3PRMA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords L protein
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
total genus 40
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prmA00
3PRPA 4BOQA 4BOSA 4BOPA 3PHXA 3BY4A 4BOUA 3PRMA 3PT2A 3TMPA 4HXDB 4BOZA 3ZNHA 3PHUA 3PSEA 3PHWA 3C0RA 5JZEA
chains in the Genus database with same CATH superfamily
8PCHA 2C0YA 3E9SA 4BPVA 1AU0A 2YJ2A 1Q6KA 2DZYA 3C9EA 2XU4A 3I3TA 4FIPA 4YYWA 4PADA 3OF9A 1BY8A 1MEMA 2F7DA 4HXDB 2E01A 3V6CA 1GLOA 1A6RA 2FTDA 1PXVA 1MHWA 4AXMA 4OVZB 5EGWA 3PW3A 4X6IA 2R9FA 2DOSA 3KWBX 4K7CA 4WA6A 4OELA 4M0WA 5PADA 4DMYA 2P86A 1U9XA 1STFE 3OVZA 1U9WA 1FH0A 2GFOA 4ZUXU 2AGAA 4QRGA 3KFQA 4BS6A 3BPMA 2H7JA 3P5XA 1NB3A 5CVMA 1ATKA 2UZJA 3USVA 2DC8A 1PADA 1MDWA 3TRKA 4RKXA 5CHTA 2FQ9A 1DKIA 3H8BA 4YYRA 3H89A 2OULA 1AU2A 3B79A 4BOQA 4YYUA 1QXPA 3KKUA 1PPPA 4XR7A 5CVOB 3F5VA 3W30A 3B21A 4MM3B 5JH3A 3HD3A 2J7QA 2BDZA 2FT2A 2PBHA 2P7UA 1YALA 3M99A 5KO3A 4GUAA 1UKFA 4BOUA 4D8EA 1EWOA 4REZA 3MTNA 3E1ZB 3N3KA 2BU3A 4W5BA 1F2BA 2R9NA 2G8JA 2XU3A 4P16A 4XUIA 4WURA 4HWYA 3RNVA 3DF0A 2JTCA 1BP4A 1ME3A 4P6GA 3IEJA 3V6EA 3K24A 3PNRA 2AS8A 1M6DA 1CB5A 3MTVA 3MP2A 1PIPA 4RF1A 1AU4A 4YV8A 4I04A 1YT7A 1F2CA 1KFXL 3F75A 2YJCA 3PHWA 4I07A 1POPA 2JQGR 2G6DA 4CZWA 3KSEA 1F29A 3QJ3A 3BWKA 5A24A 1U9VA 1PPNA 4QH6A 3RVVA 3BB7A 2CIOA 2OP3A 5JZEA 2AUZA 4PP2E 1QDQA 2R9OA 2Y6EA 2BTWA 9PAPA 3P5VA 3CH3X 1BGOA 1EWPA 4PI3A 4YYQA 1AU3A 4BQVA 3S3QA 2DCCA 4PP1A 4CDFB 4DMXA 3IV2A 4MZSA 5CHVA 3K9MA 3OISA 4BS5A 5K16A 3OVXA 1AYWA 3N4CA 1DEUA 3KX1A 3MHHA 3BC3A 1YK7A 1NB5A 3BPFA 1MIRA 5JA7A 2IPPB 1KFUL 1VJVA 5J94A 1U5IA 1NPZA 1DF0A 2YJBA 1GCBA 1AYVA 4QRXA 2ACTA 3OF8A 3IFUA 2G8EA 2B1NA 2HWKA 2AUXA 2BDLA 3BY4A 1PE6A 1KHPA 4P6EA 1YZBA 3IHPA 1AIMA 1YK8A 2GHUA 3IMAA 2YJ8A 3WXGA 2DCDA 3P5UA 4QBBA 2E02A 3PHUA 2HXZA 2G7YA 4KLBA 4OEMA 2Z84A 1U9QX 3OQCA 3H7DA 4RY2A 2PREA 3PHXA 3RVXA 3BOWA 2BTWB 2DC7A 3H8CA 3WXFA 2DC6A 3W31A 4ZTBA 1Y4HA 3PRMA 5E6JA 2R9CA 4CDCB 3BCNA 4R3DA 1ITOA 1TLOA 3GCBA 2CB5A 2P0RA 2DC9A 2E03A 3H6SA 1ZCMA 1SNKA 3BBAA 3MHSA 4YYSA 4YVAA 4CDDB 4FJCA 2NQAA 4BOPA 4PT5A 2IBIA 1YVBA 2HD5A 1PBHA 1AECA 3TMPA 4MI7A 2B1MA 1X9YA 3O1GA 1MS6A 4W5CA 2YJ9A 3PSEA 3K8UA 1VSNA 1CPJA 3S3RA 3HWNA 1CV8A 1KXRA 2AYNA 3ZUAA 1HUCB 1NLJA 2HHNA 1IWDA 7PCKA 1S4VA 4BOZA 1CVZA 2JRIA 3ZNHA 2FYEA 4IP3A 1KHQA 2R6NA 1K3BB 3NHEA 2JQFR 2NQGA 2VHFA 3KW9A 3C0RA 2XU5A 3KWZA 2VHSA 4N79A 3HHAA 3LXSA 4BOSA 3MORA 4AXLA 1SP4B 1NQCA 5EF4A 1Y08A 1GMYA 1PVJA 1O0EA 2FRAA 2PNSA 2ARYA 2FRQA 4OW0A 3N3GA 1EWLA 1TL9A 2F1GA 1CS8A 2NQIA 1F2AA 3LFYA 2OZ2A 4I05A 1ME4A 4YYVA 3CH2X 3HHIA 5EZSA 3CBKA 3QSDA 3P5WA 4W4UA 3PBHA 4MZOA 4D8IA 1CSBB 2FE8A 4RF0A 3I06A 2J7QC 2NQDB 4FK5A 2DZZA 3D6SA 3WXEA 2DCAA 4N4ZA 1EWMA 4Q8HA 4IUMA 1PPOA 4X6JA 1AYUA 4CDEB 1MEGA 1ICFA 5F02A 1XKGA 2AVWA 3PT2A 5EZQA 2AYOA 1THEA 4OVZA 4A5UA 4D8BA 2ATOA 3RVWA 2DJGB 1ZIVA 2HH5A 3U8EA 1CJLA 3AI8A 4QRVA 1PCIA 2FUDA 2AU1A 3IOQA 1TU6A 5FPWA 4G54A 1JQPA 6PADA 3CBJA 4X6HA 2XU1A 3PDFA 2AIMA 4RNAA 3TNXA 1QOLA 2PADA 3IUTA 1EF7A 3MJ5A 1CQDA 1QMYA 4N8WA 1BQIA 2DJFB 4XZXA 4MSXA 3O0UA 3O65A 2DCBA 1GECE 3QT4A 1NL6A 3ERVA 3PRPA 2R9MA 1CTEA 2FO5A 5CVNB 2E00A 2O6XA 2WBFX 4Q8GA 1PPDA 4BSQA 2Y5BA
chains in the Genus database with same CATH topology
4RF1A 3E9SA 3PHXA 2BTWB 5EZSA 4HXDB 3PHWA 4D8IA 2FE8A 4RF0A 2J7QC 4ZTBA 3W31A 3PRMA 5E6JA 4OVZB 4R3DA 2DOSA 3BB7A 4IUMA 4M0WA 5JZEA 2BTWA 2AGAA 3BBAA 2UZJA 4BOPA 3PT2A 4PT5A 5EZQA 4OVZA 4A5UA 4D8BA 3TRKA 4RKXA 3TMPA 4MI7A 1DKIA 4BOQA 3PSEA 3W30A 3B21A 4MM3B 2J7QA 3IFUA 4RNAA 5KO3A 4BOZA 2JRIA 4GUAA 3ZNHA 2HWKA 4IP3A 3MJ5A 1UKFA 3BY4A 4BOUA 4D8EA 4REZA 2BU3A 4XZXA 1YZBA 3C0RA 3O65A 4P16A 4WURA 3RNVA 2JTCA 3PRPA 4BOSA 3PHUA 1PVJA 2Z84A 3OQCA 4OW0A 3MTVA 3MP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRP A;  4BOQ A;  4BOS A;  4BOP A;  3PHX A;  3BY4 A;  4BOU A;  3PRM A;  3PT2 A;  3TMP A;  4HXD B;  4BOZ A;  3ZNH A;  3PHU A;  3PSE A;  3PHW A;  3C0R A;  5JZE A; 
#chains in the Genus database with same CATH topology
 8PCH A;  2C0Y A;  3E9S A;  4BPV A;  1AU0 A;  2YJ2 A;  1Q6K A;  2DZY A;  3C9E A;  2XU4 A;  3I3T A;  4FIP A;  4YYW A;  4PAD A;  3OF9 A;  1BY8 A;  1MEM A;  2F7D A;  4HXD B;  2E01 A;  3V6C A;  1GLO A;  1A6R A;  2FTD A;  1PXV A;  1MHW A;  4AXM A;  4OVZ B;  5EGW A;  3PW3 A;  4X6I A;  2R9F A;  2DOS A;  3KWB X;  4K7C A;  4WA6 A;  4OEL A;  4M0W A;  5PAD A;  4DMY A;  2P86 A;  1U9X A;  1STF E;  3OVZ A;  1U9W A;  1FH0 A;  2GFO A;  4ZUX U;  2AGA A;  4QRG A;  3KFQ A;  4BS6 A;  3BPM A;  2H7J A;  3P5X A;  1NB3 A;  5CVM A;  1ATK A;  2UZJ A;  3USV A;  2DC8 A;  1PAD A;  1MDW A;  3TRK A;  4RKX A;  5CHT A;  2FQ9 A;  1DKI A;  3H8B A;  4YYR A;  3H89 A;  2OUL A;  1AU2 A;  3B79 A;  4BOQ A;  4YYU A;  1QXP A;  3KKU A;  1PPP A;  4XR7 A;  5CVO B;  3F5V A;  3W30 A;  3B21 A;  4MM3 B;  5JH3 A;  3HD3 A;  2J7Q A;  2BDZ A;  2FT2 A;  2PBH A;  2P7U A;  1YAL A;  3M99 A;  5KO3 A;  4GUA A;  1UKF A;  4BOU A;  4D8E A;  1EWO A;  4REZ A;  3MTN A;  3E1Z B;  3N3K A;  2BU3 A;  4W5B A;  1F2B A;  2R9N A;  2G8J A;  2XU3 A;  4P16 A;  4XUI A;  4WUR A;  4HWY A;  3RNV A;  3DF0 A;  2JTC A;  1BP4 A;  1ME3 A;  4P6G A;  3IEJ A;  3V6E A;  3K24 A;  3PNR A;  2AS8 A;  1M6D A;  1CB5 A;  3MTV A;  3MP2 A;  1PIP A;  4RF1 A;  1AU4 A;  4YV8 A;  4I04 A;  1YT7 A;  1F2C A;  1KFX L;  3F75 A;  2YJC A;  3PHW A;  4I07 A;  1POP A;  2JQG R;  2G6D A;  4CZW A;  3KSE A;  1F29 A;  3QJ3 A;  3BWK A;  5A24 A;  1U9V A;  1PPN A;  4QH6 A;  3RVV A;  3BB7 A;  2CIO A;  2OP3 A;  5JZE A;  2AUZ A;  4PP2 E;  1QDQ A;  2R9O A;  2Y6E A;  2BTW A;  9PAP A;  3P5V A;  3CH3 X;  1BGO A;  1EWP A;  4PI3 A;  4YYQ A;  1AU3 A;  4BQV A;  3S3Q A;  2DCC A;  4PP1 A;  4CDF B;  4DMX A;  3IV2 A;  4MZS A;  5CHV A;  3K9M A;  3OIS A;  4BS5 A;  5K16 A;  3OVX A;  1AYW A;  3N4C A;  1DEU A;  3KX1 A;  3MHH A;  3BC3 A;  1YK7 A;  1NB5 A;  3BPF A;  1MIR A;  5JA7 A;  2IPP B;  1KFU L;  1VJV A;  5J94 A;  1U5I A;  1NPZ A;  1DF0 A;  2YJB A;  1GCB A;  1AYV A;  4QRX A;  2ACT A;  3OF8 A;  3IFU A;  2G8E A;  2B1N A;  2HWK A;  2AUX A;  2BDL A;  3BY4 A;  1PE6 A;  1KHP A;  4P6E A;  1YZB A;  3IHP A;  1AIM A;  1YK8 A;  2GHU A;  3IMA A;  2YJ8 A;  3WXG A;  2DCD A;  3P5U A;  4QBB A;  2E02 A;  3PHU A;  2HXZ A;  2G7Y A;  4KLB A;  4OEM A;  2Z84 A;  1U9Q X;  3OQC A;  3H7D A;  4RY2 A;  2PRE A;  3PHX A;  3RVX A;  3BOW A;  2BTW B;  2DC7 A;  3H8C A;  3WXF A;  2DC6 A;  3W31 A;  4ZTB A;  1Y4H A;  3PRM A;  5E6J A;  2R9C A;  4CDC B;  3BCN A;  4R3D A;  1ITO A;  1TLO A;  3GCB A;  2CB5 A;  2P0R A;  2DC9 A;  2E03 A;  3H6S A;  1ZCM A;  1SNK A;  3BBA A;  3MHS A;  4YYS A;  4YVA A;  4CDD B;  4FJC A;  2NQA A;  4BOP A;  4PT5 A;  2IBI A;  1YVB A;  2HD5 A;  1PBH A;  1AEC A;  3TMP A;  4MI7 A;  2B1M A;  1X9Y A;  3O1G A;  1MS6 A;  4W5C A;  2YJ9 A;  3PSE A;  3K8U A;  1VSN A;  1CPJ A;  3S3R A;  3HWN A;  1CV8 A;  1KXR A;  2AYN A;  3ZUA A;  1HUC B;  1NLJ A;  2HHN A;  1IWD A;  7PCK A;  1S4V A;  4BOZ A;  1CVZ A;  2JRI A;  3ZNH A;  2FYE A;  4IP3 A;  1KHQ A;  2R6N A;  1K3B B;  3NHE A;  2JQF R;  2NQG A;  2VHF A;  3KW9 A;  3C0R A;  2XU5 A;  3KWZ A;  2VHS A;  4N79 A;  3HHA A;  3LXS A;  4BOS A;  3MOR A;  4AXL A;  1SP4 B;  1NQC A;  5EF4 A;  1Y08 A;  1GMY A;  1PVJ A;  1O0E A;  2FRA A;  2PNS A;  2ARY A;  2FRQ A;  4OW0 A;  3N3G A;  1EWL A;  1TL9 A;  2F1G A;  1CS8 A;  2NQI A;  1F2A A;  3LFY A;  2OZ2 A;  4I05 A;  1ME4 A;  4YYV A;  3CH2 X;  3HHI A;  5EZS A;  3CBK A;  3QSD A;  3P5W A;  4W4U A;  3PBH A;  4MZO A;  4D8I A;  1CSB B;  2FE8 A;  4RF0 A;  3I06 A;  2J7Q C;  2NQD B;  4FK5 A;  2DZZ A;  3D6S A;  3WXE A;  2DCA A;  4N4Z A;  1EWM A;  4Q8H A;  4IUM A;  1PPO A;  4X6J A;  1AYU A;  4CDE B;  1MEG A;  1ICF A;  5F02 A;  1XKG A;  2AVW A;  3PT2 A;  5EZQ A;  2AYO A;  1THE A;  4OVZ A;  4A5U A;  4D8B A;  2ATO A;  3RVW A;  2DJG B;  1ZIV A;  2HH5 A;  3U8E A;  1CJL A;  3AI8 A;  4QRV A;  1PCI A;  2FUD A;  2AU1 A;  3IOQ A;  1TU6 A;  5FPW A;  4G54 A;  1JQP A;  6PAD A;  3CBJ A;  4X6H A;  2XU1 A;  3PDF A;  2AIM A;  4RNA A;  3TNX A;  1QOL A;  2PAD A;  3IUT A;  1EF7 A;  3MJ5 A;  1CQD A;  1QMY A;  4N8W A;  1BQI A;  2DJF B;  4XZX A;  4MSX A;  3O0U A;  3O65 A;  2DCB A;  1GEC E;  3QT4 A;  1NL6 A;  3ERV A;  3PRP A;  2R9M A;  1CTE A;  2FO5 A;  5CVN B;  2E00 A;  2O6X A;  2WBF X;  4Q8G A;  1PPD A;  4BSQ A;  2Y5B A; 
#chains in the Genus database with same CATH homology
 4RF1 A;  3E9S A;  3PHX A;  2BTW B;  5EZS A;  4HXD B;  3PHW A;  4D8I A;  2FE8 A;  4RF0 A;  2J7Q C;  4ZTB A;  3W31 A;  3PRM A;  5E6J A;  4OVZ B;  4R3D A;  2DOS A;  3BB7 A;  4IUM A;  4M0W A;  5JZE A;  2BTW A;  2AGA A;  3BBA A;  2UZJ A;  4BOP A;  3PT2 A;  4PT5 A;  5EZQ A;  4OVZ A;  4A5U A;  4D8B A;  3TRK A;  4RKX A;  3TMP A;  4MI7 A;  1DKI A;  4BOQ A;  3PSE A;  3W30 A;  3B21 A;  4MM3 B;  2J7Q A;  3IFU A;  4RNA A;  5KO3 A;  4BOZ A;  2JRI A;  4GUA A;  3ZNH A;  2HWK A;  4IP3 A;  3MJ5 A;  1UKF A;  3BY4 A;  4BOU A;  4D8E A;  4REZ A;  2BU3 A;  4XZX A;  1YZB A;  3C0R A;  3O65 A;  4P16 A;  4WUR A;  3RNV A;  2JTC A;  3PRP A;  4BOS A;  3PHU A;  1PVJ A;  2Z84 A;  3OQC A;  4OW0 A;  3MTV A;  3MP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...