1GECE

Glycyl endopeptidase-complex with benzyloxycarbonyl-leucine-valine-glycine-methylene covalently bound to cysteine 25
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
LPESVDWRAKGAVTPVKHQGYCESCWAFSTVATVEGINKIKTGNLVELSEQELVDCDLQSYGCNRGYQSTSLQYVAQNGIHLRAKYPYIAKQQTCRANQVGGPKVKTNGVGRVQSNNEGSLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKSGGKGYILIKNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GLYCYL ENDOPEPTIDASE
publication title Crystal structure of glycyl endopeptidase from Carica papaya: a cysteine endopeptidase of unusual substrate specificity.
pubmed doi rcsb
total genus 65
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.25: Glycyl endopeptidase.
pdb deposition date 1995-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1gecE00
2FRQA 1MEMA 2XU5A 4OEMA 1Y08A 3MHHA 2FO5A 2F7DA 4W5BA 3K24A 2GFOA 2WBFX 1VJVA 3KFQA 4QBBA 3LFYA 1KFUL 2E01A 1CV8A 4I04A 1PBHA 2R9CA 1NPZA 3BCNA 1EWMA 2DC7A 5CVOB 4MSXA 2CIOA 2FUDA 4YYWA 4BSQA 1FH0A 3KSEA 4YYVA 1EWLA 1TU6A 1U9VA 4YV8A 2AVWA 2DCAA 4YVAA 1EWOA 2VHSA 3WXFA 1CJLA 2P7UA 3LXSA 4ZUXU 3I06A 1F2BA 4QRGA 1AU3A 3P5WA 3CBKA 2AU1A 1ME4A 1SNKA 3C9EA 2R9FA 5CVNB 1GMYA 3K9MA 1F2CA 2H7JA 4X6JA 4BS5A 3KW9A 1U9XA 3USVA 1GECE 5CHTA 2JQGR 3IHPA 1XKGA 9PAPA 2ACTA 3GCBA 2PREA 3U8EA 4N8WA 3WXEA 3QT4A 1NQCA 3OVZA 1YVBA 2PADA 3RVXA 1PPNA 1QOLA 4YYQA 1NL6A 1BQIA 1AYVA 3PW3A 1PPDA 1YT7A 1MDWA 4X6HA 1STFE 2P0RA 1EWPA 1U5IA 4MZSA 3PNRA 2YJBA 4BPVA 5JH3A 3N3KA 4W4UA 4CDEB 1ITOA 1EF7A 2AYOA 4AXMA 2B1MA 4KLBA 1AIMA 4MZOA 2DCDA 3PBHA 2DJGB 4CDDB 2F1GA 4QH6A 1MIRA 2C0YA 3S3RA 4I05A 1KHPA 2IPPB 2XU3A 3B79A 1VSNA 3MORA 3H8CA 2PNSA 1PPPA 2AS8A 3AI8A 1A6RA 1S4VA 3NHEA 1DEUA 2NQAA 5PADA 5J94A 1K3BB 2DC9A 2XU1A 4FIPA 1F29A 3IUTA 3CH3X 4WA6A 5CHVA 2B1NA 2OP3A 2DCBA 2P86A 3IEJA 2FRAA 4K7CA 1CPJA 2FTDA 2HHNA 1SP4B 4HWYA 1GLOA 2XU4A 1KFXL 4W5CA 3H8BA 3H6SA 2IBIA 2PBHA 4OELA 5EGWA 1MS6A 8PCHA 3IOQA 2FT2A 2G6DA 2YJ9A 1CQDA 1NB3A 2R9OA 3M99A 3H89A 3HHAA 1PXVA 2DZYA 1CVZA 2DJFB 3S3QA 3H7DA 4X6IA 3D6SA 5JA7A 2E00A 3PDFA 3ZUAA 1CS8A 3KKUA 2DZZA 3HHIA 2HXZA 3I3TA 1PPOA 2NQGA 3O0UA 2YJ8A 1PCIA 4CZWA 4YYUA 3OF9A 2JQFR 3BC3A 7PCKA 1Q6KA 4CDCB 3F5VA 4P6EA 3P5VA 2YJ2A 1X9YA 1QDQA 3N4CA 4Q8GA 1TLOA 2BDZA 1BP4A 2OULA 2Y6EA 4Q8HA 1CB5A 4PI3A 4XR7A 2R9NA 4FJCA 5K16A 1ATKA 3BPFA 1HUCB 1BY8A 5A24A 1ZCMA 1Y4HA 3MHSA 1CSBB 4BQVA 1PE6A 4PADA 4P6GA 2GHUA 1TL9A 1YK7A 2NQDB 2G8EA 1AYWA 2E02A 4PP1A 1AYUA 2R9MA 1M6DA 1BGOA 2NQIA 3QJ3A 3OF8A 1DF0A 5EF4A 1AU2A 4G54A 1F2AA 3O1GA 4QRXA 3IV2A 4DMYA 4DMXA 3ERVA 5CVMA 3OISA 1NLJA 3V6CA 3KX1A 3DF0A 4FK5A 3QSDA 1ICFA 1KXRA 4N4ZA 4XUIA 2E03A 1NB5A 2ATOA 3HWNA 1YK8A 3CBJA 3P5UA 2HH5A 1PIPA 1QXPA 3N3GA 4YYSA 3KWZA 4QRVA 2Y5BA 2G8JA 4CDFB 3WXGA 2YJCA 1PADA 3RVWA 2AUZA 4RY2A 1KHQA 2O6XA 1MEGA 3TNXA 3BOWA 2R6NA 4YYRA 3MTNA 3IMAA 1CTEA 2FQ9A 1POPA 2FYEA 1O0EA 2ARYA 1AECA 1QMYA 2DC8A 3K8UA 3OVXA 2AIMA 2CB5A 1U9WA 2AUXA 2AYNA 2DCCA 1ZIVA 2BDLA 3RVVA 1JQPA 2HD5A 4BS6A 1AU0A 3HD3A 4N79A 4AXLA 2VHFA 3KWBX 1AU4A 4I07A 2DC6A 3P5XA 3F75A 6PADA 1U9QX 1THEA 1YALA 3BPMA 3V6EA 5FPWA 3BWKA 3E1ZB 4PP2E 1MHWA 1ME3A 1IWDA 3CH2X 2G7YA 5F02A 2OZ2A 1GCBA
chains in the Genus database with same CATH superfamily
4REZA 1PVJA 2FRQA 1MEMA 4IP3A 2XU5A 4OEMA 1Y08A 3MHHA 2FO5A 2F7DA 4W5BA 3K24A 2GFOA 2WBFX 1VJVA 3KFQA 4BOQA 4QBBA 3LFYA 1KFUL 2E01A 1CV8A 4I04A 1PBHA 2R9CA 3MTVA 1NPZA 3BCNA 1EWMA 2DC7A 4RF0A 5CVOB 4MSXA 2CIOA 2FUDA 4YYWA 4BSQA 1FH0A 1YZBA 3KSEA 4YYVA 1EWLA 1TU6A 1U9VA 4YV8A 2AVWA 2DCAA 3BB7A 4YVAA 1EWOA 3IFUA 3E9SA 4MI7A 2VHSA 3BY4A 3WXFA 1CJLA 4OW0A 2P7UA 3LXSA 2HWKA 4ZUXU 3I06A 1F2BA 4QRGA 1DKIA 1AU3A 3P5WA 3CBKA 2AU1A 1ME4A 1SNKA 4HXDB 4OVZA 3C9EA 2R9FA 5CVNB 1GMYA 3K9MA 1F2CA 2H7JA 4X6JA 4BS5A 3KW9A 1U9XA 3USVA 1GECE 5CHTA 2JQGR 3IHPA 1XKGA 9PAPA 2ACTA 3GCBA 2Z84A 2PREA 3U8EA 4N8WA 3WXEA 2JRIA 3QT4A 1NQCA 3OVZA 1YVBA 2PADA 3RVXA 1PPNA 1QOLA 3ZNHA 1NL6A 4YYQA 1BQIA 3PT2A 1AYVA 3PW3A 1PPDA 1YT7A 1MDWA 4X6HA 1STFE 2P0RA 2UZJA 4XZXA 1EWPA 1U5IA 4MZSA 3PNRA 2YJBA 3PHUA 4BPVA 5JH3A 3N3KA 4W4UA 4CDEB 1ITOA 1EF7A 3BBAA 4BOZA 2AYOA 4AXMA 2B1MA 4KLBA 1AIMA 4MZOA 2DCDA 3PBHA 3B21A 2DJGB 4CDDB 3W31A 2F1GA 4QH6A 4P16A 5EZQA 1MIRA 2C0YA 3S3RA 4I05A 4OVZB 1KHPA 2IPPB 2XU3A 3B79A 1VSNA 3MORA 3H8CA 2PNSA 1PPPA 3OQCA 4RF1A 2AS8A 3AI8A 1A6RA 1S4VA 3NHEA 1DEUA 2NQAA 5PADA 5J94A 1K3BB 2DC9A 2XU1A 4FIPA 1F29A 3IUTA 3CH3X 4WA6A 4BOPA 5CHVA 2B1NA 2OP3A 2DCBA 2P86A 3IEJA 2FRAA 4K7CA 1CPJA 2FTDA 2HHNA 1SP4B 4HWYA 1GLOA 4MM3B 2XU4A 1KFXL 2BU3A 4GUAA 4W5CA 3H8BA 3H6SA 4BOSA 2IBIA 2PBHA 3C0RA 4OELA 5EGWA 1MS6A 2DOSA 8PCHA 3IOQA 2FT2A 4RKXA 2G6DA 2YJ9A 5EZSA 1CQDA 1NB3A 2R9OA 3M99A 2AGAA 2FE8A 3H89A 3HHAA 1PXVA 2DZYA 1CVZA 2DJFB 3S3QA 3H7DA 4X6IA 3D6SA 5JA7A 2E00A 3PDFA 3ZUAA 4BOUA 1CS8A 3KKUA 2DZZA 3HHIA 2HXZA 3I3TA 1PPOA 2NQGA 3O0UA 2YJ8A 1PCIA 4CZWA 4YYUA 3OF9A 3PHWA 2JQFR 3BC3A 7PCKA 1Q6KA 4D8IA 4CDCB 3F5VA 4P6EA 3P5VA 2YJ2A 3MP2A 1X9YA 1QDQA 3N4CA 4Q8GA 1TLOA 2BDZA 1BP4A 4D8BA 2BTWA 4R3DA 2OULA 2Y6EA 4Q8HA 1CB5A 4PI3A 5E6JA 4XR7A 4D8EA 2R9NA 4FJCA 5K16A 1ATKA 3BPFA 1HUCB 1BY8A 5A24A 1ZCMA 1Y4HA 3MHSA 1CSBB 4BQVA 5JZEA 1PE6A 4ZTBA 4PADA 4P6GA 2GHUA 1TL9A 1YK7A 2NQDB 2G8EA 1AYWA 2E02A 4PP1A 1AYUA 2R9MA 1M6DA 1BGOA 2NQIA 3QJ3A 3OF8A 1DF0A 5EF4A 1AU2A 3PRMA 4G54A 1F2AA 3O1GA 3TMPA 4QRXA 3IV2A 4DMYA 2J7QC 4DMXA 3ERVA 2J7QA 5CVMA 3OISA 1NLJA 3V6CA 3KX1A 3DF0A 3RNVA 4FK5A 3QSDA 1ICFA 1KXRA 4PT5A 4N4ZA 4XUIA 2E03A 1NB5A 2ATOA 3HWNA 1YK8A 3CBJA 3P5UA 2HH5A 1PIPA 2BTWB 1QXPA 3N3GA 4RNAA 4M0WA 1UKFA 3KWZA 4YYSA 4QRVA 2Y5BA 3PHXA 2G8JA 4CDFB 3WXGA 2YJCA 1PADA 3RVWA 2AUZA 4RY2A 1KHQA 2O6XA 3O65A 1MEGA 3TNXA 3BOWA 2R6NA 4YYRA 3MTNA 3IMAA 1CTEA 2FQ9A 4A5UA 4IUMA 1POPA 2FYEA 1O0EA 2ARYA 1AECA 1QMYA 2DC8A 3K8UA 3OVXA 2AIMA 2CB5A 1U9WA 2AUXA 2AYNA 2DCCA 1ZIVA 2BDLA 3RVVA 1JQPA 2HD5A 4BS6A 1AU0A 3HD3A 4N79A 4AXLA 2VHFA 3KWBX 1AU4A 2DC6A 4I07A 3P5XA 3TRKA 3F75A 6PADA 1U9QX 1THEA 3W30A 1YALA 3BPMA 3V6EA 5FPWA 3BWKA 3PRPA 3E1ZB 5KO3A 2JTCA 4WURA 4PP2E 1MHWA 1ME3A 3PSEA 1IWDA 3CH2X 3MJ5A 2G7YA 5F02A 2OZ2A 1GCBA
chains in the Genus database with same CATH topology
2BSZA 2FRQA 1MEMA 2XU5A 4OEMA 1Y08A 3MHHA 2FO5A 2F7DA 4W5BA 3K24A 2GFOA 2WBFX 1VJVA 3KFQA 4QBBA 3LFYA 1KFUL 2E01A 1CV8A 4I04A 1PBHA 2R9CA 1NPZA 3BCNA 1EWMA 2DC7A 5CVOB 4MSXA 2CIOA 2FUDA 4YYWA 4BSQA 1FH0A 3KSEA 4YYVA 1EWLA 1TU6A 1U9VA 4YV8A 2AVWA 2DCAA 4YVAA 1EWOA 2VHSA 3WXFA 1CJLA 1W6FA 2P7UA 3LXSA 4ZUXU 3I06A 1F2BA 4QRGA 1AU3A 3P5WA 3CBKA 2AU1A 1ME4A 1SNKA 3C9EA 2R9FA 5CVNB 1GMYA 3K9MA 1F2CA 2H7JA 4X6JA 4BS5A 3KW9A 1U9XA 3USVA 1GECE 5CHTA 2JQGR 3IHPA 1XKGA 9PAPA 2ACTA 3GCBA 2PREA 3U8EA 4N8WA 3WXEA 3QT4A 1NQCA 3OVZA 1YVBA 2PADA 3RVXA 1PPNA 1QOLA 4YYQA 1NL6A 1BQIA 1AYVA 3PW3A 1PPDA 1YT7A 1MDWA 4X6HA 1STFE 2P0RA 1EWPA 1U5IA 4MZSA 3PNRA 2YJBA 4BPVA 5JH3A 3N3KA 4W4UA 4CDEB 1ITOA 1EF7A 2AYOA 4AXMA 2B1MA 4KLBA 1AIMA 4MZOA 2DCDA 3PBHA 2DJGB 1GX3A 4CDDB 2F1GA 4QH6A 1MIRA 2C0YA 3S3RA 4I05A 1KHPA 2IPPB 2XU3A 3B79A 1VSNA 3MORA 3H8CA 2PNSA 1PPPA 2AS8A 3AI8A 1A6RA 1S4VA 3NHEA 1DEUA 2NQAA 5PADA 5J94A 1K3BB 2DC9A 2XU1A 4FIPA 1F29A 3IUTA 3CH3X 4WA6A 5CHVA 2B1NA 2OP3A 2DCBA 2P86A 3IEJA 2FRAA 4K7CA 1CPJA 2FTDA 2HHNA 1SP4B 4HWYA 1GLOA 2XU4A 1KFXL 4W5CA 3H8BA 3H6SA 2IBIA 2PBHA 4OELA 5EGWA 1MS6A 8PCHA 3IOQA 3LTWA 2FT2A 2G6DA 2YJ9A 1CQDA 1NB3A 2R9OA 3M99A 3H89A 3HHAA 1PXVA 2DZYA 1CVZA 2DJFB 3S3QA 4NV8A 3H7DA 4X6IA 3D6SA 5JA7A 2E00A 3PDFA 3ZUAA 1CS8A 3KKUA 2DZZA 3HHIA 2HXZA 3I3TA 1PPOA 2NQGA 3O0UA 2YJ8A 1PCIA 4CZWA 4YYUA 3OF9A 2JQFR 3BC3A 7PCKA 1Q6KA 4CDCB 3F5VA 4P6EA 3P5VA 2YJ2A 1X9YA 1QDQA 3N4CA 4Q8GA 1TLOA 2BDZA 1BP4A 2VFBA 2OULA 2Y6EA 4Q8HA 1CB5A 4PI3A 4XR7A 2R9NA 4FJCA 5K16A 1ATKA 3BPFA 1HUCB 1BY8A 5A24A 1ZCMA 1Y4HA 3MHSA 1CSBB 4BQVA 1PE6A 4PADA 4P6GA 2GHUA 1TL9A 1YK7A 2NQDB 2G8EA 1AYWA 2E02A 4PP1A 1AYUA 2R9MA 1M6DA 1BGOA 2NQIA 3QJ3A 3OF8A 1DF0A 5EF4A 1AU2A 4G54A 1F2AA 3O1GA 4QRXA 3IV2A 4DMYA 4DMXA 3ERVA 5CVMA 3OISA 1NLJA 3V6CA 3KX1A 3DF0A 4FK5A 3QSDA 1ICFA 1KXRA 1W5RA 4N4ZA 4XUIA 2E03A 1NB5A 2ATOA 3HWNA 1YK8A 3CBJA 3P5UA 2HH5A 1PIPA 1QXPA 3N3GA 4YYSA 3KWZA 4QRVA 2Y5BA 2G8JA 4CDFB 3WXGA 2YJCA 1PADA 3RVWA 2AUZA 4RY2A 1KHQA 2VFCA 1E2TA 2O6XA 1MEGA 3TNXA 3BOWA 2R6NA 4YYRA 3MTNA 3IMAA 1CTEA 2FQ9A 1POPA 2FYEA 1W4TA 1O0EA 2ARYA 1AECA 1QMYA 2DC8A 3D9WA 3K8UA 4GUZA 3OVXA 4BGFA 2AIMA 2CB5A 1U9WA 2AUXA 2AYNA 2DCCA 1ZIVA 2BDLA 3RVVA 4NV7A 1JQPA 2HD5A 4BS6A 1AU0A 3HD3A 4N79A 4AXLA 2VHFA 3KWBX 1AU4A 4I07A 2DC6A 3P5XA 3F75A 6PADA 1U9QX 1THEA 1YALA 3BPMA 3V6EA 5FPWA 3BWKA 4B55A 3E1ZB 4PP2E 1MHWA 1ME3A 1IWDA 3CH2X 2G7YA 5F02A 2OZ2A 4C5PA 1GCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRQ A;  1MEM A;  2XU5 A;  4OEM A;  1Y08 A;  3MHH A;  2FO5 A;  2F7D A;  4W5B A;  3K24 A;  2GFO A;  2WBF X;  1VJV A;  3KFQ A;  4QBB A;  3LFY A;  1KFU L;  2E01 A;  1CV8 A;  4I04 A;  1PBH A;  2R9C A;  1NPZ A;  3BCN A;  1EWM A;  2DC7 A;  5CVO B;  4MSX A;  2CIO A;  2FUD A;  4YYW A;  4BSQ A;  1FH0 A;  3KSE A;  4YYV A;  1EWL A;  1TU6 A;  1U9V A;  4YV8 A;  2AVW A;  2DCA A;  4YVA A;  1EWO A;  2VHS A;  3WXF A;  1CJL A;  2P7U A;  3LXS A;  4ZUX U;  3I06 A;  1F2B A;  4QRG A;  1AU3 A;  3P5W A;  3CBK A;  2AU1 A;  1ME4 A;  1SNK A;  3C9E A;  2R9F A;  5CVN B;  1GMY A;  3K9M A;  1F2C A;  2H7J A;  4X6J A;  4BS5 A;  3KW9 A;  1U9X A;  3USV A;  1GEC E;  5CHT A;  2JQG R;  3IHP A;  1XKG A;  9PAP A;  2ACT A;  3GCB A;  2PRE A;  3U8E A;  4N8W A;  3WXE A;  3QT4 A;  1NQC A;  3OVZ A;  1YVB A;  2PAD A;  3RVX A;  1PPN A;  1QOL A;  4YYQ A;  1NL6 A;  1BQI A;  1AYV A;  3PW3 A;  1PPD A;  1YT7 A;  1MDW A;  4X6H A;  1STF E;  2P0R A;  1EWP A;  1U5I A;  4MZS A;  3PNR A;  2YJB A;  4BPV A;  5JH3 A;  3N3K A;  4W4U A;  4CDE B;  1ITO A;  1EF7 A;  2AYO A;  4AXM A;  2B1M A;  4KLB A;  1AIM A;  4MZO A;  2DCD A;  3PBH A;  2DJG B;  4CDD B;  2F1G A;  4QH6 A;  1MIR A;  2C0Y A;  3S3R A;  4I05 A;  1KHP A;  2IPP B;  2XU3 A;  3B79 A;  1VSN A;  3MOR A;  3H8C A;  2PNS A;  1PPP A;  2AS8 A;  3AI8 A;  1A6R A;  1S4V A;  3NHE A;  1DEU A;  2NQA A;  5PAD A;  5J94 A;  1K3B B;  2DC9 A;  2XU1 A;  4FIP A;  1F29 A;  3IUT A;  3CH3 X;  4WA6 A;  5CHV A;  2B1N A;  2OP3 A;  2DCB A;  2P86 A;  3IEJ A;  2FRA A;  4K7C A;  1CPJ A;  2FTD A;  2HHN A;  1SP4 B;  4HWY A;  1GLO A;  2XU4 A;  1KFX L;  4W5C A;  3H8B A;  3H6S A;  2IBI A;  2PBH A;  4OEL A;  5EGW A;  1MS6 A;  8PCH A;  3IOQ A;  2FT2 A;  2G6D A;  2YJ9 A;  1CQD A;  1NB3 A;  2R9O A;  3M99 A;  3H89 A;  3HHA A;  1PXV A;  2DZY A;  1CVZ A;  2DJF B;  3S3Q A;  3H7D A;  4X6I A;  3D6S A;  5JA7 A;  2E00 A;  3PDF A;  3ZUA A;  1CS8 A;  3KKU A;  2DZZ A;  3HHI A;  2HXZ A;  3I3T A;  1PPO A;  2NQG A;  3O0U A;  2YJ8 A;  1PCI A;  4CZW A;  4YYU A;  3OF9 A;  2JQF R;  3BC3 A;  7PCK A;  1Q6K A;  4CDC B;  3F5V A;  4P6E A;  3P5V A;  2YJ2 A;  1X9Y A;  1QDQ A;  3N4C A;  4Q8G A;  1TLO A;  2BDZ A;  1BP4 A;  2OUL A;  2Y6E A;  4Q8H A;  1CB5 A;  4PI3 A;  4XR7 A;  2R9N A;  4FJC A;  5K16 A;  1ATK A;  3BPF A;  1HUC B;  1BY8 A;  5A24 A;  1ZCM A;  1Y4H A;  3MHS A;  1CSB B;  4BQV A;  1PE6 A;  4PAD A;  4P6G A;  2GHU A;  1TL9 A;  1YK7 A;  2NQD B;  2G8E A;  1AYW A;  2E02 A;  4PP1 A;  1AYU A;  2R9M A;  1M6D A;  1BGO A;  2NQI A;  3QJ3 A;  3OF8 A;  1DF0 A;  5EF4 A;  1AU2 A;  4G54 A;  1F2A A;  3O1G A;  4QRX A;  3IV2 A;  4DMY A;  4DMX A;  3ERV A;  5CVM A;  3OIS A;  1NLJ A;  3V6C A;  3KX1 A;  3DF0 A;  4FK5 A;  3QSD A;  1ICF A;  1KXR A;  4N4Z A;  4XUI A;  2E03 A;  1NB5 A;  2ATO A;  3HWN A;  1YK8 A;  3CBJ A;  3P5U A;  2HH5 A;  1PIP A;  1QXP A;  3N3G A;  4YYS A;  3KWZ A;  4QRV A;  2Y5B A;  2G8J A;  4CDF B;  3WXG A;  2YJC A;  1PAD A;  3RVW A;  2AUZ A;  4RY2 A;  1KHQ A;  2O6X A;  1MEG A;  3TNX A;  3BOW A;  2R6N A;  4YYR A;  3MTN A;  3IMA A;  1CTE A;  2FQ9 A;  1POP A;  2FYE A;  1O0E A;  2ARY A;  1AEC A;  1QMY A;  2DC8 A;  3K8U A;  3OVX A;  2AIM A;  2CB5 A;  1U9W A;  2AUX A;  2AYN A;  2DCC A;  1ZIV A;  2BDL A;  3RVV A;  1JQP A;  2HD5 A;  4BS6 A;  1AU0 A;  3HD3 A;  4N79 A;  4AXL A;  2VHF A;  3KWB X;  1AU4 A;  4I07 A;  2DC6 A;  3P5X A;  3F75 A;  6PAD A;  1U9Q X;  1THE A;  1YAL A;  3BPM A;  3V6E A;  5FPW A;  3BWK A;  3E1Z B;  4PP2 E;  1MHW A;  1ME3 A;  1IWD A;  3CH2 X;  2G7Y A;  5F02 A;  2OZ2 A;  1GCB A; 
#chains in the Genus database with same CATH topology
 4REZ A;  1PVJ A;  2FRQ A;  1MEM A;  4IP3 A;  2XU5 A;  4OEM A;  1Y08 A;  3MHH A;  2FO5 A;  2F7D A;  4W5B A;  3K24 A;  2GFO A;  2WBF X;  1VJV A;  3KFQ A;  4BOQ A;  4QBB A;  3LFY A;  1KFU L;  2E01 A;  1CV8 A;  4I04 A;  1PBH A;  2R9C A;  3MTV A;  1NPZ A;  3BCN A;  1EWM A;  2DC7 A;  4RF0 A;  5CVO B;  4MSX A;  2CIO A;  2FUD A;  4YYW A;  4BSQ A;  1FH0 A;  1YZB A;  3KSE A;  4YYV A;  1EWL A;  1TU6 A;  1U9V A;  4YV8 A;  2AVW A;  2DCA A;  3BB7 A;  4YVA A;  1EWO A;  3IFU A;  3E9S A;  4MI7 A;  2VHS A;  3BY4 A;  3WXF A;  1CJL A;  4OW0 A;  2P7U A;  3LXS A;  2HWK A;  4ZUX U;  3I06 A;  1F2B A;  4QRG A;  1DKI A;  1AU3 A;  3P5W A;  3CBK A;  2AU1 A;  1ME4 A;  1SNK A;  4HXD B;  4OVZ A;  3C9E A;  2R9F A;  5CVN B;  1GMY A;  3K9M A;  1F2C A;  2H7J A;  4X6J A;  4BS5 A;  3KW9 A;  1U9X A;  3USV A;  1GEC E;  5CHT A;  2JQG R;  3IHP A;  1XKG A;  9PAP A;  2ACT A;  3GCB A;  2Z84 A;  2PRE A;  3U8E A;  4N8W A;  3WXE A;  2JRI A;  3QT4 A;  1NQC A;  3OVZ A;  1YVB A;  2PAD A;  3RVX A;  1PPN A;  1QOL A;  3ZNH A;  1NL6 A;  4YYQ A;  1BQI A;  3PT2 A;  1AYV A;  3PW3 A;  1PPD A;  1YT7 A;  1MDW A;  4X6H A;  1STF E;  2P0R A;  2UZJ A;  4XZX A;  1EWP A;  1U5I A;  4MZS A;  3PNR A;  2YJB A;  3PHU A;  4BPV A;  5JH3 A;  3N3K A;  4W4U A;  4CDE B;  1ITO A;  1EF7 A;  3BBA A;  4BOZ A;  2AYO A;  4AXM A;  2B1M A;  4KLB A;  1AIM A;  4MZO A;  2DCD A;  3PBH A;  3B21 A;  2DJG B;  4CDD B;  3W31 A;  2F1G A;  4QH6 A;  4P16 A;  5EZQ A;  1MIR A;  2C0Y A;  3S3R A;  4I05 A;  4OVZ B;  1KHP A;  2IPP B;  2XU3 A;  3B79 A;  1VSN A;  3MOR A;  3H8C A;  2PNS A;  1PPP A;  3OQC A;  4RF1 A;  2AS8 A;  3AI8 A;  1A6R A;  1S4V A;  3NHE A;  1DEU A;  2NQA A;  5PAD A;  5J94 A;  1K3B B;  2DC9 A;  2XU1 A;  4FIP A;  1F29 A;  3IUT A;  3CH3 X;  4WA6 A;  4BOP A;  5CHV A;  2B1N A;  2OP3 A;  2DCB A;  2P86 A;  3IEJ A;  2FRA A;  4K7C A;  1CPJ A;  2FTD A;  2HHN A;  1SP4 B;  4HWY A;  1GLO A;  4MM3 B;  2XU4 A;  1KFX L;  2BU3 A;  4GUA A;  4W5C A;  3H8B A;  3H6S A;  4BOS A;  2IBI A;  2PBH A;  3C0R A;  4OEL A;  5EGW A;  1MS6 A;  2DOS A;  8PCH A;  3IOQ A;  2FT2 A;  4RKX A;  2G6D A;  2YJ9 A;  5EZS A;  1CQD A;  1NB3 A;  2R9O A;  3M99 A;  2AGA A;  2FE8 A;  3H89 A;  3HHA A;  1PXV A;  2DZY A;  1CVZ A;  2DJF B;  3S3Q A;  3H7D A;  4X6I A;  3D6S A;  5JA7 A;  2E00 A;  3PDF A;  3ZUA A;  4BOU A;  1CS8 A;  3KKU A;  2DZZ A;  3HHI A;  2HXZ A;  3I3T A;  1PPO A;  2NQG A;  3O0U A;  2YJ8 A;  1PCI A;  4CZW A;  4YYU A;  3OF9 A;  3PHW A;  2JQF R;  3BC3 A;  7PCK A;  1Q6K A;  4D8I A;  4CDC B;  3F5V A;  4P6E A;  3P5V A;  2YJ2 A;  3MP2 A;  1X9Y A;  1QDQ A;  3N4C A;  4Q8G A;  1TLO A;  2BDZ A;  1BP4 A;  4D8B A;  2BTW A;  4R3D A;  2OUL A;  2Y6E A;  4Q8H A;  1CB5 A;  4PI3 A;  5E6J A;  4XR7 A;  4D8E A;  2R9N A;  4FJC A;  5K16 A;  1ATK A;  3BPF A;  1HUC B;  1BY8 A;  5A24 A;  1ZCM A;  1Y4H A;  3MHS A;  1CSB B;  4BQV A;  5JZE A;  1PE6 A;  4ZTB A;  4PAD A;  4P6G A;  2GHU A;  1TL9 A;  1YK7 A;  2NQD B;  2G8E A;  1AYW A;  2E02 A;  4PP1 A;  1AYU A;  2R9M A;  1M6D A;  1BGO A;  2NQI A;  3QJ3 A;  3OF8 A;  1DF0 A;  5EF4 A;  1AU2 A;  3PRM A;  4G54 A;  1F2A A;  3O1G A;  3TMP A;  4QRX A;  3IV2 A;  4DMY A;  2J7Q C;  4DMX A;  3ERV A;  2J7Q A;  5CVM A;  3OIS A;  1NLJ A;  3V6C A;  3KX1 A;  3DF0 A;  3RNV A;  4FK5 A;  3QSD A;  1ICF A;  1KXR A;  4PT5 A;  4N4Z A;  4XUI A;  2E03 A;  1NB5 A;  2ATO A;  3HWN A;  1YK8 A;  3CBJ A;  3P5U A;  2HH5 A;  1PIP A;  2BTW B;  1QXP A;  3N3G A;  4RNA A;  4M0W A;  1UKF A;  3KWZ A;  4YYS A;  4QRV A;  2Y5B A;  3PHX A;  2G8J A;  4CDF B;  3WXG A;  2YJC A;  1PAD A;  3RVW A;  2AUZ A;  4RY2 A;  1KHQ A;  2O6X A;  3O65 A;  1MEG A;  3TNX A;  3BOW A;  2R6N A;  4YYR A;  3MTN A;  3IMA A;  1CTE A;  2FQ9 A;  4A5U A;  4IUM A;  1POP A;  2FYE A;  1O0E A;  2ARY A;  1AEC A;  1QMY A;  2DC8 A;  3K8U A;  3OVX A;  2AIM A;  2CB5 A;  1U9W A;  2AUX A;  2AYN A;  2DCC A;  1ZIV A;  2BDL A;  3RVV A;  1JQP A;  2HD5 A;  4BS6 A;  1AU0 A;  3HD3 A;  4N79 A;  4AXL A;  2VHF A;  3KWB X;  1AU4 A;  2DC6 A;  4I07 A;  3P5X A;  3TRK A;  3F75 A;  6PAD A;  1U9Q X;  1THE A;  3W30 A;  1YAL A;  3BPM A;  3V6E A;  5FPW A;  3BWK A;  3PRP A;  3E1Z B;  5KO3 A;  2JTC A;  4WUR A;  4PP2 E;  1MHW A;  1ME3 A;  3PSE A;  1IWD A;  3CH2 X;  3MJ5 A;  2G7Y A;  5F02 A;  2OZ2 A;  1GCB A; 
#chains in the Genus database with same CATH homology
 2BSZ A;  2FRQ A;  1MEM A;  2XU5 A;  4OEM A;  1Y08 A;  3MHH A;  2FO5 A;  2F7D A;  4W5B A;  3K24 A;  2GFO A;  2WBF X;  1VJV A;  3KFQ A;  4QBB A;  3LFY A;  1KFU L;  2E01 A;  1CV8 A;  4I04 A;  1PBH A;  2R9C A;  1NPZ A;  3BCN A;  1EWM A;  2DC7 A;  5CVO B;  4MSX A;  2CIO A;  2FUD A;  4YYW A;  4BSQ A;  1FH0 A;  3KSE A;  4YYV A;  1EWL A;  1TU6 A;  1U9V A;  4YV8 A;  2AVW A;  2DCA A;  4YVA A;  1EWO A;  2VHS A;  3WXF A;  1CJL A;  1W6F A;  2P7U A;  3LXS A;  4ZUX U;  3I06 A;  1F2B A;  4QRG A;  1AU3 A;  3P5W A;  3CBK A;  2AU1 A;  1ME4 A;  1SNK A;  3C9E A;  2R9F A;  5CVN B;  1GMY A;  3K9M A;  1F2C A;  2H7J A;  4X6J A;  4BS5 A;  3KW9 A;  1U9X A;  3USV A;  1GEC E;  5CHT A;  2JQG R;  3IHP A;  1XKG A;  9PAP A;  2ACT A;  3GCB A;  2PRE A;  3U8E A;  4N8W A;  3WXE A;  3QT4 A;  1NQC A;  3OVZ A;  1YVB A;  2PAD A;  3RVX A;  1PPN A;  1QOL A;  4YYQ A;  1NL6 A;  1BQI A;  1AYV A;  3PW3 A;  1PPD A;  1YT7 A;  1MDW A;  4X6H A;  1STF E;  2P0R A;  1EWP A;  1U5I A;  4MZS A;  3PNR A;  2YJB A;  4BPV A;  5JH3 A;  3N3K A;  4W4U A;  4CDE B;  1ITO A;  1EF7 A;  2AYO A;  4AXM A;  2B1M A;  4KLB A;  1AIM A;  4MZO A;  2DCD A;  3PBH A;  2DJG B;  1GX3 A;  4CDD B;  2F1G A;  4QH6 A;  1MIR A;  2C0Y A;  3S3R A;  4I05 A;  1KHP A;  2IPP B;  2XU3 A;  3B79 A;  1VSN A;  3MOR A;  3H8C A;  2PNS A;  1PPP A;  2AS8 A;  3AI8 A;  1A6R A;  1S4V A;  3NHE A;  1DEU A;  2NQA A;  5PAD A;  5J94 A;  1K3B B;  2DC9 A;  2XU1 A;  4FIP A;  1F29 A;  3IUT A;  3CH3 X;  4WA6 A;  5CHV A;  2B1N A;  2OP3 A;  2DCB A;  2P86 A;  3IEJ A;  2FRA A;  4K7C A;  1CPJ A;  2FTD A;  2HHN A;  1SP4 B;  4HWY A;  1GLO A;  2XU4 A;  1KFX L;  4W5C A;  3H8B A;  3H6S A;  2IBI A;  2PBH A;  4OEL A;  5EGW A;  1MS6 A;  8PCH A;  3IOQ A;  3LTW A;  2FT2 A;  2G6D A;  2YJ9 A;  1CQD A;  1NB3 A;  2R9O A;  3M99 A;  3H89 A;  3HHA A;  1PXV A;  2DZY A;  1CVZ A;  2DJF B;  3S3Q A;  4NV8 A;  3H7D A;  4X6I A;  3D6S A;  5JA7 A;  2E00 A;  3PDF A;  3ZUA A;  1CS8 A;  3KKU A;  2DZZ A;  3HHI A;  2HXZ A;  3I3T A;  1PPO A;  2NQG A;  3O0U A;  2YJ8 A;  1PCI A;  4CZW A;  4YYU A;  3OF9 A;  2JQF R;  3BC3 A;  7PCK A;  1Q6K A;  4CDC B;  3F5V A;  4P6E A;  3P5V A;  2YJ2 A;  1X9Y A;  1QDQ A;  3N4C A;  4Q8G A;  1TLO A;  2BDZ A;  1BP4 A;  2VFB A;  2OUL A;  2Y6E A;  4Q8H A;  1CB5 A;  4PI3 A;  4XR7 A;  2R9N A;  4FJC A;  5K16 A;  1ATK A;  3BPF A;  1HUC B;  1BY8 A;  5A24 A;  1ZCM A;  1Y4H A;  3MHS A;  1CSB B;  4BQV A;  1PE6 A;  4PAD A;  4P6G A;  2GHU A;  1TL9 A;  1YK7 A;  2NQD B;  2G8E A;  1AYW A;  2E02 A;  4PP1 A;  1AYU A;  2R9M A;  1M6D A;  1BGO A;  2NQI A;  3QJ3 A;  3OF8 A;  1DF0 A;  5EF4 A;  1AU2 A;  4G54 A;  1F2A A;  3O1G A;  4QRX A;  3IV2 A;  4DMY A;  4DMX A;  3ERV A;  5CVM A;  3OIS A;  1NLJ A;  3V6C A;  3KX1 A;  3DF0 A;  4FK5 A;  3QSD A;  1ICF A;  1KXR A;  1W5R A;  4N4Z A;  4XUI A;  2E03 A;  1NB5 A;  2ATO A;  3HWN A;  1YK8 A;  3CBJ A;  3P5U A;  2HH5 A;  1PIP A;  1QXP A;  3N3G A;  4YYS A;  3KWZ A;  4QRV A;  2Y5B A;  2G8J A;  4CDF B;  3WXG A;  2YJC A;  1PAD A;  3RVW A;  2AUZ A;  4RY2 A;  1KHQ A;  2VFC A;  1E2T A;  2O6X A;  1MEG A;  3TNX A;  3BOW A;  2R6N A;  4YYR A;  3MTN A;  3IMA A;  1CTE A;  2FQ9 A;  1POP A;  2FYE A;  1W4T A;  1O0E A;  2ARY A;  1AEC A;  1QMY A;  2DC8 A;  3D9W A;  3K8U A;  4GUZ A;  3OVX A;  4BGF A;  2AIM A;  2CB5 A;  1U9W A;  2AUX A;  2AYN A;  2DCC A;  1ZIV A;  2BDL A;  3RVV A;  4NV7 A;  1JQP A;  2HD5 A;  4BS6 A;  1AU0 A;  3HD3 A;  4N79 A;  4AXL A;  2VHF A;  3KWB X;  1AU4 A;  4I07 A;  2DC6 A;  3P5X A;  3F75 A;  6PAD A;  1U9Q X;  1THE A;  1YAL A;  3BPM A;  3V6E A;  5FPW A;  3BWK A;  4B55 A;  3E1Z B;  4PP2 E;  1MHW A;  1ME3 A;  1IWD A;  3CH2 X;  2G7Y A;  5F02 A;  2OZ2 A;  4C5P A;  1GCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...