3PBHA

Refined crystal structure of human procathepsin b at 2.5 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
317
structure length
317
Chain Sequence
MRSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the wild-type human procathepsin B at 2.5 A resolution reveals the native active site of a papain-like cysteine protease zymogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease
molecule keywords PROCATHEPSIN B
total genus 67
structure length 317
sequence length 317
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1997-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pbhA00
2NQAA 3H8BA 2DZZA 2VHFA 4KLBA 1QDQA 2AYOA 2BDZA 2P0RA 2AVWA 2AIMA 3TNXA 4BQVA 4Q8HA 1M6DA 3M99A 2R9FA 3K9MA 5CVMA 6PADA 3H8CA 1TL9A 2DCBA 4CDFB 1IWDA 3HHAA 3PDFA 4XUIA 4PADA 3PW3A 2R6NA 3V6EA 2PADA 3USVA 1FH0A 5F02A 3S3QA 3BC3A 3D6SA 2OZ2A 4P6EA 4DMXA 1CJLA 3K24A 2F1GA 3O1GA 3ERVA 2HXZA 2Y6EA 1F2BA 4BS5A 1PE6A 2DC9A 1KHQA 2P7UA 4QRVA 1U5IA 3S3RA 1CVZA 1QOLA 2DJFB 5CHTA 4PP1A 4FJCA 2FO5A 3MORA 1NB3A 4QRXA 4QRGA 3RVWA 2JQFR 5A24A 3ZUAA 3F5VA 7PCKA 4YYWA 2HH5A 3P5WA 1PPDA 4YYUA 3GCBA 1ITOA 2XU3A 2O6XA 2IBIA 1POPA 1MDWA 2OULA 2P86A 3P5XA 4RY2A 1HUCB 3H6SA 4YVAA 1K3BB 3LXSA 1KFUL 1Y08A 2PBHA 1YVBA 4CDEB 1CS8A 3K8UA 1ME3A 2YJCA 3WXGA 3P5VA 9PAPA 1AIMA 2VHSA 1EWMA 3N4CA 4Q8GA 2AS8A 1KHPA 3PNRA 3B79A 5PADA 4FIPA 4N8WA 2XU5A 1GLOA 1AECA 1CB5A 1ICFA 2XU1A 2IPPB 3MTNA 2NQDB 4N79A 3BPMA 2ARYA 1S4VA 1TLOA 1CSBB 2R9NA 1GMYA 2ACTA 4BSQA 3OISA 1DF0A 2DJGB 1YK7A 3N3KA 4W5CA 1PBHA 1MS6A 3CBJA 1DEUA 1QMYA 2R9OA 1NLJA 3E1ZB 3KX1A 4FK5A 1QXPA 3DF0A 2G6DA 3BCNA 1NQCA 4MZSA 1MIRA 1EF7A 3IOQA 2AUXA 1Q6KA 2FYEA 5CVOB 5EF4A 4X6IA 1U9VA 1BGOA 2JQGR 3F75A 1AU3A 1SNKA 4OELA 3RVVA 3BPFA 2CB5A 3MHSA 2B1NA 4WA6A 4YV8A 2G8EA 5K16A 3CH2X 3P5UA 4MZOA 8PCHA 4CZWA 1NL6A 4MSXA 1EWPA 2CIOA 2FQ9A 2DZYA 4YYRA 1CQDA 3PBHA 2NQIA 3N3GA 4G54A 2FT2A 1AU4A 2OP3A 1PPOA 1STFE 2YJ2A 3KWBX 1Y4HA 1ATKA 2H7JA 1PPNA 2R9MA 2E03A 2G7YA 3NHEA 5CVNB 1AU2A 3IUTA 1YT7A 4YYSA 3QT4A 4ZUXU 3I3TA 2E00A 3OF9A 4K7CA 3IHPA 3HD3A 1A6RA 3CBKA 3OVZA 3U8EA 2FUDA 2G8JA 1XKGA 1EWOA 4X6JA 3IV2A 3QSDA 2FRQA 1EWLA 4AXMA 2XU4A 1THEA 3HHIA 2AU1A 2ATOA 1F2CA 3KFQA 2DCCA 1AYWA 3IEJA 5JH3A 2DC7A 4QBBA 2FRAA 2E01A 3QJ3A 1NB5A 2NQGA 4DMYA 4I07A 1AU0A 1PCIA 3KKUA 2F7DA 1YK8A 1F2AA 4PP2E 4AXLA 3MHHA 5FPWA 3WXEA 2C0YA 1BQIA 2DCAA 3AI8A 1ZCMA 1X9YA 1GCBA 1NPZA 1YALA 3H89A 3HWNA 4BS6A 1MHWA 3KSEA 1PXVA 3RVXA 1ME4A 4N4ZA 4CDDB 3KW9A 1KFXL 2AUZA 2DC8A 3IMAA 1U9XA 1ZIVA 1TU6A 1PIPA 2GHUA 1CV8A 2BDLA 3OVXA 2YJ9A 4OEMA 1SP4B 4W5BA 3WXFA 2YJ8A 5EGWA 2WBFX 2GFOA 1U9WA 1JQPA 3H7DA 3C9EA 2DCDA 2B1MA 3V6CA 4CDCB 1PPPA 2FTDA 1AYUA 1VSNA 3LFYA 4YYQA 5J94A 1O0EA 2HHNA 4QH6A 2AYNA 2R9CA 1BP4A 2E02A 1F29A 3KWZA 1PADA 3CH3X 1U9QX 1MEMA 1AYVA 5JA7A 2HD5A 1GECE 4BPVA 1CPJA 1KXRA 4PI3A 2DC6A 4HWYA 3O0UA 4I04A 5CHVA 2PNSA 2YJBA 3I06A 3BOWA 1VJVA 3BWKA 4W4UA 2Y5BA 4XR7A 1CTEA 4P6GA 3OF8A 2PREA 4X6HA 4YYVA 1MEGA 4I05A 1BY8A
chains in the Genus database with same CATH superfamily
2NQAA 4MI7A 3H8BA 2DZZA 2VHFA 4P16A 4KLBA 1QDQA 2AYOA 2BDZA 2P0RA 2AVWA 2AIMA 3TNXA 4BQVA 4Q8HA 4OVZB 1M6DA 3M99A 2R9FA 3K9MA 4RNAA 5CVMA 3H8CA 6PADA 1TL9A 2DCBA 4CDFB 1IWDA 3HHAA 2AGAA 3PDFA 4XUIA 4PADA 3PW3A 2R6NA 3V6EA 2PADA 3USVA 1FH0A 5F02A 3S3QA 3BC3A 3B21A 3D6SA 2OZ2A 4P6EA 4DMXA 1CJLA 3K24A 2F1GA 3O1GA 3ERVA 2HXZA 2Y6EA 1F2BA 4BS5A 1PE6A 2DC9A 4OVZA 1KHQA 2P7UA 4QRVA 1U5IA 3S3RA 1CVZA 3W31A 1QOLA 2DJFB 5CHTA 4PP1A 4FJCA 2FO5A 3MORA 4D8IA 1NB3A 4QRXA 4MM3B 2JTCA 2J7QC 4QRGA 3RVWA 2JQFR 5A24A 3ZUAA 4RF1A 3F5VA 7PCKA 4YYWA 2HH5A 2UZJA 3MJ5A 3P5WA 1PPDA 4YYUA 3GCBA 1ITOA 2XU3A 2O6XA 2IBIA 1POPA 1MDWA 2OULA 2P86A 3P5XA 4RY2A 1HUCB 3H6SA 4YVAA 1K3BB 3LXSA 3PRPA 1KFUL 1Y08A 2PBHA 1YVBA 4CDEB 1CS8A 3K8UA 3RNVA 1ME3A 2YJCA 3WXGA 2FE8A 3O65A 3P5VA 3BBAA 9PAPA 1AIMA 2VHSA 1EWMA 3N4CA 4BOSA 4Q8GA 2AS8A 1KHPA 3PNRA 3B79A 5PADA 1PVJA 4FIPA 4N8WA 2XU5A 1GLOA 1AECA 1CB5A 1ICFA 2XU1A 2IPPB 3MTNA 4BOZA 3PRMA 2NQDB 4N79A 3BPMA 3ZNHA 2ARYA 1S4VA 1TLOA 1CSBB 2R9NA 1GMYA 5EZQA 2ACTA 4BSQA 3OISA 1DF0A 2DJGB 1YK7A 3N3KA 4W5CA 3W30A 1PBHA 1MS6A 3BB7A 3CBJA 1DEUA 1QMYA 2R9OA 1NLJA 3E1ZB 3KX1A 4FK5A 1QXPA 3DF0A 2G6DA 3BCNA 1NQCA 4MZSA 1MIRA 3C0RA 1EF7A 5E6JA 3MTVA 3IOQA 2AUXA 1Q6KA 4GUAA 2FYEA 5CVOB 5EF4A 4X6IA 1U9VA 4BOQA 3TMPA 1BGOA 2JQGR 3F75A 1AU3A 4OELA 1SNKA 3RVVA 3BPFA 5EZSA 3BY4A 2CB5A 3MHSA 2B1NA 4WA6A 4YV8A 2G8EA 5K16A 2BTWB 3CH2X 3P5UA 4MZOA 2BTWA 8PCHA 4CZWA 4IP3A 1NL6A 4MSXA 1EWPA 2CIOA 2FQ9A 2DZYA 2BU3A 4OW0A 4YYRA 1CQDA 3PBHA 2NQIA 3N3GA 4G54A 2FT2A 4HXDB 1AU4A 2OP3A 1PPOA 1STFE 2YJ2A 4A5UA 3KWBX 1Y4HA 2HWKA 2DOSA 1ATKA 2H7JA 2JRIA 1PPNA 2R9MA 2E03A 2G7YA 3NHEA 5CVNB 1AU2A 3IUTA 1YT7A 4YYSA 3QT4A 4ZUXU 4D8EA 3I3TA 2E00A 3OF9A 4K7CA 3IHPA 3HD3A 1A6RA 3CBKA 3PHWA 3OVZA 3U8EA 2FUDA 2G8JA 1XKGA 1EWOA 3PHUA 4X6JA 3IV2A 3QSDA 2FRQA 4RKXA 1EWLA 4AXMA 2XU4A 4R3DA 1THEA 1YZBA 3HHIA 2AU1A 3PHXA 2ATOA 1F2CA 3KFQA 4RF0A 2DCCA 1AYWA 3IEJA 5JH3A 1UKFA 2DC7A 4QBBA 2FRAA 2E01A 4PT5A 3QJ3A 1NB5A 2NQGA 4DMYA 3PSEA 4I07A 1AU0A 1PCIA 3KKUA 2F7DA 1YK8A 1F2AA 4PP2E 4AXLA 3MHHA 5FPWA 4M0WA 3OQCA 2J7QA 3WXEA 3PT2A 2Z84A 2C0YA 1BQIA 2DCAA 3AI8A 1ZCMA 1X9YA 1GCBA 1NPZA 1DKIA 1YALA 3H89A 3HWNA 4BS6A 1MHWA 3KSEA 4BOPA 1PXVA 3RVXA 1ME4A 4N4ZA 4CDDB 3KW9A 1KFXL 2AUZA 4WURA 2DC8A 3IMAA 1U9XA 1ZIVA 1TU6A 1PIPA 2GHUA 1CV8A 2BDLA 3OVXA 2YJ9A 4OEMA 1SP4B 4W5BA 3WXFA 2YJ8A 5EGWA 2WBFX 2GFOA 1U9WA 5JZEA 1JQPA 3H7DA 3C9EA 2DCDA 2B1MA 3V6CA 4BOUA 4CDCB 1PPPA 2FTDA 1AYUA 1VSNA 3LFYA 4ZTBA 4YYQA 5J94A 1O0EA 3IFUA 2HHNA 4QH6A 2AYNA 2R9CA 1BP4A 2E02A 4XZXA 1F29A 3KWZA 1PADA 3CH3X 1U9QX 1MEMA 3TRKA 1AYVA 5JA7A 2HD5A 5KO3A 1GECE 4BPVA 1CPJA 1KXRA 2DC6A 4HWYA 4PI3A 3O0UA 4I04A 5CHVA 2PNSA 4REZA 2YJBA 3I06A 3BOWA 1VJVA 3BWKA 4D8BA 4W4UA 3MP2A 2Y5BA 4XR7A 1CTEA 4P6GA 3OF8A 4IUMA 2PREA 4X6HA 4YYVA 3E9SA 1MEGA 4I05A 1BY8A
chains in the Genus database with same CATH topology
2NQAA 3H8BA 2DZZA 2VHFA 4KLBA 1QDQA 2AYOA 2BDZA 2P0RA 2AVWA 2AIMA 3TNXA 4BQVA 4Q8HA 1M6DA 3M99A 2R9FA 3K9MA 5CVMA 6PADA 3H8CA 1TL9A 2DCBA 4CDFB 1IWDA 3HHAA 3PDFA 4XUIA 4PADA 3PW3A 2R6NA 3V6EA 2PADA 3USVA 1FH0A 2VFCA 5F02A 3S3QA 3BC3A 3D6SA 2OZ2A 4P6EA 4DMXA 1CJLA 3K24A 2F1GA 3O1GA 3ERVA 2HXZA 2Y6EA 1F2BA 4BS5A 1PE6A 2DC9A 1KHQA 2P7UA 4QRVA 1U5IA 3S3RA 1CVZA 1QOLA 5CHTA 2DJFB 4PP1A 4FJCA 2FO5A 3MORA 1NB3A 4QRXA 4NV8A 4QRGA 3RVWA 2JQFR 5A24A 3ZUAA 3F5VA 7PCKA 4YYWA 4B55A 2HH5A 1GX3A 3P5WA 1PPDA 4YYUA 3GCBA 1ITOA 2XU3A 2O6XA 2IBIA 1POPA 1MDWA 2OULA 2P86A 3P5XA 4RY2A 1HUCB 3H6SA 4YVAA 1K3BB 3LXSA 1KFUL 1Y08A 2PBHA 1YVBA 4CDEB 1CS8A 3K8UA 1ME3A 2YJCA 3WXGA 3P5VA 9PAPA 1AIMA 2VHSA 1EWMA 3N4CA 4Q8GA 2AS8A 1KHPA 3PNRA 3B79A 5PADA 4FIPA 4N8WA 2XU5A 1GLOA 1AECA 1CB5A 1ICFA 2XU1A 2IPPB 3MTNA 2NQDB 4N79A 3BPMA 2ARYA 1S4VA 1TLOA 1CSBB 2R9NA 1GMYA 2BSZA 2ACTA 4BSQA 3OISA 1DF0A 2DJGB 1YK7A 3N3KA 4W5CA 1E2TA 1PBHA 1MS6A 3CBJA 1DEUA 1QMYA 3D9WA 2R9OA 1NLJA 3E1ZB 3KX1A 4FK5A 1QXPA 3DF0A 2G6DA 3BCNA 1NQCA 4MZSA 1MIRA 1EF7A 3IOQA 2AUXA 1Q6KA 2FYEA 5CVOB 5EF4A 4X6IA 1U9VA 1BGOA 2JQGR 3F75A 1AU3A 1SNKA 4OELA 3RVVA 3BPFA 2CB5A 3MHSA 2B1NA 3LTWA 4WA6A 4YV8A 2G8EA 5K16A 3CH2X 3P5UA 4MZOA 8PCHA 4CZWA 4GUZA 1NL6A 4MSXA 1EWPA 2CIOA 2FQ9A 2DZYA 4YYRA 1CQDA 3PBHA 2NQIA 3N3GA 4G54A 2FT2A 1AU4A 2OP3A 1PPOA 1STFE 2YJ2A 3KWBX 1Y4HA 1ATKA 2VFBA 2H7JA 1PPNA 2R9MA 2E03A 2G7YA 3NHEA 5CVNB 1W6FA 1AU2A 3IUTA 1YT7A 4YYSA 3QT4A 4ZUXU 3I3TA 2E00A 3OF9A 4K7CA 3IHPA 3HD3A 1A6RA 3CBKA 3OVZA 3U8EA 2FUDA 2G8JA 1XKGA 1EWOA 4X6JA 3IV2A 3QSDA 2FRQA 1EWLA 4AXMA 2XU4A 1THEA 3HHIA 4BGFA 2AU1A 2ATOA 1F2CA 3KFQA 2DCCA 1AYWA 3IEJA 5JH3A 2DC7A 4QBBA 2FRAA 2E01A 3QJ3A 1NB5A 2NQGA 4DMYA 4I07A 1AU0A 1PCIA 3KKUA 2F7DA 1YK8A 1F2AA 4PP2E 4AXLA 3MHHA 5FPWA 3WXEA 2C0YA 1BQIA 2DCAA 3AI8A 1ZCMA 1X9YA 1GCBA 1NPZA 1YALA 3H89A 3HWNA 4BS6A 1MHWA 3KSEA 1PXVA 3RVXA 1ME4A 4N4ZA 4CDDB 3KW9A 1KFXL 2AUZA 2DC8A 3IMAA 1U9XA 1ZIVA 1TU6A 1PIPA 2GHUA 1CV8A 2BDLA 3OVXA 2YJ9A 1W4TA 4OEMA 1SP4B 4W5BA 3WXFA 2YJ8A 5EGWA 2WBFX 2GFOA 1U9WA 1JQPA 3H7DA 3C9EA 2DCDA 2B1MA 3V6CA 4CDCB 1PPPA 2FTDA 1AYUA 1VSNA 3LFYA 4YYQA 5J94A 1O0EA 2HHNA 4QH6A 2AYNA 2R9CA 1BP4A 2E02A 1F29A 3KWZA 1PADA 3CH3X 1U9QX 1MEMA 1AYVA 5JA7A 2HD5A 4NV7A 1GECE 4BPVA 1CPJA 1KXRA 4PI3A 2DC6A 4HWYA 3O0UA 4I04A 5CHVA 2PNSA 2YJBA 3I06A 3BOWA 1VJVA 3BWKA 4W4UA 2Y5BA 4XR7A 1CTEA 4P6GA 3OF8A 2PREA 4X6HA 4YYVA 4C5PA 1W5RA 1MEGA 4I05A 1BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQA A;  3H8B A;  2DZZ A;  2VHF A;  4KLB A;  1QDQ A;  2AYO A;  2BDZ A;  2P0R A;  2AVW A;  2AIM A;  3TNX A;  4BQV A;  4Q8H A;  1M6D A;  3M99 A;  2R9F A;  3K9M A;  5CVM A;  6PAD A;  3H8C A;  1TL9 A;  2DCB A;  4CDF B;  1IWD A;  3HHA A;  3PDF A;  4XUI A;  4PAD A;  3PW3 A;  2R6N A;  3V6E A;  2PAD A;  3USV A;  1FH0 A;  5F02 A;  3S3Q A;  3BC3 A;  3D6S A;  2OZ2 A;  4P6E A;  4DMX A;  1CJL A;  3K24 A;  2F1G A;  3O1G A;  3ERV A;  2HXZ A;  2Y6E A;  1F2B A;  4BS5 A;  1PE6 A;  2DC9 A;  1KHQ A;  2P7U A;  4QRV A;  1U5I A;  3S3R A;  1CVZ A;  1QOL A;  2DJF B;  5CHT A;  4PP1 A;  4FJC A;  2FO5 A;  3MOR A;  1NB3 A;  4QRX A;  4QRG A;  3RVW A;  2JQF R;  5A24 A;  3ZUA A;  3F5V A;  7PCK A;  4YYW A;  2HH5 A;  3P5W A;  1PPD A;  4YYU A;  3GCB A;  1ITO A;  2XU3 A;  2O6X A;  2IBI A;  1POP A;  1MDW A;  2OUL A;  2P86 A;  3P5X A;  4RY2 A;  1HUC B;  3H6S A;  4YVA A;  1K3B B;  3LXS A;  1KFU L;  1Y08 A;  2PBH A;  1YVB A;  4CDE B;  1CS8 A;  3K8U A;  1ME3 A;  2YJC A;  3WXG A;  3P5V A;  9PAP A;  1AIM A;  2VHS A;  1EWM A;  3N4C A;  4Q8G A;  2AS8 A;  1KHP A;  3PNR A;  3B79 A;  5PAD A;  4FIP A;  4N8W A;  2XU5 A;  1GLO A;  1AEC A;  1CB5 A;  1ICF A;  2XU1 A;  2IPP B;  3MTN A;  2NQD B;  4N79 A;  3BPM A;  2ARY A;  1S4V A;  1TLO A;  1CSB B;  2R9N A;  1GMY A;  2ACT A;  4BSQ A;  3OIS A;  1DF0 A;  2DJG B;  1YK7 A;  3N3K A;  4W5C A;  1PBH A;  1MS6 A;  3CBJ A;  1DEU A;  1QMY A;  2R9O A;  1NLJ A;  3E1Z B;  3KX1 A;  4FK5 A;  1QXP A;  3DF0 A;  2G6D A;  3BCN A;  1NQC A;  4MZS A;  1MIR A;  1EF7 A;  3IOQ A;  2AUX A;  1Q6K A;  2FYE A;  5CVO B;  5EF4 A;  4X6I A;  1U9V A;  1BGO A;  2JQG R;  3F75 A;  1AU3 A;  1SNK A;  4OEL A;  3RVV A;  3BPF A;  2CB5 A;  3MHS A;  2B1N A;  4WA6 A;  4YV8 A;  2G8E A;  5K16 A;  3CH2 X;  3P5U A;  4MZO A;  8PCH A;  4CZW A;  1NL6 A;  4MSX A;  1EWP A;  2CIO A;  2FQ9 A;  2DZY A;  4YYR A;  1CQD A;  3PBH A;  2NQI A;  3N3G A;  4G54 A;  2FT2 A;  1AU4 A;  2OP3 A;  1PPO A;  1STF E;  2YJ2 A;  3KWB X;  1Y4H A;  1ATK A;  2H7J A;  1PPN A;  2R9M A;  2E03 A;  2G7Y A;  3NHE A;  5CVN B;  1AU2 A;  3IUT A;  1YT7 A;  4YYS A;  3QT4 A;  4ZUX U;  3I3T A;  2E00 A;  3OF9 A;  4K7C A;  3IHP A;  3HD3 A;  1A6R A;  3CBK A;  3OVZ A;  3U8E A;  2FUD A;  2G8J A;  1XKG A;  1EWO A;  4X6J A;  3IV2 A;  3QSD A;  2FRQ A;  1EWL A;  4AXM A;  2XU4 A;  1THE A;  3HHI A;  2AU1 A;  2ATO A;  1F2C A;  3KFQ A;  2DCC A;  1AYW A;  3IEJ A;  5JH3 A;  2DC7 A;  4QBB A;  2FRA A;  2E01 A;  3QJ3 A;  1NB5 A;  2NQG A;  4DMY A;  4I07 A;  1AU0 A;  1PCI A;  3KKU A;  2F7D A;  1YK8 A;  1F2A A;  4PP2 E;  4AXL A;  3MHH A;  5FPW A;  3WXE A;  2C0Y A;  1BQI A;  2DCA A;  3AI8 A;  1ZCM A;  1X9Y A;  1GCB A;  1NPZ A;  1YAL A;  3H89 A;  3HWN A;  4BS6 A;  1MHW A;  3KSE A;  1PXV A;  3RVX A;  1ME4 A;  4N4Z A;  4CDD B;  3KW9 A;  1KFX L;  2AUZ A;  2DC8 A;  3IMA A;  1U9X A;  1ZIV A;  1TU6 A;  1PIP A;  2GHU A;  1CV8 A;  2BDL A;  3OVX A;  2YJ9 A;  4OEM A;  1SP4 B;  4W5B A;  3WXF A;  2YJ8 A;  5EGW A;  2WBF X;  2GFO A;  1U9W A;  1JQP A;  3H7D A;  3C9E A;  2DCD A;  2B1M A;  3V6C A;  4CDC B;  1PPP A;  2FTD A;  1AYU A;  1VSN A;  3LFY A;  4YYQ A;  5J94 A;  1O0E A;  2HHN A;  4QH6 A;  2AYN A;  2R9C A;  1BP4 A;  2E02 A;  1F29 A;  3KWZ A;  1PAD A;  3CH3 X;  1U9Q X;  1MEM A;  1AYV A;  5JA7 A;  2HD5 A;  1GEC E;  4BPV A;  1CPJ A;  1KXR A;  4PI3 A;  2DC6 A;  4HWY A;  3O0U A;  4I04 A;  5CHV A;  2PNS A;  2YJB A;  3I06 A;  3BOW A;  1VJV A;  3BWK A;  4W4U A;  2Y5B A;  4XR7 A;  1CTE A;  4P6G A;  3OF8 A;  2PRE A;  4X6H A;  4YYV A;  1MEG A;  4I05 A;  1BY8 A; 
#chains in the Genus database with same CATH topology
 2NQA A;  4MI7 A;  3H8B A;  2DZZ A;  2VHF A;  4P16 A;  4KLB A;  1QDQ A;  2AYO A;  2BDZ A;  2P0R A;  2AVW A;  2AIM A;  3TNX A;  4BQV A;  4Q8H A;  4OVZ B;  1M6D A;  3M99 A;  2R9F A;  3K9M A;  4RNA A;  5CVM A;  3H8C A;  6PAD A;  1TL9 A;  2DCB A;  4CDF B;  1IWD A;  3HHA A;  2AGA A;  3PDF A;  4XUI A;  4PAD A;  3PW3 A;  2R6N A;  3V6E A;  2PAD A;  3USV A;  1FH0 A;  5F02 A;  3S3Q A;  3BC3 A;  3B21 A;  3D6S A;  2OZ2 A;  4P6E A;  4DMX A;  1CJL A;  3K24 A;  2F1G A;  3O1G A;  3ERV A;  2HXZ A;  2Y6E A;  1F2B A;  4BS5 A;  1PE6 A;  2DC9 A;  4OVZ A;  1KHQ A;  2P7U A;  4QRV A;  1U5I A;  3S3R A;  1CVZ A;  3W31 A;  1QOL A;  2DJF B;  5CHT A;  4PP1 A;  4FJC A;  2FO5 A;  3MOR A;  4D8I A;  1NB3 A;  4QRX A;  4MM3 B;  2JTC A;  2J7Q C;  4QRG A;  3RVW A;  2JQF R;  5A24 A;  3ZUA A;  4RF1 A;  3F5V A;  7PCK A;  4YYW A;  2HH5 A;  2UZJ A;  3MJ5 A;  3P5W A;  1PPD A;  4YYU A;  3GCB A;  1ITO A;  2XU3 A;  2O6X A;  2IBI A;  1POP A;  1MDW A;  2OUL A;  2P86 A;  3P5X A;  4RY2 A;  1HUC B;  3H6S A;  4YVA A;  1K3B B;  3LXS A;  3PRP A;  1KFU L;  1Y08 A;  2PBH A;  1YVB A;  4CDE B;  1CS8 A;  3K8U A;  3RNV A;  1ME3 A;  2YJC A;  3WXG A;  2FE8 A;  3O65 A;  3P5V A;  3BBA A;  9PAP A;  1AIM A;  2VHS A;  1EWM A;  3N4C A;  4BOS A;  4Q8G A;  2AS8 A;  1KHP A;  3PNR A;  3B79 A;  5PAD A;  1PVJ A;  4FIP A;  4N8W A;  2XU5 A;  1GLO A;  1AEC A;  1CB5 A;  1ICF A;  2XU1 A;  2IPP B;  3MTN A;  4BOZ A;  3PRM A;  2NQD B;  4N79 A;  3BPM A;  3ZNH A;  2ARY A;  1S4V A;  1TLO A;  1CSB B;  2R9N A;  1GMY A;  5EZQ A;  2ACT A;  4BSQ A;  3OIS A;  1DF0 A;  2DJG B;  1YK7 A;  3N3K A;  4W5C A;  3W30 A;  1PBH A;  1MS6 A;  3BB7 A;  3CBJ A;  1DEU A;  1QMY A;  2R9O A;  1NLJ A;  3E1Z B;  3KX1 A;  4FK5 A;  1QXP A;  3DF0 A;  2G6D A;  3BCN A;  1NQC A;  4MZS A;  1MIR A;  3C0R A;  1EF7 A;  5E6J A;  3MTV A;  3IOQ A;  2AUX A;  1Q6K A;  4GUA A;  2FYE A;  5CVO B;  5EF4 A;  4X6I A;  1U9V A;  4BOQ A;  3TMP A;  1BGO A;  2JQG R;  3F75 A;  1AU3 A;  4OEL A;  1SNK A;  3RVV A;  3BPF A;  5EZS A;  3BY4 A;  2CB5 A;  3MHS A;  2B1N A;  4WA6 A;  4YV8 A;  2G8E A;  5K16 A;  2BTW B;  3CH2 X;  3P5U A;  4MZO A;  2BTW A;  8PCH A;  4CZW A;  4IP3 A;  1NL6 A;  4MSX A;  1EWP A;  2CIO A;  2FQ9 A;  2DZY A;  2BU3 A;  4OW0 A;  4YYR A;  1CQD A;  3PBH A;  2NQI A;  3N3G A;  4G54 A;  2FT2 A;  4HXD B;  1AU4 A;  2OP3 A;  1PPO A;  1STF E;  2YJ2 A;  4A5U A;  3KWB X;  1Y4H A;  2HWK A;  2DOS A;  1ATK A;  2H7J A;  2JRI A;  1PPN A;  2R9M A;  2E03 A;  2G7Y A;  3NHE A;  5CVN B;  1AU2 A;  3IUT A;  1YT7 A;  4YYS A;  3QT4 A;  4ZUX U;  4D8E A;  3I3T A;  2E00 A;  3OF9 A;  4K7C A;  3IHP A;  3HD3 A;  1A6R A;  3CBK A;  3PHW A;  3OVZ A;  3U8E A;  2FUD A;  2G8J A;  1XKG A;  1EWO A;  3PHU A;  4X6J A;  3IV2 A;  3QSD A;  2FRQ A;  4RKX A;  1EWL A;  4AXM A;  2XU4 A;  4R3D A;  1THE A;  1YZB A;  3HHI A;  2AU1 A;  3PHX A;  2ATO A;  1F2C A;  3KFQ A;  4RF0 A;  2DCC A;  1AYW A;  3IEJ A;  5JH3 A;  1UKF A;  2DC7 A;  4QBB A;  2FRA A;  2E01 A;  4PT5 A;  3QJ3 A;  1NB5 A;  2NQG A;  4DMY A;  3PSE A;  4I07 A;  1AU0 A;  1PCI A;  3KKU A;  2F7D A;  1YK8 A;  1F2A A;  4PP2 E;  4AXL A;  3MHH A;  5FPW A;  4M0W A;  3OQC A;  2J7Q A;  3WXE A;  3PT2 A;  2Z84 A;  2C0Y A;  1BQI A;  2DCA A;  3AI8 A;  1ZCM A;  1X9Y A;  1GCB A;  1NPZ A;  1DKI A;  1YAL A;  3H89 A;  3HWN A;  4BS6 A;  1MHW A;  3KSE A;  4BOP A;  1PXV A;  3RVX A;  1ME4 A;  4N4Z A;  4CDD B;  3KW9 A;  1KFX L;  2AUZ A;  4WUR A;  2DC8 A;  3IMA A;  1U9X A;  1ZIV A;  1TU6 A;  1PIP A;  2GHU A;  1CV8 A;  2BDL A;  3OVX A;  2YJ9 A;  4OEM A;  1SP4 B;  4W5B A;  3WXF A;  2YJ8 A;  5EGW A;  2WBF X;  2GFO A;  1U9W A;  5JZE A;  1JQP A;  3H7D A;  3C9E A;  2DCD A;  2B1M A;  3V6C A;  4BOU A;  4CDC B;  1PPP A;  2FTD A;  1AYU A;  1VSN A;  3LFY A;  4ZTB A;  4YYQ A;  5J94 A;  1O0E A;  3IFU A;  2HHN A;  4QH6 A;  2AYN A;  2R9C A;  1BP4 A;  2E02 A;  4XZX A;  1F29 A;  3KWZ A;  1PAD A;  3CH3 X;  1U9Q X;  1MEM A;  3TRK A;  1AYV A;  5JA7 A;  2HD5 A;  5KO3 A;  1GEC E;  4BPV A;  1CPJ A;  1KXR A;  2DC6 A;  4HWY A;  4PI3 A;  3O0U A;  4I04 A;  5CHV A;  2PNS A;  4REZ A;  2YJB A;  3I06 A;  3BOW A;  1VJV A;  3BWK A;  4D8B A;  4W4U A;  3MP2 A;  2Y5B A;  4XR7 A;  1CTE A;  4P6G A;  3OF8 A;  4IUM A;  2PRE A;  4X6H A;  4YYV A;  3E9S A;  1MEG A;  4I05 A;  1BY8 A; 
#chains in the Genus database with same CATH homology
 2NQA A;  3H8B A;  2DZZ A;  2VHF A;  4KLB A;  1QDQ A;  2AYO A;  2BDZ A;  2P0R A;  2AVW A;  2AIM A;  3TNX A;  4BQV A;  4Q8H A;  1M6D A;  3M99 A;  2R9F A;  3K9M A;  5CVM A;  6PAD A;  3H8C A;  1TL9 A;  2DCB A;  4CDF B;  1IWD A;  3HHA A;  3PDF A;  4XUI A;  4PAD A;  3PW3 A;  2R6N A;  3V6E A;  2PAD A;  3USV A;  1FH0 A;  2VFC A;  5F02 A;  3S3Q A;  3BC3 A;  3D6S A;  2OZ2 A;  4P6E A;  4DMX A;  1CJL A;  3K24 A;  2F1G A;  3O1G A;  3ERV A;  2HXZ A;  2Y6E A;  1F2B A;  4BS5 A;  1PE6 A;  2DC9 A;  1KHQ A;  2P7U A;  4QRV A;  1U5I A;  3S3R A;  1CVZ A;  1QOL A;  5CHT A;  2DJF B;  4PP1 A;  4FJC A;  2FO5 A;  3MOR A;  1NB3 A;  4QRX A;  4NV8 A;  4QRG A;  3RVW A;  2JQF R;  5A24 A;  3ZUA A;  3F5V A;  7PCK A;  4YYW A;  4B55 A;  2HH5 A;  1GX3 A;  3P5W A;  1PPD A;  4YYU A;  3GCB A;  1ITO A;  2XU3 A;  2O6X A;  2IBI A;  1POP A;  1MDW A;  2OUL A;  2P86 A;  3P5X A;  4RY2 A;  1HUC B;  3H6S A;  4YVA A;  1K3B B;  3LXS A;  1KFU L;  1Y08 A;  2PBH A;  1YVB A;  4CDE B;  1CS8 A;  3K8U A;  1ME3 A;  2YJC A;  3WXG A;  3P5V A;  9PAP A;  1AIM A;  2VHS A;  1EWM A;  3N4C A;  4Q8G A;  2AS8 A;  1KHP A;  3PNR A;  3B79 A;  5PAD A;  4FIP A;  4N8W A;  2XU5 A;  1GLO A;  1AEC A;  1CB5 A;  1ICF A;  2XU1 A;  2IPP B;  3MTN A;  2NQD B;  4N79 A;  3BPM A;  2ARY A;  1S4V A;  1TLO A;  1CSB B;  2R9N A;  1GMY A;  2BSZ A;  2ACT A;  4BSQ A;  3OIS A;  1DF0 A;  2DJG B;  1YK7 A;  3N3K A;  4W5C A;  1E2T A;  1PBH A;  1MS6 A;  3CBJ A;  1DEU A;  1QMY A;  3D9W A;  2R9O A;  1NLJ A;  3E1Z B;  3KX1 A;  4FK5 A;  1QXP A;  3DF0 A;  2G6D A;  3BCN A;  1NQC A;  4MZS A;  1MIR A;  1EF7 A;  3IOQ A;  2AUX A;  1Q6K A;  2FYE A;  5CVO B;  5EF4 A;  4X6I A;  1U9V A;  1BGO A;  2JQG R;  3F75 A;  1AU3 A;  1SNK A;  4OEL A;  3RVV A;  3BPF A;  2CB5 A;  3MHS A;  2B1N A;  3LTW A;  4WA6 A;  4YV8 A;  2G8E A;  5K16 A;  3CH2 X;  3P5U A;  4MZO A;  8PCH A;  4CZW A;  4GUZ A;  1NL6 A;  4MSX A;  1EWP A;  2CIO A;  2FQ9 A;  2DZY A;  4YYR A;  1CQD A;  3PBH A;  2NQI A;  3N3G A;  4G54 A;  2FT2 A;  1AU4 A;  2OP3 A;  1PPO A;  1STF E;  2YJ2 A;  3KWB X;  1Y4H A;  1ATK A;  2VFB A;  2H7J A;  1PPN A;  2R9M A;  2E03 A;  2G7Y A;  3NHE A;  5CVN B;  1W6F A;  1AU2 A;  3IUT A;  1YT7 A;  4YYS A;  3QT4 A;  4ZUX U;  3I3T A;  2E00 A;  3OF9 A;  4K7C A;  3IHP A;  3HD3 A;  1A6R A;  3CBK A;  3OVZ A;  3U8E A;  2FUD A;  2G8J A;  1XKG A;  1EWO A;  4X6J A;  3IV2 A;  3QSD A;  2FRQ A;  1EWL A;  4AXM A;  2XU4 A;  1THE A;  3HHI A;  4BGF A;  2AU1 A;  2ATO A;  1F2C A;  3KFQ A;  2DCC A;  1AYW A;  3IEJ A;  5JH3 A;  2DC7 A;  4QBB A;  2FRA A;  2E01 A;  3QJ3 A;  1NB5 A;  2NQG A;  4DMY A;  4I07 A;  1AU0 A;  1PCI A;  3KKU A;  2F7D A;  1YK8 A;  1F2A A;  4PP2 E;  4AXL A;  3MHH A;  5FPW A;  3WXE A;  2C0Y A;  1BQI A;  2DCA A;  3AI8 A;  1ZCM A;  1X9Y A;  1GCB A;  1NPZ A;  1YAL A;  3H89 A;  3HWN A;  4BS6 A;  1MHW A;  3KSE A;  1PXV A;  3RVX A;  1ME4 A;  4N4Z A;  4CDD B;  3KW9 A;  1KFX L;  2AUZ A;  2DC8 A;  3IMA A;  1U9X A;  1ZIV A;  1TU6 A;  1PIP A;  2GHU A;  1CV8 A;  2BDL A;  3OVX A;  2YJ9 A;  1W4T A;  4OEM A;  1SP4 B;  4W5B A;  3WXF A;  2YJ8 A;  5EGW A;  2WBF X;  2GFO A;  1U9W A;  1JQP A;  3H7D A;  3C9E A;  2DCD A;  2B1M A;  3V6C A;  4CDC B;  1PPP A;  2FTD A;  1AYU A;  1VSN A;  3LFY A;  4YYQ A;  5J94 A;  1O0E A;  2HHN A;  4QH6 A;  2AYN A;  2R9C A;  1BP4 A;  2E02 A;  1F29 A;  3KWZ A;  1PAD A;  3CH3 X;  1U9Q X;  1MEM A;  1AYV A;  5JA7 A;  2HD5 A;  4NV7 A;  1GEC E;  4BPV A;  1CPJ A;  1KXR A;  4PI3 A;  2DC6 A;  4HWY A;  3O0U A;  4I04 A;  5CHV A;  2PNS A;  2YJB A;  3I06 A;  3BOW A;  1VJV A;  3BWK A;  4W4U A;  2Y5B A;  4XR7 A;  1CTE A;  4P6G A;  3OF8 A;  2PRE A;  4X6H A;  4YYV A;  4C5P A;  1W5R A;  1MEG A;  4I05 A;  1BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...