1POPA

X-ray crystallographic structure of a papain-leupeptin complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
publication title X-ray crystallographic structure of a papain-leupeptin complex.
pubmed doi rcsb
source organism Carica papaya
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1popA00
2YJBA 3RVVA 3PNRA 4X6HA 4QRXA 1MEMA 4CZWA 2E00A 4BSQA 2G8JA 4HWYA 1YK8A 4P6GA 3U8EA 1U9WA 3TNXA 1CQDA 1GECE 1SNKA 2AYNA 1TU6A 1X9YA 2B1MA 3LXSA 4I05A 1EWPA 4W4UA 3P5UA 1CPJA 1O0EA 3OVXA 3QT4A 1KFUL 2Y6EA 4FJCA 1BGOA 4I04A 1CTEA 2C0YA 1CB5A 2FQ9A 1EWOA 3K24A 1FH0A 2G6DA 3RVXA 4FK5A 3I06A 2AUXA 1ZCMA 2GFOA 3H6SA 1Y08A 3BWKA 1KXRA 1NB3A 3O0UA 5FPWA 5K16A 1GMYA 3OVZA 4P6EA 4CDEB 1YALA 1AYUA 2FRQA 3C9EA 3WXGA 1NL6A 1VJVA 3I3TA 2FO5A 2DC6A 5CVNB 3BPFA 3QSDA 3CBJA 3H8BA 1MHWA 2R6NA 2AS8A 1CVZA 2HXZA 1K3BB 3RVWA 1QXPA 4X6JA 1ME4A 4YYQA 8PCHA 2DJFB 1POPA 3KW9A 4YVAA 4PADA 2DCCA 2R9CA 3S3QA 2GHUA 1XKGA 2NQAA 4KLBA 2AIMA 1ME3A 1PIPA 1NLJA 4MZSA 3BOWA 3QJ3A 1F2CA 2JQFR 3MHHA 1NPZA 1ZIVA 1YVBA 2OP3A 2P7UA 4OEMA 3LFYA 5EF4A 2AVWA 3ZUAA 1AIMA 5PADA 1PPOA 4QRGA 4FIPA 4N4ZA 1ATKA 2CB5A 3F5VA 4QBBA 4G54A 3H89A 1IWDA 2G7YA 3OISA 5CVOB 1PPNA 7PCKA 4YYSA 4PI3A 4AXMA 2PNSA 2E02A 3KKUA 4YYUA 4I07A 3BC3A 1U9XA 3NHEA 2FUDA 1M6DA 2IPPB 3HD3A 3N4CA 2B1NA 1CS8A 3N3GA 4X6IA 3IV2A 1MDWA 9PAPA 4AXLA 4CDFB 1S4VA 5F02A 2DC8A 4BPVA 2FRAA 3BCNA 1NQCA 1F29A 2OZ2A 3IMAA 2HH5A 1F2AA 2DC9A 1HUCB 1BY8A 2ATOA 1AYVA 2R9FA 1STFE 4XUIA 4BQVA 1ITOA 1VSNA 1A6RA 3MTNA 3KWZA 3WXFA 3CH3X 3O1GA 4N79A 1U5IA 4YYVA 4QRVA 2BDZA 2IBIA 3P5VA 4YV8A 1AECA 2DZYA 1PADA 1MIRA 2PADA 2XU4A 4BS6A 5CHTA 1GLOA 4DMXA 3MHSA 1PCIA 2YJ9A 4K7CA 3IOQA 3H8CA 1PPDA 2FYEA 3OF8A 1MS6A 4QH6A 1QMYA 2NQDB 3DF0A 1KHQA 2JQGR 4W5BA 3HHAA 2NQGA 3OF9A 1BQIA 3B79A 2G8EA 5CHVA 1BP4A 2DZZA 3D6SA 1GCBA 1ICFA 1EWLA 1NB5A 3KFQA 6PADA 1EF7A 4PP1A 3N3KA 3IUTA 3AI8A 1AU4A 2PBHA 1CJLA 1DF0A 1U9VA 2DC7A 3E1ZB 2YJ8A 2VHSA 2OULA 4CDDB 1PPPA 2AUZA 5EGWA 1U9QX 3S3RA 2F7DA 1QOLA 3PDFA 1KFXL 3KSEA 5J94A 5JA7A 4DMYA 1QDQA 2R9NA 1YK7A 1PE6A 1PBHA 2R9MA 3HWNA 2DCAA 2O6XA 3ERVA 4N8WA 2ARYA 1AU3A 2FT2A 3BPMA 3WXEA 3K9MA 4Q8HA 1KHPA 1CSBB 1Q6KA 2CIOA 3GCBA 3F75A 1SP4B 3KWBX 2P86A 1MEGA 1THEA 4BS5A 3CH2X 2ACTA 3CBKA 5A24A 1JQPA 1DEUA 1AYWA 1F2BA 3K8UA 3USVA 4MZOA 3KX1A 2F1GA 2WBFX 2PREA 4Q8GA 3MORA 4ZUXU 4YYWA 1CV8A 2XU1A 3H7DA 2E01A 2AYOA 4PP2E 2H7JA 2HD5A 2HHNA 3IHPA 2YJ2A 2DJGB 3IEJA 4CDCB 2BDLA 4WA6A 1Y4HA 5JH3A 3PW3A 3PBHA 2DCBA 1EWMA 4RY2A 1TL9A 1AU2A 3HHIA 4MSXA 1PXVA 5CVMA 2Y5BA 2AU1A 3P5XA 3V6CA 4YYRA 2FTDA 1YT7A 2XU5A 4XR7A 4W5CA 3P5WA 1TLOA 2NQIA 3V6EA 2VHFA 2E03A 3M99A 2R9OA 2XU3A 4OELA 2P0RA 2YJCA 1AU0A 2DCDA
chains in the Genus database with same CATH superfamily
2YJBA 3RVVA 3PNRA 4X6HA 4QRXA 1MEMA 4CZWA 2E00A 4BSQA 3TRKA 2G8JA 4HWYA 4REZA 1YK8A 4P6GA 3U8EA 3RNVA 1U9WA 3TNXA 1CQDA 1GECE 1SNKA 2AYNA 1TU6A 1X9YA 2B1MA 3LXSA 4I05A 3TMPA 1EWPA 1DKIA 4W4UA 3P5UA 1CPJA 1O0EA 3OVXA 3QT4A 3BY4A 1KFUL 2Y6EA 4FJCA 1BGOA 4I04A 1CTEA 2C0YA 1CB5A 2FQ9A 1EWOA 3K24A 1FH0A 2G6DA 4OVZB 3RVXA 4FK5A 3I06A 2AUXA 1ZCMA 2GFOA 3H6SA 5E6JA 1Y08A 3BWKA 1KXRA 1NB3A 3O0UA 5FPWA 5K16A 1GMYA 4ZTBA 3OVZA 4P6EA 4CDEB 4D8EA 1YALA 4PT5A 1AYUA 4IUMA 2J7QC 2FRQA 3C9EA 3WXGA 1NL6A 1VJVA 2JRIA 3I3TA 3OQCA 2FO5A 2DC6A 5CVNB 3PSEA 3BPFA 3QSDA 3CBJA 3H8BA 1MHWA 2R6NA 2AS8A 1CVZA 2HXZA 1K3BB 1UKFA 3RVWA 1QXPA 4R3DA 4X6JA 1ME4A 4MI7A 4YYQA 8PCHA 2DJFB 5KO3A 1POPA 3KW9A 4YVAA 4PADA 3W31A 2DCCA 4HXDB 2R9CA 3S3QA 2GHUA 1XKGA 2NQAA 4KLBA 2AIMA 2FE8A 1ME3A 1PIPA 3MJ5A 4D8IA 1NLJA 4MZSA 3BOWA 3QJ3A 1F2CA 2BTWA 2JQFR 3MHHA 1NPZA 1ZIVA 4D8BA 1YVBA 2OP3A 2P7UA 5EZQA 4OEMA 3LFYA 5EF4A 2AVWA 3ZUAA 1AIMA 5PADA 1PPOA 4QRGA 4FIPA 4N4ZA 1ATKA 2CB5A 4M0WA 3F5VA 4QBBA 4G54A 3H89A 4OW0A 1IWDA 4IP3A 2G7YA 3OISA 5CVOB 1PPNA 7PCKA 4YYSA 4PI3A 4AXMA 2PNSA 2E02A 3KKUA 4YYUA 4BOZA 4I07A 3BC3A 1U9XA 2AGAA 3NHEA 2FUDA 1M6DA 2IPPB 4BOSA 3HD3A 3N4CA 2B1NA 2Z84A 3BB7A 1CS8A 3PHWA 3N3GA 2DOSA 4X6IA 3IV2A 1MDWA 9PAPA 4AXLA 4CDFB 1S4VA 5F02A 2DC8A 4BPVA 2FRAA 3BCNA 1NQCA 1F29A 2OZ2A 4A5UA 3IMAA 2HH5A 1F2AA 4BOUA 2DC9A 1HUCB 1BY8A 2JTCA 2ATOA 1AYVA 2R9FA 1STFE 4XUIA 4BQVA 3IFUA 1ITOA 1VSNA 1A6RA 3MTNA 2J7QA 3KWZA 3WXFA 3PHXA 3CH3X 3C0RA 3O1GA 4N79A 1U5IA 3MTVA 4YYVA 4QRVA 2BDZA 2IBIA 3P5VA 5EZSA 4YV8A 1AECA 2DZYA 1PADA 1MIRA 2PADA 2XU4A 3E9SA 4BS6A 5CHTA 1GLOA 4DMXA 3MHSA 1PCIA 2YJ9A 4K7CA 3IOQA 3H8CA 2BTWB 1PPDA 2FYEA 3OF8A 1MS6A 4QH6A 4BOPA 3PRMA 1QMYA 2NQDB 3MP2A 3DF0A 1KHQA 2JQGR 4W5BA 3HHAA 2NQGA 3OF9A 1BQIA 3B79A 2G8EA 5CHVA 1BP4A 3BBAA 2DZZA 3D6SA 2UZJA 1GCBA 5JZEA 1ICFA 1EWLA 1NB5A 3O65A 3KFQA 6PADA 1PVJA 1EF7A 4PP1A 3N3KA 3IUTA 4XZXA 3AI8A 1AU4A 2PBHA 1CJLA 1DF0A 1U9VA 2DC7A 3E1ZB 2YJ8A 2VHSA 2OULA 4CDDB 1YZBA 1PPPA 2AUZA 5EGWA 1U9QX 3S3RA 2F7DA 1QOLA 3PDFA 4P16A 1KFXL 3KSEA 5J94A 5JA7A 4GUAA 4DMYA 1QDQA 2R9NA 1YK7A 3B21A 1PE6A 4RF0A 1PBHA 2R9MA 2HWKA 3HWNA 2DCAA 2O6XA 3ERVA 4N8WA 2ARYA 1AU3A 2FT2A 3BPMA 3WXEA 3K9MA 4Q8HA 1KHPA 1CSBB 1Q6KA 2CIOA 4OVZA 3GCBA 3F75A 1SP4B 3KWBX 4BOQA 2P86A 1MEGA 1THEA 4RNAA 3CH2X 4BS5A 2ACTA 3W30A 3CBKA 5A24A 3PHUA 1JQPA 1DEUA 1AYWA 1F2BA 3K8UA 3USVA 3ZNHA 4MZOA 3KX1A 2F1GA 2WBFX 2PREA 4Q8GA 3MORA 4ZUXU 4YYWA 1CV8A 2XU1A 4WURA 3H7DA 2E01A 2AYOA 4PP2E 2H7JA 2HD5A 2HHNA 3IHPA 2YJ2A 2DJGB 4RKXA 3IEJA 4CDCB 3PRPA 2BDLA 4WA6A 1Y4HA 5JH3A 3PW3A 3PBHA 2DCBA 1EWMA 4RY2A 1TL9A 1AU2A 3HHIA 4MSXA 1PXVA 5CVMA 2Y5BA 2AU1A 3P5XA 3V6CA 4YYRA 4MM3B 2FTDA 1YT7A 3PT2A 2BU3A 2XU5A 4XR7A 4RF1A 4W5CA 3P5WA 1TLOA 2NQIA 3V6EA 2VHFA 2E03A 3M99A 2R9OA 2XU3A 4OELA 2P0RA 2YJCA 1AU0A 2DCDA
chains in the Genus database with same CATH topology
2YJBA 3RVVA 3PNRA 4GUZA 4QRXA 4X6HA 1MEMA 4CZWA 2E00A 4BSQA 2G8JA 4HWYA 1YK8A 4P6GA 3U8EA 4C5PA 1U9WA 3TNXA 1CQDA 1GECE 1SNKA 2AYNA 1TU6A 1X9YA 2B1MA 3LXSA 4I05A 1EWPA 4W4UA 3P5UA 1CPJA 1O0EA 3OVXA 3QT4A 1KFUL 2Y6EA 4FJCA 1BGOA 4I04A 1CTEA 2C0YA 1CB5A 2FQ9A 1EWOA 4BGFA 3K24A 1FH0A 2G6DA 3RVXA 4FK5A 3I06A 2AUXA 1ZCMA 2GFOA 3H6SA 1Y08A 3BWKA 1KXRA 1NB3A 3O0UA 5FPWA 5K16A 1GMYA 3OVZA 4P6EA 4CDEB 1YALA 1AYUA 2FRQA 3C9EA 3WXGA 1NL6A 1VJVA 3I3TA 2FO5A 2DC6A 5CVNB 3BPFA 3QSDA 3CBJA 3H8BA 1MHWA 2R6NA 2AS8A 1CVZA 2HXZA 1K3BB 3RVWA 1QXPA 4X6JA 1ME4A 4YYQA 8PCHA 2DJFB 1POPA 3KW9A 4YVAA 4PADA 2DCCA 2R9CA 4NV8A 3S3QA 2GHUA 3LTWA 1XKGA 2NQAA 4KLBA 2AIMA 1ME3A 1PIPA 1NLJA 4MZSA 3BOWA 3QJ3A 1F2CA 2JQFR 3MHHA 1NPZA 1ZIVA 1YVBA 2OP3A 2P7UA 4OEMA 3LFYA 5EF4A 2AVWA 3ZUAA 1AIMA 5PADA 1PPOA 4QRGA 4FIPA 4N4ZA 1E2TA 1ATKA 2CB5A 3F5VA 4QBBA 4G54A 3H89A 1IWDA 2G7YA 3OISA 5CVOB 4B55A 1PPNA 7PCKA 4YYSA 4PI3A 4AXMA 2PNSA 2E02A 3KKUA 4YYUA 4I07A 3BC3A 1U9XA 1GX3A 3NHEA 2FUDA 1M6DA 2IPPB 3HD3A 3N4CA 2B1NA 1CS8A 1W6FA 3N3GA 4X6IA 3IV2A 1MDWA 9PAPA 4AXLA 4CDFB 1S4VA 4NV7A 5F02A 2DC8A 4BPVA 2FRAA 3BCNA 1NQCA 1F29A 2OZ2A 3IMAA 2HH5A 1F2AA 2DC9A 1HUCB 1BY8A 2ATOA 1AYVA 2R9FA 1STFE 4XUIA 4BQVA 1ITOA 1VSNA 1A6RA 1W4TA 3MTNA 3KWZA 3WXFA 3CH3X 3O1GA 4N79A 1U5IA 4YYVA 4QRVA 2BDZA 2IBIA 3P5VA 4YV8A 1AECA 2DZYA 1PADA 2BSZA 1MIRA 2PADA 2XU4A 4BS6A 5CHTA 1GLOA 4DMXA 3MHSA 1PCIA 2YJ9A 4K7CA 3IOQA 3H8CA 1PPDA 2FYEA 3OF8A 1MS6A 4QH6A 1QMYA 2VFCA 2NQDB 3D9WA 3DF0A 1KHQA 2JQGR 4W5BA 3HHAA 2NQGA 3OF9A 1BQIA 3B79A 2G8EA 5CHVA 1BP4A 2DZZA 3D6SA 1GCBA 1W5RA 1ICFA 1EWLA 1NB5A 3KFQA 6PADA 1EF7A 4PP1A 3N3KA 3IUTA 3AI8A 1AU4A 2PBHA 1CJLA 1DF0A 1U9VA 2DC7A 3E1ZB 2YJ8A 2VHSA 2OULA 4CDDB 1PPPA 2AUZA 5EGWA 1U9QX 3S3RA 2F7DA 1QOLA 3PDFA 1KFXL 3KSEA 5J94A 5JA7A 4DMYA 1QDQA 2R9NA 1YK7A 1PE6A 1PBHA 2R9MA 3HWNA 2DCAA 2O6XA 3ERVA 4N8WA 2ARYA 1AU3A 2FT2A 3BPMA 3WXEA 3K9MA 4Q8HA 1KHPA 1CSBB 1Q6KA 2CIOA 3GCBA 3F75A 1SP4B 3KWBX 2P86A 1MEGA 1THEA 4BS5A 3CH2X 2ACTA 3CBKA 5A24A 1JQPA 1DEUA 1AYWA 1F2BA 3K8UA 3USVA 4MZOA 3KX1A 2F1GA 2WBFX 2PREA 4Q8GA 3MORA 4ZUXU 4YYWA 1CV8A 2XU1A 3H7DA 2E01A 2AYOA 4PP2E 2VFBA 2H7JA 2HD5A 2HHNA 3IHPA 2YJ2A 2DJGB 3IEJA 4CDCB 2BDLA 4WA6A 1Y4HA 5JH3A 3PW3A 3PBHA 2DCBA 1EWMA 4RY2A 1TL9A 1AU2A 3HHIA 4MSXA 1PXVA 5CVMA 2Y5BA 2AU1A 3P5XA 3V6CA 4YYRA 2FTDA 1YT7A 2XU5A 4XR7A 4W5CA 3P5WA 1TLOA 2NQIA 3V6EA 2VHFA 2E03A 3M99A 2R9OA 2XU3A 4OELA 2P0RA 2YJCA 1AU0A 2DCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJB A;  3RVV A;  3PNR A;  4X6H A;  4QRX A;  1MEM A;  4CZW A;  2E00 A;  4BSQ A;  2G8J A;  4HWY A;  1YK8 A;  4P6G A;  3U8E A;  1U9W A;  3TNX A;  1CQD A;  1GEC E;  1SNK A;  2AYN A;  1TU6 A;  1X9Y A;  2B1M A;  3LXS A;  4I05 A;  1EWP A;  4W4U A;  3P5U A;  1CPJ A;  1O0E A;  3OVX A;  3QT4 A;  1KFU L;  2Y6E A;  4FJC A;  1BGO A;  4I04 A;  1CTE A;  2C0Y A;  1CB5 A;  2FQ9 A;  1EWO A;  3K24 A;  1FH0 A;  2G6D A;  3RVX A;  4FK5 A;  3I06 A;  2AUX A;  1ZCM A;  2GFO A;  3H6S A;  1Y08 A;  3BWK A;  1KXR A;  1NB3 A;  3O0U A;  5FPW A;  5K16 A;  1GMY A;  3OVZ A;  4P6E A;  4CDE B;  1YAL A;  1AYU A;  2FRQ A;  3C9E A;  3WXG A;  1NL6 A;  1VJV A;  3I3T A;  2FO5 A;  2DC6 A;  5CVN B;  3BPF A;  3QSD A;  3CBJ A;  3H8B A;  1MHW A;  2R6N A;  2AS8 A;  1CVZ A;  2HXZ A;  1K3B B;  3RVW A;  1QXP A;  4X6J A;  1ME4 A;  4YYQ A;  8PCH A;  2DJF B;  1POP A;  3KW9 A;  4YVA A;  4PAD A;  2DCC A;  2R9C A;  3S3Q A;  2GHU A;  1XKG A;  2NQA A;  4KLB A;  2AIM A;  1ME3 A;  1PIP A;  1NLJ A;  4MZS A;  3BOW A;  3QJ3 A;  1F2C A;  2JQF R;  3MHH A;  1NPZ A;  1ZIV A;  1YVB A;  2OP3 A;  2P7U A;  4OEM A;  3LFY A;  5EF4 A;  2AVW A;  3ZUA A;  1AIM A;  5PAD A;  1PPO A;  4QRG A;  4FIP A;  4N4Z A;  1ATK A;  2CB5 A;  3F5V A;  4QBB A;  4G54 A;  3H89 A;  1IWD A;  2G7Y A;  3OIS A;  5CVO B;  1PPN A;  7PCK A;  4YYS A;  4PI3 A;  4AXM A;  2PNS A;  2E02 A;  3KKU A;  4YYU A;  4I07 A;  3BC3 A;  1U9X A;  3NHE A;  2FUD A;  1M6D A;  2IPP B;  3HD3 A;  3N4C A;  2B1N A;  1CS8 A;  3N3G A;  4X6I A;  3IV2 A;  1MDW A;  9PAP A;  4AXL A;  4CDF B;  1S4V A;  5F02 A;  2DC8 A;  4BPV A;  2FRA A;  3BCN A;  1NQC A;  1F29 A;  2OZ2 A;  3IMA A;  2HH5 A;  1F2A A;  2DC9 A;  1HUC B;  1BY8 A;  2ATO A;  1AYV A;  2R9F A;  1STF E;  4XUI A;  4BQV A;  1ITO A;  1VSN A;  1A6R A;  3MTN A;  3KWZ A;  3WXF A;  3CH3 X;  3O1G A;  4N79 A;  1U5I A;  4YYV A;  4QRV A;  2BDZ A;  2IBI A;  3P5V A;  4YV8 A;  1AEC A;  2DZY A;  1PAD A;  1MIR A;  2PAD A;  2XU4 A;  4BS6 A;  5CHT A;  1GLO A;  4DMX A;  3MHS A;  1PCI A;  2YJ9 A;  4K7C A;  3IOQ A;  3H8C A;  1PPD A;  2FYE A;  3OF8 A;  1MS6 A;  4QH6 A;  1QMY A;  2NQD B;  3DF0 A;  1KHQ A;  2JQG R;  4W5B A;  3HHA A;  2NQG A;  3OF9 A;  1BQI A;  3B79 A;  2G8E A;  5CHV A;  1BP4 A;  2DZZ A;  3D6S A;  1GCB A;  1ICF A;  1EWL A;  1NB5 A;  3KFQ A;  6PAD A;  1EF7 A;  4PP1 A;  3N3K A;  3IUT A;  3AI8 A;  1AU4 A;  2PBH A;  1CJL A;  1DF0 A;  1U9V A;  2DC7 A;  3E1Z B;  2YJ8 A;  2VHS A;  2OUL A;  4CDD B;  1PPP A;  2AUZ A;  5EGW A;  1U9Q X;  3S3R A;  2F7D A;  1QOL A;  3PDF A;  1KFX L;  3KSE A;  5J94 A;  5JA7 A;  4DMY A;  1QDQ A;  2R9N A;  1YK7 A;  1PE6 A;  1PBH A;  2R9M A;  3HWN A;  2DCA A;  2O6X A;  3ERV A;  4N8W A;  2ARY A;  1AU3 A;  2FT2 A;  3BPM A;  3WXE A;  3K9M A;  4Q8H A;  1KHP A;  1CSB B;  1Q6K A;  2CIO A;  3GCB A;  3F75 A;  1SP4 B;  3KWB X;  2P86 A;  1MEG A;  1THE A;  4BS5 A;  3CH2 X;  2ACT A;  3CBK A;  5A24 A;  1JQP A;  1DEU A;  1AYW A;  1F2B A;  3K8U A;  3USV A;  4MZO A;  3KX1 A;  2F1G A;  2WBF X;  2PRE A;  4Q8G A;  3MOR A;  4ZUX U;  4YYW A;  1CV8 A;  2XU1 A;  3H7D A;  2E01 A;  2AYO A;  4PP2 E;  2H7J A;  2HD5 A;  2HHN A;  3IHP A;  2YJ2 A;  2DJG B;  3IEJ A;  4CDC B;  2BDL A;  4WA6 A;  1Y4H A;  5JH3 A;  3PW3 A;  3PBH A;  2DCB A;  1EWM A;  4RY2 A;  1TL9 A;  1AU2 A;  3HHI A;  4MSX A;  1PXV A;  5CVM A;  2Y5B A;  2AU1 A;  3P5X A;  3V6C A;  4YYR A;  2FTD A;  1YT7 A;  2XU5 A;  4XR7 A;  4W5C A;  3P5W A;  1TLO A;  2NQI A;  3V6E A;  2VHF A;  2E03 A;  3M99 A;  2R9O A;  2XU3 A;  4OEL A;  2P0R A;  2YJC A;  1AU0 A;  2DCD A; 
#chains in the Genus database with same CATH topology
 2YJB A;  3RVV A;  3PNR A;  4X6H A;  4QRX A;  1MEM A;  4CZW A;  2E00 A;  4BSQ A;  3TRK A;  2G8J A;  4HWY A;  4REZ A;  1YK8 A;  4P6G A;  3U8E A;  3RNV A;  1U9W A;  3TNX A;  1CQD A;  1GEC E;  1SNK A;  2AYN A;  1TU6 A;  1X9Y A;  2B1M A;  3LXS A;  4I05 A;  3TMP A;  1EWP A;  1DKI A;  4W4U A;  3P5U A;  1CPJ A;  1O0E A;  3OVX A;  3QT4 A;  3BY4 A;  1KFU L;  2Y6E A;  4FJC A;  1BGO A;  4I04 A;  1CTE A;  2C0Y A;  1CB5 A;  2FQ9 A;  1EWO A;  3K24 A;  1FH0 A;  2G6D A;  4OVZ B;  3RVX A;  4FK5 A;  3I06 A;  2AUX A;  1ZCM A;  2GFO A;  3H6S A;  5E6J A;  1Y08 A;  3BWK A;  1KXR A;  1NB3 A;  3O0U A;  5FPW A;  5K16 A;  1GMY A;  4ZTB A;  3OVZ A;  4P6E A;  4CDE B;  4D8E A;  1YAL A;  4PT5 A;  1AYU A;  4IUM A;  2J7Q C;  2FRQ A;  3C9E A;  3WXG A;  1NL6 A;  1VJV A;  2JRI A;  3I3T A;  3OQC A;  2FO5 A;  2DC6 A;  5CVN B;  3PSE A;  3BPF A;  3QSD A;  3CBJ A;  3H8B A;  1MHW A;  2R6N A;  2AS8 A;  1CVZ A;  2HXZ A;  1K3B B;  1UKF A;  3RVW A;  1QXP A;  4R3D A;  4X6J A;  1ME4 A;  4MI7 A;  4YYQ A;  8PCH A;  2DJF B;  5KO3 A;  1POP A;  3KW9 A;  4YVA A;  4PAD A;  3W31 A;  2DCC A;  4HXD B;  2R9C A;  3S3Q A;  2GHU A;  1XKG A;  2NQA A;  4KLB A;  2AIM A;  2FE8 A;  1ME3 A;  1PIP A;  3MJ5 A;  4D8I A;  1NLJ A;  4MZS A;  3BOW A;  3QJ3 A;  1F2C A;  2BTW A;  2JQF R;  3MHH A;  1NPZ A;  1ZIV A;  4D8B A;  1YVB A;  2OP3 A;  2P7U A;  5EZQ A;  4OEM A;  3LFY A;  5EF4 A;  2AVW A;  3ZUA A;  1AIM A;  5PAD A;  1PPO A;  4QRG A;  4FIP A;  4N4Z A;  1ATK A;  2CB5 A;  4M0W A;  3F5V A;  4QBB A;  4G54 A;  3H89 A;  4OW0 A;  1IWD A;  4IP3 A;  2G7Y A;  3OIS A;  5CVO B;  1PPN A;  7PCK A;  4YYS A;  4PI3 A;  4AXM A;  2PNS A;  2E02 A;  3KKU A;  4YYU A;  4BOZ A;  4I07 A;  3BC3 A;  1U9X A;  2AGA A;  3NHE A;  2FUD A;  1M6D A;  2IPP B;  4BOS A;  3HD3 A;  3N4C A;  2B1N A;  2Z84 A;  3BB7 A;  1CS8 A;  3PHW A;  3N3G A;  2DOS A;  4X6I A;  3IV2 A;  1MDW A;  9PAP A;  4AXL A;  4CDF B;  1S4V A;  5F02 A;  2DC8 A;  4BPV A;  2FRA A;  3BCN A;  1NQC A;  1F29 A;  2OZ2 A;  4A5U A;  3IMA A;  2HH5 A;  1F2A A;  4BOU A;  2DC9 A;  1HUC B;  1BY8 A;  2JTC A;  2ATO A;  1AYV A;  2R9F A;  1STF E;  4XUI A;  4BQV A;  3IFU A;  1ITO A;  1VSN A;  1A6R A;  3MTN A;  2J7Q A;  3KWZ A;  3WXF A;  3PHX A;  3CH3 X;  3C0R A;  3O1G A;  4N79 A;  1U5I A;  3MTV A;  4YYV A;  4QRV A;  2BDZ A;  2IBI A;  3P5V A;  5EZS A;  4YV8 A;  1AEC A;  2DZY A;  1PAD A;  1MIR A;  2PAD A;  2XU4 A;  3E9S A;  4BS6 A;  5CHT A;  1GLO A;  4DMX A;  3MHS A;  1PCI A;  2YJ9 A;  4K7C A;  3IOQ A;  3H8C A;  2BTW B;  1PPD A;  2FYE A;  3OF8 A;  1MS6 A;  4QH6 A;  4BOP A;  3PRM A;  1QMY A;  2NQD B;  3MP2 A;  3DF0 A;  1KHQ A;  2JQG R;  4W5B A;  3HHA A;  2NQG A;  3OF9 A;  1BQI A;  3B79 A;  2G8E A;  5CHV A;  1BP4 A;  3BBA A;  2DZZ A;  3D6S A;  2UZJ A;  1GCB A;  5JZE A;  1ICF A;  1EWL A;  1NB5 A;  3O65 A;  3KFQ A;  6PAD A;  1PVJ A;  1EF7 A;  4PP1 A;  3N3K A;  3IUT A;  4XZX A;  3AI8 A;  1AU4 A;  2PBH A;  1CJL A;  1DF0 A;  1U9V A;  2DC7 A;  3E1Z B;  2YJ8 A;  2VHS A;  2OUL A;  4CDD B;  1YZB A;  1PPP A;  2AUZ A;  5EGW A;  1U9Q X;  3S3R A;  2F7D A;  1QOL A;  3PDF A;  4P16 A;  1KFX L;  3KSE A;  5J94 A;  5JA7 A;  4GUA A;  4DMY A;  1QDQ A;  2R9N A;  1YK7 A;  3B21 A;  1PE6 A;  4RF0 A;  1PBH A;  2R9M A;  2HWK A;  3HWN A;  2DCA A;  2O6X A;  3ERV A;  4N8W A;  2ARY A;  1AU3 A;  2FT2 A;  3BPM A;  3WXE A;  3K9M A;  4Q8H A;  1KHP A;  1CSB B;  1Q6K A;  2CIO A;  4OVZ A;  3GCB A;  3F75 A;  1SP4 B;  3KWB X;  4BOQ A;  2P86 A;  1MEG A;  1THE A;  4RNA A;  3CH2 X;  4BS5 A;  2ACT A;  3W30 A;  3CBK A;  5A24 A;  3PHU A;  1JQP A;  1DEU A;  1AYW A;  1F2B A;  3K8U A;  3USV A;  3ZNH A;  4MZO A;  3KX1 A;  2F1G A;  2WBF X;  2PRE A;  4Q8G A;  3MOR A;  4ZUX U;  4YYW A;  1CV8 A;  2XU1 A;  4WUR A;  3H7D A;  2E01 A;  2AYO A;  4PP2 E;  2H7J A;  2HD5 A;  2HHN A;  3IHP A;  2YJ2 A;  2DJG B;  4RKX A;  3IEJ A;  4CDC B;  3PRP A;  2BDL A;  4WA6 A;  1Y4H A;  5JH3 A;  3PW3 A;  3PBH A;  2DCB A;  1EWM A;  4RY2 A;  1TL9 A;  1AU2 A;  3HHI A;  4MSX A;  1PXV A;  5CVM A;  2Y5B A;  2AU1 A;  3P5X A;  3V6C A;  4YYR A;  4MM3 B;  2FTD A;  1YT7 A;  3PT2 A;  2BU3 A;  2XU5 A;  4XR7 A;  4RF1 A;  4W5C A;  3P5W A;  1TLO A;  2NQI A;  3V6E A;  2VHF A;  2E03 A;  3M99 A;  2R9O A;  2XU3 A;  4OEL A;  2P0R A;  2YJC A;  1AU0 A;  2DCD A; 
#chains in the Genus database with same CATH homology
 2YJB A;  3RVV A;  3PNR A;  4GUZ A;  4QRX A;  4X6H A;  1MEM A;  4CZW A;  2E00 A;  4BSQ A;  2G8J A;  4HWY A;  1YK8 A;  4P6G A;  3U8E A;  4C5P A;  1U9W A;  3TNX A;  1CQD A;  1GEC E;  1SNK A;  2AYN A;  1TU6 A;  1X9Y A;  2B1M A;  3LXS A;  4I05 A;  1EWP A;  4W4U A;  3P5U A;  1CPJ A;  1O0E A;  3OVX A;  3QT4 A;  1KFU L;  2Y6E A;  4FJC A;  1BGO A;  4I04 A;  1CTE A;  2C0Y A;  1CB5 A;  2FQ9 A;  1EWO A;  4BGF A;  3K24 A;  1FH0 A;  2G6D A;  3RVX A;  4FK5 A;  3I06 A;  2AUX A;  1ZCM A;  2GFO A;  3H6S A;  1Y08 A;  3BWK A;  1KXR A;  1NB3 A;  3O0U A;  5FPW A;  5K16 A;  1GMY A;  3OVZ A;  4P6E A;  4CDE B;  1YAL A;  1AYU A;  2FRQ A;  3C9E A;  3WXG A;  1NL6 A;  1VJV A;  3I3T A;  2FO5 A;  2DC6 A;  5CVN B;  3BPF A;  3QSD A;  3CBJ A;  3H8B A;  1MHW A;  2R6N A;  2AS8 A;  1CVZ A;  2HXZ A;  1K3B B;  3RVW A;  1QXP A;  4X6J A;  1ME4 A;  4YYQ A;  8PCH A;  2DJF B;  1POP A;  3KW9 A;  4YVA A;  4PAD A;  2DCC A;  2R9C A;  4NV8 A;  3S3Q A;  2GHU A;  3LTW A;  1XKG A;  2NQA A;  4KLB A;  2AIM A;  1ME3 A;  1PIP A;  1NLJ A;  4MZS A;  3BOW A;  3QJ3 A;  1F2C A;  2JQF R;  3MHH A;  1NPZ A;  1ZIV A;  1YVB A;  2OP3 A;  2P7U A;  4OEM A;  3LFY A;  5EF4 A;  2AVW A;  3ZUA A;  1AIM A;  5PAD A;  1PPO A;  4QRG A;  4FIP A;  4N4Z A;  1E2T A;  1ATK A;  2CB5 A;  3F5V A;  4QBB A;  4G54 A;  3H89 A;  1IWD A;  2G7Y A;  3OIS A;  5CVO B;  4B55 A;  1PPN A;  7PCK A;  4YYS A;  4PI3 A;  4AXM A;  2PNS A;  2E02 A;  3KKU A;  4YYU A;  4I07 A;  3BC3 A;  1U9X A;  1GX3 A;  3NHE A;  2FUD A;  1M6D A;  2IPP B;  3HD3 A;  3N4C A;  2B1N A;  1CS8 A;  1W6F A;  3N3G A;  4X6I A;  3IV2 A;  1MDW A;  9PAP A;  4AXL A;  4CDF B;  1S4V A;  4NV7 A;  5F02 A;  2DC8 A;  4BPV A;  2FRA A;  3BCN A;  1NQC A;  1F29 A;  2OZ2 A;  3IMA A;  2HH5 A;  1F2A A;  2DC9 A;  1HUC B;  1BY8 A;  2ATO A;  1AYV A;  2R9F A;  1STF E;  4XUI A;  4BQV A;  1ITO A;  1VSN A;  1A6R A;  1W4T A;  3MTN A;  3KWZ A;  3WXF A;  3CH3 X;  3O1G A;  4N79 A;  1U5I A;  4YYV A;  4QRV A;  2BDZ A;  2IBI A;  3P5V A;  4YV8 A;  1AEC A;  2DZY A;  1PAD A;  2BSZ A;  1MIR A;  2PAD A;  2XU4 A;  4BS6 A;  5CHT A;  1GLO A;  4DMX A;  3MHS A;  1PCI A;  2YJ9 A;  4K7C A;  3IOQ A;  3H8C A;  1PPD A;  2FYE A;  3OF8 A;  1MS6 A;  4QH6 A;  1QMY A;  2VFC A;  2NQD B;  3D9W A;  3DF0 A;  1KHQ A;  2JQG R;  4W5B A;  3HHA A;  2NQG A;  3OF9 A;  1BQI A;  3B79 A;  2G8E A;  5CHV A;  1BP4 A;  2DZZ A;  3D6S A;  1GCB A;  1W5R A;  1ICF A;  1EWL A;  1NB5 A;  3KFQ A;  6PAD A;  1EF7 A;  4PP1 A;  3N3K A;  3IUT A;  3AI8 A;  1AU4 A;  2PBH A;  1CJL A;  1DF0 A;  1U9V A;  2DC7 A;  3E1Z B;  2YJ8 A;  2VHS A;  2OUL A;  4CDD B;  1PPP A;  2AUZ A;  5EGW A;  1U9Q X;  3S3R A;  2F7D A;  1QOL A;  3PDF A;  1KFX L;  3KSE A;  5J94 A;  5JA7 A;  4DMY A;  1QDQ A;  2R9N A;  1YK7 A;  1PE6 A;  1PBH A;  2R9M A;  3HWN A;  2DCA A;  2O6X A;  3ERV A;  4N8W A;  2ARY A;  1AU3 A;  2FT2 A;  3BPM A;  3WXE A;  3K9M A;  4Q8H A;  1KHP A;  1CSB B;  1Q6K A;  2CIO A;  3GCB A;  3F75 A;  1SP4 B;  3KWB X;  2P86 A;  1MEG A;  1THE A;  4BS5 A;  3CH2 X;  2ACT A;  3CBK A;  5A24 A;  1JQP A;  1DEU A;  1AYW A;  1F2B A;  3K8U A;  3USV A;  4MZO A;  3KX1 A;  2F1G A;  2WBF X;  2PRE A;  4Q8G A;  3MOR A;  4ZUX U;  4YYW A;  1CV8 A;  2XU1 A;  3H7D A;  2E01 A;  2AYO A;  4PP2 E;  2VFB A;  2H7J A;  2HD5 A;  2HHN A;  3IHP A;  2YJ2 A;  2DJG B;  3IEJ A;  4CDC B;  2BDL A;  4WA6 A;  1Y4H A;  5JH3 A;  3PW3 A;  3PBH A;  2DCB A;  1EWM A;  4RY2 A;  1TL9 A;  1AU2 A;  3HHI A;  4MSX A;  1PXV A;  5CVM A;  2Y5B A;  2AU1 A;  3P5X A;  3V6C A;  4YYR A;  2FTD A;  1YT7 A;  2XU5 A;  4XR7 A;  4W5C A;  3P5W A;  1TLO A;  2NQI A;  3V6E A;  2VHF A;  2E03 A;  3M99 A;  2R9O A;  2XU3 A;  4OEL A;  2P0R A;  2YJC A;  1AU0 A;  2DCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...