3PRMA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/hydrolase
molecule keywords L protein
total genus 40
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prmA00
3TMPA 3PHWA 3PHUA 3PHXA 4BOSA 3PRPA 3PT2A 4BOZA 4BOQA 3ZNHA 5JZEA 4HXDB 4BOPA 3BY4A 3C0RA 4BOUA 3PSEA 3PRMA
chains in the Genus database with same CATH superfamily
2DCBA 3KKUA 1GLOA 3E1ZB 4N8WA 1VSNA 2AU1A 2F7DA 3PHWA 4BQVA 3BWKA 3M99A 3PHXA 3N4CA 4DMYA 1U9QX 2G6DA 3ERVA 4BOSA 4ZUXU 1FH0A 4IP3A 2DC8A 2BU3A 2DZZA 5CHTA 3V6EA 3H8BA 3H8CA 2FRQA 3TNXA 1NB5A 2JQGR 4CDFB 1QXPA 4PP2E 3BBAA 1YK7A 5CHVA 5PADA 2PADA 4ZTBA 1EWMA 1YVBA 1U9WA 1THEA 3OQCA 2FQ9A 3BY4A 4QRGA 1ICFA 3USVA 4MM3B 4D8EA 1TLOA 4W4UA 4R3DA 1EWLA 5J94A 4OELA 4WA6A 3WXGA 4D8IA 4YV8A 3GCBA 4QH6A 1ME3A 2XU1A 1YZBA 5CVNB 2R9FA 2YJ2A 2G8EA 2YJBA 1GCBA 4P6EA 2WBFX 3RNVA 1MS6A 1ITOA 1PBHA 1BQIA 2DC9A 2BTWB 3IV2A 5CVOB 1M6DA 4HXDB 1MDWA 1MEGA 1AU2A 3P5UA 2HHNA 2FT2A 4X6IA 2FYEA 3F5VA 4IUMA 1A6RA 5F02A 3MHHA 3K8UA 3HD3A 1F2BA 2J7QA 4BOPA 3O65A 3I06A 3NHEA 3CBKA 6PADA 3P5VA 2VHFA 3B79A 4XZXA 4BPVA 2R9CA 4QRXA 4OW0A 1CB5A 1O0EA 5KO3A 4CDDB 2BDZA 4QBBA 4X6JA 2AIMA 1AU4A 3OVZA 4N4ZA 3O1GA 1U5IA 5EZSA 1GMYA 2HXZA 1EWOA 3S3RA 1TL9A 2HH5A 1DEUA 3D6SA 2R9MA 2Z84A 5EZQA 4FJCA 1KFXL 5A24A 1VJVA 3OVXA 1MEMA 2AUXA 3KWZA 2JQFR 2IBIA 3H7DA 4I04A 1PE6A 3CH2X 2R9NA 2AVWA 1CVZA 3MTNA 3PNRA 3PRPA 3V6CA 4M0WA 4Q8GA 3ZNHA 2ARYA 1BP4A 4W5CA 2E01A 1Q6KA 4MSXA 1NPZA 2DOSA 1U9XA 1JQPA 3E9SA 2IPPB 1U9VA 4FIPA 4AXLA 3QT4A 3BPFA 1Y4HA 2Y5BA 1CV8A 4WURA 2R6NA 4BOZA 3O0UA 4AXMA 3KFQA 2DZYA 2NQAA 2YJ8A 3H6SA 1F2AA 3K24A 3C0RA 4X6HA 2E02A 1KHPA 4BS6A 3B21A 5JH3A 4YYUA 3PDFA 2FO5A 3IOQA 4XR7A 1NLJA 4GUAA 1PPNA 1TU6A 2JRIA 1PCIA 3OISA 2F1GA 1GECE 1AYVA 1Y08A 3PRMA 2P0RA 4OVZA 3U8EA 1PPDA 3KSEA 1EF7A 4YYQA 1KXRA 3MP2A 1AU3A 3P5WA 8PCHA 3PW3A 1CS8A 3PHUA 1BY8A 4G54A 2AUZA 2JTCA 3AI8A 4P6GA 2AS8A 4MI7A 1PPPA 2VHSA 2O6XA 3OF9A 3WXFA 2C0YA 4OVZB 2ATOA 3RVXA 1ATKA 1PADA 1POPA 2FTDA 1AYUA 4I05A 3HHIA 3PSEA 1QMYA 3BB7A 3MHSA 1QDQA 3CBJA 3BC3A 1CQDA 4HWYA 1MHWA 4I07A 3I3TA 4XUIA 1F29A 3IUTA 5EF4A 4RF0A 1AIMA 3P5XA 2XU3A 4Q8HA 2UZJA 3TRKA 4REZA 1YK8A 4BSQA 1NB3A 3W31A 3MORA 4FK5A 1YALA 2HD5A 2PREA 4CZWA 4PI3A 4YYVA 4MZSA 4CDCB 1X9YA 3W30A 1ZIVA 4CDEB 1CSBB 1XKGA 2P7UA 1PPOA 3RVVA 4BOQA 1AECA 4N79A 1PVJA 2CB5A 2ACTA 2AYOA 3BCNA 1NQCA 2DC6A 2FE8A 1CTEA 1MIRA 1YT7A 1PXVA 2OULA 2G7YA 5FPWA 3RVWA 1STFE 1UKFA 2GHUA 2DCCA 3F75A 3IFUA 1S4VA 4YYWA 3BOWA 5CVMA 2AYNA 4BOUA 2DCDA 1DKIA 1IWDA 4YVAA 1CJLA 2NQGA 4BS5A 2OZ2A 5JA7A 1KFUL 2YJCA 3IMAA 1AYWA 4D8BA 3N3KA 3PBHA 3HWNA 2B1MA 3K9MA 3WXEA 3ZUAA 1NL6A 2XU5A 3KX1A 2NQIA 2R9OA 3OF8A 1ME4A 1QOLA 4RKXA 2DJFB 3PT2A 3QSDA 3BPMA 4OEMA 3IEJA 2FUDA 2Y6EA 2J7QC 2PBHA 3LXSA 1CPJA 4MZOA 3N3GA 2E00A 4PT5A 2FRAA 5EGWA 2GFOA 4K7CA 1F2CA 4W5BA 1KHQA 3C9EA 3MTVA 9PAPA 1HUCB 3IHPA 3H89A 2OP3A 3KWBX 4KLBA 2P86A 4PADA 3MJ5A 3KW9A 2XU4A 1AU0A 1ZCMA 2NQDB 1SP4B 4QRVA 4PP1A 1DF0A 7PCKA 3LFYA 3TMPA 4A5UA 1EWPA 1K3BB 5JZEA 2DCAA 2YJ9A 2G8JA 4YYRA 1SNKA 3QJ3A 2H7JA 3S3QA 4DMXA 4P16A 4RY2A 4YYSA 2DJGB 3CH3X 4RF1A 1PIPA 2HWKA 2AGAA 2CIOA 2B1NA 5E6JA 2E03A 2DC7A 2BTWA 2PNSA 5K16A 1BGOA 2BDLA 3DF0A 3HHAA 4RNAA
chains in the Genus database with same CATH topology
3BB7A 4D8EA 2BTWB 4P16A 2FE8A 3B21A 4R3DA 4OW0A 2J7QC 2Z84A 4HXDB 3MP2A 5JZEA 5KO3A 2DOSA 5EZQA 3E9SA 3TMPA 4PT5A 3PHUA 3BBAA 3PHWA 4D8BA 4RF0A 2JTCA 4A5UA 4D8IA 4RF1A 4GUAA 1UKFA 2HWKA 4WURA 4IUMA 1YZBA 2AGAA 4ZTBA 3PHXA 2JRIA 4BOZA 3MTVA 4MI7A 5EZSA 3IFUA 3OQCA 5E6JA 2J7QA 2UZJA 3W30A 3BY4A 2BTWA 3TRKA 4OVZB 3PSEA 4BOPA 3O65A 3PRMA 3RNVA 4REZA 4RKXA 4OVZA 4BOSA 4BOQA 3PRPA 3PT2A 4IP3A 2BU3A 4M0WA 4XZXA 3ZNHA 1PVJA 3MJ5A 3C0RA 3W31A 4BOUA 4MM3B 4RNAA 1DKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMP A;  3PHW A;  3PHU A;  3PHX A;  4BOS A;  3PRP A;  3PT2 A;  4BOZ A;  4BOQ A;  3ZNH A;  5JZE A;  4HXD B;  4BOP A;  3BY4 A;  3C0R A;  4BOU A;  3PSE A;  3PRM A; 
#chains in the Genus database with same CATH topology
 2DCB A;  3KKU A;  1GLO A;  3E1Z B;  4N8W A;  1VSN A;  2AU1 A;  2F7D A;  3PHW A;  4BQV A;  3BWK A;  3M99 A;  3PHX A;  3N4C A;  4DMY A;  1U9Q X;  2G6D A;  3ERV A;  4BOS A;  4ZUX U;  1FH0 A;  4IP3 A;  2DC8 A;  2BU3 A;  2DZZ A;  5CHT A;  3V6E A;  3H8B A;  3H8C A;  2FRQ A;  3TNX A;  1NB5 A;  2JQG R;  4CDF B;  1QXP A;  4PP2 E;  3BBA A;  1YK7 A;  5CHV A;  5PAD A;  2PAD A;  4ZTB A;  1EWM A;  1YVB A;  1U9W A;  1THE A;  3OQC A;  2FQ9 A;  3BY4 A;  4QRG A;  1ICF A;  3USV A;  4MM3 B;  4D8E A;  1TLO A;  4W4U A;  4R3D A;  1EWL A;  5J94 A;  4OEL A;  4WA6 A;  3WXG A;  4D8I A;  4YV8 A;  3GCB A;  4QH6 A;  1ME3 A;  2XU1 A;  1YZB A;  5CVN B;  2R9F A;  2YJ2 A;  2G8E A;  2YJB A;  1GCB A;  4P6E A;  2WBF X;  3RNV A;  1MS6 A;  1ITO A;  1PBH A;  1BQI A;  2DC9 A;  2BTW B;  3IV2 A;  5CVO B;  1M6D A;  4HXD B;  1MDW A;  1MEG A;  1AU2 A;  3P5U A;  2HHN A;  2FT2 A;  4X6I A;  2FYE A;  3F5V A;  4IUM A;  1A6R A;  5F02 A;  3MHH A;  3K8U A;  3HD3 A;  1F2B A;  2J7Q A;  4BOP A;  3O65 A;  3I06 A;  3NHE A;  3CBK A;  6PAD A;  3P5V A;  2VHF A;  3B79 A;  4XZX A;  4BPV A;  2R9C A;  4QRX A;  4OW0 A;  1CB5 A;  1O0E A;  5KO3 A;  4CDD B;  2BDZ A;  4QBB A;  4X6J A;  2AIM A;  1AU4 A;  3OVZ A;  4N4Z A;  3O1G A;  1U5I A;  5EZS A;  1GMY A;  2HXZ A;  1EWO A;  3S3R A;  1TL9 A;  2HH5 A;  1DEU A;  3D6S A;  2R9M A;  2Z84 A;  5EZQ A;  4FJC A;  1KFX L;  5A24 A;  1VJV A;  3OVX A;  1MEM A;  2AUX A;  3KWZ A;  2JQF R;  2IBI A;  3H7D A;  4I04 A;  1PE6 A;  3CH2 X;  2R9N A;  2AVW A;  1CVZ A;  3MTN A;  3PNR A;  3PRP A;  3V6C A;  4M0W A;  4Q8G A;  3ZNH A;  2ARY A;  1BP4 A;  4W5C A;  2E01 A;  1Q6K A;  4MSX A;  1NPZ A;  2DOS A;  1U9X A;  1JQP A;  3E9S A;  2IPP B;  1U9V A;  4FIP A;  4AXL A;  3QT4 A;  3BPF A;  1Y4H A;  2Y5B A;  1CV8 A;  4WUR A;  2R6N A;  4BOZ A;  3O0U A;  4AXM A;  3KFQ A;  2DZY A;  2NQA A;  2YJ8 A;  3H6S A;  1F2A A;  3K24 A;  3C0R A;  4X6H A;  2E02 A;  1KHP A;  4BS6 A;  3B21 A;  5JH3 A;  4YYU A;  3PDF A;  2FO5 A;  3IOQ A;  4XR7 A;  1NLJ A;  4GUA A;  1PPN A;  1TU6 A;  2JRI A;  1PCI A;  3OIS A;  2F1G A;  1GEC E;  1AYV A;  1Y08 A;  3PRM A;  2P0R A;  4OVZ A;  3U8E A;  1PPD A;  3KSE A;  1EF7 A;  4YYQ A;  1KXR A;  3MP2 A;  1AU3 A;  3P5W A;  8PCH A;  3PW3 A;  1CS8 A;  3PHU A;  1BY8 A;  4G54 A;  2AUZ A;  2JTC A;  3AI8 A;  4P6G A;  2AS8 A;  4MI7 A;  1PPP A;  2VHS A;  2O6X A;  3OF9 A;  3WXF A;  2C0Y A;  4OVZ B;  2ATO A;  3RVX A;  1ATK A;  1PAD A;  1POP A;  2FTD A;  1AYU A;  4I05 A;  3HHI A;  3PSE A;  1QMY A;  3BB7 A;  3MHS A;  1QDQ A;  3CBJ A;  3BC3 A;  1CQD A;  4HWY A;  1MHW A;  4I07 A;  3I3T A;  4XUI A;  1F29 A;  3IUT A;  5EF4 A;  4RF0 A;  1AIM A;  3P5X A;  2XU3 A;  4Q8H A;  2UZJ A;  3TRK A;  4REZ A;  1YK8 A;  4BSQ A;  1NB3 A;  3W31 A;  3MOR A;  4FK5 A;  1YAL A;  2HD5 A;  2PRE A;  4CZW A;  4PI3 A;  4YYV A;  4MZS A;  4CDC B;  1X9Y A;  3W30 A;  1ZIV A;  4CDE B;  1CSB B;  1XKG A;  2P7U A;  1PPO A;  3RVV A;  4BOQ A;  1AEC A;  4N79 A;  1PVJ A;  2CB5 A;  2ACT A;  2AYO A;  3BCN A;  1NQC A;  2DC6 A;  2FE8 A;  1CTE A;  1MIR A;  1YT7 A;  1PXV A;  2OUL A;  2G7Y A;  5FPW A;  3RVW A;  1STF E;  1UKF A;  2GHU A;  2DCC A;  3F75 A;  3IFU A;  1S4V A;  4YYW A;  3BOW A;  5CVM A;  2AYN A;  4BOU A;  2DCD A;  1DKI A;  1IWD A;  4YVA A;  1CJL A;  2NQG A;  4BS5 A;  2OZ2 A;  5JA7 A;  1KFU L;  2YJC A;  3IMA A;  1AYW A;  4D8B A;  3N3K A;  3PBH A;  3HWN A;  2B1M A;  3K9M A;  3WXE A;  3ZUA A;  1NL6 A;  2XU5 A;  3KX1 A;  2NQI A;  2R9O A;  3OF8 A;  1ME4 A;  1QOL A;  4RKX A;  2DJF B;  3PT2 A;  3QSD A;  3BPM A;  4OEM A;  3IEJ A;  2FUD A;  2Y6E A;  2J7Q C;  2PBH A;  3LXS A;  1CPJ A;  4MZO A;  3N3G A;  2E00 A;  4PT5 A;  2FRA A;  5EGW A;  2GFO A;  4K7C A;  1F2C A;  4W5B A;  1KHQ A;  3C9E A;  3MTV A;  9PAP A;  1HUC B;  3IHP A;  3H89 A;  2OP3 A;  3KWB X;  4KLB A;  2P86 A;  4PAD A;  3MJ5 A;  3KW9 A;  2XU4 A;  1AU0 A;  1ZCM A;  2NQD B;  1SP4 B;  4QRV A;  4PP1 A;  1DF0 A;  7PCK A;  3LFY A;  3TMP A;  4A5U A;  1EWP A;  1K3B B;  5JZE A;  2DCA A;  2YJ9 A;  2G8J A;  4YYR A;  1SNK A;  3QJ3 A;  2H7J A;  3S3Q A;  4DMX A;  4P16 A;  4RY2 A;  4YYS A;  2DJG B;  3CH3 X;  4RF1 A;  1PIP A;  2HWK A;  2AGA A;  2CIO A;  2B1N A;  5E6J A;  2E03 A;  2DC7 A;  2BTW A;  2PNS A;  5K16 A;  1BGO A;  2BDL A;  3DF0 A;  3HHA A;  4RNA A; 
#chains in the Genus database with same CATH homology
 3BB7 A;  4D8E A;  2BTW B;  4P16 A;  2FE8 A;  3B21 A;  4R3D A;  4OW0 A;  2J7Q C;  2Z84 A;  4HXD B;  3MP2 A;  5JZE A;  5KO3 A;  2DOS A;  5EZQ A;  3E9S A;  3TMP A;  4PT5 A;  3PHU A;  3BBA A;  3PHW A;  4D8B A;  4RF0 A;  2JTC A;  4A5U A;  4D8I A;  4RF1 A;  4GUA A;  1UKF A;  2HWK A;  4WUR A;  4IUM A;  1YZB A;  2AGA A;  4ZTB A;  3PHX A;  2JRI A;  4BOZ A;  3MTV A;  4MI7 A;  5EZS A;  3IFU A;  3OQC A;  5E6J A;  2J7Q A;  2UZJ A;  3W30 A;  3BY4 A;  2BTW A;  3TRK A;  4OVZ B;  3PSE A;  4BOP A;  3O65 A;  3PRM A;  3RNV A;  4REZ A;  4RKX A;  4OVZ A;  4BOS A;  4BOQ A;  3PRP A;  3PT2 A;  4IP3 A;  2BU3 A;  4M0W A;  4XZX A;  3ZNH A;  1PVJ A;  3MJ5 A;  3C0R A;  3W31 A;  4BOU A;  4MM3 B;  4RNA A;  1DKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...