1GECE

Glycyl endopeptidase-complex with benzyloxycarbonyl-leucine-valine-glycine-methylene covalently bound to cysteine 25
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
216
structure length
216
Chain Sequence
LPESVDWRAKGAVTPVKHQGYCESCWAFSTVATVEGINKIKTGNLVELSEQELVDCDLQSYGCNRGYQSTSLQYVAQNGIHLRAKYPYIAKQQTCRANQVGGPKVKTNGVGRVQSNNEGSLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKSGGKGYILIKNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYL ENDOPEPTIDASE
publication title Crystal structure of glycyl endopeptidase from Carica papaya: a cysteine endopeptidase of unusual substrate specificity.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 65
structure length 216
sequence length 216
ec nomenclature ec 3.4.22.25: Glycyl endopeptidase.
pdb deposition date 1995-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1gecE00
1VJVA 1EWMA 1AU3A 3CBJA 3QJ3A 3TNXA 4PP2E 1ME4A 2FRAA 1MDWA 1BP4A 4I04A 2CIOA 1K3BB 1AYWA 3ERVA 3I06A 1JQPA 2R9FA 5JH3A 3KX1A 1AYUA 1ICFA 3S3QA 5CVMA 3K9MA 1GECE 1THEA 2R9NA 3OF8A 2FO5A 1KFUL 4DMYA 6PADA 4PP1A 1M6DA 2DJGB 2DZZA 2JQFR 5A24A 1Y4HA 2NQIA 2CB5A 1MS6A 5EGWA 3OVZA 4N79A 4YYWA 3HHAA 3H8CA 2DZYA 3H6SA 3WXGA 3QT4A 2DCCA 3HHIA 3CH2X 5FPWA 4QRVA 2Y5BA 3CBKA 1NQCA 2HHNA 3HD3A 2HH5A 5CHTA 3GCBA 1PXVA 1U9VA 1KHPA 4CDFB 2E01A 4DMXA 1PCIA 3KWZA 4X6JA 3KSEA 2FTDA 3KW9A 1CPJA 2P0RA 3H8BA 3V6CA 1CS8A 4K7CA 1F2CA 1F2BA 1CQDA 1YVBA 1PE6A 2HD5A 1O0EA 1PPPA 2OP3A 3BOWA 2E02A 2F7DA 4XR7A 1AIMA 1DEUA 3E1ZB 3MORA 1Y08A 4YV8A 1KFXL 3S3RA 4Q8GA 1MHWA 4CZWA 3F5VA 4MZOA 4ZUXU 2YJBA 5CHVA 1VSNA 3USVA 1CVZA 1AYVA 1EWPA 1U5IA 4YYRA 3LFYA 4W5BA 1FH0A 2R9OA 3F75A 1AU4A 2FQ9A 2G8EA 4I07A 3RVXA 4G54A 3MTNA 1X9YA 2DCBA 3P5XA 3IEJA 2NQDB 3BPFA 1CTEA 4Q8HA 1TLOA 5K16A 3BWKA 3O1GA 4WA6A 4I05A 5CVNB 1F2AA 2YJ2A 4N4ZA 3RVWA 1A6RA 4RY2A 2FUDA 2ARYA 1U9XA 3P5VA 4X6IA 3WXFA 8PCHA 1NB3A 2AS8A 3DF0A 3M99A 1QDQA 2NQAA 1SP4B 3N3KA 3H7DA 2IPPB 4YYVA 2OZ2A 1PIPA 2XU3A 4YYUA 4QRXA 2DC6A 2E00A 2GHUA 2AYNA 2Y6EA 3N3GA 2ATOA 4CDEB 5JA7A 2AVWA 2YJ9A 4KLBA 3AI8A 1CB5A 3P5UA 4BS5A 2OULA 1CJLA 1PBHA 1KXRA 1ME3A 1QOLA 3U8EA 4PADA 2DC7A 1TL9A 4MSXA 3KFQA 2B1MA 2DC8A 4FIPA 1ZCMA 4QH6A 1PPNA 2B1NA 3N4CA 2AUXA 3I3TA 3QSDA 2O6XA 3IMAA 3BC3A 1PPDA 2BDZA 3IOQA 1EWOA 1EF7A 4AXLA 2AU1A 2DC9A 1AU2A 3RVVA 4CDCB 2FT2A 3O0UA 2YJ8A 1NB5A 2R6NA 5F02A 1YALA 1QMYA 2E03A 3OISA 1BGOA 3PNRA 1BQIA 1MEGA 2YJCA 4N8WA 1NLJA 3PW3A 2XU5A 1AECA 2VHSA 1TU6A 2PNSA 3ZUAA 2PBHA 1CV8A 1CSBB 2P7UA 3IHPA 3MHSA 2PADA 1BY8A 2WBFX 3D6SA 3HWNA 4AXMA 1ZIVA 3WXEA 3LXSA 4MZSA 4HWYA 2F1GA 1AU0A 1S4VA 3PBHA 1F29A 4OELA 3KWBX 5CVOB 1NPZA 2ACTA 1U9WA 2XU4A 2HXZA 2G8JA 4P6GA 2JQGR 3IUTA 5EF4A 7PCKA 1QXPA 3B79A 1MIRA 3OVXA 4PI3A 1PPOA 1GLOA 1YK7A 1STFE 2G6DA 1MEMA 1GMYA 1KHQA 1NL6A 5J94A 4BQVA 2R9CA 4FK5A 4W5CA 4BPVA 4BSQA 2XU1A 1SNKA 3K8UA 4CDDB 3KKUA 1IWDA 2FYEA 3IV2A 4XUIA 5PADA 2GFOA 4OEMA 1ATKA 2AIMA 2PREA 3CH3X 2P86A 3NHEA 1DF0A 1U9QX 2DCAA 4P6EA 2VHFA 4BS6A 2AUZA 1POPA 2DCDA 3BCNA 2G7YA 1YK8A 1GCBA 3K24A 2DJFB 2C0YA 1Q6KA 2BDLA 3H89A 2AYOA 2R9MA 1YT7A 3BPMA 3OF9A 9PAPA 4YYSA 4X6HA 4QBBA 1ITOA 4YYQA 4YVAA 4W4UA 3MHHA 4QRGA 1PADA 2FRQA 3P5WA 3PDFA 1HUCB 2IBIA 1XKGA 1EWLA 4FJCA 2H7JA 3V6EA 2NQGA 3C9EA
chains in the Genus database with same CATH superfamily
1VJVA 2J7QA 2BU3A 1EWMA 1AU3A 3CBJA 3QJ3A 4REZA 3TNXA 4PP2E 1ME4A 2FRAA 3W31A 1MDWA 1BP4A 4I04A 2CIOA 1K3BB 1AYWA 3ERVA 3I06A 1JQPA 2R9FA 5JH3A 3KX1A 1AYUA 1ICFA 3S3QA 5CVMA 3K9MA 1GECE 1THEA 2R9NA 3OF8A 2FO5A 2BTWB 1KFUL 4DMYA 6PADA 4PP1A 1M6DA 2DJGB 2DZZA 2JQFR 5A24A 1Y4HA 5E6JA 2NQIA 4RNAA 4MM3B 2CB5A 1MS6A 5EGWA 3OVZA 4N79A 2JRIA 4YYWA 3HHAA 3H8CA 2DZYA 4BOUA 3H6SA 3WXGA 3QT4A 2BTWA 2DCCA 3HHIA 5KO3A 3CH2X 3PSEA 5FPWA 4QRVA 2Y5BA 3CBKA 4ZTBA 1NQCA 1PVJA 4BOZA 2AGAA 2HHNA 3IFUA 3HD3A 2HH5A 5CHTA 3GCBA 1PXVA 1U9VA 1KHPA 4CDFB 2E01A 4D8EA 4DMXA 1PCIA 3KWZA 4X6JA 5EZQA 2J7QC 3KSEA 2FTDA 3KW9A 1CPJA 2P0RA 3H8BA 3V6CA 1CS8A 4K7CA 1F2CA 1F2BA 1CQDA 1YVBA 1PE6A 2HD5A 1O0EA 1PPPA 2OP3A 3BOWA 2E02A 2F7DA 4XR7A 3ZNHA 3PT2A 1AIMA 1DEUA 3E1ZB 3MORA 1Y08A 4YV8A 1KFXL 3S3RA 4Q8GA 1MHWA 3MP2A 4CZWA 3F5VA 3W30A 4MZOA 4ZUXU 2YJBA 5CHVA 1VSNA 3USVA 1CVZA 1AYVA 1EWPA 1U5IA 4YYRA 4OVZB 3LFYA 4W5BA 1FH0A 4BOPA 2R9OA 3F75A 1AU4A 2FQ9A 2G8EA 5JZEA 4I07A 3PRPA 3RVXA 4G54A 3MTNA 1X9YA 2DCBA 3P5XA 3IEJA 2NQDB 3BPFA 1CTEA 4Q8HA 1TLOA 5K16A 3BWKA 3O1GA 4WA6A 4I05A 3O65A 5CVNB 1F2AA 2YJ2A 4OVZA 4N4ZA 3RVWA 1A6RA 4RY2A 2FUDA 2ARYA 2DOSA 1U9XA 3P5VA 4P16A 4X6IA 4IP3A 3WXFA 8PCHA 1NB3A 2AS8A 3DF0A 3M99A 1QDQA 2NQAA 1SP4B 3N3KA 4GUAA 3E9SA 3H7DA 2IPPB 4YYVA 2OZ2A 1PIPA 2XU3A 4YYUA 4QRXA 2DC6A 3PRMA 2E00A 2GHUA 2AYNA 2Y6EA 3N3GA 4HXDB 2ATOA 4CDEB 5JA7A 4RF0A 2AVWA 3RNVA 2HWKA 2YJ9A 4KLBA 3AI8A 1CB5A 3P5UA 4BS5A 4A5UA 2OULA 1CJLA 1PBHA 1KXRA 1ME3A 1QOLA 3U8EA 4PADA 2DC7A 1TL9A 4MSXA 3KFQA 3C0RA 2B1MA 2DC8A 4FIPA 1ZCMA 4QH6A 3PHUA 1PPNA 2B1NA 3N4CA 2AUXA 3I3TA 3QSDA 2O6XA 3IMAA 3BC3A 1PPDA 2BDZA 3IOQA 1EWOA 1EF7A 4AXLA 2AU1A 2DC9A 1AU2A 3RVVA 4CDCB 2FT2A 3O0UA 4RKXA 2YJ8A 4R3DA 1NB5A 3OQCA 2R6NA 2UZJA 5F02A 4D8BA 1YALA 1QMYA 2E03A 3OISA 1BGOA 3PNRA 1BQIA 1MEGA 2YJCA 4N8WA 1NLJA 3PW3A 2XU5A 1AECA 2VHSA 1TU6A 2PNSA 3ZUAA 2PBHA 1CV8A 1CSBB 4BOQA 2P7UA 3IHPA 3MHSA 2PADA 1BY8A 2WBFX 3D6SA 3HWNA 4AXMA 1ZIVA 3WXEA 3LXSA 4MZSA 4HWYA 2F1GA 1AU0A 5EZSA 1S4VA 3PBHA 1F29A 4BOSA 4OELA 3KWBX 5CVOB 1NPZA 2ACTA 1U9WA 2XU4A 3TMPA 2HXZA 2G8JA 3BY4A 4IUMA 4P6GA 2JQGR 3IUTA 5EF4A 7PCKA 1QXPA 2FE8A 3B79A 1MIRA 3BB7A 3MTVA 3BBAA 3OVXA 4PI3A 3B21A 1PPOA 1GLOA 1YK7A 1STFE 2G6DA 1MEMA 1UKFA 1GMYA 2Z84A 1KHQA 1NL6A 5J94A 1DKIA 4M0WA 4BQVA 2R9CA 4FK5A 4W5CA 4BPVA 4BSQA 4OW0A 3MJ5A 3PHWA 2XU1A 1SNKA 3K8UA 4CDDB 3KKUA 1IWDA 2FYEA 3IV2A 4XUIA 5PADA 3PHXA 2GFOA 4OEMA 1ATKA 2AIMA 4D8IA 2PREA 3CH3X 4MI7A 2P86A 3NHEA 3TRKA 1DF0A 1U9QX 4XZXA 2DCAA 4P6EA 2VHFA 4BS6A 2AUZA 1POPA 2DCDA 3BCNA 4WURA 2G7YA 1YK8A 1GCBA 4PT5A 3K24A 2DJFB 2C0YA 1Q6KA 2BDLA 3H89A 2JTCA 2AYOA 2R9MA 1YT7A 3BPMA 3OF9A 9PAPA 4YYSA 4X6HA 1YZBA 4QBBA 1ITOA 4YYQA 4RF1A 4YVAA 4W4UA 3MHHA 4QRGA 1PADA 2FRQA 3P5WA 3PDFA 1HUCB 2IBIA 1XKGA 1EWLA 4FJCA 2H7JA 3V6EA 2NQGA 3C9EA
chains in the Genus database with same CATH topology
1VJVA 1EWMA 1AU3A 3CBJA 3QJ3A 3TNXA 4PP2E 1ME4A 2FRAA 1MDWA 1BP4A 4I04A 2CIOA 1K3BB 1AYWA 1W6FA 3ERVA 3I06A 1JQPA 1W4TA 2R9FA 5JH3A 3KX1A 1AYUA 1ICFA 3S3QA 5CVMA 3K9MA 1GECE 1THEA 2R9NA 3OF8A 2FO5A 1KFUL 4DMYA 6PADA 4PP1A 1M6DA 2DJGB 2DZZA 2JQFR 5A24A 1Y4HA 2NQIA 2CB5A 1MS6A 5EGWA 3OVZA 4N79A 4YYWA 4B55A 3HHAA 3H8CA 2DZYA 3H6SA 3WXGA 3QT4A 2DCCA 3HHIA 3CH2X 5FPWA 4QRVA 2Y5BA 3CBKA 1NQCA 2HHNA 3HD3A 2HH5A 5CHTA 3GCBA 1PXVA 1U9VA 1KHPA 4CDFB 2E01A 4DMXA 1PCIA 3KWZA 4X6JA 3KSEA 2FTDA 3KW9A 1CPJA 2P0RA 3H8BA 3V6CA 1CS8A 4K7CA 1F2CA 1F2BA 1CQDA 1YVBA 1PE6A 2HD5A 1O0EA 1PPPA 2OP3A 3BOWA 2E02A 1GX3A 2F7DA 4XR7A 1AIMA 1DEUA 3E1ZB 3MORA 1Y08A 4YV8A 1KFXL 3S3RA 4Q8GA 1MHWA 4CZWA 3F5VA 4MZOA 4ZUXU 2YJBA 5CHVA 1VSNA 3USVA 1CVZA 1AYVA 1EWPA 1U5IA 4YYRA 3LFYA 4W5BA 1FH0A 2R9OA 3F75A 1AU4A 2FQ9A 2G8EA 4I07A 3LTWA 3RVXA 4G54A 3MTNA 1X9YA 2DCBA 3P5XA 3IEJA 2NQDB 3BPFA 1CTEA 4Q8HA 1TLOA 5K16A 3BWKA 3O1GA 4WA6A 4I05A 5CVNB 1F2AA 2YJ2A 4BGFA 4N4ZA 3RVWA 1A6RA 4RY2A 2FUDA 2ARYA 1U9XA 3P5VA 2BSZA 4X6IA 3WXFA 8PCHA 1NB3A 2AS8A 3DF0A 3M99A 1QDQA 2NQAA 4NV7A 1SP4B 3N3KA 3H7DA 2IPPB 4YYVA 2OZ2A 1PIPA 2XU3A 4YYUA 4QRXA 2DC6A 2E00A 2GHUA 2AYNA 2Y6EA 3N3GA 2ATOA 4CDEB 5JA7A 2AVWA 2YJ9A 4KLBA 2VFCA 3AI8A 1CB5A 3P5UA 4BS5A 2OULA 1CJLA 1PBHA 1KXRA 1ME3A 1QOLA 3U8EA 4PADA 2DC7A 1TL9A 4MSXA 3KFQA 2B1MA 2DC8A 4FIPA 1ZCMA 4QH6A 1PPNA 2B1NA 3N4CA 2AUXA 3I3TA 3QSDA 2O6XA 3IMAA 3BC3A 1PPDA 2BDZA 3IOQA 1EWOA 1EF7A 4AXLA 2AU1A 2DC9A 1AU2A 3RVVA 4CDCB 2FT2A 3O0UA 2YJ8A 1NB5A 2R6NA 5F02A 1YALA 1QMYA 2E03A 4NV8A 3OISA 1BGOA 3PNRA 1BQIA 1MEGA 2YJCA 4N8WA 1NLJA 3PW3A 2XU5A 1AECA 2VHSA 1TU6A 2PNSA 3ZUAA 2PBHA 1CV8A 1CSBB 2P7UA 3IHPA 3MHSA 2PADA 1BY8A 2WBFX 3D6SA 3HWNA 4AXMA 1ZIVA 3WXEA 3LXSA 4MZSA 4HWYA 2F1GA 1AU0A 4GUZA 1S4VA 3PBHA 1F29A 4OELA 3KWBX 5CVOB 1NPZA 2ACTA 1U9WA 2XU4A 1E2TA 2HXZA 2G8JA 4P6GA 2JQGR 3IUTA 5EF4A 7PCKA 1QXPA 3B79A 1MIRA 2VFBA 3OVXA 4PI3A 1PPOA 1GLOA 1YK7A 1STFE 2G6DA 1MEMA 1GMYA 1KHQA 1NL6A 5J94A 4BQVA 2R9CA 4FK5A 4W5CA 4BPVA 4BSQA 2XU1A 1SNKA 3K8UA 4CDDB 3KKUA 1IWDA 2FYEA 3IV2A 4XUIA 5PADA 2GFOA 4OEMA 1ATKA 2AIMA 2PREA 1W5RA 3CH3X 2P86A 3NHEA 1DF0A 1U9QX 2DCAA 4P6EA 2VHFA 4BS6A 2AUZA 1POPA 2DCDA 3BCNA 2G7YA 1YK8A 1GCBA 3K24A 2DJFB 2C0YA 1Q6KA 2BDLA 3H89A 2AYOA 2R9MA 1YT7A 3BPMA 3OF9A 9PAPA 4C5PA 4YYSA 4X6HA 4QBBA 1ITOA 4YYQA 4YVAA 4W4UA 3MHHA 4QRGA 1PADA 2FRQA 3P5WA 3PDFA 1HUCB 3D9WA 2IBIA 1XKGA 1EWLA 4FJCA 2H7JA 3V6EA 2NQGA 3C9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJV A;  1EWM A;  1AU3 A;  3CBJ A;  3QJ3 A;  3TNX A;  4PP2 E;  1ME4 A;  2FRA A;  1MDW A;  1BP4 A;  4I04 A;  2CIO A;  1K3B B;  1AYW A;  3ERV A;  3I06 A;  1JQP A;  2R9F A;  5JH3 A;  3KX1 A;  1AYU A;  1ICF A;  3S3Q A;  5CVM A;  3K9M A;  1GEC E;  1THE A;  2R9N A;  3OF8 A;  2FO5 A;  1KFU L;  4DMY A;  6PAD A;  4PP1 A;  1M6D A;  2DJG B;  2DZZ A;  2JQF R;  5A24 A;  1Y4H A;  2NQI A;  2CB5 A;  1MS6 A;  5EGW A;  3OVZ A;  4N79 A;  4YYW A;  3HHA A;  3H8C A;  2DZY A;  3H6S A;  3WXG A;  3QT4 A;  2DCC A;  3HHI A;  3CH2 X;  5FPW A;  4QRV A;  2Y5B A;  3CBK A;  1NQC A;  2HHN A;  3HD3 A;  2HH5 A;  5CHT A;  3GCB A;  1PXV A;  1U9V A;  1KHP A;  4CDF B;  2E01 A;  4DMX A;  1PCI A;  3KWZ A;  4X6J A;  3KSE A;  2FTD A;  3KW9 A;  1CPJ A;  2P0R A;  3H8B A;  3V6C A;  1CS8 A;  4K7C A;  1F2C A;  1F2B A;  1CQD A;  1YVB A;  1PE6 A;  2HD5 A;  1O0E A;  1PPP A;  2OP3 A;  3BOW A;  2E02 A;  2F7D A;  4XR7 A;  1AIM A;  1DEU A;  3E1Z B;  3MOR A;  1Y08 A;  4YV8 A;  1KFX L;  3S3R A;  4Q8G A;  1MHW A;  4CZW A;  3F5V A;  4MZO A;  4ZUX U;  2YJB A;  5CHV A;  1VSN A;  3USV A;  1CVZ A;  1AYV A;  1EWP A;  1U5I A;  4YYR A;  3LFY A;  4W5B A;  1FH0 A;  2R9O A;  3F75 A;  1AU4 A;  2FQ9 A;  2G8E A;  4I07 A;  3RVX A;  4G54 A;  3MTN A;  1X9Y A;  2DCB A;  3P5X A;  3IEJ A;  2NQD B;  3BPF A;  1CTE A;  4Q8H A;  1TLO A;  5K16 A;  3BWK A;  3O1G A;  4WA6 A;  4I05 A;  5CVN B;  1F2A A;  2YJ2 A;  4N4Z A;  3RVW A;  1A6R A;  4RY2 A;  2FUD A;  2ARY A;  1U9X A;  3P5V A;  4X6I A;  3WXF A;  8PCH A;  1NB3 A;  2AS8 A;  3DF0 A;  3M99 A;  1QDQ A;  2NQA A;  1SP4 B;  3N3K A;  3H7D A;  2IPP B;  4YYV A;  2OZ2 A;  1PIP A;  2XU3 A;  4YYU A;  4QRX A;  2DC6 A;  2E00 A;  2GHU A;  2AYN A;  2Y6E A;  3N3G A;  2ATO A;  4CDE B;  5JA7 A;  2AVW A;  2YJ9 A;  4KLB A;  3AI8 A;  1CB5 A;  3P5U A;  4BS5 A;  2OUL A;  1CJL A;  1PBH A;  1KXR A;  1ME3 A;  1QOL A;  3U8E A;  4PAD A;  2DC7 A;  1TL9 A;  4MSX A;  3KFQ A;  2B1M A;  2DC8 A;  4FIP A;  1ZCM A;  4QH6 A;  1PPN A;  2B1N A;  3N4C A;  2AUX A;  3I3T A;  3QSD A;  2O6X A;  3IMA A;  3BC3 A;  1PPD A;  2BDZ A;  3IOQ A;  1EWO A;  1EF7 A;  4AXL A;  2AU1 A;  2DC9 A;  1AU2 A;  3RVV A;  4CDC B;  2FT2 A;  3O0U A;  2YJ8 A;  1NB5 A;  2R6N A;  5F02 A;  1YAL A;  1QMY A;  2E03 A;  3OIS A;  1BGO A;  3PNR A;  1BQI A;  1MEG A;  2YJC A;  4N8W A;  1NLJ A;  3PW3 A;  2XU5 A;  1AEC A;  2VHS A;  1TU6 A;  2PNS A;  3ZUA A;  2PBH A;  1CV8 A;  1CSB B;  2P7U A;  3IHP A;  3MHS A;  2PAD A;  1BY8 A;  2WBF X;  3D6S A;  3HWN A;  4AXM A;  1ZIV A;  3WXE A;  3LXS A;  4MZS A;  4HWY A;  2F1G A;  1AU0 A;  1S4V A;  3PBH A;  1F29 A;  4OEL A;  3KWB X;  5CVO B;  1NPZ A;  2ACT A;  1U9W A;  2XU4 A;  2HXZ A;  2G8J A;  4P6G A;  2JQG R;  3IUT A;  5EF4 A;  7PCK A;  1QXP A;  3B79 A;  1MIR A;  3OVX A;  4PI3 A;  1PPO A;  1GLO A;  1YK7 A;  1STF E;  2G6D A;  1MEM A;  1GMY A;  1KHQ A;  1NL6 A;  5J94 A;  4BQV A;  2R9C A;  4FK5 A;  4W5C A;  4BPV A;  4BSQ A;  2XU1 A;  1SNK A;  3K8U A;  4CDD B;  3KKU A;  1IWD A;  2FYE A;  3IV2 A;  4XUI A;  5PAD A;  2GFO A;  4OEM A;  1ATK A;  2AIM A;  2PRE A;  3CH3 X;  2P86 A;  3NHE A;  1DF0 A;  1U9Q X;  2DCA A;  4P6E A;  2VHF A;  4BS6 A;  2AUZ A;  1POP A;  2DCD A;  3BCN A;  2G7Y A;  1YK8 A;  1GCB A;  3K24 A;  2DJF B;  2C0Y A;  1Q6K A;  2BDL A;  3H89 A;  2AYO A;  2R9M A;  1YT7 A;  3BPM A;  3OF9 A;  9PAP A;  4YYS A;  4X6H A;  4QBB A;  1ITO A;  4YYQ A;  4YVA A;  4W4U A;  3MHH A;  4QRG A;  1PAD A;  2FRQ A;  3P5W A;  3PDF A;  1HUC B;  2IBI A;  1XKG A;  1EWL A;  4FJC A;  2H7J A;  3V6E A;  2NQG A;  3C9E A; 
#chains in the Genus database with same CATH topology
 1VJV A;  2J7Q A;  2BU3 A;  1EWM A;  1AU3 A;  3CBJ A;  3QJ3 A;  4REZ A;  3TNX A;  4PP2 E;  1ME4 A;  2FRA A;  3W31 A;  1MDW A;  1BP4 A;  4I04 A;  2CIO A;  1K3B B;  1AYW A;  3ERV A;  3I06 A;  1JQP A;  2R9F A;  5JH3 A;  3KX1 A;  1AYU A;  1ICF A;  3S3Q A;  5CVM A;  3K9M A;  1GEC E;  1THE A;  2R9N A;  3OF8 A;  2FO5 A;  2BTW B;  1KFU L;  4DMY A;  6PAD A;  4PP1 A;  1M6D A;  2DJG B;  2DZZ A;  2JQF R;  5A24 A;  1Y4H A;  5E6J A;  2NQI A;  4RNA A;  4MM3 B;  2CB5 A;  1MS6 A;  5EGW A;  3OVZ A;  4N79 A;  2JRI A;  4YYW A;  3HHA A;  3H8C A;  2DZY A;  4BOU A;  3H6S A;  3WXG A;  3QT4 A;  2BTW A;  2DCC A;  3HHI A;  5KO3 A;  3CH2 X;  3PSE A;  5FPW A;  4QRV A;  2Y5B A;  3CBK A;  4ZTB A;  1NQC A;  1PVJ A;  4BOZ A;  2AGA A;  2HHN A;  3IFU A;  3HD3 A;  2HH5 A;  5CHT A;  3GCB A;  1PXV A;  1U9V A;  1KHP A;  4CDF B;  2E01 A;  4D8E A;  4DMX A;  1PCI A;  3KWZ A;  4X6J A;  5EZQ A;  2J7Q C;  3KSE A;  2FTD A;  3KW9 A;  1CPJ A;  2P0R A;  3H8B A;  3V6C A;  1CS8 A;  4K7C A;  1F2C A;  1F2B A;  1CQD A;  1YVB A;  1PE6 A;  2HD5 A;  1O0E A;  1PPP A;  2OP3 A;  3BOW A;  2E02 A;  2F7D A;  4XR7 A;  3ZNH A;  3PT2 A;  1AIM A;  1DEU A;  3E1Z B;  3MOR A;  1Y08 A;  4YV8 A;  1KFX L;  3S3R A;  4Q8G A;  1MHW A;  3MP2 A;  4CZW A;  3F5V A;  3W30 A;  4MZO A;  4ZUX U;  2YJB A;  5CHV A;  1VSN A;  3USV A;  1CVZ A;  1AYV A;  1EWP A;  1U5I A;  4YYR A;  4OVZ B;  3LFY A;  4W5B A;  1FH0 A;  4BOP A;  2R9O A;  3F75 A;  1AU4 A;  2FQ9 A;  2G8E A;  5JZE A;  4I07 A;  3PRP A;  3RVX A;  4G54 A;  3MTN A;  1X9Y A;  2DCB A;  3P5X A;  3IEJ A;  2NQD B;  3BPF A;  1CTE A;  4Q8H A;  1TLO A;  5K16 A;  3BWK A;  3O1G A;  4WA6 A;  4I05 A;  3O65 A;  5CVN B;  1F2A A;  2YJ2 A;  4OVZ A;  4N4Z A;  3RVW A;  1A6R A;  4RY2 A;  2FUD A;  2ARY A;  2DOS A;  1U9X A;  3P5V A;  4P16 A;  4X6I A;  4IP3 A;  3WXF A;  8PCH A;  1NB3 A;  2AS8 A;  3DF0 A;  3M99 A;  1QDQ A;  2NQA A;  1SP4 B;  3N3K A;  4GUA A;  3E9S A;  3H7D A;  2IPP B;  4YYV A;  2OZ2 A;  1PIP A;  2XU3 A;  4YYU A;  4QRX A;  2DC6 A;  3PRM A;  2E00 A;  2GHU A;  2AYN A;  2Y6E A;  3N3G A;  4HXD B;  2ATO A;  4CDE B;  5JA7 A;  4RF0 A;  2AVW A;  3RNV A;  2HWK A;  2YJ9 A;  4KLB A;  3AI8 A;  1CB5 A;  3P5U A;  4BS5 A;  4A5U A;  2OUL A;  1CJL A;  1PBH A;  1KXR A;  1ME3 A;  1QOL A;  3U8E A;  4PAD A;  2DC7 A;  1TL9 A;  4MSX A;  3KFQ A;  3C0R A;  2B1M A;  2DC8 A;  4FIP A;  1ZCM A;  4QH6 A;  3PHU A;  1PPN A;  2B1N A;  3N4C A;  2AUX A;  3I3T A;  3QSD A;  2O6X A;  3IMA A;  3BC3 A;  1PPD A;  2BDZ A;  3IOQ A;  1EWO A;  1EF7 A;  4AXL A;  2AU1 A;  2DC9 A;  1AU2 A;  3RVV A;  4CDC B;  2FT2 A;  3O0U A;  4RKX A;  2YJ8 A;  4R3D A;  1NB5 A;  3OQC A;  2R6N A;  2UZJ A;  5F02 A;  4D8B A;  1YAL A;  1QMY A;  2E03 A;  3OIS A;  1BGO A;  3PNR A;  1BQI A;  1MEG A;  2YJC A;  4N8W A;  1NLJ A;  3PW3 A;  2XU5 A;  1AEC A;  2VHS A;  1TU6 A;  2PNS A;  3ZUA A;  2PBH A;  1CV8 A;  1CSB B;  4BOQ A;  2P7U A;  3IHP A;  3MHS A;  2PAD A;  1BY8 A;  2WBF X;  3D6S A;  3HWN A;  4AXM A;  1ZIV A;  3WXE A;  3LXS A;  4MZS A;  4HWY A;  2F1G A;  1AU0 A;  5EZS A;  1S4V A;  3PBH A;  1F29 A;  4BOS A;  4OEL A;  3KWB X;  5CVO B;  1NPZ A;  2ACT A;  1U9W A;  2XU4 A;  3TMP A;  2HXZ A;  2G8J A;  3BY4 A;  4IUM A;  4P6G A;  2JQG R;  3IUT A;  5EF4 A;  7PCK A;  1QXP A;  2FE8 A;  3B79 A;  1MIR A;  3BB7 A;  3MTV A;  3BBA A;  3OVX A;  4PI3 A;  3B21 A;  1PPO A;  1GLO A;  1YK7 A;  1STF E;  2G6D A;  1MEM A;  1UKF A;  1GMY A;  2Z84 A;  1KHQ A;  1NL6 A;  5J94 A;  1DKI A;  4M0W A;  4BQV A;  2R9C A;  4FK5 A;  4W5C A;  4BPV A;  4BSQ A;  4OW0 A;  3MJ5 A;  3PHW A;  2XU1 A;  1SNK A;  3K8U A;  4CDD B;  3KKU A;  1IWD A;  2FYE A;  3IV2 A;  4XUI A;  5PAD A;  3PHX A;  2GFO A;  4OEM A;  1ATK A;  2AIM A;  4D8I A;  2PRE A;  3CH3 X;  4MI7 A;  2P86 A;  3NHE A;  3TRK A;  1DF0 A;  1U9Q X;  4XZX A;  2DCA A;  4P6E A;  2VHF A;  4BS6 A;  2AUZ A;  1POP A;  2DCD A;  3BCN A;  4WUR A;  2G7Y A;  1YK8 A;  1GCB A;  4PT5 A;  3K24 A;  2DJF B;  2C0Y A;  1Q6K A;  2BDL A;  3H89 A;  2JTC A;  2AYO A;  2R9M A;  1YT7 A;  3BPM A;  3OF9 A;  9PAP A;  4YYS A;  4X6H A;  1YZB A;  4QBB A;  1ITO A;  4YYQ A;  4RF1 A;  4YVA A;  4W4U A;  3MHH A;  4QRG A;  1PAD A;  2FRQ A;  3P5W A;  3PDF A;  1HUC B;  2IBI A;  1XKG A;  1EWL A;  4FJC A;  2H7J A;  3V6E A;  2NQG A;  3C9E A; 
#chains in the Genus database with same CATH homology
 1VJV A;  1EWM A;  1AU3 A;  3CBJ A;  3QJ3 A;  3TNX A;  4PP2 E;  1ME4 A;  2FRA A;  1MDW A;  1BP4 A;  4I04 A;  2CIO A;  1K3B B;  1AYW A;  1W6F A;  3ERV A;  3I06 A;  1JQP A;  1W4T A;  2R9F A;  5JH3 A;  3KX1 A;  1AYU A;  1ICF A;  3S3Q A;  5CVM A;  3K9M A;  1GEC E;  1THE A;  2R9N A;  3OF8 A;  2FO5 A;  1KFU L;  4DMY A;  6PAD A;  4PP1 A;  1M6D A;  2DJG B;  2DZZ A;  2JQF R;  5A24 A;  1Y4H A;  2NQI A;  2CB5 A;  1MS6 A;  5EGW A;  3OVZ A;  4N79 A;  4YYW A;  4B55 A;  3HHA A;  3H8C A;  2DZY A;  3H6S A;  3WXG A;  3QT4 A;  2DCC A;  3HHI A;  3CH2 X;  5FPW A;  4QRV A;  2Y5B A;  3CBK A;  1NQC A;  2HHN A;  3HD3 A;  2HH5 A;  5CHT A;  3GCB A;  1PXV A;  1U9V A;  1KHP A;  4CDF B;  2E01 A;  4DMX A;  1PCI A;  3KWZ A;  4X6J A;  3KSE A;  2FTD A;  3KW9 A;  1CPJ A;  2P0R A;  3H8B A;  3V6C A;  1CS8 A;  4K7C A;  1F2C A;  1F2B A;  1CQD A;  1YVB A;  1PE6 A;  2HD5 A;  1O0E A;  1PPP A;  2OP3 A;  3BOW A;  2E02 A;  1GX3 A;  2F7D A;  4XR7 A;  1AIM A;  1DEU A;  3E1Z B;  3MOR A;  1Y08 A;  4YV8 A;  1KFX L;  3S3R A;  4Q8G A;  1MHW A;  4CZW A;  3F5V A;  4MZO A;  4ZUX U;  2YJB A;  5CHV A;  1VSN A;  3USV A;  1CVZ A;  1AYV A;  1EWP A;  1U5I A;  4YYR A;  3LFY A;  4W5B A;  1FH0 A;  2R9O A;  3F75 A;  1AU4 A;  2FQ9 A;  2G8E A;  4I07 A;  3LTW A;  3RVX A;  4G54 A;  3MTN A;  1X9Y A;  2DCB A;  3P5X A;  3IEJ A;  2NQD B;  3BPF A;  1CTE A;  4Q8H A;  1TLO A;  5K16 A;  3BWK A;  3O1G A;  4WA6 A;  4I05 A;  5CVN B;  1F2A A;  2YJ2 A;  4BGF A;  4N4Z A;  3RVW A;  1A6R A;  4RY2 A;  2FUD A;  2ARY A;  1U9X A;  3P5V A;  2BSZ A;  4X6I A;  3WXF A;  8PCH A;  1NB3 A;  2AS8 A;  3DF0 A;  3M99 A;  1QDQ A;  2NQA A;  4NV7 A;  1SP4 B;  3N3K A;  3H7D A;  2IPP B;  4YYV A;  2OZ2 A;  1PIP A;  2XU3 A;  4YYU A;  4QRX A;  2DC6 A;  2E00 A;  2GHU A;  2AYN A;  2Y6E A;  3N3G A;  2ATO A;  4CDE B;  5JA7 A;  2AVW A;  2YJ9 A;  4KLB A;  2VFC A;  3AI8 A;  1CB5 A;  3P5U A;  4BS5 A;  2OUL A;  1CJL A;  1PBH A;  1KXR A;  1ME3 A;  1QOL A;  3U8E A;  4PAD A;  2DC7 A;  1TL9 A;  4MSX A;  3KFQ A;  2B1M A;  2DC8 A;  4FIP A;  1ZCM A;  4QH6 A;  1PPN A;  2B1N A;  3N4C A;  2AUX A;  3I3T A;  3QSD A;  2O6X A;  3IMA A;  3BC3 A;  1PPD A;  2BDZ A;  3IOQ A;  1EWO A;  1EF7 A;  4AXL A;  2AU1 A;  2DC9 A;  1AU2 A;  3RVV A;  4CDC B;  2FT2 A;  3O0U A;  2YJ8 A;  1NB5 A;  2R6N A;  5F02 A;  1YAL A;  1QMY A;  2E03 A;  4NV8 A;  3OIS A;  1BGO A;  3PNR A;  1BQI A;  1MEG A;  2YJC A;  4N8W A;  1NLJ A;  3PW3 A;  2XU5 A;  1AEC A;  2VHS A;  1TU6 A;  2PNS A;  3ZUA A;  2PBH A;  1CV8 A;  1CSB B;  2P7U A;  3IHP A;  3MHS A;  2PAD A;  1BY8 A;  2WBF X;  3D6S A;  3HWN A;  4AXM A;  1ZIV A;  3WXE A;  3LXS A;  4MZS A;  4HWY A;  2F1G A;  1AU0 A;  4GUZ A;  1S4V A;  3PBH A;  1F29 A;  4OEL A;  3KWB X;  5CVO B;  1NPZ A;  2ACT A;  1U9W A;  2XU4 A;  1E2T A;  2HXZ A;  2G8J A;  4P6G A;  2JQG R;  3IUT A;  5EF4 A;  7PCK A;  1QXP A;  3B79 A;  1MIR A;  2VFB A;  3OVX A;  4PI3 A;  1PPO A;  1GLO A;  1YK7 A;  1STF E;  2G6D A;  1MEM A;  1GMY A;  1KHQ A;  1NL6 A;  5J94 A;  4BQV A;  2R9C A;  4FK5 A;  4W5C A;  4BPV A;  4BSQ A;  2XU1 A;  1SNK A;  3K8U A;  4CDD B;  3KKU A;  1IWD A;  2FYE A;  3IV2 A;  4XUI A;  5PAD A;  2GFO A;  4OEM A;  1ATK A;  2AIM A;  2PRE A;  1W5R A;  3CH3 X;  2P86 A;  3NHE A;  1DF0 A;  1U9Q X;  2DCA A;  4P6E A;  2VHF A;  4BS6 A;  2AUZ A;  1POP A;  2DCD A;  3BCN A;  2G7Y A;  1YK8 A;  1GCB A;  3K24 A;  2DJF B;  2C0Y A;  1Q6K A;  2BDL A;  3H89 A;  2AYO A;  2R9M A;  1YT7 A;  3BPM A;  3OF9 A;  9PAP A;  4C5P A;  4YYS A;  4X6H A;  4QBB A;  1ITO A;  4YYQ A;  4YVA A;  4W4U A;  3MHH A;  4QRG A;  1PAD A;  2FRQ A;  3P5W A;  3PDF A;  1HUC B;  3D9W A;  2IBI A;  1XKG A;  1EWL A;  4FJC A;  2H7J A;  3V6E A;  2NQG A;  3C9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...