA 1CV8A 2R9OA 2DJFB 1AYUA 1STFE 5J94A 4CDCB 1PPOA 2DC8A 1GX3A 4P6EA 2G6DA 4G54A 3HHAA 3K8UA 3K24A 1F2CA 3H7DA 1YVBA 4X6IA 2DC6A 3S3RA 1BQIA 1QDQA 4W4UA 6PADA 3CBJA 5EGWA 3IUTA 3IHPA 2FT2A 5CVMA 4YYWA 1ME3A 3IMAA 1PBHA 3E1ZB 9PAPA 1F29A 2FO5A 1CS8A 4PP1A 2R9FA 2FQ9A 4OEMA 1IWDA 3H8CA 1MEMA 2DZZA 1EF7A 1AYWA 1XKGA 4BGFA 1K3BB 2DCCA 4YYQA 3WXEA 3QT4A 2NQAA 2GHUA 3LFYA 3N3GA 3RVWA 2AS8A 3QJ3A 3O0UA 2AYOA 3N4CA 2AUZA 4PP2E 4YV8A 1F2BA 2DCBA 2B1MA 1POPA 4XR7A 4B55A 4P6GA 1PADA 2YJ9A 2OP3A 5K16A 1CJLA 4I07A 1BP4A 3N3KA 2R6NA 1YK7A 1ATKA 1S4VA 2JQFR 5PADA 1AU4A 1AU2A 3NHEA 1PPDA 1PPPA 3BWKA 3OF8A 1VSNA 4DMYA 3WXFA 3GCBA 4K7CA 4N8WA 4QH6A 2AIMA 1PPNA 1FH0A 1NB3A 3U8EA 2YJCA 1MS6A 3V6EA 4N4ZA 2VHSA 3HD3A 1TU6A 4Q8GA 2Y6EA 3KKUA 1NPZA 5FPWA 2YJ2A 1ITOA 3RVVA 2XU4A 1E2TA 4FJCA 2O6XA 1QXPA 2E00A 3BPFA 1TL9A 2PNSA 5CVOB 1GLOA 2OULA 2BDZA 1KXRA 3QSDA 4C5PA 2XU3A 4CZWA 3IV2A 1ME4A 3OISA 4NV7A 3KW9A 3OVXA 3DF0A 3HWNA 2JQGR 2B1NA 2FUDA 3MTNA 2BSZA 1EWLA 3H8BA 3IOQA 2P0RA 3USVA 2WBFX 1W4TA 3H6SA 3I3TA 3BC3A 2OZ2A 1W6FA 2YJBA 2E02A 3ZUAA 2FRQA 3LXSA 3MHSA 4PADA 1Y4HA 1KHQA 4CDDB 2E03A 1AIMA 4RY2A 4QRXA 1KHPA 4CDEB 4MZSA 1HUCB 1U5IA 2IBIA 2E01A 2DJGB 3BOWA 1U9VA 4BS6A 3MORA 1CB5A 3HHIA 1YALA 4WA6A 1Q6KA 5F02A 4MZOA 1DF0A 2VFBA 2BDLA 3PBHA 1CPJA 2DCDA 4YYUA 3MHHA 2AYNA 2PADA 4BPVA 1ICFA 1GECE 3M99A 3O1GA 3PNRA 1U9WA 1Y08A 1PXVA 4N79A 1QOLA 5A24A 3I06A 2ACTA 2G8EA 4PI3A 3P5WA 2F1GA 2H7JA 1NLJA 2XU1A 1ZCMA 1CSBB 4XUIA 3CH3X 3K9MA 2NQDB 5JH3A 1EWOA 1NL6A 3V6CA 1MDWA 3BPMA 3ERVA 1PE6A 4YYVA 3S3QA 1VJVA 4HWYA 4QRGA 2ATOA 1AECA 4FIPA 4OELA 3OVZA 2XU5A 1YK8A 2HHNA 2DZYA 4YYRA 2PREA 1CVZA 1TLOA 4CDFB 1AU0A 3D6SA 4ZUXU 2ARYA 4KLBA 3B79A 1BY8A 4QRVA 1BGOA 3H89A 1O0EA 3KFQA 4I04A 1AYVA 1A6RA 4BQVA 2C0YA 2DC7A 2G8JA 2PBHA 2HH5A 3F5VA 2IPPB 4W5CA 4YYSA 1MHWA 2DCAA 2VFCA 3BCNA 1MIRA 1NQCA 1GCBA 4DMXA 1PCIA 2DC9A 1AU3A 1EWPA 3CBKA 3PDFA 3P5XA 4GUZA 2HD5A 7PCKA 1QMYA 4BS5A 1U9QX 4QBBA 2HXZA 4X6JA 3KWBX 8PCHA 1YT7A 1PIPA 2F7DA 1JQPA 2Y5BA 3IEJA 1U9XA 1THEA 3WXGA 2FYEA 2VHFA 2FRAA 4MSXA 3TNXA 1EWMA 2R9MA 5EF4A 3D9WA 2AU1A 3CH2X 3C9EA 2P7UA 2G7YA 3P5VA 2R9NA 3OF9A 4I05A 4Q8HA 3P5UA 1GMYA 2NQGA 3KSEA 1M6DA 1SP4B 3AI8A 5JA7A 1SNKA 4W5BA 2GFOA 2AUXA 5CVNB 4FK5A 1X9YA 4NV8A 5CHTA 2CIOA 4AXMA 1NB5A 3KWZA 4BSQA 3F75A 4AXLA 1W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEG A;  1CTE A;  1KFU L;  2AVW A;  1F2A A;  1DEU A;  3RVX A;  5CHV A;  4YVA A;  1CQD A;  2NQI A;  2R9C A;  1KFX L;  3KX1 A;  1ZIV A;  2P86 A;  4X6H A;  2YJ8 A;  2CB5 A;  3PW3 A;  2FTD A;  1CV8 A;  2R9O A;  2DJF B;  1AYU A;  1STF E;  5J94 A;  4CDC B;  1PPO A;  2DC8 A;  4P6E A;  2G6D A;  4G54 A;  3HHA A;  3K8U A;  3K24 A;  1F2C A;  3H7D A;  1YVB A;  4X6I A;  2DC6 A;  3S3R A;  1BQI A;  1QDQ A;  4W4U A;  6PAD A;  3CBJ A;  5EGW A;  3IUT A;  3IHP A;  2FT2 A;  5CVM A;  4YYW A;  1ME3 A;  3IMA A;  1PBH A;  3E1Z B;  9PAP A;  1F29 A;  2FO5 A;  1CS8 A;  4PP1 A;  2R9F A;  2FQ9 A;  4OEM A;  1IWD A;  3H8C A;  1MEM A;  2DZZ A;  1EF7 A;  1AYW A;  1XKG A;  1K3B B;  2DCC A;  4YYQ A;  3WXE A;  3QT4 A;  2NQA A;  2GHU A;  3LFY A;  3N3G A;  3RVW A;  2AS8 A;  3QJ3 A;  3O0U A;  2AYO A;  3N4C A;  2AUZ A;  4PP2 E;  4YV8 A;  1F2B A;  2DCB A;  2B1M A;  1POP A;  4XR7 A;  4P6G A;  1PAD A;  2YJ9 A;  2OP3 A;  5K16 A;  1CJL A;  4I07 A;  1BP4 A;  3N3K A;  2R6N A;  1YK7 A;  1ATK A;  1S4V A;  2JQF R;  5PAD A;  1AU4 A;  1AU2 A;  3NHE A;  1PPD A;  1PPP A;  3BWK A;  3OF8 A;  1VSN A;  4DMY A;  3WXF A;  3GCB A;  4K7C A;  4N8W A;  4QH6 A;  2AIM A;  1PPN A;  1FH0 A;  1NB3 A;  3U8E A;  2YJC A;  1MS6 A;  3V6E A;  4N4Z A;  2VHS A;  3HD3 A;  1TU6 A;  4Q8G A;  2Y6E A;  3KKU A;  1NPZ A;  5FPW A;  2YJ2 A;  1ITO A;  3RVV A;  2XU4 A;  4FJC A;  2O6X A;  1QXP A;  2E00 A;  3BPF A;  1TL9 A;  2PNS A;  5CVO B;  1GLO A;  2OUL A;  2BDZ A;  1KXR A;  3QSD A;  2XU3 A;  4CZW A;  3IV2 A;  1ME4 A;  3OIS A;  3KW9 A;  3OVX A;  3DF0 A;  3HWN A;  2JQG R;  2B1N A;  2FUD A;  3MTN A;  1EWL A;  3H8B A;  3IOQ A;  2P0R A;  3USV A;  2WBF X;  3H6S A;  3I3T A;  3BC3 A;  2OZ2 A;  2YJB A;  2E02 A;  3ZUA A;  2FRQ A;  3LXS A;  3MHS A;  4PAD A;  1Y4H A;  1KHQ A;  4CDD B;  2E03 A;  1AIM A;  4RY2 A;  4QRX A;  1KHP A;  4CDE B;  4MZS A;  1HUC B;  1U5I A;  2IBI A;  2E01 A;  2DJG B;  3BOW A;  1U9V A;  4BS6 A;  3MOR A;  1CB5 A;  3HHI A;  1YAL A;  4WA6 A;  1Q6K A;  5F02 A;  4MZO A;  1DF0 A;  2BDL A;  3PBH A;  1CPJ A;  2DCD A;  4YYU A;  3MHH A;  2AYN A;  2PAD A;  4BPV A;  1ICF A;  1GEC E;  3M99 A;  3O1G A;  3PNR A;  1U9W A;  1Y08 A;  1PXV A;  4N79 A;  1QOL A;  5A24 A;  3I06 A;  2ACT A;  2G8E A;  4PI3 A;  3P5W A;  2F1G A;  2H7J A;  1NLJ A;  2XU1 A;  1ZCM A;  1CSB B;  4XUI A;  3CH3 X;  3K9M A;  2NQD B;  5JH3 A;  1EWO A;  1NL6 A;  3V6C A;  1MDW A;  3BPM A;  3ERV A;  1PE6 A;  4YYV A;  3S3Q A;  1VJV A;  4HWY A;  4QRG A;  2ATO A;  1AEC A;  4FIP A;  4OEL A;  3OVZ A;  2XU5 A;  1YK8 A;  2HHN A;  2DZY A;  4YYR A;  2PRE A;  1CVZ A;  1TLO A;  4CDF B;  1AU0 A;  3D6S A;  4ZUX U;  2ARY A;  4KLB A;  3B79 A;  1BY8 A;  4QRV A;  1BGO A;  3H89 A;  1O0E A;  3KFQ A;  4I04 A;  1AYV A;  1A6R A;  4BQV A;  2C0Y A;  2DC7 A;  2G8J A;  2PBH A;  2HH5 A;  3F5V A;  2IPP B;  4W5C A;  4YYS A;  1MHW A;  2DCA A;  3BCN A;  1MIR A;  1NQC A;  1GCB A;  4DMX A;  1PCI A;  2DC9 A;  1AU3 A;  1EWP A;  3CBK A;  3PDF A;  3P5X A;  2HD5 A;  7PCK A;  1QMY A;  4BS5 A;  1U9Q X;  4QBB A;  2HXZ A;  4X6J A;  3KWB X;  8PCH A;  1YT7 A;  1PIP A;  2F7D A;  1JQP A;  2Y5B A;  3IEJ A;  1U9X A;  1THE A;  3WXG A;  2FYE A;  2VHF A;  2FRA A;  4MSX A;  3TNX A;  1EWM A;  2R9M A;  5EF4 A;  2AU1 A;  3CH2 X;  3C9E A;  2P7U A;  2G7Y A;  3P5V A;  2R9N A;  3OF9 A;  4I05 A;  4Q8H A;  3P5U A;  1GMY A;  2NQG A;  3KSE A;  1M6D A;  1SP4 B;  3AI8 A;  5JA7 A;  1SNK A;  4W5B A;  2GFO A;  2AUX A;  5CVN B;  4FK5 A;  1X9Y A;  5CHT A;  2CIO A;  4AXM A;  1NB5 A;  3KWZ A;  4BSQ A;  3F75 A;  4AXL A; 
#chains in the Genus database with same CATH topology
 1MEG A;  1CTE A;  1KFU L;  2AVW A;  1F2A A;  1DEU A;  3RVX A;  5CHV A;  4YVA A;  1CQD A;  3TMP A;  2NQI A;  2R9C A;  3OQC A;  1KFX L;  3KX1 A;  1ZIV A;  2P86 A;  5KO3 A;  3BBA A;  3IFU A;  4X6H A;  2YJ8 A;  2CB5 A;  3PW3 A;  2FTD A;  1CV8 A;  4BOS A;  2R9O A;  2DJF B;  1AYU A;  1STF E;  5J94 A;  4CDC B;  1PPO A;  2DC8 A;  5E6J A;  4P6E A;  2G6D A;  4G54 A;  3HHA A;  3K8U A;  4OVZ B;  3K24 A;  1F2C A;  3H7D A;  1YVB A;  4X6I A;  2DC6 A;  3S3R A;  1BQI A;  1QDQ A;  2Z84 A;  4W4U A;  6PAD A;  3CBJ A;  5EGW A;  3IUT A;  3E9S A;  3IHP A;  2FT2 A;  4M0W A;  5CVM A;  1ME3 A;  4YYW A;  3IMA A;  3PSE A;  1PBH A;  3E1Z B;  2UZJ A;  9PAP A;  1F29 A;  2AGA A;  2FO5 A;  1CS8 A;  4PP1 A;  3B21 A;  2R9F A;  2FQ9 A;  4OEM A;  1IWD A;  3H8C A;  1MEM A;  2DZZ A;  1EF7 A;  4BOU A;  1AYW A;  1XKG A;  1K3B B;  2DCC A;  4YYQ A;  3WXE A;  3QT4 A;  2NQA A;  2GHU A;  3LFY A;  3N3G A;  3RVW A;  2AS8 A;  3QJ3 A;  4ZTB A;  3O0U A;  2AYO A;  3N4C A;  2AUZ A;  4PP2 E;  4YV8 A;  1F2B A;  2BTW A;  2DCB A;  2B1M A;  1POP A;  4XR7 A;  4P6G A;  1PAD A;  2YJ9 A;  2OP3 A;  5K16 A;  1CJL A;  4D8B A;  4I07 A;  1BP4 A;  3N3K A;  2R6N A;  1YK7 A;  1ATK A;  3MJ5 A;  1S4V A;  2JQF R;  3MTV A;  5PAD A;  1AU4 A;  1AU2 A;  4D8I A;  3NHE A;  1PPD A;  1PPP A;  3BWK A;  3OF8 A;  1VSN A;  4DMY A;  3PRP A;  3WXF A;  3GCB A;  4K7C A;  4N8W A;  4QH6 A;  2AIM A;  1PPN A;  4BOP A;  1FH0 A;  1NB3 A;  3BY4 A;  2YJC A;  3U8E A;  1MS6 A;  3V6E A;  3W30 A;  4N4Z A;  2VHS A;  2FE8 A;  3HD3 A;  1TU6 A;  4Q8G A;  2Y6E A;  3KKU A;  1NPZ A;  5FPW A;  2YJ2 A;  1ITO A;  3RVV A;  2XU4 A;  4MM3 B;  4FJC A;  2O6X A;  1QXP A;  2E00 A;  4RF0 A;  3BPF A;  1TL9 A;  2PNS A;  5CVO B;  3ZNH A;  1GLO A;  2OUL A;  2BDZ A;  4XZX A;  4RF1 A;  1KXR A;  3QSD A;  2XU3 A;  4CZW A;  3IV2 A;  1ME4 A;  3OIS A;  3KW9 A;  3OVX A;  3DF0 A;  2BU3 A;  3HWN A;  2JQG R;  2B1N A;  4BOQ A;  2FUD A;  3MTN A;  1DKI A;  1EWL A;  3H8B A;  3IOQ A;  2P0R A;  3USV A;  4MI7 A;  2WBF X;  3PHW A;  3H6S A;  3I3T A;  3BC3 A;  2OZ2 A;  2YJB A;  4HXD B;  2E02 A;  3ZUA A;  2FRQ A;  3LXS A;  2J7Q C;  4P16 A;  3W31 A;  3MHS A;  4PAD A;  1Y4H A;  1KHQ A;  4CDD B;  2E03 A;  1AIM A;  4RY2 A;  4QRX A;  1KHP A;  4CDE B;  4MZS A;  1HUC B;  1U5I A;  2JTC A;  2IBI A;  2E01 A;  4RNA A;  2DJG B;  3BOW A;  1U9V A;  4BS6 A;  3MOR A;  1CB5 A;  2JRI A;  3HHI A;  5EZQ A;  1YAL A;  4WA6 A;  1Q6K A;  5F02 A;  4MZO A;  4OW0 A;  1DF0 A;  2BDL A;  3PBH A;  1CPJ A;  2DCD A;  4YYU A;  3MHH A;  2AYN A;  2PAD A;  3RNV A;  4BPV A;  1ICF A;  1GEC E;  3M99 A;  3O1G A;  3PNR A;  1U9W A;  1Y08 A;  1PXV A;  4N79 A;  1QOL A;  3PHX A;  5A24 A;  3I06 A;  2ACT A;  2G8E A;  4PI3 A;  3P5W A;  2BTW B;  5JZE A;  2F1G A;  4GUA A;  2H7J A;  1NLJ A;  3TRK A;  2XU1 A;  1ZCM A;  3C0R A;  1CSB B;  4XUI A;  1YZB A;  3CH3 X;  3K9M A;  2NQD B;  5JH3 A;  1EWO A;  1NL6 A;  4WUR A;  3V6C A;  1MDW A;  3BPM A;  3ERV A;  1PE6 A;  4OVZ A;  4YYV A;  3S3Q A;  1VJV A;  4HWY A;  4QRG A;  2ATO A;  1AEC A;  2DOS A;  4FIP A;  4OEL A;  3OVZ A;  4IP3 A;  2XU5 A;  1YK8 A;  2HHN A;  2DZY A;  4YYR A;  2PRE A;  1CVZ A;  1TLO A;  4CDF B;  1AU0 A;  3D6S A;  4ZUX U;  4REZ A;  2ARY A;  4KLB A;  3BB7 A;  3B79 A;  1BY8 A;  4QRV A;  4R3D A;  1BGO A;  3H89 A;  5EZS A;  4D8E A;  1O0E A;  3KFQ A;  4I04 A;  1AYV A;  1A6R A;  2HWK A;  4BQV A;  2C0Y A;  3MP2 A;  2DC7 A;  2G8J A;  2PBH A;  4BOZ A;  2HH5 A;  1PVJ A;  3F5V A;  2IPP B;  4W5C A;  4YYS A;  1MHW A;  2DCA A;  3BCN A;  1MIR A;  1NQC A;  1GCB A;  4DMX A;  1PCI A;  2DC9 A;  1AU3 A;  1EWP A;  3CBK A;  3PDF A;  3P5X A;  2HD5 A;  7PCK A;  1QMY A;  3PRM A;  4BS5 A;  1U9Q X;  4QBB A;  2HXZ A;  4X6J A;  4A5U A;  3KWB X;  8PCH A;  1YT7 A;  1PIP A;  2F7D A;  1JQP A;  2Y5B A;  3IEJ A;  1U9X A;  1THE A;  3WXG A;  2FYE A;  2VHF A;  4PT5 A;  2FRA A;  4MSX A;  3TNX A;  1EWM A;  2R9M A;  5EF4 A;  4RKX A;  4IUM A;  2AU1 A;  3CH2 X;  3C9E A;  2P7U A;  2G7Y A;  3P5V A;  2R9N A;  3OF9 A;  4I05 A;  4Q8H A;  3P5U A;  1GMY A;  2NQG A;  3KSE A;  1M6D A;  1SP4 B;  3PT2 A;  3AI8 A;  5JA7 A;  1SNK A;  4W5B A;  2J7Q A;  2GFO A;  2AUX A;  5CVN B;  3PHU A;  4FK5 A;  1X9Y A;  3O65 A;  5CHT A;  2CIO A;  4AXM A;  1NB5 A;  1UKF A;  3KWZ A;  4BSQ A;  3F75 A;  4AXL A; 
#chains in the Genus database with same CATH homology
 1MEG A;  1CTE A;  1KFU L;  2AVW A;  1F2A A;  1DEU A;  3RVX A;  5CHV A;  3LTW A;  4YVA A;  1CQD A;  2NQI A;  2R9C A;  1KFX L;  3KX1 A;  1ZIV A;  2P86 A;  4X6H A;  2YJ8 A;  2CB5 A;  3PW3 A;  2FTD A;  1CV8 A;  2R9O A;  2DJF B;  1AYU A;  1STF E;  5J94 A;  4CDC B;  1PPO A;  2DC8 A;  1GX3 A;  4P6E A;  2G6D A;  4G54 A;  3HHA A;  3K8U A;  3K24 A;  1F2C A;  3H7D A;  1YVB A;  4X6I A;  2DC6 A;  3S3R A;  1BQI A;  1QDQ A;  4W4U A;  6PAD A;  3CBJ A;  5EGW A;  3IUT A;  3IHP A;  2FT2 A;  5CVM A;  4YYW A;  1ME3 A;  3IMA A;  1PBH A;  3E1Z B;  9PAP A;  1F29 A;  2FO5 A;  1CS8 A;  4PP1 A;  2R9F A;  2FQ9 A;  4OEM A;  1IWD A;  3H8C A;  1MEM A;  2DZZ A;  1EF7 A;  1AYW A;  1XKG A;  4BGF A;  1K3B B;  2DCC A;  4YYQ A;  3WXE A;  3QT4 A;  2NQA A;  2GHU A;  3LFY A;  3N3G A;  3RVW A;  2AS8 A;  3QJ3 A;  3O0U A;  2AYO A;  3N4C A;  2AUZ A;  4PP2 E;  4YV8 A;  1F2B A;  2DCB A;  2B1M A;  1POP A;  4XR7 A;  4B55 A;  4P6G A;  1PAD A;  2YJ9 A;  2OP3 A;  5K16 A;  1CJL A;  4I07 A;  1BP4 A;  3N3K A;  2R6N A;  1YK7 A;  1ATK A;  1S4V A;  2JQF R;  5PAD A;  1AU4 A;  1AU2 A;  3NHE A;  1PPD A;  1PPP A;  3BWK A;  3OF8 A;  1VSN A;  4DMY A;  3WXF A;  3GCB A;  4K7C A;  4N8W A;  4QH6 A;  2AIM A;  1PPN A;  1FH0 A;  1NB3 A;  3U8E A;  2YJC A;  1MS6 A;  3V6E A;  4N4Z A;  2VHS A;  3HD3 A;  1TU6 A;  4Q8G A;  2Y6E A;  3KKU A;  1NPZ A;  5FPW A;  2YJ2 A;  1ITO A;  3RVV A;  2XU4 A;  1E2T A;  4FJC A;  2O6X A;  1QXP A;  2E00 A;  3BPF A;  1TL9 A;  2PNS A;  5CVO B;  1GLO A;  2OUL A;  2BDZ A;  1KXR A;  3QSD A;  4C5P A;  2XU3 A;  4CZW A;  3IV2 A;  1ME4 A;  3OIS A;  4NV7 A;  3KW9 A;  3OVX A;  3DF0 A;  3HWN A;  2JQG R;  2B1N A;  2FUD A;  3MTN A;  2BSZ A;  1EWL A;  3H8B A;  3IOQ A;  2P0R A;  3USV A;  2WBF X;  1W4T A;  3H6S A;  3I3T A;  3BC3 A;  2OZ2 A;  1W6F A;  2YJB A;  2E02 A;  3ZUA A;  2FRQ A;  3LXS A;  3MHS A;  4PAD A;  1Y4H A;  1KHQ A;  4CDD B;  2E03 A;  1AIM A;  4RY2 A;  4QRX A;  1KHP A;  4CDE B;  4MZS A;  1HUC B;  1U5I A;  2IBI A;  2E01 A;  2DJG B;  3BOW A;  1U9V A;  4BS6 A;  3MOR A;  1CB5 A;  3HHI A;  1YAL A;  4WA6 A;  1Q6K A;  5F02 A;  4MZO A;  1DF0 A;  2VFB A;  2BDL A;  3PBH A;  1CPJ A;  2DCD A;  4YYU A;  3MHH A;  2AYN A;  2PAD A;  4BPV A;  1ICF A;  1GEC E;  3M99 A;  3O1G A;  3PNR A;  1U9W A;  1Y08 A;  1PXV A;  4N79 A;  1QOL A;  5A24 A;  3I06 A;  2ACT A;  2G8E A;  4PI3 A;  3P5W A;  2F1G A;  2H7J A;  1NLJ A;  2XU1 A;  1ZCM A;  1CSB B;  4XUI A;  3CH3 X;  3K9M A;  2NQD B;  5JH3 A;  1EWO A;  1NL6 A;  3V6C A;  1MDW A;  3BPM A;  3ERV A;  1PE6 A;  4YYV A;  3S3Q A;  1VJV A;  4HWY A;  4QRG A;  2ATO A;  1AEC A;  4FIP A;  4OEL A;  3OVZ A;  2XU5 A;  1YK8 A;  2HHN A;  2DZY A;  4YYR A;  2PRE A;  1CVZ A;  1TLO A;  4CDF B;  1AU0 A;  3D6S A;  4ZUX U;  2ARY A;  4KLB A;  3B79 A;  1BY8 A;  4QRV A;  1BGO A;  3H89 A;  1O0E A;  3KFQ A;  4I04 A;  1AYV A;  1A6R A;  4BQV A;  2C0Y A;  2DC7 A;  2G8J A;  2PBH A;  2HH5 A;  3F5V A;  2IPP B;  4W5C A;  4YYS A;  1MHW A;  2DCA A;  2VFC A;  3BCN A;  1MIR A;  1NQC A;  1GCB A;  4DMX A;  1PCI A;  2DC9 A;  1AU3 A;  1EWP A;  3CBK A;  3PDF A;  3P5X A;  4GUZ A;  2HD5 A;  7PCK A;  1QMY A;  4BS5 A;  1U9Q X;  4QBB A;  2HXZ A;  4X6J A;  3KWB X;  8PCH A;  1YT7 A;  1PIP A;  2F7D A;  1JQP A;  2Y5B A;  3IEJ A;  1U9X A;  1THE A;  3WXG A;  2FYE A;  2VHF A;  2FRA A;  4MSX A;  3TNX A;  1EWM A;  2R9M A;  5EF4 A;  3D9W A;  2AU1 A;  3CH2 X;  3C9E A;  2P7U A;  2G7Y A;  3P5V A;  2R9N A;  3OF9 A;  4I05 A;  4Q8H A;  3P5U A;  1GMY A;  2NQG A;  3KSE A;  1M6D A;  1SP4 B;  3AI8 A;  5JA7 A;  1SNK A;  4W5B A;  2GFO A;  2AUX A;  5CVN B;  4FK5 A;  1X9Y A;  4NV8 A;  5CHT A;  2CIO A;  4AXM A;  1NB5 A;  3KWZ A;  4BSQ A;  3F75 A;  4AXL A;  1W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...