1POPA

X-ray crystallographic structure of a papain-leupeptin complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title X-ray crystallographic structure of a papain-leupeptin complex.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1popA00
4XUIA 1EWLA 4YVAA 3N3KA 3BCNA 9PAPA 2AVWA 3WXFA 4XR7A 1F2CA 4YYWA 1NB3A 2DC9A 1KXRA 2AS8A 4FIPA 1F2AA 1ME4A 1TLOA 4I05A 1CSBB 5CVNB 2DJFB 1M6DA 4YV8A 4I07A 1TL9A 1VSNA 2B1MA 2CB5A 1F29A 2FTDA 2YJ8A 1PADA 2PBHA 2HD5A 3OVXA 3E1ZB 1KFUL 1QOLA 1AYUA 5EF4A 1YT7A 3GCBA 3H89A 6PADA 1EWMA 1AU3A 2IPPB 3O1GA 2BDLA 1KHQA 5A24A 3V6EA 2OZ2A 4FJCA 2YJBA 3O0UA 3BPMA 3QSDA 3N4CA 3MTNA 2WBFX 5JA7A 3KKUA 2XU5A 3OVZA 1ME3A 3F5VA 4W4UA 1PPPA 2AYNA 1PPOA 4DMYA 1MEGA 1AU2A 3H6SA 3IHPA 1QXPA 4X6JA 1BY8A 1QMYA 3V6CA 3F75A 1STFE 2Y5BA 1CQDA 1EWPA 4CZWA 2OP3A 3OISA 3KWBX 3HWNA 3K9MA 1CB5A 4X6HA 2P7UA 4I04A 2DC6A 4MSXA 1PPDA 3H8BA 1AYWA 3K8UA 5F02A 4Q8HA 4CDFB 2FO5A 2XU3A 1CS8A 1PXVA 3OF9A 5JH3A 3WXGA 1ZIVA 4AXLA 4QH6A 2FQ9A 4P6EA 5FPWA 1VJVA 2ATOA 4DMXA 5CVOB 2AU1A 2R9OA 4YYRA 3KFQA 3RVVA 3H8CA 1AECA 1PPNA 1GCBA 1U9QX 4P6GA 2DCAA 2FRQA 3P5XA 1THEA 3HHIA 1U9WA 1QDQA 3LFYA 4YYUA 3KWZA 2DC7A 2E03A 2GFOA 2PREA 3KX1A 2E01A 3CH3X 1NL6A 2YJ9A 3MHSA 1Y08A 2HXZA 4Q8GA 2NQDB 2PADA 5CVMA 4BPVA 2BDZA 3PDFA 7PCKA 3C9EA 1AYVA 2DCDA 2R9CA 4HWYA 3BC3A 4PP1A 2B1NA 3TNXA 1NB5A 3KSEA 1KHPA 4RY2A 1BP4A 3CBKA 2NQGA 1NQCA 1MS6A 1U5IA 3AI8A 3MHHA 4W5CA 1NPZA 4W5BA 3OF8A 3ZUAA 1YK7A 3PBHA 3BWKA 4CDDB 1U9XA 1Q6KA 2ACTA 2CIOA 2XU4A 4AXMA 2AUXA 2G6DA 2VHSA 2DCBA 1DF0A 3N3GA 2IBIA 1BGOA 1XKGA 3S3QA 3H7DA 2DJGB 1NLJA 1EF7A 3I06A 3P5UA 3I3TA 3M99A 1X9YA 4K7CA 2F1GA 1A6RA 1CTEA 1MDWA 1CPJA 1MIRA 2VHFA 4PADA 3P5VA 4N8WA 3LXSA 4FK5A 4PI3A 3PNRA 8PCHA 1IWDA 1O0EA 1POPA 2DCCA 3IMAA 4OELA 1YK8A 2R9MA 4BS6A 4BQVA 4CDEB 2R9FA 2R6NA 2FUDA 2P86A 4N4ZA 3DF0A 1YALA 3BPFA 2ARYA 2E02A 1AU4A 1CVZA 2PNSA 2NQAA 2YJCA 3ERVA 2XU1A 3PW3A 3IEJA 3D6SA 3RVXA 2OULA 4MZSA 1CV8A 3P5WA 3CH2X 1MEMA 2G7YA 1HUCB 4OEMA 1EWOA 1KFXL 3USVA 1MHWA 2R9NA 2G8EA 2GHUA 1SP4B 2HHNA 2O6XA 4WA6A 2NQIA 4PP2E 4QBBA 3CBJA 1ZCMA 1ITOA 2H7JA 2DZZA 1ICFA 1PBHA 4MZOA 3B79A 3HHAA 3IOQA 1Y4HA 1F2BA 1AU0A 4ZUXU 2FYEA 2FT2A 2AYOA 4BS5A 2JQFR 3QJ3A 2P0RA 1BQIA 2AUZA 1K3BB 1AIMA 5J94A 1GMYA 4QRGA 4YYQA 4G54A 4BSQA 1SNKA 3HD3A 3NHEA 4QRXA 3MORA 3IV2A 2DZYA 1U9VA 1DEUA 3K24A 2F7DA 4X6IA 1GLOA 5PADA 1PIPA 1PE6A 3IUTA 2HH5A 2E00A 1ATKA 2G8JA 4YYVA 1CJLA 3KW9A 3BOWA 1S4VA 4KLBA 5K16A 5CHVA 1GECE 1PCIA 4CDCB 2JQGR 1YVBA 1JQPA 1TU6A 2FRAA 4YYSA 5CHTA 3QT4A 2YJ2A 3RVWA 2DC8A 5EGWA 2Y6EA 4N79A 2AIMA 1FH0A 3U8EA 2C0YA 3WXEA 4QRVA 3S3RA
chains in the Genus database with same CATH superfamily
4XUIA 1EWLA 4YVAA 3N3KA 3BCNA 9PAPA 2AVWA 3WXFA 4XR7A 1F2CA 1YZBA 4YYWA 1NB3A 2DC9A 4A5UA 1KXRA 5E6JA 2AS8A 4FIPA 1F2AA 3B21A 1ME4A 1TLOA 4I05A 1CSBB 5CVNB 2DJFB 1M6DA 4YV8A 4I07A 3MJ5A 1TL9A 1VSNA 2B1MA 2CB5A 1F29A 2FTDA 2YJ8A 1PADA 2PBHA 2HD5A 3OVXA 3E1ZB 1KFUL 1QOLA 5EZQA 1AYUA 5EF4A 1YT7A 3GCBA 3H89A 6PADA 4RNAA 1EWMA 1AU3A 2IPPB 3O1GA 2BDLA 1KHQA 5A24A 3V6EA 2OZ2A 4FJCA 2YJBA 3O0UA 3BPMA 3QSDA 2BU3A 2JRIA 5KO3A 3N4CA 3PHUA 3MTNA 2WBFX 5JA7A 3KKUA 2XU5A 3OVZA 1ME3A 3F5VA 4W4UA 1PPPA 2AYNA 1PPOA 4REZA 4OW0A 4DMYA 1MEGA 1AU2A 3H6SA 3IHPA 1QXPA 4X6JA 1BY8A 1QMYA 3V6CA 3F75A 1STFE 2Y5BA 1CQDA 1EWPA 4CZWA 2OP3A 3OISA 3KWBX 3HWNA 3PSEA 3K9MA 1CB5A 4X6HA 2P7UA 4I04A 2DC6A 4MSXA 1PPDA 3H8BA 1AYWA 3K8UA 5F02A 4Q8HA 4CDFB 4GUAA 3E9SA 2FO5A 2XU3A 1CS8A 1PXVA 3OF9A 5JH3A 3WXGA 4MM3B 1ZIVA 4AXLA 4QH6A 2FQ9A 4P6EA 5FPWA 1VJVA 2ATOA 4DMXA 5CVOB 2AU1A 2R9OA 3ZNHA 4YYRA 3KFQA 3RVVA 3H8CA 3BY4A 1AECA 1PPNA 3MTVA 1GCBA 1U9QX 4WURA 4OVZA 1DKIA 4P6GA 2DCAA 2FRQA 3P5XA 1THEA 4HXDB 3HHIA 1U9WA 1QDQA 3LFYA 4YYUA 3KWZA 2AGAA 2DC7A 2E03A 2GFOA 2PREA 3KX1A 2E01A 4BOQA 3CH3X 1NL6A 2YJ9A 3MHSA 1Y08A 2HXZA 4Q8GA 3W31A 2NQDB 2PADA 5CVMA 4BPVA 2BDZA 3PDFA 7PCKA 3C9EA 1AYVA 4IUMA 2DCDA 2R9CA 4HWYA 3O65A 3TMPA 3BC3A 4PP1A 2B1NA 3TNXA 1NB5A 1UKFA 4BOPA 3KSEA 1KHPA 4RY2A 1BP4A 3CBKA 2NQGA 1NQCA 4BOZA 1MS6A 1U5IA 3AI8A 3MHHA 4W5CA 1NPZA 4W5BA 3OF8A 3ZUAA 1YK7A 3PBHA 3BWKA 4CDDB 1U9XA 1Q6KA 2ACTA 2CIOA 2J7QA 2XU4A 4AXMA 2AUXA 2G6DA 2VHSA 2DCBA 4OVZB 1DF0A 3N3GA 4RF1A 4D8EA 2IBIA 1BGOA 1XKGA 3S3QA 3H7DA 2DJGB 1NLJA 1EF7A 3I06A 2J7QC 3P5UA 3I3TA 3M99A 3BB7A 1X9YA 4K7CA 2F1GA 1A6RA 1CTEA 1MDWA 1CPJA 1MIRA 4RKXA 2VHFA 4PADA 2HWKA 3P5VA 4N8WA 3LXSA 4FK5A 4PI3A 3PNRA 3PT2A 8PCHA 4D8BA 1IWDA 1O0EA 1POPA 2DCCA 3IMAA 3PRPA 4OELA 1YK8A 2R9MA 4BS6A 4BQVA 4BOUA 4CDEB 2R9FA 2R6NA 2FUDA 2P86A 4N4ZA 3DF0A 2JTCA 1YALA 3BPFA 2ARYA 2E02A 1AU4A 5EZSA 1CVZA 4RF0A 2PNSA 2NQAA 2FE8A 2YJCA 3PRMA 3ERVA 2XU1A 3PW3A 4P16A 3IEJA 3D6SA 3OQCA 3RVXA 3W30A 2OULA 4D8IA 4MZSA 1CV8A 3P5WA 3RNVA 3CH2X 1MEMA 2G7YA 1HUCB 4OEMA 1EWOA 1KFXL 3USVA 1MHWA 3TRKA 2R9NA 2G8EA 4IP3A 2GHUA 1SP4B 2HHNA 2O6XA 4WA6A 2NQIA 4PP2E 3BBAA 4QBBA 3CBJA 4BOSA 1ZCMA 1ITOA 2H7JA 2DZZA 1ICFA 1PBHA 4MZOA 3PHWA 3B79A 3HHAA 3IOQA 1Y4HA 4ZTBA 1F2BA 3IFUA 2Z84A 1AU0A 4ZUXU 2FYEA 5JZEA 2FT2A 2AYOA 4BS5A 2BTWA 2JQFR 3QJ3A 2P0RA 1BQIA 2AUZA 1K3BB 3MP2A 1AIMA 4XZXA 5J94A 1GMYA 4QRGA 4YYQA 4G54A 4BSQA 1SNKA 3HD3A 2UZJA 3NHEA 4QRXA 4MI7A 3MORA 3IV2A 2DZYA 1U9VA 1DEUA 3K24A 2F7DA 4X6IA 1GLOA 3C0RA 5PADA 1PIPA 1PE6A 3IUTA 2HH5A 4M0WA 2E00A 1ATKA 2G8JA 4YYVA 1CJLA 3KW9A 3BOWA 1S4VA 4KLBA 5K16A 5CHVA 1GECE 1PCIA 2DOSA 4CDCB 2JQGR 1YVBA 4R3DA 1JQPA 1TU6A 2FRAA 4YYSA 5CHTA 3QT4A 2YJ2A 3RVWA 2DC8A 1PVJA 5EGWA 2Y6EA 4N79A 4PT5A 2AIMA 1FH0A 3U8EA 2C0YA 3WXEA 3PHXA 4QRVA 2BTWB 3S3RA
chains in the Genus database with same CATH topology
4XUIA 1EWLA 4YVAA 3N3KA 3BCNA 9PAPA 2AVWA 3WXFA 4XR7A 1F2CA 4YYWA 1NB3A 2DC9A 1KXRA 2AS8A 4FIPA 1F2AA 1ME4A 1TLOA 4I05A 1CSBB 5CVNB 2DJFB 1M6DA 4YV8A 4I07A 1TL9A 1VSNA 2B1MA 2CB5A 1F29A 2FTDA 2YJ8A 1PADA 2PBHA 2HD5A 3OVXA 3E1ZB 1KFUL 1QOLA 4NV7A 1AYUA 5EF4A 1YT7A 3GCBA 3H89A 6PADA 1EWMA 1AU3A 2IPPB 3O1GA 2BDLA 1KHQA 5A24A 3V6EA 2OZ2A 4FJCA 2YJBA 3O0UA 3BPMA 3QSDA 3N4CA 3MTNA 2WBFX 5JA7A 3KKUA 2XU5A 3OVZA 1ME3A 3F5VA 4W4UA 1W4TA 1PPPA 2AYNA 1PPOA 4DMYA 1MEGA 1AU2A 3H6SA 3IHPA 1QXPA 4X6JA 1BY8A 1QMYA 3V6CA 3F75A 1STFE 2Y5BA 1CQDA 1EWPA 4CZWA 2OP3A 3OISA 3KWBX 3HWNA 3K9MA 1CB5A 4X6HA 2P7UA 4I04A 2DC6A 4MSXA 1PPDA 3H8BA 1AYWA 3K8UA 5F02A 4Q8HA 4CDFB 2FO5A 2XU3A 1CS8A 1PXVA 3OF9A 5JH3A 2VFBA 3WXGA 2VFCA 1ZIVA 4AXLA 4QH6A 2FQ9A 4P6EA 5FPWA 1VJVA 2ATOA 4DMXA 5CVOB 2AU1A 2R9OA 4YYRA 3KFQA 3RVVA 3H8CA 1AECA 1PPNA 4C5PA 1GCBA 1U9QX 4P6GA 2DCAA 2FRQA 3P5XA 1THEA 3HHIA 1GX3A 1U9WA 1QDQA 3LFYA 4YYUA 3KWZA 2DC7A 2E03A 2GFOA 2PREA 3KX1A 2E01A 3CH3X 1NL6A 2YJ9A 3MHSA 2BSZA 1Y08A 2HXZA 4Q8GA 2NQDB 2PADA 5CVMA 4BPVA 2BDZA 3PDFA 7PCKA 3C9EA 1AYVA 2DCDA 2R9CA 4HWYA 3BC3A 4PP1A 2B1NA 3TNXA 1NB5A 3KSEA 1KHPA 4RY2A 1BP4A 3CBKA 2NQGA 1NQCA 1MS6A 1U5IA 3AI8A 3MHHA 4W5CA 1NPZA 4W5BA 3OF8A 3ZUAA 1YK7A 3PBHA 3BWKA 4CDDB 1U9XA 1Q6KA 2ACTA 2CIOA 2XU4A 4AXMA 2AUXA 2G6DA 2VHSA 2DCBA 1DF0A 3N3GA 2IBIA 1BGOA 1XKGA 3S3QA 3H7DA 2DJGB 1NLJA 1EF7A 3I06A 3P5UA 3I3TA 3M99A 1X9YA 4K7CA 2F1GA 1W6FA 1A6RA 1CTEA 1MDWA 1CPJA 1MIRA 2VHFA 4PADA 3P5VA 4N8WA 3LXSA 4FK5A 4PI3A 3PNRA 8PCHA 1IWDA 1O0EA 1POPA 2DCCA 3IMAA 4OELA 1YK8A 2R9MA 4BS6A 4BQVA 4CDEB 2R9FA 2R6NA 2FUDA 2P86A 4N4ZA 3DF0A 1YALA 3BPFA 2ARYA 2E02A 3LTWA 1AU4A 1CVZA 2PNSA 2NQAA 2YJCA 3ERVA 2XU1A 3PW3A 3IEJA 3D6SA 3RVXA 2OULA 4MZSA 1CV8A 3P5WA 3CH2X 1MEMA 2G7YA 4NV8A 1HUCB 4OEMA 1EWOA 1KFXL 3USVA 1MHWA 2R9NA 2G8EA 3D9WA 2GHUA 1SP4B 2HHNA 2O6XA 4WA6A 2NQIA 4PP2E 4QBBA 3CBJA 1W5RA 1ZCMA 1ITOA 2H7JA 2DZZA 1ICFA 1PBHA 4MZOA 3B79A 3HHAA 3IOQA 1Y4HA 1F2BA 1AU0A 4ZUXU 2FYEA 2FT2A 2AYOA 4BS5A 2JQFR 3QJ3A 2P0RA 1BQIA 2AUZA 1K3BB 1AIMA 5J94A 1GMYA 4QRGA 4YYQA 4G54A 4BSQA 1SNKA 3HD3A 3NHEA 4QRXA 3MORA 3IV2A 2DZYA 1U9VA 1DEUA 3K24A 2F7DA 4X6IA 4BGFA 1GLOA 5PADA 1PIPA 1PE6A 4GUZA 3IUTA 2HH5A 2E00A 1ATKA 2G8JA 4YYVA 1CJLA 3KW9A 3BOWA 1S4VA 4KLBA 5K16A 5CHVA 1GECE 1PCIA 4CDCB 2JQGR 1YVBA 1JQPA 1TU6A 2FRAA 4YYSA 5CHTA 3QT4A 2YJ2A 3RVWA 2DC8A 5EGWA 2Y6EA 4N79A 2AIMA 1FH0A 3U8EA 4B55A 2C0YA 3WXEA 4QRVA 1E2TA 3S3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUI A;  1EWL A;  4YVA A;  3N3K A;  3BCN A;  9PAP A;  2AVW A;  3WXF A;  4XR7 A;  1F2C A;  4YYW A;  1NB3 A;  2DC9 A;  1KXR A;  2AS8 A;  4FIP A;  1F2A A;  1ME4 A;  1TLO A;  4I05 A;  1CSB B;  5CVN B;  2DJF B;  1M6D A;  4YV8 A;  4I07 A;  1TL9 A;  1VSN A;  2B1M A;  2CB5 A;  1F29 A;  2FTD A;  2YJ8 A;  1PAD A;  2PBH A;  2HD5 A;  3OVX A;  3E1Z B;  1KFU L;  1QOL A;  1AYU A;  5EF4 A;  1YT7 A;  3GCB A;  3H89 A;  6PAD A;  1EWM A;  1AU3 A;  2IPP B;  3O1G A;  2BDL A;  1KHQ A;  5A24 A;  3V6E A;  2OZ2 A;  4FJC A;  2YJB A;  3O0U A;  3BPM A;  3QSD A;  3N4C A;  3MTN A;  2WBF X;  5JA7 A;  3KKU A;  2XU5 A;  3OVZ A;  1ME3 A;  3F5V A;  4W4U A;  1PPP A;  2AYN A;  1PPO A;  4DMY A;  1MEG A;  1AU2 A;  3H6S A;  3IHP A;  1QXP A;  4X6J A;  1BY8 A;  1QMY A;  3V6C A;  3F75 A;  1STF E;  2Y5B A;  1CQD A;  1EWP A;  4CZW A;  2OP3 A;  3OIS A;  3KWB X;  3HWN A;  3K9M A;  1CB5 A;  4X6H A;  2P7U A;  4I04 A;  2DC6 A;  4MSX A;  1PPD A;  3H8B A;  1AYW A;  3K8U A;  5F02 A;  4Q8H A;  4CDF B;  2FO5 A;  2XU3 A;  1CS8 A;  1PXV A;  3OF9 A;  5JH3 A;  3WXG A;  1ZIV A;  4AXL A;  4QH6 A;  2FQ9 A;  4P6E A;  5FPW A;  1VJV A;  2ATO A;  4DMX A;  5CVO B;  2AU1 A;  2R9O A;  4YYR A;  3KFQ A;  3RVV A;  3H8C A;  1AEC A;  1PPN A;  1GCB A;  1U9Q X;  4P6G A;  2DCA A;  2FRQ A;  3P5X A;  1THE A;  3HHI A;  1U9W A;  1QDQ A;  3LFY A;  4YYU A;  3KWZ A;  2DC7 A;  2E03 A;  2GFO A;  2PRE A;  3KX1 A;  2E01 A;  3CH3 X;  1NL6 A;  2YJ9 A;  3MHS A;  1Y08 A;  2HXZ A;  4Q8G A;  2NQD B;  2PAD A;  5CVM A;  4BPV A;  2BDZ A;  3PDF A;  7PCK A;  3C9E A;  1AYV A;  2DCD A;  2R9C A;  4HWY A;  3BC3 A;  4PP1 A;  2B1N A;  3TNX A;  1NB5 A;  3KSE A;  1KHP A;  4RY2 A;  1BP4 A;  3CBK A;  2NQG A;  1NQC A;  1MS6 A;  1U5I A;  3AI8 A;  3MHH A;  4W5C A;  1NPZ A;  4W5B A;  3OF8 A;  3ZUA A;  1YK7 A;  3PBH A;  3BWK A;  4CDD B;  1U9X A;  1Q6K A;  2ACT A;  2CIO A;  2XU4 A;  4AXM A;  2AUX A;  2G6D A;  2VHS A;  2DCB A;  1DF0 A;  3N3G A;  2IBI A;  1BGO A;  1XKG A;  3S3Q A;  3H7D A;  2DJG B;  1NLJ A;  1EF7 A;  3I06 A;  3P5U A;  3I3T A;  3M99 A;  1X9Y A;  4K7C A;  2F1G A;  1A6R A;  1CTE A;  1MDW A;  1CPJ A;  1MIR A;  2VHF A;  4PAD A;  3P5V A;  4N8W A;  3LXS A;  4FK5 A;  4PI3 A;  3PNR A;  8PCH A;  1IWD A;  1O0E A;  1POP A;  2DCC A;  3IMA A;  4OEL A;  1YK8 A;  2R9M A;  4BS6 A;  4BQV A;  4CDE B;  2R9F A;  2R6N A;  2FUD A;  2P86 A;  4N4Z A;  3DF0 A;  1YAL A;  3BPF A;  2ARY A;  2E02 A;  1AU4 A;  1CVZ A;  2PNS A;  2NQA A;  2YJC A;  3ERV A;  2XU1 A;  3PW3 A;  3IEJ A;  3D6S A;  3RVX A;  2OUL A;  4MZS A;  1CV8 A;  3P5W A;  3CH2 X;  1MEM A;  2G7Y A;  1HUC B;  4OEM A;  1EWO A;  1KFX L;  3USV A;  1MHW A;  2R9N A;  2G8E A;  2GHU A;  1SP4 B;  2HHN A;  2O6X A;  4WA6 A;  2NQI A;  4PP2 E;  4QBB A;  3CBJ A;  1ZCM A;  1ITO A;  2H7J A;  2DZZ A;  1ICF A;  1PBH A;  4MZO A;  3B79 A;  3HHA A;  3IOQ A;  1Y4H A;  1F2B A;  1AU0 A;  4ZUX U;  2FYE A;  2FT2 A;  2AYO A;  4BS5 A;  2JQF R;  3QJ3 A;  2P0R A;  1BQI A;  2AUZ A;  1K3B B;  1AIM A;  5J94 A;  1GMY A;  4QRG A;  4YYQ A;  4G54 A;  4BSQ A;  1SNK A;  3HD3 A;  3NHE A;  4QRX A;  3MOR A;  3IV2 A;  2DZY A;  1U9V A;  1DEU A;  3K24 A;  2F7D A;  4X6I A;  1GLO A;  5PAD A;  1PIP A;  1PE6 A;  3IUT A;  2HH5 A;  2E00 A;  1ATK A;  2G8J A;  4YYV A;  1CJL A;  3KW9 A;  3BOW A;  1S4V A;  4KLB A;  5K16 A;  5CHV A;  1GEC E;  1PCI A;  4CDC B;  2JQG R;  1YVB A;  1JQP A;  1TU6 A;  2FRA A;  4YYS A;  5CHT A;  3QT4 A;  2YJ2 A;  3RVW A;  2DC8 A;  5EGW A;  2Y6E A;  4N79 A;  2AIM A;  1FH0 A;  3U8E A;  2C0Y A;  3WXE A;  4QRV A;  3S3R A; 
#chains in the Genus database with same CATH topology
 4XUI A;  1EWL A;  4YVA A;  3N3K A;  3BCN A;  9PAP A;  2AVW A;  3WXF A;  4XR7 A;  1F2C A;  1YZB A;  4YYW A;  1NB3 A;  2DC9 A;  4A5U A;  1KXR A;  5E6J A;  2AS8 A;  4FIP A;  1F2A A;  3B21 A;  1ME4 A;  1TLO A;  4I05 A;  1CSB B;  5CVN B;  2DJF B;  1M6D A;  4YV8 A;  4I07 A;  3MJ5 A;  1TL9 A;  1VSN A;  2B1M A;  2CB5 A;  1F29 A;  2FTD A;  2YJ8 A;  1PAD A;  2PBH A;  2HD5 A;  3OVX A;  3E1Z B;  1KFU L;  1QOL A;  5EZQ A;  1AYU A;  5EF4 A;  1YT7 A;  3GCB A;  3H89 A;  6PAD A;  4RNA A;  1EWM A;  1AU3 A;  2IPP B;  3O1G A;  2BDL A;  1KHQ A;  5A24 A;  3V6E A;  2OZ2 A;  4FJC A;  2YJB A;  3O0U A;  3BPM A;  3QSD A;  2BU3 A;  2JRI A;  5KO3 A;  3N4C A;  3PHU A;  3MTN A;  2WBF X;  5JA7 A;  3KKU A;  2XU5 A;  3OVZ A;  1ME3 A;  3F5V A;  4W4U A;  1PPP A;  2AYN A;  1PPO A;  4REZ A;  4OW0 A;  4DMY A;  1MEG A;  1AU2 A;  3H6S A;  3IHP A;  1QXP A;  4X6J A;  1BY8 A;  1QMY A;  3V6C A;  3F75 A;  1STF E;  2Y5B A;  1CQD A;  1EWP A;  4CZW A;  2OP3 A;  3OIS A;  3KWB X;  3HWN A;  3PSE A;  3K9M A;  1CB5 A;  4X6H A;  2P7U A;  4I04 A;  2DC6 A;  4MSX A;  1PPD A;  3H8B A;  1AYW A;  3K8U A;  5F02 A;  4Q8H A;  4CDF B;  4GUA A;  3E9S A;  2FO5 A;  2XU3 A;  1CS8 A;  1PXV A;  3OF9 A;  5JH3 A;  3WXG A;  4MM3 B;  1ZIV A;  4AXL A;  4QH6 A;  2FQ9 A;  4P6E A;  5FPW A;  1VJV A;  2ATO A;  4DMX A;  5CVO B;  2AU1 A;  2R9O A;  3ZNH A;  4YYR A;  3KFQ A;  3RVV A;  3H8C A;  3BY4 A;  1AEC A;  1PPN A;  3MTV A;  1GCB A;  1U9Q X;  4WUR A;  4OVZ A;  1DKI A;  4P6G A;  2DCA A;  2FRQ A;  3P5X A;  1THE A;  4HXD B;  3HHI A;  1U9W A;  1QDQ A;  3LFY A;  4YYU A;  3KWZ A;  2AGA A;  2DC7 A;  2E03 A;  2GFO A;  2PRE A;  3KX1 A;  2E01 A;  4BOQ A;  3CH3 X;  1NL6 A;  2YJ9 A;  3MHS A;  1Y08 A;  2HXZ A;  4Q8G A;  3W31 A;  2NQD B;  2PAD A;  5CVM A;  4BPV A;  2BDZ A;  3PDF A;  7PCK A;  3C9E A;  1AYV A;  4IUM A;  2DCD A;  2R9C A;  4HWY A;  3O65 A;  3TMP A;  3BC3 A;  4PP1 A;  2B1N A;  3TNX A;  1NB5 A;  1UKF A;  4BOP A;  3KSE A;  1KHP A;  4RY2 A;  1BP4 A;  3CBK A;  2NQG A;  1NQC A;  4BOZ A;  1MS6 A;  1U5I A;  3AI8 A;  3MHH A;  4W5C A;  1NPZ A;  4W5B A;  3OF8 A;  3ZUA A;  1YK7 A;  3PBH A;  3BWK A;  4CDD B;  1U9X A;  1Q6K A;  2ACT A;  2CIO A;  2J7Q A;  2XU4 A;  4AXM A;  2AUX A;  2G6D A;  2VHS A;  2DCB A;  4OVZ B;  1DF0 A;  3N3G A;  4RF1 A;  4D8E A;  2IBI A;  1BGO A;  1XKG A;  3S3Q A;  3H7D A;  2DJG B;  1NLJ A;  1EF7 A;  3I06 A;  2J7Q C;  3P5U A;  3I3T A;  3M99 A;  3BB7 A;  1X9Y A;  4K7C A;  2F1G A;  1A6R A;  1CTE A;  1MDW A;  1CPJ A;  1MIR A;  4RKX A;  2VHF A;  4PAD A;  2HWK A;  3P5V A;  4N8W A;  3LXS A;  4FK5 A;  4PI3 A;  3PNR A;  3PT2 A;  8PCH A;  4D8B A;  1IWD A;  1O0E A;  1POP A;  2DCC A;  3IMA A;  3PRP A;  4OEL A;  1YK8 A;  2R9M A;  4BS6 A;  4BQV A;  4BOU A;  4CDE B;  2R9F A;  2R6N A;  2FUD A;  2P86 A;  4N4Z A;  3DF0 A;  2JTC A;  1YAL A;  3BPF A;  2ARY A;  2E02 A;  1AU4 A;  5EZS A;  1CVZ A;  4RF0 A;  2PNS A;  2NQA A;  2FE8 A;  2YJC A;  3PRM A;  3ERV A;  2XU1 A;  3PW3 A;  4P16 A;  3IEJ A;  3D6S A;  3OQC A;  3RVX A;  3W30 A;  2OUL A;  4D8I A;  4MZS A;  1CV8 A;  3P5W A;  3RNV A;  3CH2 X;  1MEM A;  2G7Y A;  1HUC B;  4OEM A;  1EWO A;  1KFX L;  3USV A;  1MHW A;  3TRK A;  2R9N A;  2G8E A;  4IP3 A;  2GHU A;  1SP4 B;  2HHN A;  2O6X A;  4WA6 A;  2NQI A;  4PP2 E;  3BBA A;  4QBB A;  3CBJ A;  4BOS A;  1ZCM A;  1ITO A;  2H7J A;  2DZZ A;  1ICF A;  1PBH A;  4MZO A;  3PHW A;  3B79 A;  3HHA A;  3IOQ A;  1Y4H A;  4ZTB A;  1F2B A;  3IFU A;  2Z84 A;  1AU0 A;  4ZUX U;  2FYE A;  5JZE A;  2FT2 A;  2AYO A;  4BS5 A;  2BTW A;  2JQF R;  3QJ3 A;  2P0R A;  1BQI A;  2AUZ A;  1K3B B;  3MP2 A;  1AIM A;  4XZX A;  5J94 A;  1GMY A;  4QRG A;  4YYQ A;  4G54 A;  4BSQ A;  1SNK A;  3HD3 A;  2UZJ A;  3NHE A;  4QRX A;  4MI7 A;  3MOR A;  3IV2 A;  2DZY A;  1U9V A;  1DEU A;  3K24 A;  2F7D A;  4X6I A;  1GLO A;  3C0R A;  5PAD A;  1PIP A;  1PE6 A;  3IUT A;  2HH5 A;  4M0W A;  2E00 A;  1ATK A;  2G8J A;  4YYV A;  1CJL A;  3KW9 A;  3BOW A;  1S4V A;  4KLB A;  5K16 A;  5CHV A;  1GEC E;  1PCI A;  2DOS A;  4CDC B;  2JQG R;  1YVB A;  4R3D A;  1JQP A;  1TU6 A;  2FRA A;  4YYS A;  5CHT A;  3QT4 A;  2YJ2 A;  3RVW A;  2DC8 A;  1PVJ A;  5EGW A;  2Y6E A;  4N79 A;  4PT5 A;  2AIM A;  1FH0 A;  3U8E A;  2C0Y A;  3WXE A;  3PHX A;  4QRV A;  2BTW B;  3S3R A; 
#chains in the Genus database with same CATH homology
 4XUI A;  1EWL A;  4YVA A;  3N3K A;  3BCN A;  9PAP A;  2AVW A;  3WXF A;  4XR7 A;  1F2C A;  4YYW A;  1NB3 A;  2DC9 A;  1KXR A;  2AS8 A;  4FIP A;  1F2A A;  1ME4 A;  1TLO A;  4I05 A;  1CSB B;  5CVN B;  2DJF B;  1M6D A;  4YV8 A;  4I07 A;  1TL9 A;  1VSN A;  2B1M A;  2CB5 A;  1F29 A;  2FTD A;  2YJ8 A;  1PAD A;  2PBH A;  2HD5 A;  3OVX A;  3E1Z B;  1KFU L;  1QOL A;  4NV7 A;  1AYU A;  5EF4 A;  1YT7 A;  3GCB A;  3H89 A;  6PAD A;  1EWM A;  1AU3 A;  2IPP B;  3O1G A;  2BDL A;  1KHQ A;  5A24 A;  3V6E A;  2OZ2 A;  4FJC A;  2YJB A;  3O0U A;  3BPM A;  3QSD A;  3N4C A;  3MTN A;  2WBF X;  5JA7 A;  3KKU A;  2XU5 A;  3OVZ A;  1ME3 A;  3F5V A;  4W4U A;  1W4T A;  1PPP A;  2AYN A;  1PPO A;  4DMY A;  1MEG A;  1AU2 A;  3H6S A;  3IHP A;  1QXP A;  4X6J A;  1BY8 A;  1QMY A;  3V6C A;  3F75 A;  1STF E;  2Y5B A;  1CQD A;  1EWP A;  4CZW A;  2OP3 A;  3OIS A;  3KWB X;  3HWN A;  3K9M A;  1CB5 A;  4X6H A;  2P7U A;  4I04 A;  2DC6 A;  4MSX A;  1PPD A;  3H8B A;  1AYW A;  3K8U A;  5F02 A;  4Q8H A;  4CDF B;  2FO5 A;  2XU3 A;  1CS8 A;  1PXV A;  3OF9 A;  5JH3 A;  2VFB A;  3WXG A;  2VFC A;  1ZIV A;  4AXL A;  4QH6 A;  2FQ9 A;  4P6E A;  5FPW A;  1VJV A;  2ATO A;  4DMX A;  5CVO B;  2AU1 A;  2R9O A;  4YYR A;  3KFQ A;  3RVV A;  3H8C A;  1AEC A;  1PPN A;  4C5P A;  1GCB A;  1U9Q X;  4P6G A;  2DCA A;  2FRQ A;  3P5X A;  1THE A;  3HHI A;  1GX3 A;  1U9W A;  1QDQ A;  3LFY A;  4YYU A;  3KWZ A;  2DC7 A;  2E03 A;  2GFO A;  2PRE A;  3KX1 A;  2E01 A;  3CH3 X;  1NL6 A;  2YJ9 A;  3MHS A;  2BSZ A;  1Y08 A;  2HXZ A;  4Q8G A;  2NQD B;  2PAD A;  5CVM A;  4BPV A;  2BDZ A;  3PDF A;  7PCK A;  3C9E A;  1AYV A;  2DCD A;  2R9C A;  4HWY A;  3BC3 A;  4PP1 A;  2B1N A;  3TNX A;  1NB5 A;  3KSE A;  1KHP A;  4RY2 A;  1BP4 A;  3CBK A;  2NQG A;  1NQC A;  1MS6 A;  1U5I A;  3AI8 A;  3MHH A;  4W5C A;  1NPZ A;  4W5B A;  3OF8 A;  3ZUA A;  1YK7 A;  3PBH A;  3BWK A;  4CDD B;  1U9X A;  1Q6K A;  2ACT A;  2CIO A;  2XU4 A;  4AXM A;  2AUX A;  2G6D A;  2VHS A;  2DCB A;  1DF0 A;  3N3G A;  2IBI A;  1BGO A;  1XKG A;  3S3Q A;  3H7D A;  2DJG B;  1NLJ A;  1EF7 A;  3I06 A;  3P5U A;  3I3T A;  3M99 A;  1X9Y A;  4K7C A;  2F1G A;  1W6F A;  1A6R A;  1CTE A;  1MDW A;  1CPJ A;  1MIR A;  2VHF A;  4PAD A;  3P5V A;  4N8W A;  3LXS A;  4FK5 A;  4PI3 A;  3PNR A;  8PCH A;  1IWD A;  1O0E A;  1POP A;  2DCC A;  3IMA A;  4OEL A;  1YK8 A;  2R9M A;  4BS6 A;  4BQV A;  4CDE B;  2R9F A;  2R6N A;  2FUD A;  2P86 A;  4N4Z A;  3DF0 A;  1YAL A;  3BPF A;  2ARY A;  2E02 A;  3LTW A;  1AU4 A;  1CVZ A;  2PNS A;  2NQA A;  2YJC A;  3ERV A;  2XU1 A;  3PW3 A;  3IEJ A;  3D6S A;  3RVX A;  2OUL A;  4MZS A;  1CV8 A;  3P5W A;  3CH2 X;  1MEM A;  2G7Y A;  4NV8 A;  1HUC B;  4OEM A;  1EWO A;  1KFX L;  3USV A;  1MHW A;  2R9N A;  2G8E A;  3D9W A;  2GHU A;  1SP4 B;  2HHN A;  2O6X A;  4WA6 A;  2NQI A;  4PP2 E;  4QBB A;  3CBJ A;  1W5R A;  1ZCM A;  1ITO A;  2H7J A;  2DZZ A;  1ICF A;  1PBH A;  4MZO A;  3B79 A;  3HHA A;  3IOQ A;  1Y4H A;  1F2B A;  1AU0 A;  4ZUX U;  2FYE A;  2FT2 A;  2AYO A;  4BS5 A;  2JQF R;  3QJ3 A;  2P0R A;  1BQI A;  2AUZ A;  1K3B B;  1AIM A;  5J94 A;  1GMY A;  4QRG A;  4YYQ A;  4G54 A;  4BSQ A;  1SNK A;  3HD3 A;  3NHE A;  4QRX A;  3MOR A;  3IV2 A;  2DZY A;  1U9V A;  1DEU A;  3K24 A;  2F7D A;  4X6I A;  4BGF A;  1GLO A;  5PAD A;  1PIP A;  1PE6 A;  4GUZ A;  3IUT A;  2HH5 A;  2E00 A;  1ATK A;  2G8J A;  4YYV A;  1CJL A;  3KW9 A;  3BOW A;  1S4V A;  4KLB A;  5K16 A;  5CHV A;  1GEC E;  1PCI A;  4CDC B;  2JQG R;  1YVB A;  1JQP A;  1TU6 A;  2FRA A;  4YYS A;  5CHT A;  3QT4 A;  2YJ2 A;  3RVW A;  2DC8 A;  5EGW A;  2Y6E A;  4N79 A;  2AIM A;  1FH0 A;  3U8E A;  4B55 A;  2C0Y A;  3WXE A;  4QRV A;  1E2T A;  3S3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...