3PBHA

Refined crystal structure of human procathepsin b at 2.5 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
317
structure length
317
Chain Sequence
MRSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the wild-type human procathepsin B at 2.5 A resolution reveals the native active site of a papain-like cysteine protease zymogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Thiol protease
molecule keywords PROCATHEPSIN B
total genus 67
structure length 317
sequence length 317
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1997-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pbhA00
1JQPA 4FJCA 1QMYA 1EWOA 3E1ZB 1AU4A 1PE6A 3IV2A 3H6SA 1QDQA 4BPVA 1MS6A 4N8WA 1BGOA 2E02A 4KLBA 4ZUXU 3OVXA 3I06A 4BS6A 1U9VA 1PPPA 4MSXA 1U9WA 3HWNA 1STFE 2PREA 3LFYA 2F1GA 2DZYA 1CTEA 4MZSA 2JQFR 2OP3A 1S4VA 2C0YA 3BC3A 3MORA 1X9YA 3KW9A 1NL6A 2Y5BA 1KHQA 2DCBA 4CDEB 3RVWA 2Y6EA 3CH2X 1PPNA 1SNKA 4YYVA 2ATOA 1NB5A 2AU1A 2PBHA 1Y4HA 4YV8A 2AIMA 3PNRA 1PPDA 4BSQA 1ZCMA 3AI8A 2ARYA 2BDZA 1PXVA 3H7DA 4BQVA 3IMAA 1AU0A 2CB5A 1ME3A 1ME4A 1AECA 1F29A 5PADA 2R9FA 2NQGA 3QT4A 2NQAA 2AYOA 3NHEA 3WXFA 1AU3A 3PW3A 2R9OA 1NQCA 2E00A 5EF4A 1HUCB 3K8UA 2YJCA 4AXLA 5J94A 1BY8A 2YJ9A 1ATKA 3RVXA 1YVBA 1PBHA 1ZIVA 4I07A 2DC7A 3OF8A 2HXZA 2FO5A 2OZ2A 3BOWA 3WXEA 3USVA 1CSBB 5CHTA 2DCDA 1MIRA 4N79A 3H8CA 2FYEA 3WXGA 4N4ZA 3V6EA 4RY2A 3H8BA 2DC6A 1EWMA 3P5VA 1POPA 2DC9A 2FTDA 3N3KA 2R9CA 2P86A 3PBHA 1TLOA 2R9MA 2AUXA 1K3BB 4OEMA 4XUIA 5K16A 4AXMA 1GMYA 2FRQA 2HHNA 3ERVA 1CQDA 1U5IA 3O0UA 2DJGB 1EF7A 2G7YA 5JH3A 2O6XA 4YVAA 4CDFB 2B1MA 2H7JA 1AIMA 2G8JA 2XU5A 2DCAA 2XU3A 3IUTA 2F7DA 1MHWA 1CV8A 1YK7A 1EWLA 2AVWA 3C9EA 4Q8HA 3HHIA 4MZOA 3OF9A 1PIPA 3O1GA 2G8EA 4QRVA 3P5UA 2R6NA 1NB3A 4W5BA 3ZUAA 1KXRA 4FIPA 1ICFA 1BP4A 1GCBA 4W5CA 1PPOA 2DJFB 3HHAA 1KFUL 1YK8A 3CBJA 1F2CA 1A6RA 1KFXL 4QBBA 3N4CA 2YJBA 1EWPA 5CVNB 2IPPB 2YJ8A 5CVOB 4PADA 1U9XA 5F02A 5EGWA 3MTNA 4DMYA 2BDLA 4CDDB 4X6IA 1SP4B 3TNXA 3B79A 4P6GA 1DF0A 1Y08A 2PADA 3HD3A 3OISA 3KSEA 3F75A 3KX1A 2E01A 4YYWA 3KFQA 2ACTA 2AYNA 3N3GA 2R9NA 4OELA 1QOLA 3U8EA 1Q6KA 3MHHA 1VSNA 1VJVA 2AS8A 2AUZA 3I3TA 3CBKA 3KKUA 2B1NA 2DCCA 4FK5A 3V6CA 2FRAA 3CH3X 1CVZA 1ITOA 1MDWA 3IOQA 8PCHA 2FUDA 2E03A 1AYUA 1QXPA 1M6DA 3BWKA 2FQ9A 5CHVA 1CPJA 2GFOA 4P6EA 1CS8A 4XR7A 3H89A 3S3QA 1XKGA 2DZZA 4CDCB 3BPMA 2XU1A 5FPWA 2CIOA 2FT2A 9PAPA 2HH5A 1MEGA 1THEA 3RVVA 3D6SA 3K24A 3LXSA 1NLJA 5JA7A 3IEJA 2VHSA 3P5WA 1FH0A 2OULA 1AU2A 1TU6A 1YALA 4HWYA 4Q8GA 4W4UA 4X6HA 1O0EA 3KWBX 3QSDA 4I04A 1TL9A 2XU4A 2P7UA 4QRXA 1GECE 3QJ3A 1PADA 4YYUA 3S3RA 2DC8A 4YYRA 3BPFA 1U9QX 4X6JA 3OVZA 4G54A 2JQGR 1AYVA 3BCNA 2PNSA 4DMXA 1BQIA 3PDFA 6PADA 4YYQA 2P0RA 1F2AA 1F2BA 3DF0A 4CZWA 1CB5A 3GCBA 3KWZA 1CJLA 4PP1A 2IBIA 2HD5A 4PP2E 4QRGA 7PCKA 2YJ2A 2G6DA 2NQIA 2WBFX 5CVMA 1YT7A 3M99A 2VHFA 4YYSA 1GLOA 4BS5A 1PCIA 1IWDA 2NQDB 4WA6A 1AYWA 4QH6A 3P5XA 4K7CA 3MHSA 3IHPA 5A24A 4I05A 1NPZA 3F5VA 1KHPA 1DEUA 2GHUA 1MEMA 3K9MA 4PI3A
chains in the Genus database with same CATH superfamily
1JQPA 4D8EA 4FJCA 1QMYA 1EWOA 3E1ZB 1AU4A 1PE6A 3IV2A 3H6SA 1QDQA 4BPVA 1MS6A 4N8WA 1BGOA 2JTCA 2E02A 4KLBA 4ZUXU 3OVXA 3PRMA 3I06A 4BS6A 1U9VA 1PPPA 4MI7A 4MSXA 1U9WA 3HWNA 1STFE 3MJ5A 3PHXA 2PREA 3LFYA 2F1GA 2DZYA 4GUAA 1CTEA 3PRPA 4RF1A 4MZSA 2JQFR 3E9SA 2OP3A 1S4VA 2C0YA 3BC3A 3MORA 3IFUA 1X9YA 3KW9A 1NL6A 2Y5BA 1KHQA 2DCBA 4CDEB 3RVWA 2Y6EA 3CH2X 1PPNA 1SNKA 4YYVA 2ATOA 1NB5A 2AU1A 2PBHA 1Y4HA 4YV8A 2AIMA 3PNRA 1PPDA 4BSQA 1ZCMA 3AI8A 2ARYA 2BDZA 1PXVA 3H7DA 4BQVA 3IMAA 1AU0A 2CB5A 1ME3A 1ME4A 1AECA 1F29A 5PADA 2R9FA 2NQGA 3QT4A 2NQAA 2AYOA 3NHEA 3WXFA 1AU3A 3PW3A 2R9OA 3OQCA 3PSEA 1NQCA 2E00A 5EF4A 1HUCB 3K8UA 2YJCA 3W30A 5J94A 4AXLA 2FE8A 1BY8A 2YJ9A 1ATKA 3RVXA 1YVBA 4MM3B 1PBHA 1ZIVA 4I07A 2DC7A 3OF8A 2HXZA 2FO5A 2OZ2A 3BOWA 3WXEA 3USVA 1CSBB 5CHTA 2DCDA 1MIRA 4N79A 4OVZA 3H8CA 2FYEA 3WXGA 4N4ZA 3V6EA 4RY2A 3H8BA 2DC6A 1EWMA 3P5VA 1POPA 2DC9A 2FTDA 2AGAA 3BY4A 3N3KA 2R9CA 2P86A 1UKFA 3PBHA 4XZXA 1TLOA 2R9MA 2AUXA 1K3BB 4OEMA 4XUIA 5K16A 4AXMA 4BOZA 1GMYA 2FRQA 2HHNA 3W31A 3ERVA 2JRIA 1CQDA 1U5IA 3O0UA 2DJGB 1EF7A 2G7YA 5JH3A 3PHUA 2O6XA 4RNAA 4YVAA 4CDFB 5JZEA 2BTWB 2B1MA 2H7JA 1AIMA 2G8JA 2XU5A 2DCAA 2XU3A 3IUTA 2F7DA 1MHWA 3B21A 1CV8A 1YK7A 1EWLA 2AVWA 3C9EA 4Q8HA 3HHIA 4MZOA 3OF9A 1PIPA 3O1GA 2G8EA 4QRVA 4BOQA 3P5UA 2R6NA 1NB3A 3PT2A 4W5BA 3ZUAA 3TRKA 1KXRA 4FIPA 1ICFA 4PT5A 4RF0A 1BP4A 2J7QC 1GCBA 4RKXA 4W5CA 1PPOA 2DJFB 3HHAA 3O65A 1KFUL 1YK8A 3CBJA 1F2CA 1A6RA 1KFXL 4QBBA 3N4CA 2YJBA 4WURA 1EWPA 5CVNB 2IPPB 2YJ8A 5CVOB 4PADA 1U9XA 4BOUA 5F02A 5EGWA 3MTNA 4DMYA 2DOSA 2BDLA 4CDDB 4X6IA 1SP4B 3TNXA 2Z84A 3B79A 4P6GA 1DF0A 2BTWA 4P16A 1Y08A 2PADA 3HD3A 3OISA 3KSEA 3F75A 3KX1A 2E01A 4REZA 5E6JA 4YYWA 3KFQA 4M0WA 2ACTA 2AYNA 3N3GA 2R9NA 4OELA 1QOLA 3U8EA 1Q6KA 3MHHA 1VSNA 1VJVA 2AS8A 2AUZA 3I3TA 3CBKA 3KKUA 2B1NA 2DCCA 4FK5A 3V6CA 2FRAA 3CH3X 1CVZA 1ITOA 1MDWA 3IOQA 8PCHA 2FUDA 2E03A 1AYUA 1QXPA 2BU3A 3RNVA 4BOPA 1M6DA 4D8BA 1PVJA 3BWKA 2FQ9A 5CHVA 2UZJA 1CPJA 2GFOA 5KO3A 4P6EA 1CS8A 4XR7A 3TMPA 3MTVA 3H89A 3S3QA 1XKGA 4R3DA 2DZZA 4CDCB 3BPMA 2XU1A 5FPWA 2CIOA 2FT2A 9PAPA 2HH5A 1MEGA 1THEA 3C0RA 3RVVA 3D6SA 3K24A 4IUMA 3LXSA 1NLJA 5JA7A 3IEJA 2VHSA 4OW0A 3P5WA 1FH0A 1DKIA 2OULA 4OVZB 1AU2A 1TU6A 1YALA 4HWYA 4Q8GA 4W4UA 4X6HA 1O0EA 2HWKA 3KWBX 3QSDA 4I04A 1TL9A 2XU4A 2P7UA 4QRXA 1GECE 3QJ3A 1PADA 4BOSA 4YYUA 3S3RA 2DC8A 4YYRA 3BPFA 4HXDB 3MP2A 4ZTBA 1U9QX 4X6JA 3OVZA 4G54A 2JQGR 3BB7A 1AYVA 3BCNA 2PNSA 4DMXA 1BQIA 3PDFA 6PADA 4YYQA 2P0RA 1F2AA 1F2BA 3DF0A 4CZWA 5EZQA 1CB5A 3GCBA 3KWZA 1CJLA 4PP1A 2IBIA 2HD5A 4PP2E 4QRGA 3PHWA 7PCKA 2YJ2A 2G6DA 2NQIA 2WBFX 5CVMA 1YT7A 3M99A 2VHFA 4YYSA 1GLOA 3ZNHA 1PCIA 4BS5A 1YZBA 1IWDA 2NQDB 4WA6A 1AYWA 4QH6A 4D8IA 3P5XA 3BBAA 4K7CA 3MHSA 2J7QA 3IHPA 4A5UA 5A24A 4I05A 1NPZA 4IP3A 3F5VA 1KHPA 1DEUA 2GHUA 5EZSA 1MEMA 3K9MA 4PI3A
chains in the Genus database with same CATH topology
1JQPA 4FJCA 1QMYA 1EWOA 3E1ZB 1AU4A 1PE6A 3IV2A 3H6SA 1QDQA 4BPVA 1MS6A 4N8WA 1BGOA 2E02A 4KLBA 4ZUXU 4NV8A 3OVXA 3I06A 4BS6A 1U9VA 1PPPA 4MSXA 1U9WA 3HWNA 1STFE 2PREA 3LFYA 2F1GA 2DZYA 4GUZA 1CTEA 4MZSA 2JQFR 2OP3A 1S4VA 2C0YA 3BC3A 3MORA 1X9YA 3KW9A 1NL6A 2Y5BA 1KHQA 2DCBA 4CDEB 3RVWA 2Y6EA 3CH2X 1PPNA 1SNKA 4YYVA 2ATOA 1NB5A 2AU1A 2PBHA 1Y4HA 4YV8A 2AIMA 3PNRA 1PPDA 4BSQA 1ZCMA 3AI8A 2ARYA 2BDZA 1PXVA 3H7DA 4BQVA 3IMAA 1AU0A 2CB5A 2BSZA 1ME3A 1ME4A 1AECA 1F29A 5PADA 2R9FA 2NQGA 3QT4A 2NQAA 2AYOA 3NHEA 3WXFA 1AU3A 4BGFA 3PW3A 2R9OA 1NQCA 2E00A 5EF4A 1HUCB 3K8UA 2YJCA 4AXLA 5J94A 1BY8A 2YJ9A 1ATKA 3RVXA 1YVBA 1PBHA 1ZIVA 4I07A 2DC7A 3OF8A 2HXZA 2FO5A 2OZ2A 3BOWA 3WXEA 3USVA 1CSBB 5CHTA 2DCDA 1MIRA 4N79A 1W5RA 3H8CA 2FYEA 3WXGA 4N4ZA 3V6EA 4RY2A 3H8BA 2DC6A 1EWMA 3P5VA 1POPA 2DC9A 2FTDA 3N3KA 2R9CA 2P86A 3PBHA 1TLOA 2R9MA 2AUXA 1K3BB 4OEMA 4XUIA 5K16A 4AXMA 1GMYA 2FRQA 2HHNA 1W4TA 3ERVA 1CQDA 1U5IA 3O0UA 2DJGB 1EF7A 2G7YA 5JH3A 2O6XA 4YVAA 4CDFB 2B1MA 2H7JA 1AIMA 2G8JA 2XU5A 2DCAA 2XU3A 3IUTA 2F7DA 1MHWA 1CV8A 1YK7A 1EWLA 2AVWA 3C9EA 4Q8HA 3HHIA 1E2TA 4MZOA 3OF9A 1PIPA 3O1GA 2G8EA 4QRVA 3P5UA 2R6NA 1NB3A 4W5BA 3ZUAA 1KXRA 4FIPA 1ICFA 1BP4A 1GCBA 4W5CA 1PPOA 2DJFB 3HHAA 1KFUL 1YK8A 3CBJA 1F2CA 1A6RA 1KFXL 4QBBA 3N4CA 2YJBA 1EWPA 5CVNB 2IPPB 2YJ8A 5CVOB 4PADA 1U9XA 5F02A 5EGWA 3MTNA 4DMYA 2BDLA 4CDDB 4X6IA 1SP4B 3TNXA 3B79A 4P6GA 1DF0A 1Y08A 2PADA 3HD3A 3OISA 3KSEA 3F75A 3KX1A 2E01A 4YYWA 3KFQA 2ACTA 2AYNA 3N3GA 2R9NA 4OELA 1QOLA 3U8EA 1Q6KA 3MHHA 1VSNA 1VJVA 2AS8A 2AUZA 3D9WA 3LTWA 3I3TA 3CBKA 3KKUA 2B1NA 2DCCA 4FK5A 3V6CA 4B55A 2FRAA 3CH3X 1CVZA 1ITOA 1MDWA 3IOQA 8PCHA 2FUDA 2E03A 1AYUA 1QXPA 1M6DA 3BWKA 2FQ9A 5CHVA 1CPJA 2GFOA 4P6EA 1CS8A 4XR7A 3H89A 3S3QA 1XKGA 2DZZA 4CDCB 2VFCA 3BPMA 2XU1A 5FPWA 2CIOA 2FT2A 9PAPA 2HH5A 1MEGA 1THEA 3RVVA 3D6SA 3K24A 3LXSA 1NLJA 5JA7A 3IEJA 2VHSA 3P5WA 1FH0A 2OULA 1AU2A 1TU6A 1YALA 4HWYA 4Q8GA 4W4UA 4X6HA 1O0EA 3KWBX 3QSDA 4I04A 1TL9A 2XU4A 2P7UA 4QRXA 1GECE 3QJ3A 1PADA 4YYUA 3S3RA 2DC8A 4YYRA 3BPFA 1U9QX 4X6JA 3OVZA 4G54A 2JQGR 1AYVA 3BCNA 2PNSA 4DMXA 1BQIA 3PDFA 6PADA 4YYQA 4C5PA 2P0RA 1F2AA 1F2BA 3DF0A 4CZWA 1CB5A 3GCBA 3KWZA 1CJLA 4PP1A 2IBIA 2HD5A 4PP2E 4QRGA 7PCKA 2YJ2A 2G6DA 2NQIA 1GX3A 2WBFX 5CVMA 1YT7A 3M99A 2VHFA 4YYSA 1GLOA 4BS5A 1PCIA 1IWDA 2VFBA 2NQDB 4WA6A 1AYWA 4QH6A 3P5XA 4K7CA 3MHSA 3IHPA 5A24A 4I05A 1NPZA 1W6FA 3F5VA 1KHPA 1DEUA 2GHUA 1MEMA 3K9MA 4PI3A 4NV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQP A;  4FJC A;  1QMY A;  1EWO A;  3E1Z B;  1AU4 A;  1PE6 A;  3IV2 A;  3H6S A;  1QDQ A;  4BPV A;  1MS6 A;  4N8W A;  1BGO A;  2E02 A;  4KLB A;  4ZUX U;  3OVX A;  3I06 A;  4BS6 A;  1U9V A;  1PPP A;  4MSX A;  1U9W A;  3HWN A;  1STF E;  2PRE A;  3LFY A;  2F1G A;  2DZY A;  1CTE A;  4MZS A;  2JQF R;  2OP3 A;  1S4V A;  2C0Y A;  3BC3 A;  3MOR A;  1X9Y A;  3KW9 A;  1NL6 A;  2Y5B A;  1KHQ A;  2DCB A;  4CDE B;  3RVW A;  2Y6E A;  3CH2 X;  1PPN A;  1SNK A;  4YYV A;  2ATO A;  1NB5 A;  2AU1 A;  2PBH A;  1Y4H A;  4YV8 A;  2AIM A;  3PNR A;  1PPD A;  4BSQ A;  1ZCM A;  3AI8 A;  2ARY A;  2BDZ A;  1PXV A;  3H7D A;  4BQV A;  3IMA A;  1AU0 A;  2CB5 A;  1ME3 A;  1ME4 A;  1AEC A;  1F29 A;  5PAD A;  2R9F A;  2NQG A;  3QT4 A;  2NQA A;  2AYO A;  3NHE A;  3WXF A;  1AU3 A;  3PW3 A;  2R9O A;  1NQC A;  2E00 A;  5EF4 A;  1HUC B;  3K8U A;  2YJC A;  4AXL A;  5J94 A;  1BY8 A;  2YJ9 A;  1ATK A;  3RVX A;  1YVB A;  1PBH A;  1ZIV A;  4I07 A;  2DC7 A;  3OF8 A;  2HXZ A;  2FO5 A;  2OZ2 A;  3BOW A;  3WXE A;  3USV A;  1CSB B;  5CHT A;  2DCD A;  1MIR A;  4N79 A;  3H8C A;  2FYE A;  3WXG A;  4N4Z A;  3V6E A;  4RY2 A;  3H8B A;  2DC6 A;  1EWM A;  3P5V A;  1POP A;  2DC9 A;  2FTD A;  3N3K A;  2R9C A;  2P86 A;  3PBH A;  1TLO A;  2R9M A;  2AUX A;  1K3B B;  4OEM A;  4XUI A;  5K16 A;  4AXM A;  1GMY A;  2FRQ A;  2HHN A;  3ERV A;  1CQD A;  1U5I A;  3O0U A;  2DJG B;  1EF7 A;  2G7Y A;  5JH3 A;  2O6X A;  4YVA A;  4CDF B;  2B1M A;  2H7J A;  1AIM A;  2G8J A;  2XU5 A;  2DCA A;  2XU3 A;  3IUT A;  2F7D A;  1MHW A;  1CV8 A;  1YK7 A;  1EWL A;  2AVW A;  3C9E A;  4Q8H A;  3HHI A;  4MZO A;  3OF9 A;  1PIP A;  3O1G A;  2G8E A;  4QRV A;  3P5U A;  2R6N A;  1NB3 A;  4W5B A;  3ZUA A;  1KXR A;  4FIP A;  1ICF A;  1BP4 A;  1GCB A;  4W5C A;  1PPO A;  2DJF B;  3HHA A;  1KFU L;  1YK8 A;  3CBJ A;  1F2C A;  1A6R A;  1KFX L;  4QBB A;  3N4C A;  2YJB A;  1EWP A;  5CVN B;  2IPP B;  2YJ8 A;  5CVO B;  4PAD A;  1U9X A;  5F02 A;  5EGW A;  3MTN A;  4DMY A;  2BDL A;  4CDD B;  4X6I A;  1SP4 B;  3TNX A;  3B79 A;  4P6G A;  1DF0 A;  1Y08 A;  2PAD A;  3HD3 A;  3OIS A;  3KSE A;  3F75 A;  3KX1 A;  2E01 A;  4YYW A;  3KFQ A;  2ACT A;  2AYN A;  3N3G A;  2R9N A;  4OEL A;  1QOL A;  3U8E A;  1Q6K A;  3MHH A;  1VSN A;  1VJV A;  2AS8 A;  2AUZ A;  3I3T A;  3CBK A;  3KKU A;  2B1N A;  2DCC A;  4FK5 A;  3V6C A;  2FRA A;  3CH3 X;  1CVZ A;  1ITO A;  1MDW A;  3IOQ A;  8PCH A;  2FUD A;  2E03 A;  1AYU A;  1QXP A;  1M6D A;  3BWK A;  2FQ9 A;  5CHV A;  1CPJ A;  2GFO A;  4P6E A;  1CS8 A;  4XR7 A;  3H89 A;  3S3Q A;  1XKG A;  2DZZ A;  4CDC B;  3BPM A;  2XU1 A;  5FPW A;  2CIO A;  2FT2 A;  9PAP A;  2HH5 A;  1MEG A;  1THE A;  3RVV A;  3D6S A;  3K24 A;  3LXS A;  1NLJ A;  5JA7 A;  3IEJ A;  2VHS A;  3P5W A;  1FH0 A;  2OUL A;  1AU2 A;  1TU6 A;  1YAL A;  4HWY A;  4Q8G A;  4W4U A;  4X6H A;  1O0E A;  3KWB X;  3QSD A;  4I04 A;  1TL9 A;  2XU4 A;  2P7U A;  4QRX A;  1GEC E;  3QJ3 A;  1PAD A;  4YYU A;  3S3R A;  2DC8 A;  4YYR A;  3BPF A;  1U9Q X;  4X6J A;  3OVZ A;  4G54 A;  2JQG R;  1AYV A;  3BCN A;  2PNS A;  4DMX A;  1BQI A;  3PDF A;  6PAD A;  4YYQ A;  2P0R A;  1F2A A;  1F2B A;  3DF0 A;  4CZW A;  1CB5 A;  3GCB A;  3KWZ A;  1CJL A;  4PP1 A;  2IBI A;  2HD5 A;  4PP2 E;  4QRG A;  7PCK A;  2YJ2 A;  2G6D A;  2NQI A;  2WBF X;  5CVM A;  1YT7 A;  3M99 A;  2VHF A;  4YYS A;  1GLO A;  4BS5 A;  1PCI A;  1IWD A;  2NQD B;  4WA6 A;  1AYW A;  4QH6 A;  3P5X A;  4K7C A;  3MHS A;  3IHP A;  5A24 A;  4I05 A;  1NPZ A;  3F5V A;  1KHP A;  1DEU A;  2GHU A;  1MEM A;  3K9M A;  4PI3 A; 
#chains in the Genus database with same CATH topology
 1JQP A;  4D8E A;  4FJC A;  1QMY A;  1EWO A;  3E1Z B;  1AU4 A;  1PE6 A;  3IV2 A;  3H6S A;  1QDQ A;  4BPV A;  1MS6 A;  4N8W A;  1BGO A;  2JTC A;  2E02 A;  4KLB A;  4ZUX U;  3OVX A;  3PRM A;  3I06 A;  4BS6 A;  1U9V A;  1PPP A;  4MI7 A;  4MSX A;  1U9W A;  3HWN A;  1STF E;  3MJ5 A;  3PHX A;  2PRE A;  3LFY A;  2F1G A;  2DZY A;  4GUA A;  1CTE A;  3PRP A;  4RF1 A;  4MZS A;  2JQF R;  3E9S A;  2OP3 A;  1S4V A;  2C0Y A;  3BC3 A;  3MOR A;  3IFU A;  1X9Y A;  3KW9 A;  1NL6 A;  2Y5B A;  1KHQ A;  2DCB A;  4CDE B;  3RVW A;  2Y6E A;  3CH2 X;  1PPN A;  1SNK A;  4YYV A;  2ATO A;  1NB5 A;  2AU1 A;  2PBH A;  1Y4H A;  4YV8 A;  2AIM A;  3PNR A;  1PPD A;  4BSQ A;  1ZCM A;  3AI8 A;  2ARY A;  2BDZ A;  1PXV A;  3H7D A;  4BQV A;  3IMA A;  1AU0 A;  2CB5 A;  1ME3 A;  1ME4 A;  1AEC A;  1F29 A;  5PAD A;  2R9F A;  2NQG A;  3QT4 A;  2NQA A;  2AYO A;  3NHE A;  3WXF A;  1AU3 A;  3PW3 A;  2R9O A;  3OQC A;  3PSE A;  1NQC A;  2E00 A;  5EF4 A;  1HUC B;  3K8U A;  2YJC A;  3W30 A;  5J94 A;  4AXL A;  2FE8 A;  1BY8 A;  2YJ9 A;  1ATK A;  3RVX A;  1YVB A;  4MM3 B;  1PBH A;  1ZIV A;  4I07 A;  2DC7 A;  3OF8 A;  2HXZ A;  2FO5 A;  2OZ2 A;  3BOW A;  3WXE A;  3USV A;  1CSB B;  5CHT A;  2DCD A;  1MIR A;  4N79 A;  4OVZ A;  3H8C A;  2FYE A;  3WXG A;  4N4Z A;  3V6E A;  4RY2 A;  3H8B A;  2DC6 A;  1EWM A;  3P5V A;  1POP A;  2DC9 A;  2FTD A;  2AGA A;  3BY4 A;  3N3K A;  2R9C A;  2P86 A;  1UKF A;  3PBH A;  4XZX A;  1TLO A;  2R9M A;  2AUX A;  1K3B B;  4OEM A;  4XUI A;  5K16 A;  4AXM A;  4BOZ A;  1GMY A;  2FRQ A;  2HHN A;  3W31 A;  3ERV A;  2JRI A;  1CQD A;  1U5I A;  3O0U A;  2DJG B;  1EF7 A;  2G7Y A;  5JH3 A;  3PHU A;  2O6X A;  4RNA A;  4YVA A;  4CDF B;  5JZE A;  2BTW B;  2B1M A;  2H7J A;  1AIM A;  2G8J A;  2XU5 A;  2DCA A;  2XU3 A;  3IUT A;  2F7D A;  1MHW A;  3B21 A;  1CV8 A;  1YK7 A;  1EWL A;  2AVW A;  3C9E A;  4Q8H A;  3HHI A;  4MZO A;  3OF9 A;  1PIP A;  3O1G A;  2G8E A;  4QRV A;  4BOQ A;  3P5U A;  2R6N A;  1NB3 A;  3PT2 A;  4W5B A;  3ZUA A;  3TRK A;  1KXR A;  4FIP A;  1ICF A;  4PT5 A;  4RF0 A;  1BP4 A;  2J7Q C;  1GCB A;  4RKX A;  4W5C A;  1PPO A;  2DJF B;  3HHA A;  3O65 A;  1KFU L;  1YK8 A;  3CBJ A;  1F2C A;  1A6R A;  1KFX L;  4QBB A;  3N4C A;  2YJB A;  4WUR A;  1EWP A;  5CVN B;  2IPP B;  2YJ8 A;  5CVO B;  4PAD A;  1U9X A;  4BOU A;  5F02 A;  5EGW A;  3MTN A;  4DMY A;  2DOS A;  2BDL A;  4CDD B;  4X6I A;  1SP4 B;  3TNX A;  2Z84 A;  3B79 A;  4P6G A;  1DF0 A;  2BTW A;  4P16 A;  1Y08 A;  2PAD A;  3HD3 A;  3OIS A;  3KSE A;  3F75 A;  3KX1 A;  2E01 A;  4REZ A;  5E6J A;  4YYW A;  3KFQ A;  4M0W A;  2ACT A;  2AYN A;  3N3G A;  2R9N A;  4OEL A;  1QOL A;  3U8E A;  1Q6K A;  3MHH A;  1VSN A;  1VJV A;  2AS8 A;  2AUZ A;  3I3T A;  3CBK A;  3KKU A;  2B1N A;  2DCC A;  4FK5 A;  3V6C A;  2FRA A;  3CH3 X;  1CVZ A;  1ITO A;  1MDW A;  3IOQ A;  8PCH A;  2FUD A;  2E03 A;  1AYU A;  1QXP A;  2BU3 A;  3RNV A;  4BOP A;  1M6D A;  4D8B A;  1PVJ A;  3BWK A;  2FQ9 A;  5CHV A;  2UZJ A;  1CPJ A;  2GFO A;  5KO3 A;  4P6E A;  1CS8 A;  4XR7 A;  3TMP A;  3MTV A;  3H89 A;  3S3Q A;  1XKG A;  4R3D A;  2DZZ A;  4CDC B;  3BPM A;  2XU1 A;  5FPW A;  2CIO A;  2FT2 A;  9PAP A;  2HH5 A;  1MEG A;  1THE A;  3C0R A;  3RVV A;  3D6S A;  3K24 A;  4IUM A;  3LXS A;  1NLJ A;  5JA7 A;  3IEJ A;  2VHS A;  4OW0 A;  3P5W A;  1FH0 A;  1DKI A;  2OUL A;  4OVZ B;  1AU2 A;  1TU6 A;  1YAL A;  4HWY A;  4Q8G A;  4W4U A;  4X6H A;  1O0E A;  2HWK A;  3KWB X;  3QSD A;  4I04 A;  1TL9 A;  2XU4 A;  2P7U A;  4QRX A;  1GEC E;  3QJ3 A;  1PAD A;  4BOS A;  4YYU A;  3S3R A;  2DC8 A;  4YYR A;  3BPF A;  4HXD B;  3MP2 A;  4ZTB A;  1U9Q X;  4X6J A;  3OVZ A;  4G54 A;  2JQG R;  3BB7 A;  1AYV A;  3BCN A;  2PNS A;  4DMX A;  1BQI A;  3PDF A;  6PAD A;  4YYQ A;  2P0R A;  1F2A A;  1F2B A;  3DF0 A;  4CZW A;  5EZQ A;  1CB5 A;  3GCB A;  3KWZ A;  1CJL A;  4PP1 A;  2IBI A;  2HD5 A;  4PP2 E;  4QRG A;  3PHW A;  7PCK A;  2YJ2 A;  2G6D A;  2NQI A;  2WBF X;  5CVM A;  1YT7 A;  3M99 A;  2VHF A;  4YYS A;  1GLO A;  3ZNH A;  1PCI A;  4BS5 A;  1YZB A;  1IWD A;  2NQD B;  4WA6 A;  1AYW A;  4QH6 A;  4D8I A;  3P5X A;  3BBA A;  4K7C A;  3MHS A;  2J7Q A;  3IHP A;  4A5U A;  5A24 A;  4I05 A;  1NPZ A;  4IP3 A;  3F5V A;  1KHP A;  1DEU A;  2GHU A;  5EZS A;  1MEM A;  3K9M A;  4PI3 A; 
#chains in the Genus database with same CATH homology
 1JQP A;  4FJC A;  1QMY A;  1EWO A;  3E1Z B;  1AU4 A;  1PE6 A;  3IV2 A;  3H6S A;  1QDQ A;  4BPV A;  1MS6 A;  4N8W A;  1BGO A;  2E02 A;  4KLB A;  4ZUX U;  4NV8 A;  3OVX A;  3I06 A;  4BS6 A;  1U9V A;  1PPP A;  4MSX A;  1U9W A;  3HWN A;  1STF E;  2PRE A;  3LFY A;  2F1G A;  2DZY A;  4GUZ A;  1CTE A;  4MZS A;  2JQF R;  2OP3 A;  1S4V A;  2C0Y A;  3BC3 A;  3MOR A;  1X9Y A;  3KW9 A;  1NL6 A;  2Y5B A;  1KHQ A;  2DCB A;  4CDE B;  3RVW A;  2Y6E A;  3CH2 X;  1PPN A;  1SNK A;  4YYV A;  2ATO A;  1NB5 A;  2AU1 A;  2PBH A;  1Y4H A;  4YV8 A;  2AIM A;  3PNR A;  1PPD A;  4BSQ A;  1ZCM A;  3AI8 A;  2ARY A;  2BDZ A;  1PXV A;  3H7D A;  4BQV A;  3IMA A;  1AU0 A;  2CB5 A;  2BSZ A;  1ME3 A;  1ME4 A;  1AEC A;  1F29 A;  5PAD A;  2R9F A;  2NQG A;  3QT4 A;  2NQA A;  2AYO A;  3NHE A;  3WXF A;  1AU3 A;  4BGF A;  3PW3 A;  2R9O A;  1NQC A;  2E00 A;  5EF4 A;  1HUC B;  3K8U A;  2YJC A;  4AXL A;  5J94 A;  1BY8 A;  2YJ9 A;  1ATK A;  3RVX A;  1YVB A;  1PBH A;  1ZIV A;  4I07 A;  2DC7 A;  3OF8 A;  2HXZ A;  2FO5 A;  2OZ2 A;  3BOW A;  3WXE A;  3USV A;  1CSB B;  5CHT A;  2DCD A;  1MIR A;  4N79 A;  1W5R A;  3H8C A;  2FYE A;  3WXG A;  4N4Z A;  3V6E A;  4RY2 A;  3H8B A;  2DC6 A;  1EWM A;  3P5V A;  1POP A;  2DC9 A;  2FTD A;  3N3K A;  2R9C A;  2P86 A;  3PBH A;  1TLO A;  2R9M A;  2AUX A;  1K3B B;  4OEM A;  4XUI A;  5K16 A;  4AXM A;  1GMY A;  2FRQ A;  2HHN A;  1W4T A;  3ERV A;  1CQD A;  1U5I A;  3O0U A;  2DJG B;  1EF7 A;  2G7Y A;  5JH3 A;  2O6X A;  4YVA A;  4CDF B;  2B1M A;  2H7J A;  1AIM A;  2G8J A;  2XU5 A;  2DCA A;  2XU3 A;  3IUT A;  2F7D A;  1MHW A;  1CV8 A;  1YK7 A;  1EWL A;  2AVW A;  3C9E A;  4Q8H A;  3HHI A;  1E2T A;  4MZO A;  3OF9 A;  1PIP A;  3O1G A;  2G8E A;  4QRV A;  3P5U A;  2R6N A;  1NB3 A;  4W5B A;  3ZUA A;  1KXR A;  4FIP A;  1ICF A;  1BP4 A;  1GCB A;  4W5C A;  1PPO A;  2DJF B;  3HHA A;  1KFU L;  1YK8 A;  3CBJ A;  1F2C A;  1A6R A;  1KFX L;  4QBB A;  3N4C A;  2YJB A;  1EWP A;  5CVN B;  2IPP B;  2YJ8 A;  5CVO B;  4PAD A;  1U9X A;  5F02 A;  5EGW A;  3MTN A;  4DMY A;  2BDL A;  4CDD B;  4X6I A;  1SP4 B;  3TNX A;  3B79 A;  4P6G A;  1DF0 A;  1Y08 A;  2PAD A;  3HD3 A;  3OIS A;  3KSE A;  3F75 A;  3KX1 A;  2E01 A;  4YYW A;  3KFQ A;  2ACT A;  2AYN A;  3N3G A;  2R9N A;  4OEL A;  1QOL A;  3U8E A;  1Q6K A;  3MHH A;  1VSN A;  1VJV A;  2AS8 A;  2AUZ A;  3D9W A;  3LTW A;  3I3T A;  3CBK A;  3KKU A;  2B1N A;  2DCC A;  4FK5 A;  3V6C A;  4B55 A;  2FRA A;  3CH3 X;  1CVZ A;  1ITO A;  1MDW A;  3IOQ A;  8PCH A;  2FUD A;  2E03 A;  1AYU A;  1QXP A;  1M6D A;  3BWK A;  2FQ9 A;  5CHV A;  1CPJ A;  2GFO A;  4P6E A;  1CS8 A;  4XR7 A;  3H89 A;  3S3Q A;  1XKG A;  2DZZ A;  4CDC B;  2VFC A;  3BPM A;  2XU1 A;  5FPW A;  2CIO A;  2FT2 A;  9PAP A;  2HH5 A;  1MEG A;  1THE A;  3RVV A;  3D6S A;  3K24 A;  3LXS A;  1NLJ A;  5JA7 A;  3IEJ A;  2VHS A;  3P5W A;  1FH0 A;  2OUL A;  1AU2 A;  1TU6 A;  1YAL A;  4HWY A;  4Q8G A;  4W4U A;  4X6H A;  1O0E A;  3KWB X;  3QSD A;  4I04 A;  1TL9 A;  2XU4 A;  2P7U A;  4QRX A;  1GEC E;  3QJ3 A;  1PAD A;  4YYU A;  3S3R A;  2DC8 A;  4YYR A;  3BPF A;  1U9Q X;  4X6J A;  3OVZ A;  4G54 A;  2JQG R;  1AYV A;  3BCN A;  2PNS A;  4DMX A;  1BQI A;  3PDF A;  6PAD A;  4YYQ A;  4C5P A;  2P0R A;  1F2A A;  1F2B A;  3DF0 A;  4CZW A;  1CB5 A;  3GCB A;  3KWZ A;  1CJL A;  4PP1 A;  2IBI A;  2HD5 A;  4PP2 E;  4QRG A;  7PCK A;  2YJ2 A;  2G6D A;  2NQI A;  1GX3 A;  2WBF X;  5CVM A;  1YT7 A;  3M99 A;  2VHF A;  4YYS A;  1GLO A;  4BS5 A;  1PCI A;  1IWD A;  2VFB A;  2NQD B;  4WA6 A;  1AYW A;  4QH6 A;  3P5X A;  4K7C A;  3MHS A;  3IHP A;  5A24 A;  4I05 A;  1NPZ A;  1W6F A;  3F5V A;  1KHP A;  1DEU A;  2GHU A;  1MEM A;  3K9M A;  4PI3 A;  4NV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...