3PRMA

Structural analysis of a viral otu domain protease from the crimean-congo hemorrhagic fever virus in complex with human ubiquitin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
161
structure length
161
Chain Sequence
DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHSYHYIKRLTESAARKYYQEEPEARLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRILPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L protein
publication title Structural analysis of a viral ovarian tumor domain protease from the crimean-congo hemorrhagic Fever virus in complex with covalently bonded ubiquitin.
pubmed doi rcsb
source organism Crimean-congo hemorrhagic fever virus
molecule tags Hydrolase/hydrolase
total genus 40
structure length 161
sequence length 161
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3prmA00
3C0RA 3TMPA 3PRMA 3PRPA 4BOUA 4BOPA 4BOQA 3PSEA 3PT2A 3BY4A 4BOZA 5JZEA 3ZNHA 4BOSA 3PHWA 4HXDB 3PHUA 3PHXA
chains in the Genus database with same CATH superfamily
5CHVA 3TNXA 1GECE 3ERVA 3BBAA 5EF4A 1MS6A 3ZNHA 2FYEA 1EWLA 5J94A 3B21A 4WURA 4A5UA 3N3KA 8PCHA 3C9EA 1GLOA 4N4ZA 4WA6A 3BC3A 9PAPA 3BY4A 3WXGA 5A24A 2AYNA 2J7QC 4QRXA 3PHXA 3H89A 2O6XA 4MI7A 2G8EA 1KFXL 2R9OA 4YV8A 1U5IA 1JQPA 1DEUA 1VSNA 3HWNA 3RVVA 1EF7A 2E00A 5FPWA 3TRKA 4MM3B 1O0EA 1YK8A 3LXSA 4PI3A 4G54A 3I06A 3S3RA 4D8EA 4OELA 1F2BA 4BS5A 3I3TA 3MORA 5PADA 1THEA 4XUIA 2YJBA 1UKFA 1AU3A 2OP3A 3QJ3A 1TL9A 4BQVA 4I05A 1AU2A 5EZSA 2DJFB 4PP2E 4IUMA 2P86A 1EWOA 2B1NA 2G6DA 2GFOA 3KFQA 5EGWA 4BS6A 1MDWA 2Y6EA 3OQCA 2BDZA 1KXRA 2YJ8A 3O0UA 3N3GA 1CS8A 5EZQA 2VHFA 4P16A 3IOQA 2E03A 3KWBX 2G7YA 3OF9A 2IPPB 1CJLA 5JZEA 3OVZA 1KFUL 2CIOA 1MHWA 1AIMA 1ITOA 1DF0A 4IP3A 4ZTBA 2WBFX 1U9XA 2NQDB 1EWMA 2F1GA 4PP1A 2H7JA 3PSEA 2HWKA 1TU6A 1ME3A 3M99A 2PREA 2R9NA 3E9SA 1MIRA 4X6IA 2PADA 4BSQA 3P5VA 1YVBA 1GMYA 4DMXA 3HHIA 4X6JA 2DC8A 4BPVA 1K3BB 3IMAA 4N8WA 1PPOA 1SP4B 4I04A 1YT7A 2XU3A 3LFYA 5JH3A 3KWZA 3NHEA 5JA7A 1BP4A 3BPFA 1SNKA 1BQIA 3OISA 3MJ5A 3KKUA 1YALA 4BOUA 1BGOA 1PADA 1A6RA 3AI8A 2JQGR 2HXZA 3PDFA 2UZJA 4W5BA 5CVNB 1KHPA 3V6EA 2FQ9A 5CVOB 2R9FA 1PPNA 2FTDA 1QMYA 1ME4A 4FK5A 1F29A 1VJVA 3CBKA 1CVZA 4D8BA 3C0RA 4GUAA 2DCDA 1MEGA 5CVMA 1BY8A 4YYSA 2FO5A 4CDEB 2Y5BA 1NB5A 1CSBB 4OW0A 2FRAA 1YK7A 2R9CA 2FE8A 1DKIA 1PIPA 4W4UA 3PBHA 3PT2A 3USVA 4D8IA 3P5WA 2DZZA 2BU3A 3P5UA 1NB3A 1U9QX 1S4VA 2FUDA 4P6GA 4YYQA 5KO3A 2AGAA 2YJCA 3KSEA 3P5XA 4RF0A 4CDCB 2XU5A 4YVAA 1CTEA 2E02A 3CH3X 2DZYA 3CBJA 2F7DA 1GCBA 4N79A 2DJGB 2NQAA 4DMYA 1PPDA 2ARYA 4QRVA 4FJCA 4BOPA 2FT2A 3BCNA 4I07A 1YZBA 1X9YA 3MTVA 2JRIA 4R3DA 4YYVA 1U9VA 3IV2A 4Q8HA 4YYUA 3BPMA 3CH2X 3V6CA 2DC6A 3QSDA 2FRQA 3KW9A 4HWYA 3GCBA 1PBHA 6PADA 2DCAA 1NL6A 4QH6A 1AU0A 2ATOA 4XR7A 1PCIA 1QDQA 2JQFR 1AYWA 1PXVA 2NQGA 4OVZB 1CQDA 2IBIA 3K9MA 1ICFA 4QRGA 3W31A 4MZSA 2VHSA 4KLBA 5E6JA 4AXLA 4BOQA 2R9MA 3WXEA 2PBHA 3IEJA 2GHUA 2OZ2A 1FH0A 1U9WA 4X6HA 3N4CA 3MTNA 3RVXA 4FIPA 3RVWA 7PCKA 1AECA 4P6EA 3F5VA 3H8BA 2P7UA 1HUCB 3H8CA 3K8UA 4BOZA 2BTWB 3MHSA 3DF0A 1AYVA 4BOSA 1PPPA 1NLJA 1QOLA 1ZIVA 4RF1A 5F02A 4OEMA 2HHNA 3BWKA 4MSXA 4XZXA 2C0YA 3B79A 4YYRA 2AS8A 1CB5A 1Y4HA 4W5CA 3S3QA 2AUZA 3BB7A 1QXPA 3H6SA 3QT4A 4YYWA 2JTCA 3IHPA 1F2CA 1AU4A 2XU1A 1PE6A 4CDFB 1NPZA 2HD5A 1XKGA 2G8JA 1F2AA 4K7CA 1CPJA 2B1MA 2J7QA 4OVZA 2AIMA 2DCBA 1PVJA 3PRMA 3TMPA 2HH5A 3O65A 1MEMA 3HD3A 5K16A 4AXMA 2R6NA 2NQIA 3PHWA 1Q6KA 1TLOA 4PT5A 3W30A 1EWPA 4ZUXU 2AVWA 1AYUA 3HHAA 4PADA 1KHQA 1POPA 4RY2A 2DC7A 1CV8A 1Y08A 3OF8A 3PRPA 2OULA 3E1ZB 5CHTA 4Q8GA 2P0RA 3PHUA 3PNRA 4MZOA 3H7DA 3F75A 3MHHA 2BTWA 3K24A 4HXDB 3KX1A 2Z84A 2YJ2A 4QBBA 4CDDB 2AYOA 1NQCA 1M6DA 2E01A 3PW3A 1STFE 1ATKA 4REZA 2ACTA 3IFUA 4RKXA 4M0WA 2AUXA 3D6SA 2DC9A 3OVXA 3IUTA 2YJ9A 4RNAA 4CZWA 1IWDA 3RNVA 3WXFA 2DOSA 3ZUAA 2BDLA 3U8EA 2CB5A 3MP2A 2XU4A 1ZCMA 2DCCA 3BOWA 2AU1A 2PNSA 3O1GA
chains in the Genus database with same CATH topology
4RF0A 3BB7A 4IP3A 4ZTBA 3BBAA 3PSEA 2JTCA 2HWKA 3ZNHA 3E9SA 3B21A 4WURA 4A5UA 4BOPA 1YZBA 3MTVA 2JRIA 4R3DA 2J7QA 3BY4A 4OVZA 2J7QC 3PHXA 1PVJA 3PRMA 3TMPA 3O65A 4MI7A 3PHWA 3MJ5A 4PT5A 3TRKA 3W30A 4MM3B 4BOUA 4D8EA 4OVZB 2UZJA 3W31A 3PRPA 5E6JA 1UKFA 3PHUA 4BOQA 2BTWA 4HXDB 4D8BA 3C0RA 2Z84A 4GUAA 5EZSA 4REZA 4IUMA 3IFUA 4RKXA 4M0WA 4OW0A 3OQCA 4RNAA 2FE8A 1DKIA 3RNVA 2DOSA 3PT2A 4BOZA 2BTWB 5EZQA 4D8IA 4BOSA 2BU3A 4P16A 3MP2A 4RF1A 5KO3A 2AGAA 5JZEA 4XZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0R A;  3TMP A;  3PRM A;  3PRP A;  4BOU A;  4BOP A;  4BOQ A;  3PSE A;  3PT2 A;  3BY4 A;  4BOZ A;  5JZE A;  3ZNH A;  4BOS A;  3PHW A;  4HXD B;  3PHU A;  3PHX A; 
#chains in the Genus database with same CATH topology
 5CHV A;  3TNX A;  1GEC E;  3ERV A;  3BBA A;  5EF4 A;  1MS6 A;  3ZNH A;  2FYE A;  1EWL A;  5J94 A;  3B21 A;  4WUR A;  4A5U A;  3N3K A;  8PCH A;  3C9E A;  1GLO A;  4N4Z A;  4WA6 A;  3BC3 A;  9PAP A;  3BY4 A;  3WXG A;  5A24 A;  2AYN A;  2J7Q C;  4QRX A;  3PHX A;  3H89 A;  2O6X A;  4MI7 A;  2G8E A;  1KFX L;  2R9O A;  4YV8 A;  1U5I A;  1JQP A;  1DEU A;  1VSN A;  3HWN A;  3RVV A;  1EF7 A;  2E00 A;  5FPW A;  3TRK A;  4MM3 B;  1O0E A;  1YK8 A;  3LXS A;  4PI3 A;  4G54 A;  3I06 A;  3S3R A;  4D8E A;  4OEL A;  1F2B A;  4BS5 A;  3I3T A;  3MOR A;  5PAD A;  1THE A;  4XUI A;  2YJB A;  1UKF A;  1AU3 A;  2OP3 A;  3QJ3 A;  1TL9 A;  4BQV A;  4I05 A;  1AU2 A;  5EZS A;  2DJF B;  4PP2 E;  4IUM A;  2P86 A;  1EWO A;  2B1N A;  2G6D A;  2GFO A;  3KFQ A;  5EGW A;  4BS6 A;  1MDW A;  2Y6E A;  3OQC A;  2BDZ A;  1KXR A;  2YJ8 A;  3O0U A;  3N3G A;  1CS8 A;  5EZQ A;  2VHF A;  4P16 A;  3IOQ A;  2E03 A;  3KWB X;  2G7Y A;  3OF9 A;  2IPP B;  1CJL A;  5JZE A;  3OVZ A;  1KFU L;  2CIO A;  1MHW A;  1AIM A;  1ITO A;  1DF0 A;  4IP3 A;  4ZTB A;  2WBF X;  1U9X A;  2NQD B;  1EWM A;  2F1G A;  4PP1 A;  2H7J A;  3PSE A;  2HWK A;  1TU6 A;  1ME3 A;  3M99 A;  2PRE A;  2R9N A;  3E9S A;  1MIR A;  4X6I A;  2PAD A;  4BSQ A;  3P5V A;  1YVB A;  1GMY A;  4DMX A;  3HHI A;  4X6J A;  2DC8 A;  4BPV A;  1K3B B;  3IMA A;  4N8W A;  1PPO A;  1SP4 B;  4I04 A;  1YT7 A;  2XU3 A;  3LFY A;  5JH3 A;  3KWZ A;  3NHE A;  5JA7 A;  1BP4 A;  3BPF A;  1SNK A;  1BQI A;  3OIS A;  3MJ5 A;  3KKU A;  1YAL A;  4BOU A;  1BGO A;  1PAD A;  1A6R A;  3AI8 A;  2JQG R;  2HXZ A;  3PDF A;  2UZJ A;  4W5B A;  5CVN B;  1KHP A;  3V6E A;  2FQ9 A;  5CVO B;  2R9F A;  1PPN A;  2FTD A;  1QMY A;  1ME4 A;  4FK5 A;  1F29 A;  1VJV A;  3CBK A;  1CVZ A;  4D8B A;  3C0R A;  4GUA A;  2DCD A;  1MEG A;  5CVM A;  1BY8 A;  4YYS A;  2FO5 A;  4CDE B;  2Y5B A;  1NB5 A;  1CSB B;  4OW0 A;  2FRA A;  1YK7 A;  2R9C A;  2FE8 A;  1DKI A;  1PIP A;  4W4U A;  3PBH A;  3PT2 A;  3USV A;  4D8I A;  3P5W A;  2DZZ A;  2BU3 A;  3P5U A;  1NB3 A;  1U9Q X;  1S4V A;  2FUD A;  4P6G A;  4YYQ A;  5KO3 A;  2AGA A;  2YJC A;  3KSE A;  3P5X A;  4RF0 A;  4CDC B;  2XU5 A;  4YVA A;  1CTE A;  2E02 A;  3CH3 X;  2DZY A;  3CBJ A;  2F7D A;  1GCB A;  4N79 A;  2DJG B;  2NQA A;  4DMY A;  1PPD A;  2ARY A;  4QRV A;  4FJC A;  4BOP A;  2FT2 A;  3BCN A;  4I07 A;  1YZB A;  1X9Y A;  3MTV A;  2JRI A;  4R3D A;  4YYV A;  1U9V A;  3IV2 A;  4Q8H A;  4YYU A;  3BPM A;  3CH2 X;  3V6C A;  2DC6 A;  3QSD A;  2FRQ A;  3KW9 A;  4HWY A;  3GCB A;  1PBH A;  6PAD A;  2DCA A;  1NL6 A;  4QH6 A;  1AU0 A;  2ATO A;  4XR7 A;  1PCI A;  1QDQ A;  2JQF R;  1AYW A;  1PXV A;  2NQG A;  4OVZ B;  1CQD A;  2IBI A;  3K9M A;  1ICF A;  4QRG A;  3W31 A;  4MZS A;  2VHS A;  4KLB A;  5E6J A;  4AXL A;  4BOQ A;  2R9M A;  3WXE A;  2PBH A;  3IEJ A;  2GHU A;  2OZ2 A;  1FH0 A;  1U9W A;  4X6H A;  3N4C A;  3MTN A;  3RVX A;  4FIP A;  3RVW A;  7PCK A;  1AEC A;  4P6E A;  3F5V A;  3H8B A;  2P7U A;  1HUC B;  3H8C A;  3K8U A;  4BOZ A;  2BTW B;  3MHS A;  3DF0 A;  1AYV A;  4BOS A;  1PPP A;  1NLJ A;  1QOL A;  1ZIV A;  4RF1 A;  5F02 A;  4OEM A;  2HHN A;  3BWK A;  4MSX A;  4XZX A;  2C0Y A;  3B79 A;  4YYR A;  2AS8 A;  1CB5 A;  1Y4H A;  4W5C A;  3S3Q A;  2AUZ A;  3BB7 A;  1QXP A;  3H6S A;  3QT4 A;  4YYW A;  2JTC A;  3IHP A;  1F2C A;  1AU4 A;  2XU1 A;  1PE6 A;  4CDF B;  1NPZ A;  2HD5 A;  1XKG A;  2G8J A;  1F2A A;  4K7C A;  1CPJ A;  2B1M A;  2J7Q A;  4OVZ A;  2AIM A;  2DCB A;  1PVJ A;  3PRM A;  3TMP A;  2HH5 A;  3O65 A;  1MEM A;  3HD3 A;  5K16 A;  4AXM A;  2R6N A;  2NQI A;  3PHW A;  1Q6K A;  1TLO A;  4PT5 A;  3W30 A;  1EWP A;  4ZUX U;  2AVW A;  1AYU A;  3HHA A;  4PAD A;  1KHQ A;  1POP A;  4RY2 A;  2DC7 A;  1CV8 A;  1Y08 A;  3OF8 A;  3PRP A;  2OUL A;  3E1Z B;  5CHT A;  4Q8G A;  2P0R A;  3PHU A;  3PNR A;  4MZO A;  3H7D A;  3F75 A;  3MHH A;  2BTW A;  3K24 A;  4HXD B;  3KX1 A;  2Z84 A;  2YJ2 A;  4QBB A;  4CDD B;  2AYO A;  1NQC A;  1M6D A;  2E01 A;  3PW3 A;  1STF E;  1ATK A;  4REZ A;  2ACT A;  3IFU A;  4RKX A;  4M0W A;  2AUX A;  3D6S A;  2DC9 A;  3OVX A;  3IUT A;  2YJ9 A;  4RNA A;  4CZW A;  1IWD A;  3RNV A;  3WXF A;  2DOS A;  3ZUA A;  2BDL A;  3U8E A;  2CB5 A;  3MP2 A;  2XU4 A;  1ZCM A;  2DCC A;  3BOW A;  2AU1 A;  2PNS A;  3O1G A; 
#chains in the Genus database with same CATH homology
 4RF0 A;  3BB7 A;  4IP3 A;  4ZTB A;  3BBA A;  3PSE A;  2JTC A;  2HWK A;  3ZNH A;  3E9S A;  3B21 A;  4WUR A;  4A5U A;  4BOP A;  1YZB A;  3MTV A;  2JRI A;  4R3D A;  2J7Q A;  3BY4 A;  4OVZ A;  2J7Q C;  3PHX A;  1PVJ A;  3PRM A;  3TMP A;  3O65 A;  4MI7 A;  3PHW A;  3MJ5 A;  4PT5 A;  3TRK A;  3W30 A;  4MM3 B;  4BOU A;  4D8E A;  4OVZ B;  2UZJ A;  3W31 A;  3PRP A;  5E6J A;  1UKF A;  3PHU A;  4BOQ A;  2BTW A;  4HXD B;  4D8B A;  3C0R A;  2Z84 A;  4GUA A;  5EZS A;  4REZ A;  4IUM A;  3IFU A;  4RKX A;  4M0W A;  4OW0 A;  3OQC A;  4RNA A;  2FE8 A;  1DKI A;  3RNV A;  2DOS A;  3PT2 A;  4BOZ A;  2BTW B;  5EZQ A;  4D8I A;  4BOS A;  2BU3 A;  4P16 A;  3MP2 A;  4RF1 A;  5KO3 A;  2AGA A;  5JZE A;  4XZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...