3P5VA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
219
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
total genus 69
structure length 219
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5vA00
4N4ZA 1PADA 3H6SA 4CDEB 1QXPA 2O6XA 1AECA 4PI3A 2E03A 4YYQA 3V6CA 1BGOA 2H7JA 2DC6A 3HD3A 4P6EA 4K7CA 2CIOA 1CSBB 5PADA 2JQFR 1EWMA 3CH3X 4PP2E 5FPWA 2P0RA 3ERVA 1MIRA 3C9EA 2R9OA 3H7DA 3WXGA 1TLOA 1AU4A 2Y6EA 4YVAA 2BDZA 3V6EA 4DMXA 1IWDA 2DC8A 2HD5A 1CS8A 1POPA 2AIMA 1YT7A 3KWZA 5J94A 2R9FA 1PBHA 3QSDA 2IBIA 2E02A 4YYVA 2FUDA 1U9VA 2DCDA 1MEMA 3D6SA 2P7UA 1K3BB 1CVZA 3RVVA 5JH3A 2E01A 2FO5A 4FIPA 1KHQA 1NB5A 1YALA 1S4VA 1NPZA 2DJGB 2HXZA 2YJBA 6PADA 3OF8A 2NQGA 1U9WA 4WA6A 3HHAA 2XU4A 4CDDB 3N3KA 3BOWA 4P6GA 1DF0A 2VHFA 1KFUL 4QH6A 2DC7A 1SNKA 9PAPA 3OVZA 4CDFB 4X6IA 2CB5A 2XU3A 1AU0A 1CV8A 1SP4B 2DZYA 4I04A 3KW9A 1CB5A 2AUXA 3KKUA 3IV2A 2P86A 1GLOA 2AS8A 1Y08A 3WXFA 1NB3A 2YJ9A 1EF7A 1KFXL 4QRXA 2G7YA 2DCBA 4MZOA 1AYWA 2OZ2A 2B1MA 2WBFX 3IUTA 2E00A 1BP4A 1M6DA 2B1NA 1PPDA 3CBKA 3BWKA 2PREA 1U9QX 2HH5A 2R6NA 4MZSA 5F02A 4X6JA 4PADA 1AU2A 1ZCMA 2DJFB 3F75A 1F29A 2DCAA 3U8EA 1FH0A 2G8JA 5CHVA 4ZUXU 1TU6A 1CJLA 2AYNA 2XU5A 4AXLA 2ATOA 3OISA 4YYWA 2F7DA 1YVBA 3O1GA 5EGWA 1PPOA 4CZWA 2ARYA 3PDFA 3MHHA 1MHWA 2NQAA 2AVWA 4N79A 1NL6A 4OELA 1AU3A 3F5VA 4FK5A 1EWOA 1F2BA 3KFQA 4CDCB 1U9XA 3I3TA 5CVOB 4W5CA 3H89A 2FQ9A 5A24A 3OF9A 4XR7A 1QDQA 1QOLA 5CHTA 3MORA 2R9CA 3B79A 3MTNA 1NLJA 1STFE 4G54A 1AYVA 1BQIA 5K16A 3S3RA 1AYUA 1GCBA 1Y4HA 3HWNA 4BSQA 3E1ZB 1KHPA 4YV8A 3M99A 3IEJA 2R9MA 1VJVA 4BQVA 3GCBA 1CTEA 1MEGA 3PW3A 8PCHA 3K9MA 2G8EA 3KSEA 2AYOA 2C0YA 3K24A 4OEMA 1MS6A 2R9NA 3H8BA 1ZIVA 2GFOA 3O0UA 4KLBA 2FT2A 3N3GA 5CVMA 3USVA 2G6DA 4W5BA 1F2CA 2DCCA 3CH2X 4BS5A 4I05A 3QT4A 1EWPA 4DMYA 2GHUA 5JA7A 1TL9A 3S3QA 2F1GA 3CBJA 1PPNA 1MDWA 2FRQA 3ZUAA 1XKGA 4AXMA 2OULA 3K8UA 3NHEA 2VHSA 3AI8A 3WXEA 4QBBA 2IPPB 3LXSA 3H8CA 2YJCA 2YJ2A 4YYRA 4YYUA 7PCKA 3IHPA 1PPPA 3IOQA 3N4CA 1ME3A 1GECE 3DF0A 1O0EA 1Q6KA 4YYSA 3I06A 4PP1A 1HUCB 5CVNB 1BY8A 2DC9A 1X9YA 3RVWA 2ACTA 3P5XA 2FRAA 1EWLA 1YK7A 3BPMA 4MSXA 3PNRA 3BPFA 2JQGR 2Y5BA 2FTDA 3HHIA 4QRGA 1ME4A 1JQPA 2PBHA 1U5IA 2XU1A 2PADA 3KWBX 3PBHA 3RVXA 3TNXA 3MHSA 4QRVA 4Q8GA 5EF4A 3P5VA 1A6RA 1KXRA 1CPJA 1QMYA 2AUZA 1PE6A 4RY2A 2NQDB 4BS6A 1YK8A 4I07A 3IMAA 1PIPA 4X6HA 2FYEA 4W4UA 1F2AA 1CQDA 3P5WA 1PCIA 4XUIA 2OP3A 3OVXA 2NQIA 1THEA 2DZZA 1AIMA 3LFYA 4BPVA 1GMYA 4N8WA 2PNSA 2AU1A 3BC3A 1ICFA 2YJ8A 3P5UA 4Q8HA 1ITOA 1DEUA 4FJCA 2BDLA 1VSNA 1ATKA 1NQCA 3BCNA 1PXVA 2HHNA 4HWYA 3KX1A 3QJ3A
chains in the Genus database with same CATH superfamily
4N4ZA 1PADA 3H6SA 4CDEB 1QXPA 2O6XA 1AECA 2HWKA 2UZJA 4PI3A 3IFUA 2E03A 3BY4A 4YYQA 3V6CA 1BGOA 3PRMA 2H7JA 2DC6A 3HD3A 4P6EA 4K7CA 1PVJA 2CIOA 1CSBB 5PADA 2JQFR 4D8IA 1EWMA 3CH3X 4PP2E 5FPWA 2P0RA 3ERVA 1MIRA 3RNVA 4R3DA 4OVZB 3C9EA 2R9OA 3H7DA 3WXGA 1TLOA 1AU4A 2Y6EA 4YVAA 2BDZA 3V6EA 4DMXA 1IWDA 2DC8A 2HD5A 1CS8A 1POPA 2AIMA 1YT7A 3KWZA 5J94A 3ZNHA 2R9FA 1PBHA 3QSDA 2IBIA 2E02A 4YYVA 2FUDA 1U9VA 2DCDA 1MEMA 3D6SA 2P7UA 1K3BB 1CVZA 3RVVA 5JH3A 2E01A 2FO5A 4FIPA 1KHQA 1NB5A 3PHWA 1YALA 1S4VA 4GUAA 1NPZA 2DJGB 2HXZA 2YJBA 6PADA 4MI7A 3OF8A 2NQGA 1U9WA 2Z84A 4WA6A 4D8EA 3HHAA 2XU4A 4CDDB 3N3KA 3BOWA 4P6GA 1DF0A 4A5UA 2VHFA 1KFUL 3B21A 4QH6A 3TRKA 2DC7A 1SNKA 9PAPA 3OVZA 4CDFB 4X6IA 2CB5A 2XU3A 1AU0A 1CV8A 4OW0A 3BBAA 1SP4B 2DZYA 5KO3A 4I04A 3KW9A 1CB5A 2AUXA 3KKUA 3IV2A 2P86A 1GLOA 2AS8A 1Y08A 3WXFA 1NB3A 2YJ9A 1EF7A 1KFXL 4QRXA 2G7YA 2DCBA 4MZOA 1AYWA 2OZ2A 2B1MA 2WBFX 3IUTA 2E00A 1BP4A 4MM3B 1M6DA 2B1NA 1PPDA 3CBKA 4BOPA 3BWKA 2PREA 1U9QX 2HH5A 2R6NA 4MZSA 4BOQA 5F02A 4X6JA 4PADA 1AU2A 1ZCMA 2DJFB 4RF1A 3F75A 1F29A 2DCAA 3U8EA 1FH0A 1YZBA 2G8JA 5CHVA 4ZUXU 2BTWA 1TU6A 5EZQA 5EZSA 1CJLA 2AYNA 2XU5A 4AXLA 2ATOA 3OISA 4YYWA 2F7DA 1YVBA 3O1GA 5EGWA 1PPOA 4CZWA 2ARYA 3PDFA 3MHHA 1MHWA 2NQAA 2AVWA 2DOSA 4N79A 1NL6A 4WURA 4OELA 1AU3A 3F5VA 1DKIA 4IUMA 4D8BA 4FK5A 1EWOA 1F2BA 3KFQA 4RNAA 4BOZA 4CDCB 1U9XA 3I3TA 5CVOB 4W5CA 3H89A 2FQ9A 3O65A 5A24A 3OF9A 3C0RA 3MTVA 1QDQA 4XR7A 1QOLA 4ZTBA 5CHTA 3MORA 2R9CA 3B79A 3MTNA 1NLJA 5E6JA 1STFE 4G54A 1AYVA 4RKXA 1BQIA 5K16A 3S3RA 1AYUA 1GCBA 1Y4HA 3W31A 2BTWB 3HWNA 4BSQA 3E1ZB 1KHPA 4YV8A 3M99A 3IEJA 3PRPA 2R9MA 1VJVA 4BQVA 3GCBA 1CTEA 1MEGA 3PW3A 8PCHA 3K9MA 2G8EA 3KSEA 2AYOA 2C0YA 3K24A 4OEMA 1MS6A 1UKFA 2R9NA 3H8BA 2AGAA 1ZIVA 2GFOA 3O0UA 4KLBA 2FT2A 3N3GA 5CVMA 3USVA 2G6DA 4W5BA 1F2CA 2DCCA 3CH2X 4BS5A 4I05A 3QT4A 2J7QA 1EWPA 4DMYA 2GHUA 4IP3A 3MJ5A 5JA7A 4PT5A 1TL9A 3S3QA 2F1GA 3CBJA 4RF0A 1PPNA 1MDWA 2FRQA 4BOUA 3ZUAA 1XKGA 4AXMA 2OULA 3K8UA 3NHEA 2VHSA 3AI8A 3WXEA 4QBBA 2IPPB 3LXSA 3H8CA 2YJCA 2YJ2A 4YYRA 4YYUA 7PCKA 3IHPA 1PPPA 3IOQA 3TMPA 3N4CA 1ME3A 1GECE 3DF0A 1O0EA 1Q6KA 4YYSA 3I06A 4PP1A 1HUCB 5CVNB 1BY8A 2DC9A 1X9YA 3RVWA 2ACTA 3BB7A 3MP2A 3E9SA 3P5XA 2FRAA 2FE8A 1EWLA 1YK7A 3BPMA 2JRIA 3PNRA 4MSXA 3BPFA 2JQGR 2Y5BA 2FTDA 4HXDB 3HHIA 4QRGA 1ME4A 1JQPA 2PBHA 1U5IA 2XU1A 2PADA 3KWBX 4P16A 3PBHA 3RVXA 3TNXA 3MHSA 4QRVA 4Q8GA 5EF4A 3P5VA 1A6RA 1KXRA 1CPJA 1QMYA 2AUZA 1PE6A 4RY2A 2NQDB 4BS6A 1YK8A 4I07A 3IMAA 1PIPA 4X6HA 2FYEA 4W4UA 4BOSA 3PSEA 1F2AA 1CQDA 3P5WA 3W30A 1PCIA 4XUIA 2OP3A 4REZA 3OVXA 2NQIA 1THEA 2DZZA 1AIMA 3LFYA 4BPVA 1GMYA 4N8WA 3PHUA 2PNSA 3PT2A 2AU1A 3BC3A 1ICFA 3OQCA 4XZXA 2YJ8A 3P5UA 4Q8HA 1ITOA 1DEUA 4FJCA 2BDLA 2J7QC 1VSNA 1ATKA 1NQCA 3BCNA 2BU3A 1PXVA 2HHNA 4HWYA 4M0WA 5JZEA 2JTCA 3KX1A 4OVZA 3PHXA 3QJ3A
chains in the Genus database with same CATH topology
4N4ZA 1PADA 3H6SA 4CDEB 1QXPA 2O6XA 1AECA 4PI3A 2E03A 4YYQA 3V6CA 1BGOA 2H7JA 2DC6A 3HD3A 4NV7A 4P6EA 4K7CA 2CIOA 1CSBB 5PADA 2JQFR 1EWMA 3CH3X 4PP2E 5FPWA 2P0RA 3ERVA 1MIRA 3C9EA 2R9OA 3H7DA 3WXGA 1TLOA 1AU4A 2Y6EA 4YVAA 2BDZA 3V6EA 4DMXA 1IWDA 2DC8A 2HD5A 1CS8A 1POPA 2AIMA 1YT7A 3KWZA 5J94A 2R9FA 1PBHA 3QSDA 2IBIA 2E02A 4YYVA 2FUDA 1U9VA 2DCDA 1MEMA 3D6SA 2P7UA 1K3BB 1CVZA 3RVVA 5JH3A 2E01A 2FO5A 4FIPA 1KHQA 1NB5A 1YALA 1S4VA 1NPZA 2DJGB 2HXZA 2YJBA 6PADA 3OF8A 2NQGA 1U9WA 4WA6A 3HHAA 2XU4A 3D9WA 4CDDB 3N3KA 3BOWA 4P6GA 1DF0A 2VHFA 1KFUL 4QH6A 2DC7A 1SNKA 9PAPA 3OVZA 4CDFB 4X6IA 2CB5A 2XU3A 1AU0A 1CV8A 1SP4B 2DZYA 4I04A 3KW9A 1CB5A 2AUXA 3KKUA 3IV2A 2P86A 1GLOA 2AS8A 1Y08A 3WXFA 1NB3A 2YJ9A 1EF7A 1KFXL 4QRXA 1E2TA 2G7YA 2DCBA 4MZOA 1AYWA 2OZ2A 2B1MA 2WBFX 4NV8A 3IUTA 2E00A 1BP4A 1M6DA 2B1NA 1PPDA 3CBKA 3BWKA 2PREA 1U9QX 2HH5A 2R6NA 4MZSA 5F02A 4X6JA 4PADA 1AU2A 1ZCMA 2DJFB 3F75A 1F29A 2DCAA 3U8EA 1FH0A 4GUZA 2G8JA 5CHVA 4ZUXU 1TU6A 1CJLA 2AYNA 2XU5A 4AXLA 2ATOA 3OISA 4YYWA 2F7DA 1YVBA 3O1GA 5EGWA 1PPOA 4CZWA 2ARYA 3PDFA 3MHHA 1MHWA 2NQAA 2AVWA 4N79A 1W4TA 1NL6A 4OELA 1AU3A 3F5VA 4FK5A 1EWOA 1F2BA 3KFQA 4CDCB 1U9XA 3I3TA 5CVOB 4W5CA 3H89A 2FQ9A 5A24A 3OF9A 4XR7A 1QDQA 1QOLA 3LTWA 5CHTA 3MORA 2R9CA 3B79A 3MTNA 1NLJA 1STFE 4G54A 1AYVA 1BQIA 5K16A 3S3RA 1AYUA 1GCBA 1Y4HA 4B55A 3HWNA 4BSQA 3E1ZB 1KHPA 4YV8A 3M99A 3IEJA 2R9MA 1VJVA 4BQVA 3GCBA 1CTEA 1MEGA 3PW3A 8PCHA 3K9MA 2G8EA 3KSEA 2AYOA 2C0YA 3K24A 4OEMA 1MS6A 2R9NA 3H8BA 1ZIVA 2GFOA 3O0UA 4KLBA 2FT2A 3N3GA 5CVMA 3USVA 2G6DA 4W5BA 4BGFA 1F2CA 2DCCA 3CH2X 4BS5A 2BSZA 4I05A 1GX3A 3QT4A 1EWPA 4DMYA 2GHUA 5JA7A 1TL9A 3S3QA 2F1GA 3CBJA 1PPNA 1MDWA 2FRQA 3ZUAA 1XKGA 4AXMA 2OULA 3K8UA 2VFCA 3NHEA 2VHSA 3AI8A 3WXEA 4QBBA 2IPPB 3LXSA 3H8CA 2YJCA 2YJ2A 4YYRA 4YYUA 7PCKA 3IHPA 1PPPA 3IOQA 3N4CA 1ME3A 1GECE 3DF0A 1O0EA 1Q6KA 4YYSA 3I06A 4PP1A 1HUCB 5CVNB 2VFBA 1BY8A 2DC9A 1X9YA 3RVWA 2ACTA 3P5XA 2FRAA 1EWLA 1YK7A 3BPMA 4MSXA 3PNRA 3BPFA 2JQGR 2Y5BA 2FTDA 3HHIA 4QRGA 1ME4A 1JQPA 2PBHA 1U5IA 2XU1A 2PADA 3KWBX 3PBHA 3RVXA 3TNXA 3MHSA 4QRVA 4Q8GA 5EF4A 3P5VA 1A6RA 1KXRA 1CPJA 1QMYA 1W5RA 2AUZA 1PE6A 4RY2A 2NQDB 4BS6A 1YK8A 4I07A 3IMAA 1PIPA 4X6HA 2FYEA 4W4UA 1F2AA 1CQDA 3P5WA 1W6FA 1PCIA 4XUIA 2OP3A 3OVXA 2NQIA 1THEA 2DZZA 1AIMA 3LFYA 4BPVA 1GMYA 4N8WA 2PNSA 2AU1A 3BC3A 1ICFA 2YJ8A 3P5UA 4Q8HA 1ITOA 1DEUA 4FJCA 2BDLA 1VSNA 1ATKA 1NQCA 3BCNA 1PXVA 4C5PA 2HHNA 4HWYA 3KX1A 3QJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4Z A;  1PAD A;  3H6S A;  4CDE B;  1QXP A;  2O6X A;  1AEC A;  4PI3 A;  2E03 A;  4YYQ A;  3V6C A;  1BGO A;  2H7J A;  2DC6 A;  3HD3 A;  4P6E A;  4K7C A;  2CIO A;  1CSB B;  5PAD A;  2JQF R;  1EWM A;  3CH3 X;  4PP2 E;  5FPW A;  2P0R A;  3ERV A;  1MIR A;  3C9E A;  2R9O A;  3H7D A;  3WXG A;  1TLO A;  1AU4 A;  2Y6E A;  4YVA A;  2BDZ A;  3V6E A;  4DMX A;  1IWD A;  2DC8 A;  2HD5 A;  1CS8 A;  1POP A;  2AIM A;  1YT7 A;  3KWZ A;  5J94 A;  2R9F A;  1PBH A;  3QSD A;  2IBI A;  2E02 A;  4YYV A;  2FUD A;  1U9V A;  2DCD A;  1MEM A;  3D6S A;  2P7U A;  1K3B B;  1CVZ A;  3RVV A;  5JH3 A;  2E01 A;  2FO5 A;  4FIP A;  1KHQ A;  1NB5 A;  1YAL A;  1S4V A;  1NPZ A;  2DJG B;  2HXZ A;  2YJB A;  6PAD A;  3OF8 A;  2NQG A;  1U9W A;  4WA6 A;  3HHA A;  2XU4 A;  4CDD B;  3N3K A;  3BOW A;  4P6G A;  1DF0 A;  2VHF A;  1KFU L;  4QH6 A;  2DC7 A;  1SNK A;  9PAP A;  3OVZ A;  4CDF B;  4X6I A;  2CB5 A;  2XU3 A;  1AU0 A;  1CV8 A;  1SP4 B;  2DZY A;  4I04 A;  3KW9 A;  1CB5 A;  2AUX A;  3KKU A;  3IV2 A;  2P86 A;  1GLO A;  2AS8 A;  1Y08 A;  3WXF A;  1NB3 A;  2YJ9 A;  1EF7 A;  1KFX L;  4QRX A;  2G7Y A;  2DCB A;  4MZO A;  1AYW A;  2OZ2 A;  2B1M A;  2WBF X;  3IUT A;  2E00 A;  1BP4 A;  1M6D A;  2B1N A;  1PPD A;  3CBK A;  3BWK A;  2PRE A;  1U9Q X;  2HH5 A;  2R6N A;  4MZS A;  5F02 A;  4X6J A;  4PAD A;  1AU2 A;  1ZCM A;  2DJF B;  3F75 A;  1F29 A;  2DCA A;  3U8E A;  1FH0 A;  2G8J A;  5CHV A;  4ZUX U;  1TU6 A;  1CJL A;  2AYN A;  2XU5 A;  4AXL A;  2ATO A;  3OIS A;  4YYW A;  2F7D A;  1YVB A;  3O1G A;  5EGW A;  1PPO A;  4CZW A;  2ARY A;  3PDF A;  3MHH A;  1MHW A;  2NQA A;  2AVW A;  4N79 A;  1NL6 A;  4OEL A;  1AU3 A;  3F5V A;  4FK5 A;  1EWO A;  1F2B A;  3KFQ A;  4CDC B;  1U9X A;  3I3T A;  5CVO B;  4W5C A;  3H89 A;  2FQ9 A;  5A24 A;  3OF9 A;  4XR7 A;  1QDQ A;  1QOL A;  5CHT A;  3MOR A;  2R9C A;  3B79 A;  3MTN A;  1NLJ A;  1STF E;  4G54 A;  1AYV A;  1BQI A;  5K16 A;  3S3R A;  1AYU A;  1GCB A;  1Y4H A;  3HWN A;  4BSQ A;  3E1Z B;  1KHP A;  4YV8 A;  3M99 A;  3IEJ A;  2R9M A;  1VJV A;  4BQV A;  3GCB A;  1CTE A;  1MEG A;  3PW3 A;  8PCH A;  3K9M A;  2G8E A;  3KSE A;  2AYO A;  2C0Y A;  3K24 A;  4OEM A;  1MS6 A;  2R9N A;  3H8B A;  1ZIV A;  2GFO A;  3O0U A;  4KLB A;  2FT2 A;  3N3G A;  5CVM A;  3USV A;  2G6D A;  4W5B A;  1F2C A;  2DCC A;  3CH2 X;  4BS5 A;  4I05 A;  3QT4 A;  1EWP A;  4DMY A;  2GHU A;  5JA7 A;  1TL9 A;  3S3Q A;  2F1G A;  3CBJ A;  1PPN A;  1MDW A;  2FRQ A;  3ZUA A;  1XKG A;  4AXM A;  2OUL A;  3K8U A;  3NHE A;  2VHS A;  3AI8 A;  3WXE A;  4QBB A;  2IPP B;  3LXS A;  3H8C A;  2YJC A;  2YJ2 A;  4YYR A;  4YYU A;  7PCK A;  3IHP A;  1PPP A;  3IOQ A;  3N4C A;  1ME3 A;  1GEC E;  3DF0 A;  1O0E A;  1Q6K A;  4YYS A;  3I06 A;  4PP1 A;  1HUC B;  5CVN B;  1BY8 A;  2DC9 A;  1X9Y A;  3RVW A;  2ACT A;  3P5X A;  2FRA A;  1EWL A;  1YK7 A;  3BPM A;  4MSX A;  3PNR A;  3BPF A;  2JQG R;  2Y5B A;  2FTD A;  3HHI A;  4QRG A;  1ME4 A;  1JQP A;  2PBH A;  1U5I A;  2XU1 A;  2PAD A;  3KWB X;  3PBH A;  3RVX A;  3TNX A;  3MHS A;  4QRV A;  4Q8G A;  5EF4 A;  3P5V A;  1A6R A;  1KXR A;  1CPJ A;  1QMY A;  2AUZ A;  1PE6 A;  4RY2 A;  2NQD B;  4BS6 A;  1YK8 A;  4I07 A;  3IMA A;  1PIP A;  4X6H A;  2FYE A;  4W4U A;  1F2A A;  1CQD A;  3P5W A;  1PCI A;  4XUI A;  2OP3 A;  3OVX A;  2NQI A;  1THE A;  2DZZ A;  1AIM A;  3LFY A;  4BPV A;  1GMY A;  4N8W A;  2PNS A;  2AU1 A;  3BC3 A;  1ICF A;  2YJ8 A;  3P5U A;  4Q8H A;  1ITO A;  1DEU A;  4FJC A;  2BDL A;  1VSN A;  1ATK A;  1NQC A;  3BCN A;  1PXV A;  2HHN A;  4HWY A;  3KX1 A;  3QJ3 A; 
#chains in the Genus database with same CATH topology
 4N4Z A;  1PAD A;  3H6S A;  4CDE B;  1QXP A;  2O6X A;  1AEC A;  2HWK A;  2UZJ A;  4PI3 A;  3IFU A;  2E03 A;  3BY4 A;  4YYQ A;  3V6C A;  1BGO A;  3PRM A;  2H7J A;  2DC6 A;  3HD3 A;  4P6E A;  4K7C A;  1PVJ A;  2CIO A;  1CSB B;  5PAD A;  2JQF R;  4D8I A;  1EWM A;  3CH3 X;  4PP2 E;  5FPW A;  2P0R A;  3ERV A;  1MIR A;  3RNV A;  4R3D A;  4OVZ B;  3C9E A;  2R9O A;  3H7D A;  3WXG A;  1TLO A;  1AU4 A;  2Y6E A;  4YVA A;  2BDZ A;  3V6E A;  4DMX A;  1IWD A;  2DC8 A;  2HD5 A;  1CS8 A;  1POP A;  2AIM A;  1YT7 A;  3KWZ A;  5J94 A;  3ZNH A;  2R9F A;  1PBH A;  3QSD A;  2IBI A;  2E02 A;  4YYV A;  2FUD A;  1U9V A;  2DCD A;  1MEM A;  3D6S A;  2P7U A;  1K3B B;  1CVZ A;  3RVV A;  5JH3 A;  2E01 A;  2FO5 A;  4FIP A;  1KHQ A;  1NB5 A;  3PHW A;  1YAL A;  1S4V A;  4GUA A;  1NPZ A;  2DJG B;  2HXZ A;  2YJB A;  6PAD A;  4MI7 A;  3OF8 A;  2NQG A;  1U9W A;  2Z84 A;  4WA6 A;  4D8E A;  3HHA A;  2XU4 A;  4CDD B;  3N3K A;  3BOW A;  4P6G A;  1DF0 A;  4A5U A;  2VHF A;  1KFU L;  3B21 A;  4QH6 A;  3TRK A;  2DC7 A;  1SNK A;  9PAP A;  3OVZ A;  4CDF B;  4X6I A;  2CB5 A;  2XU3 A;  1AU0 A;  1CV8 A;  4OW0 A;  3BBA A;  1SP4 B;  2DZY A;  5KO3 A;  4I04 A;  3KW9 A;  1CB5 A;  2AUX A;  3KKU A;  3IV2 A;  2P86 A;  1GLO A;  2AS8 A;  1Y08 A;  3WXF A;  1NB3 A;  2YJ9 A;  1EF7 A;  1KFX L;  4QRX A;  2G7Y A;  2DCB A;  4MZO A;  1AYW A;  2OZ2 A;  2B1M A;  2WBF X;  3IUT A;  2E00 A;  1BP4 A;  4MM3 B;  1M6D A;  2B1N A;  1PPD A;  3CBK A;  4BOP A;  3BWK A;  2PRE A;  1U9Q X;  2HH5 A;  2R6N A;  4MZS A;  4BOQ A;  5F02 A;  4X6J A;  4PAD A;  1AU2 A;  1ZCM A;  2DJF B;  4RF1 A;  3F75 A;  1F29 A;  2DCA A;  3U8E A;  1FH0 A;  1YZB A;  2G8J A;  5CHV A;  4ZUX U;  2BTW A;  1TU6 A;  5EZQ A;  5EZS A;  1CJL A;  2AYN A;  2XU5 A;  4AXL A;  2ATO A;  3OIS A;  4YYW A;  2F7D A;  1YVB A;  3O1G A;  5EGW A;  1PPO A;  4CZW A;  2ARY A;  3PDF A;  3MHH A;  1MHW A;  2NQA A;  2AVW A;  2DOS A;  4N79 A;  1NL6 A;  4WUR A;  4OEL A;  1AU3 A;  3F5V A;  1DKI A;  4IUM A;  4D8B A;  4FK5 A;  1EWO A;  1F2B A;  3KFQ A;  4RNA A;  4BOZ A;  4CDC B;  1U9X A;  3I3T A;  5CVO B;  4W5C A;  3H89 A;  2FQ9 A;  3O65 A;  5A24 A;  3OF9 A;  3C0R A;  3MTV A;  1QDQ A;  4XR7 A;  1QOL A;  4ZTB A;  5CHT A;  3MOR A;  2R9C A;  3B79 A;  3MTN A;  1NLJ A;  5E6J A;  1STF E;  4G54 A;  1AYV A;  4RKX A;  1BQI A;  5K16 A;  3S3R A;  1AYU A;  1GCB A;  1Y4H A;  3W31 A;  2BTW B;  3HWN A;  4BSQ A;  3E1Z B;  1KHP A;  4YV8 A;  3M99 A;  3IEJ A;  3PRP A;  2R9M A;  1VJV A;  4BQV A;  3GCB A;  1CTE A;  1MEG A;  3PW3 A;  8PCH A;  3K9M A;  2G8E A;  3KSE A;  2AYO A;  2C0Y A;  3K24 A;  4OEM A;  1MS6 A;  1UKF A;  2R9N A;  3H8B A;  2AGA A;  1ZIV A;  2GFO A;  3O0U A;  4KLB A;  2FT2 A;  3N3G A;  5CVM A;  3USV A;  2G6D A;  4W5B A;  1F2C A;  2DCC A;  3CH2 X;  4BS5 A;  4I05 A;  3QT4 A;  2J7Q A;  1EWP A;  4DMY A;  2GHU A;  4IP3 A;  3MJ5 A;  5JA7 A;  4PT5 A;  1TL9 A;  3S3Q A;  2F1G A;  3CBJ A;  4RF0 A;  1PPN A;  1MDW A;  2FRQ A;  4BOU A;  3ZUA A;  1XKG A;  4AXM A;  2OUL A;  3K8U A;  3NHE A;  2VHS A;  3AI8 A;  3WXE A;  4QBB A;  2IPP B;  3LXS A;  3H8C A;  2YJC A;  2YJ2 A;  4YYR A;  4YYU A;  7PCK A;  3IHP A;  1PPP A;  3IOQ A;  3TMP A;  3N4C A;  1ME3 A;  1GEC E;  3DF0 A;  1O0E A;  1Q6K A;  4YYS A;  3I06 A;  4PP1 A;  1HUC B;  5CVN B;  1BY8 A;  2DC9 A;  1X9Y A;  3RVW A;  2ACT A;  3BB7 A;  3MP2 A;  3E9S A;  3P5X A;  2FRA A;  2FE8 A;  1EWL A;  1YK7 A;  3BPM A;  2JRI A;  3PNR A;  4MSX A;  3BPF A;  2JQG R;  2Y5B A;  2FTD A;  4HXD B;  3HHI A;  4QRG A;  1ME4 A;  1JQP A;  2PBH A;  1U5I A;  2XU1 A;  2PAD A;  3KWB X;  4P16 A;  3PBH A;  3RVX A;  3TNX A;  3MHS A;  4QRV A;  4Q8G A;  5EF4 A;  3P5V A;  1A6R A;  1KXR A;  1CPJ A;  1QMY A;  2AUZ A;  1PE6 A;  4RY2 A;  2NQD B;  4BS6 A;  1YK8 A;  4I07 A;  3IMA A;  1PIP A;  4X6H A;  2FYE A;  4W4U A;  4BOS A;  3PSE A;  1F2A A;  1CQD A;  3P5W A;  3W30 A;  1PCI A;  4XUI A;  2OP3 A;  4REZ A;  3OVX A;  2NQI A;  1THE A;  2DZZ A;  1AIM A;  3LFY A;  4BPV A;  1GMY A;  4N8W A;  3PHU A;  2PNS A;  3PT2 A;  2AU1 A;  3BC3 A;  1ICF A;  3OQC A;  4XZX A;  2YJ8 A;  3P5U A;  4Q8H A;  1ITO A;  1DEU A;  4FJC A;  2BDL A;  2J7Q C;  1VSN A;  1ATK A;  1NQC A;  3BCN A;  2BU3 A;  1PXV A;  2HHN A;  4HWY A;  4M0W A;  5JZE A;  2JTC A;  3KX1 A;  4OVZ A;  3PHX A;  3QJ3 A; 
#chains in the Genus database with same CATH homology
 4N4Z A;  1PAD A;  3H6S A;  4CDE B;  1QXP A;  2O6X A;  1AEC A;  4PI3 A;  2E03 A;  4YYQ A;  3V6C A;  1BGO A;  2H7J A;  2DC6 A;  3HD3 A;  4NV7 A;  4P6E A;  4K7C A;  2CIO A;  1CSB B;  5PAD A;  2JQF R;  1EWM A;  3CH3 X;  4PP2 E;  5FPW A;  2P0R A;  3ERV A;  1MIR A;  3C9E A;  2R9O A;  3H7D A;  3WXG A;  1TLO A;  1AU4 A;  2Y6E A;  4YVA A;  2BDZ A;  3V6E A;  4DMX A;  1IWD A;  2DC8 A;  2HD5 A;  1CS8 A;  1POP A;  2AIM A;  1YT7 A;  3KWZ A;  5J94 A;  2R9F A;  1PBH A;  3QSD A;  2IBI A;  2E02 A;  4YYV A;  2FUD A;  1U9V A;  2DCD A;  1MEM A;  3D6S A;  2P7U A;  1K3B B;  1CVZ A;  3RVV A;  5JH3 A;  2E01 A;  2FO5 A;  4FIP A;  1KHQ A;  1NB5 A;  1YAL A;  1S4V A;  1NPZ A;  2DJG B;  2HXZ A;  2YJB A;  6PAD A;  3OF8 A;  2NQG A;  1U9W A;  4WA6 A;  3HHA A;  2XU4 A;  3D9W A;  4CDD B;  3N3K A;  3BOW A;  4P6G A;  1DF0 A;  2VHF A;  1KFU L;  4QH6 A;  2DC7 A;  1SNK A;  9PAP A;  3OVZ A;  4CDF B;  4X6I A;  2CB5 A;  2XU3 A;  1AU0 A;  1CV8 A;  1SP4 B;  2DZY A;  4I04 A;  3KW9 A;  1CB5 A;  2AUX A;  3KKU A;  3IV2 A;  2P86 A;  1GLO A;  2AS8 A;  1Y08 A;  3WXF A;  1NB3 A;  2YJ9 A;  1EF7 A;  1KFX L;  4QRX A;  1E2T A;  2G7Y A;  2DCB A;  4MZO A;  1AYW A;  2OZ2 A;  2B1M A;  2WBF X;  4NV8 A;  3IUT A;  2E00 A;  1BP4 A;  1M6D A;  2B1N A;  1PPD A;  3CBK A;  3BWK A;  2PRE A;  1U9Q X;  2HH5 A;  2R6N A;  4MZS A;  5F02 A;  4X6J A;  4PAD A;  1AU2 A;  1ZCM A;  2DJF B;  3F75 A;  1F29 A;  2DCA A;  3U8E A;  1FH0 A;  4GUZ A;  2G8J A;  5CHV A;  4ZUX U;  1TU6 A;  1CJL A;  2AYN A;  2XU5 A;  4AXL A;  2ATO A;  3OIS A;  4YYW A;  2F7D A;  1YVB A;  3O1G A;  5EGW A;  1PPO A;  4CZW A;  2ARY A;  3PDF A;  3MHH A;  1MHW A;  2NQA A;  2AVW A;  4N79 A;  1W4T A;  1NL6 A;  4OEL A;  1AU3 A;  3F5V A;  4FK5 A;  1EWO A;  1F2B A;  3KFQ A;  4CDC B;  1U9X A;  3I3T A;  5CVO B;  4W5C A;  3H89 A;  2FQ9 A;  5A24 A;  3OF9 A;  4XR7 A;  1QDQ A;  1QOL A;  3LTW A;  5CHT A;  3MOR A;  2R9C A;  3B79 A;  3MTN A;  1NLJ A;  1STF E;  4G54 A;  1AYV A;  1BQI A;  5K16 A;  3S3R A;  1AYU A;  1GCB A;  1Y4H A;  4B55 A;  3HWN A;  4BSQ A;  3E1Z B;  1KHP A;  4YV8 A;  3M99 A;  3IEJ A;  2R9M A;  1VJV A;  4BQV A;  3GCB A;  1CTE A;  1MEG A;  3PW3 A;  8PCH A;  3K9M A;  2G8E A;  3KSE A;  2AYO A;  2C0Y A;  3K24 A;  4OEM A;  1MS6 A;  2R9N A;  3H8B A;  1ZIV A;  2GFO A;  3O0U A;  4KLB A;  2FT2 A;  3N3G A;  5CVM A;  3USV A;  2G6D A;  4W5B A;  4BGF A;  1F2C A;  2DCC A;  3CH2 X;  4BS5 A;  2BSZ A;  4I05 A;  1GX3 A;  3QT4 A;  1EWP A;  4DMY A;  2GHU A;  5JA7 A;  1TL9 A;  3S3Q A;  2F1G A;  3CBJ A;  1PPN A;  1MDW A;  2FRQ A;  3ZUA A;  1XKG A;  4AXM A;  2OUL A;  3K8U A;  2VFC A;  3NHE A;  2VHS A;  3AI8 A;  3WXE A;  4QBB A;  2IPP B;  3LXS A;  3H8C A;  2YJC A;  2YJ2 A;  4YYR A;  4YYU A;  7PCK A;  3IHP A;  1PPP A;  3IOQ A;  3N4C A;  1ME3 A;  1GEC E;  3DF0 A;  1O0E A;  1Q6K A;  4YYS A;  3I06 A;  4PP1 A;  1HUC B;  5CVN B;  2VFB A;  1BY8 A;  2DC9 A;  1X9Y A;  3RVW A;  2ACT A;  3P5X A;  2FRA A;  1EWL A;  1YK7 A;  3BPM A;  4MSX A;  3PNR A;  3BPF A;  2JQG R;  2Y5B A;  2FTD A;  3HHI A;  4QRG A;  1ME4 A;  1JQP A;  2PBH A;  1U5I A;  2XU1 A;  2PAD A;  3KWB X;  3PBH A;  3RVX A;  3TNX A;  3MHS A;  4QRV A;  4Q8G A;  5EF4 A;  3P5V A;  1A6R A;  1KXR A;  1CPJ A;  1QMY A;  1W5R A;  2AUZ A;  1PE6 A;  4RY2 A;  2NQD B;  4BS6 A;  1YK8 A;  4I07 A;  3IMA A;  1PIP A;  4X6H A;  2FYE A;  4W4U A;  1F2A A;  1CQD A;  3P5W A;  1W6F A;  1PCI A;  4XUI A;  2OP3 A;  3OVX A;  2NQI A;  1THE A;  2DZZ A;  1AIM A;  3LFY A;  4BPV A;  1GMY A;  4N8W A;  2PNS A;  2AU1 A;  3BC3 A;  1ICF A;  2YJ8 A;  3P5U A;  4Q8H A;  1ITO A;  1DEU A;  4FJC A;  2BDL A;  1VSN A;  1ATK A;  1NQC A;  3BCN A;  1PXV A;  4C5P A;  2HHN A;  4HWY A;  3KX1 A;  3QJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...