1POPA

X-ray crystallographic structure of a papain-leupeptin complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title X-ray crystallographic structure of a papain-leupeptin complex.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
total genus 66
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1993-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1popA00
1QOLA 2BDLA 1KFUL 3P5WA 2DC9A 2FQ9A 3H7DA 4BS6A 1F2BA 1EWMA 4QRGA 4I04A 1K3BB 1FH0A 3WXGA 3N3KA 1MIRA 2XU3A 4AXMA 4P6GA 4DMXA 1CB5A 1AU0A 1EWLA 1JQPA 2R9OA 2FT2A 2YJBA 2PNSA 3D6SA 1NLJA 4KLBA 4PI3A 2R9CA 1PXVA 1F2CA 3PW3A 1CPJA 1NB3A 3N4CA 4QBBA 3PNRA 4X6IA 2HH5A 2WBFX 9PAPA 1AYWA 1SP4B 3RVVA 2NQDB 1STFE 1MEMA 2AU1A 4K7CA 3KW9A 3I3TA 2O6XA 3TNXA 2FYEA 3OVZA 4BPVA 4PADA 1M6DA 3S3QA 1PPNA 2G7YA 1YALA 3N3GA 2ARYA 1Y08A 1CS8A 4MSXA 5PADA 5K16A 4YYUA 3BOWA 7PCKA 3GCBA 4CDCB 1HUCB 2FRAA 4W4UA 2E01A 3NHEA 3BCNA 4BS5A 2VHFA 4AXLA 1YK8A 1S4VA 1U9WA 4W5CA 1MS6A 3E1ZB 2R9MA 3HWNA 4P6EA 4Q8GA 1CVZA 3WXFA 1ICFA 2AIMA 3CH3X 3OISA 2IBIA 2DJFB 3V6EA 5F02A 3K9MA 3HHAA 2PBHA 3QJ3A 3USVA 2VHSA 1ZIVA 1CTEA 6PADA 4ZUXU 4BSQA 2F1GA 2JQFR 2P7UA 3U8EA 4I07A 4CDEB 2OP3A 2DC6A 2XU4A 4YYQA 3ERVA 4FK5A 2R9FA 1GMYA 3I06A 3HHIA 5CVOB 3H89A 3IEJA 2XU5A 1AU4A 2ATOA 3O1GA 4MZSA 2PREA 1U9XA 2YJ8A 3KFQA 5FPWA 4QH6A 2FUDA 3O0UA 2E02A 3P5UA 4BQVA 4FJCA 3S3RA 3H6SA 5EF4A 1TU6A 1YT7A 1CV8A 2AYOA 3IOQA 1BQIA 5A24A 8PCHA 3B79A 3KSEA 4CDFB 4N8WA 2P0RA 1CJLA 1AU3A 3WXEA 1EWOA 2ACTA 3BPMA 1ITOA 1PADA 3C9EA 1F29A 3OF8A 2FTDA 3QT4A 4PP1A 1O0EA 2B1NA 4HWYA 3MHSA 2FO5A 3F75A 1AU2A 1X9YA 2CB5A 1VJVA 1MDWA 4X6HA 2Y6EA 3OF9A 1F2AA 3CH2X 4YYRA 1PIPA 1GCBA 4WA6A 3LXSA 2G6DA 1ME4A 3PDFA 3KWBX 2DC8A 4YVAA 2CIOA 2BDZA 2XU1A 4YYWA 2P86A 3MHHA 1A6RA 4YYSA 4N4ZA 2OULA 3MTNA 4DMYA 2PADA 2DZYA 4I05A 2DCAA 3KKUA 1MEGA 1THEA 5CHVA 3P5XA 2GFOA 1DF0A 4MZOA 1VSNA 2R6NA 2DCCA 2HXZA 3H8CA 1TLOA 2G8EA 3IMAA 1GLOA 2AUXA 5CVMA 5J94A 1GECE 2JQGR 2B1MA 4RY2A 3ZUAA 3K24A 1DEUA 1IWDA 3OVXA 1YVBA 4X6JA 3H8BA 2DCBA 4OEMA 1BY8A 3KX1A 1PCIA 4W5BA 1U9VA 2AS8A 2R9NA 3IV2A 2C0YA 1PE6A 1Q6KA 1PBHA 5CHTA 4YV8A 1ATKA 1BP4A 3AI8A 1U9QX 1KXRA 3PBHA 2IPPB 1ME3A 2NQAA 5EGWA 1PPPA 4OELA 4CZWA 1KFXL 2H7JA 1NL6A 2DC7A 1NQCA 1Y4HA 2E00A 2HHNA 2DZZA 1QMYA 2OZ2A 3BWKA 4CDDB 2E03A 2HD5A 4Q8HA 4XR7A 3HD3A 1QDQA 2NQIA 1EWPA 3RVXA 2FRQA 1AYVA 3QSDA 4QRXA 4YYVA 5CVNB 2GHUA 1MHWA 1EF7A 1AYUA 1POPA 2Y5BA 2YJCA 3DF0A 1BGOA 5JH3A 2F7DA 2YJ2A 3V6CA 1KHPA 3BC3A 5JA7A 1AECA 3CBJA 4XUIA 3CBKA 3RVWA 2AUZA 2AVWA 2YJ9A 2AYNA 3MORA 3LFYA 1PPOA 1XKGA 4G54A 1SNKA 3IHPA 4FIPA 1NB5A 3KWZA 3P5VA 1PPDA 4N79A 3BPFA 1CSBB 3IUTA 2DJGB 1CQDA 3K8UA 1YK7A 1U5IA 1KHQA 1NPZA 1AIMA 2NQGA 3F5VA 1QXPA 4QRVA 1TL9A 2DCDA 3M99A 4PP2E 2G8JA 1ZCMA
chains in the Genus database with same CATH superfamily
1QOLA 2BDLA 1KFUL 3P5WA 2DC9A 2FQ9A 3H7DA 4BS6A 1F2BA 1EWMA 4QRGA 4I04A 1K3BB 1FH0A 3WXGA 3N3KA 2DOSA 1MIRA 2XU3A 4D8IA 4BOUA 3MTVA 4AXMA 4P6GA 4DMXA 1CB5A 2JTCA 2AGAA 1AU0A 4OVZB 1EWLA 1JQPA 2R9OA 4MM3B 2FT2A 2YJBA 4RNAA 2PNSA 3D6SA 1NLJA 4KLBA 4PI3A 2R9CA 1PXVA 1F2CA 3PW3A 1CPJA 1NB3A 3N4CA 4QBBA 3PNRA 4X6IA 2BTWA 4MI7A 2HH5A 2WBFX 9PAPA 1AYWA 1SP4B 3RVVA 2NQDB 4GUAA 1STFE 1MEMA 2AU1A 4K7CA 3KW9A 3I3TA 2O6XA 3TNXA 2FYEA 3OVZA 4BPVA 4PADA 1M6DA 3S3QA 1PPNA 2G7YA 1YALA 3N3GA 2ARYA 1Y08A 1CS8A 4MSXA 5PADA 5K16A 4YYUA 3BOWA 7PCKA 3GCBA 4CDCB 1HUCB 2FRAA 4W4UA 2E01A 4BOQA 3NHEA 3BCNA 4BS5A 2VHFA 4AXLA 1YK8A 3TMPA 1S4VA 1U9WA 4W5CA 1MS6A 3E1ZB 2R9MA 3HWNA 4P6EA 4Q8GA 1CVZA 3E9SA 3WXFA 1ICFA 2AIMA 3CH3X 3OISA 2IBIA 2DJFB 3V6EA 5F02A 3PSEA 3K9MA 3HHAA 2PBHA 3BB7A 3QJ3A 3USVA 2VHSA 1ZIVA 1CTEA 6PADA 4ZUXU 4BSQA 2F1GA 2JQFR 2P7UA 5EZQA 3U8EA 4I07A 4CDEB 2OP3A 3MP2A 2DC6A 2XU4A 3RNVA 4XZXA 4YYQA 3ERVA 4FK5A 4RKXA 2R9FA 1GMYA 3I06A 3HHIA 5CVOB 3H89A 1YZBA 3IEJA 2XU5A 1AU4A 2ATOA 3O1GA 2BTWB 4MZSA 2PREA 4M0WA 1UKFA 1U9XA 2YJ8A 4REZA 2JRIA 3KFQA 5FPWA 4QH6A 2FUDA 3O0UA 2E02A 3P5UA 4BQVA 4FJCA 3S3RA 3H6SA 3PHUA 5EF4A 1TU6A 4IP3A 1YT7A 4A5UA 2J7QC 1CV8A 2AYOA 3IOQA 1BQIA 5A24A 8PCHA 3B79A 3KSEA 4CDFB 4N8WA 2P0RA 1CJLA 1AU3A 3WXEA 1EWOA 2ACTA 3BPMA 1ITOA 1PADA 3C9EA 1F29A 3OF8A 2FTDA 3QT4A 4PP1A 1O0EA 2B1NA 3O65A 4HWYA 5KO3A 3MHSA 2FO5A 3F75A 4WURA 1AU2A 1X9YA 2CB5A 1VJVA 1MDWA 4X6HA 2Y6EA 3OF9A 1F2AA 3CH2X 4YYRA 1PIPA 1GCBA 4WA6A 3LXSA 2G6DA 3B21A 1ME4A 3PDFA 3KWBX 4D8EA 2DC8A 4YVAA 2CIOA 3BBAA 2BDZA 1PVJA 2HWKA 2XU1A 4YYWA 2P86A 3MHHA 1A6RA 4RF0A 4YYSA 4HXDB 5E6JA 4N4ZA 1DKIA 2OULA 3MTNA 4DMYA 2PADA 2DZYA 3ZNHA 5EZSA 4I05A 2DCAA 3W31A 3KKUA 1MEGA 1THEA 5CHVA 3P5XA 2GFOA 4ZTBA 1DF0A 4MZOA 1VSNA 2R6NA 3BY4A 2DCCA 2HXZA 3H8CA 1TLOA 2G8EA 3IMAA 1GLOA 2AUXA 5CVMA 5J94A 1GECE 2JQGR 2B1MA 4RY2A 3ZUAA 3K24A 1DEUA 2UZJA 4D8BA 1IWDA 3OVXA 1YVBA 4X6JA 3H8BA 2DCBA 3PRPA 4OEMA 1BY8A 3KX1A 1PCIA 4W5BA 1U9VA 2AS8A 2R9NA 3IV2A 2C0YA 1PE6A 1Q6KA 3PHXA 1PBHA 5CHTA 4YV8A 1ATKA 3PHWA 1BP4A 3AI8A 3IFUA 1U9QX 1KXRA 3PBHA 2IPPB 1ME3A 2BU3A 2NQAA 5EGWA 1PPPA 3C0RA 4OELA 4CZWA 1KFXL 2H7JA 1NL6A 2DC7A 1NQCA 1Y4HA 2E00A 4OW0A 4BOPA 2HHNA 2DZZA 4P16A 1QMYA 2OZ2A 3BWKA 4CDDB 3OQCA 2E03A 2HD5A 4Q8HA 4XR7A 3HD3A 1QDQA 2NQIA 1EWPA 3RVXA 2FRQA 1AYVA 3QSDA 4QRXA 4OVZA 4R3DA 4YYVA 3PRMA 5CVNB 2GHUA 1MHWA 1EF7A 1AYUA 1POPA 3TRKA 2Y5BA 2YJCA 3DF0A 4RF1A 1BGOA 5JH3A 2F7DA 2YJ2A 3V6CA 1KHPA 3BC3A 5JA7A 3MJ5A 1AECA 3CBJA 3W30A 4XUIA 3CBKA 3RVWA 2AUZA 2AVWA 3PT2A 2YJ9A 2AYNA 2Z84A 3MORA 3LFYA 1PPOA 1XKGA 4G54A 1SNKA 3IHPA 4FIPA 1NB5A 3KWZA 3P5VA 1PPDA 4N79A 2J7QA 3BPFA 1CSBB 3IUTA 4IUMA 2DJGB 1CQDA 3K8UA 1YK7A 4PT5A 4BOSA 2FE8A 1U5IA 1KHQA 1NPZA 1AIMA 2NQGA 3F5VA 1QXPA 4QRVA 1TL9A 2DCDA 3M99A 4PP2E 5JZEA 2G8JA 1ZCMA 4BOZA
chains in the Genus database with same CATH topology
4NV7A 1QOLA 2BDLA 1KFUL 3P5WA 2DC9A 2FQ9A 3H7DA 4BS6A 1F2BA 1EWMA 4QRGA 4I04A 1K3BB 1FH0A 3WXGA 3N3KA 1MIRA 2XU3A 4AXMA 4P6GA 4DMXA 1CB5A 1AU0A 1EWLA 1JQPA 2R9OA 2FT2A 2YJBA 2PNSA 3D6SA 1NLJA 4KLBA 4PI3A 2R9CA 1PXVA 1F2CA 3PW3A 1CPJA 1NB3A 3N4CA 4QBBA 4BGFA 3PNRA 4X6IA 2HH5A 2WBFX 9PAPA 1AYWA 1SP4B 3RVVA 2NQDB 1STFE 1MEMA 2AU1A 4K7CA 3KW9A 3I3TA 2O6XA 3TNXA 2FYEA 3OVZA 4BPVA 4PADA 1M6DA 3S3QA 1PPNA 2G7YA 1YALA 3N3GA 4NV8A 2ARYA 1Y08A 1CS8A 4MSXA 5PADA 5K16A 4YYUA 3BOWA 1GX3A 7PCKA 3GCBA 4CDCB 1HUCB 2FRAA 4W4UA 2E01A 3NHEA 3BCNA 4BS5A 2VHFA 4AXLA 1YK8A 1S4VA 1U9WA 4W5CA 1MS6A 3E1ZB 2R9MA 3HWNA 4P6EA 4Q8GA 1CVZA 3WXFA 1ICFA 4C5PA 2AIMA 3CH3X 3OISA 2IBIA 2DJFB 3V6EA 5F02A 3K9MA 3LTWA 3HHAA 2PBHA 3QJ3A 3USVA 2VHSA 1ZIVA 1CTEA 6PADA 4ZUXU 4BSQA 2F1GA 2JQFR 2P7UA 3U8EA 4I07A 4CDEB 2OP3A 2DC6A 2XU4A 4YYQA 3ERVA 4FK5A 2R9FA 1GMYA 3I06A 3HHIA 5CVOB 3H89A 3IEJA 2XU5A 1AU4A 2ATOA 3O1GA 4MZSA 2PREA 1U9XA 2YJ8A 3KFQA 5FPWA 4QH6A 2FUDA 2VFBA 3O0UA 2E02A 3P5UA 4BQVA 4FJCA 3S3RA 3H6SA 5EF4A 1TU6A 1YT7A 1CV8A 2AYOA 3IOQA 1BQIA 5A24A 8PCHA 3B79A 3KSEA 4CDFB 4N8WA 2P0RA 1CJLA 1AU3A 3WXEA 1EWOA 2ACTA 3BPMA 1ITOA 1PADA 3C9EA 1F29A 3OF8A 2FTDA 3QT4A 4PP1A 1O0EA 2B1NA 2VFCA 4HWYA 3MHSA 2FO5A 3F75A 1AU2A 1X9YA 2CB5A 1VJVA 1MDWA 4X6HA 2Y6EA 3OF9A 1F2AA 3CH2X 4YYRA 1PIPA 1GCBA 4WA6A 3LXSA 2G6DA 1ME4A 3PDFA 3KWBX 2DC8A 4YVAA 2CIOA 2BDZA 2XU1A 4YYWA 2P86A 3MHHA 1A6RA 4YYSA 4N4ZA 2OULA 3MTNA 4DMYA 2PADA 2DZYA 4I05A 2DCAA 3KKUA 1MEGA 1THEA 5CHVA 3P5XA 2GFOA 1DF0A 4MZOA 1VSNA 2R6NA 2DCCA 2HXZA 3H8CA 1TLOA 2G8EA 3IMAA 1GLOA 4GUZA 2AUXA 5CVMA 5J94A 1GECE 2JQGR 2B1MA 4RY2A 3ZUAA 3K24A 1DEUA 1IWDA 3OVXA 1YVBA 4X6JA 3H8BA 2DCBA 4OEMA 1BY8A 3KX1A 1PCIA 4W5BA 1U9VA 2AS8A 2R9NA 3IV2A 2C0YA 1PE6A 1Q6KA 3D9WA 1PBHA 5CHTA 4YV8A 1ATKA 1BP4A 3AI8A 1U9QX 1KXRA 3PBHA 2IPPB 1ME3A 2NQAA 5EGWA 1PPPA 4OELA 4CZWA 1KFXL 2H7JA 1NL6A 2DC7A 1NQCA 1Y4HA 2E00A 2HHNA 2DZZA 1QMYA 2OZ2A 3BWKA 4CDDB 2E03A 2HD5A 4Q8HA 4XR7A 3HD3A 1QDQA 2NQIA 1EWPA 3RVXA 2FRQA 1AYVA 3QSDA 4QRXA 1W4TA 4YYVA 5CVNB 2GHUA 1MHWA 1EF7A 1AYUA 1POPA 2Y5BA 2YJCA 3DF0A 1BGOA 5JH3A 2F7DA 2YJ2A 3V6CA 1KHPA 1W5RA 3BC3A 5JA7A 1AECA 3CBJA 4XUIA 3CBKA 3RVWA 2AUZA 2AVWA 2YJ9A 2AYNA 3MORA 3LFYA 1PPOA 1XKGA 4G54A 1SNKA 3IHPA 4FIPA 1NB5A 3KWZA 3P5VA 1PPDA 4N79A 3BPFA 1CSBB 3IUTA 2DJGB 1CQDA 3K8UA 1E2TA 1YK7A 1U5IA 1KHQA 1NPZA 1AIMA 2NQGA 4B55A 3F5VA 1QXPA 1W6FA 4QRVA 1TL9A 2DCDA 3M99A 4PP2E 2G8JA 2BSZA 1ZCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOL A;  2BDL A;  1KFU L;  3P5W A;  2DC9 A;  2FQ9 A;  3H7D A;  4BS6 A;  1F2B A;  1EWM A;  4QRG A;  4I04 A;  1K3B B;  1FH0 A;  3WXG A;  3N3K A;  1MIR A;  2XU3 A;  4AXM A;  4P6G A;  4DMX A;  1CB5 A;  1AU0 A;  1EWL A;  1JQP A;  2R9O A;  2FT2 A;  2YJB A;  2PNS A;  3D6S A;  1NLJ A;  4KLB A;  4PI3 A;  2R9C A;  1PXV A;  1F2C A;  3PW3 A;  1CPJ A;  1NB3 A;  3N4C A;  4QBB A;  3PNR A;  4X6I A;  2HH5 A;  2WBF X;  9PAP A;  1AYW A;  1SP4 B;  3RVV A;  2NQD B;  1STF E;  1MEM A;  2AU1 A;  4K7C A;  3KW9 A;  3I3T A;  2O6X A;  3TNX A;  2FYE A;  3OVZ A;  4BPV A;  4PAD A;  1M6D A;  3S3Q A;  1PPN A;  2G7Y A;  1YAL A;  3N3G A;  2ARY A;  1Y08 A;  1CS8 A;  4MSX A;  5PAD A;  5K16 A;  4YYU A;  3BOW A;  7PCK A;  3GCB A;  4CDC B;  1HUC B;  2FRA A;  4W4U A;  2E01 A;  3NHE A;  3BCN A;  4BS5 A;  2VHF A;  4AXL A;  1YK8 A;  1S4V A;  1U9W A;  4W5C A;  1MS6 A;  3E1Z B;  2R9M A;  3HWN A;  4P6E A;  4Q8G A;  1CVZ A;  3WXF A;  1ICF A;  2AIM A;  3CH3 X;  3OIS A;  2IBI A;  2DJF B;  3V6E A;  5F02 A;  3K9M A;  3HHA A;  2PBH A;  3QJ3 A;  3USV A;  2VHS A;  1ZIV A;  1CTE A;  6PAD A;  4ZUX U;  4BSQ A;  2F1G A;  2JQF R;  2P7U A;  3U8E A;  4I07 A;  4CDE B;  2OP3 A;  2DC6 A;  2XU4 A;  4YYQ A;  3ERV A;  4FK5 A;  2R9F A;  1GMY A;  3I06 A;  3HHI A;  5CVO B;  3H89 A;  3IEJ A;  2XU5 A;  1AU4 A;  2ATO A;  3O1G A;  4MZS A;  2PRE A;  1U9X A;  2YJ8 A;  3KFQ A;  5FPW A;  4QH6 A;  2FUD A;  3O0U A;  2E02 A;  3P5U A;  4BQV A;  4FJC A;  3S3R A;  3H6S A;  5EF4 A;  1TU6 A;  1YT7 A;  1CV8 A;  2AYO A;  3IOQ A;  1BQI A;  5A24 A;  8PCH A;  3B79 A;  3KSE A;  4CDF B;  4N8W A;  2P0R A;  1CJL A;  1AU3 A;  3WXE A;  1EWO A;  2ACT A;  3BPM A;  1ITO A;  1PAD A;  3C9E A;  1F29 A;  3OF8 A;  2FTD A;  3QT4 A;  4PP1 A;  1O0E A;  2B1N A;  4HWY A;  3MHS A;  2FO5 A;  3F75 A;  1AU2 A;  1X9Y A;  2CB5 A;  1VJV A;  1MDW A;  4X6H A;  2Y6E A;  3OF9 A;  1F2A A;  3CH2 X;  4YYR A;  1PIP A;  1GCB A;  4WA6 A;  3LXS A;  2G6D A;  1ME4 A;  3PDF A;  3KWB X;  2DC8 A;  4YVA A;  2CIO A;  2BDZ A;  2XU1 A;  4YYW A;  2P86 A;  3MHH A;  1A6R A;  4YYS A;  4N4Z A;  2OUL A;  3MTN A;  4DMY A;  2PAD A;  2DZY A;  4I05 A;  2DCA A;  3KKU A;  1MEG A;  1THE A;  5CHV A;  3P5X A;  2GFO A;  1DF0 A;  4MZO A;  1VSN A;  2R6N A;  2DCC A;  2HXZ A;  3H8C A;  1TLO A;  2G8E A;  3IMA A;  1GLO A;  2AUX A;  5CVM A;  5J94 A;  1GEC E;  2JQG R;  2B1M A;  4RY2 A;  3ZUA A;  3K24 A;  1DEU A;  1IWD A;  3OVX A;  1YVB A;  4X6J A;  3H8B A;  2DCB A;  4OEM A;  1BY8 A;  3KX1 A;  1PCI A;  4W5B A;  1U9V A;  2AS8 A;  2R9N A;  3IV2 A;  2C0Y A;  1PE6 A;  1Q6K A;  1PBH A;  5CHT A;  4YV8 A;  1ATK A;  1BP4 A;  3AI8 A;  1U9Q X;  1KXR A;  3PBH A;  2IPP B;  1ME3 A;  2NQA A;  5EGW A;  1PPP A;  4OEL A;  4CZW A;  1KFX L;  2H7J A;  1NL6 A;  2DC7 A;  1NQC A;  1Y4H A;  2E00 A;  2HHN A;  2DZZ A;  1QMY A;  2OZ2 A;  3BWK A;  4CDD B;  2E03 A;  2HD5 A;  4Q8H A;  4XR7 A;  3HD3 A;  1QDQ A;  2NQI A;  1EWP A;  3RVX A;  2FRQ A;  1AYV A;  3QSD A;  4QRX A;  4YYV A;  5CVN B;  2GHU A;  1MHW A;  1EF7 A;  1AYU A;  1POP A;  2Y5B A;  2YJC A;  3DF0 A;  1BGO A;  5JH3 A;  2F7D A;  2YJ2 A;  3V6C A;  1KHP A;  3BC3 A;  5JA7 A;  1AEC A;  3CBJ A;  4XUI A;  3CBK A;  3RVW A;  2AUZ A;  2AVW A;  2YJ9 A;  2AYN A;  3MOR A;  3LFY A;  1PPO A;  1XKG A;  4G54 A;  1SNK A;  3IHP A;  4FIP A;  1NB5 A;  3KWZ A;  3P5V A;  1PPD A;  4N79 A;  3BPF A;  1CSB B;  3IUT A;  2DJG B;  1CQD A;  3K8U A;  1YK7 A;  1U5I A;  1KHQ A;  1NPZ A;  1AIM A;  2NQG A;  3F5V A;  1QXP A;  4QRV A;  1TL9 A;  2DCD A;  3M99 A;  4PP2 E;  2G8J A;  1ZCM A; 
#chains in the Genus database with same CATH topology
 1QOL A;  2BDL A;  1KFU L;  3P5W A;  2DC9 A;  2FQ9 A;  3H7D A;  4BS6 A;  1F2B A;  1EWM A;  4QRG A;  4I04 A;  1K3B B;  1FH0 A;  3WXG A;  3N3K A;  2DOS A;  1MIR A;  2XU3 A;  4D8I A;  4BOU A;  3MTV A;  4AXM A;  4P6G A;  4DMX A;  1CB5 A;  2JTC A;  2AGA A;  1AU0 A;  4OVZ B;  1EWL A;  1JQP A;  2R9O A;  4MM3 B;  2FT2 A;  2YJB A;  4RNA A;  2PNS A;  3D6S A;  1NLJ A;  4KLB A;  4PI3 A;  2R9C A;  1PXV A;  1F2C A;  3PW3 A;  1CPJ A;  1NB3 A;  3N4C A;  4QBB A;  3PNR A;  4X6I A;  2BTW A;  4MI7 A;  2HH5 A;  2WBF X;  9PAP A;  1AYW A;  1SP4 B;  3RVV A;  2NQD B;  4GUA A;  1STF E;  1MEM A;  2AU1 A;  4K7C A;  3KW9 A;  3I3T A;  2O6X A;  3TNX A;  2FYE A;  3OVZ A;  4BPV A;  4PAD A;  1M6D A;  3S3Q A;  1PPN A;  2G7Y A;  1YAL A;  3N3G A;  2ARY A;  1Y08 A;  1CS8 A;  4MSX A;  5PAD A;  5K16 A;  4YYU A;  3BOW A;  7PCK A;  3GCB A;  4CDC B;  1HUC B;  2FRA A;  4W4U A;  2E01 A;  4BOQ A;  3NHE A;  3BCN A;  4BS5 A;  2VHF A;  4AXL A;  1YK8 A;  3TMP A;  1S4V A;  1U9W A;  4W5C A;  1MS6 A;  3E1Z B;  2R9M A;  3HWN A;  4P6E A;  4Q8G A;  1CVZ A;  3E9S A;  3WXF A;  1ICF A;  2AIM A;  3CH3 X;  3OIS A;  2IBI A;  2DJF B;  3V6E A;  5F02 A;  3PSE A;  3K9M A;  3HHA A;  2PBH A;  3BB7 A;  3QJ3 A;  3USV A;  2VHS A;  1ZIV A;  1CTE A;  6PAD A;  4ZUX U;  4BSQ A;  2F1G A;  2JQF R;  2P7U A;  5EZQ A;  3U8E A;  4I07 A;  4CDE B;  2OP3 A;  3MP2 A;  2DC6 A;  2XU4 A;  3RNV A;  4XZX A;  4YYQ A;  3ERV A;  4FK5 A;  4RKX A;  2R9F A;  1GMY A;  3I06 A;  3HHI A;  5CVO B;  3H89 A;  1YZB A;  3IEJ A;  2XU5 A;  1AU4 A;  2ATO A;  3O1G A;  2BTW B;  4MZS A;  2PRE A;  4M0W A;  1UKF A;  1U9X A;  2YJ8 A;  4REZ A;  2JRI A;  3KFQ A;  5FPW A;  4QH6 A;  2FUD A;  3O0U A;  2E02 A;  3P5U A;  4BQV A;  4FJC A;  3S3R A;  3H6S A;  3PHU A;  5EF4 A;  1TU6 A;  4IP3 A;  1YT7 A;  4A5U A;  2J7Q C;  1CV8 A;  2AYO A;  3IOQ A;  1BQI A;  5A24 A;  8PCH A;  3B79 A;  3KSE A;  4CDF B;  4N8W A;  2P0R A;  1CJL A;  1AU3 A;  3WXE A;  1EWO A;  2ACT A;  3BPM A;  1ITO A;  1PAD A;  3C9E A;  1F29 A;  3OF8 A;  2FTD A;  3QT4 A;  4PP1 A;  1O0E A;  2B1N A;  3O65 A;  4HWY A;  5KO3 A;  3MHS A;  2FO5 A;  3F75 A;  4WUR A;  1AU2 A;  1X9Y A;  2CB5 A;  1VJV A;  1MDW A;  4X6H A;  2Y6E A;  3OF9 A;  1F2A A;  3CH2 X;  4YYR A;  1PIP A;  1GCB A;  4WA6 A;  3LXS A;  2G6D A;  3B21 A;  1ME4 A;  3PDF A;  3KWB X;  4D8E A;  2DC8 A;  4YVA A;  2CIO A;  3BBA A;  2BDZ A;  1PVJ A;  2HWK A;  2XU1 A;  4YYW A;  2P86 A;  3MHH A;  1A6R A;  4RF0 A;  4YYS A;  4HXD B;  5E6J A;  4N4Z A;  1DKI A;  2OUL A;  3MTN A;  4DMY A;  2PAD A;  2DZY A;  3ZNH A;  5EZS A;  4I05 A;  2DCA A;  3W31 A;  3KKU A;  1MEG A;  1THE A;  5CHV A;  3P5X A;  2GFO A;  4ZTB A;  1DF0 A;  4MZO A;  1VSN A;  2R6N A;  3BY4 A;  2DCC A;  2HXZ A;  3H8C A;  1TLO A;  2G8E A;  3IMA A;  1GLO A;  2AUX A;  5CVM A;  5J94 A;  1GEC E;  2JQG R;  2B1M A;  4RY2 A;  3ZUA A;  3K24 A;  1DEU A;  2UZJ A;  4D8B A;  1IWD A;  3OVX A;  1YVB A;  4X6J A;  3H8B A;  2DCB A;  3PRP A;  4OEM A;  1BY8 A;  3KX1 A;  1PCI A;  4W5B A;  1U9V A;  2AS8 A;  2R9N A;  3IV2 A;  2C0Y A;  1PE6 A;  1Q6K A;  3PHX A;  1PBH A;  5CHT A;  4YV8 A;  1ATK A;  3PHW A;  1BP4 A;  3AI8 A;  3IFU A;  1U9Q X;  1KXR A;  3PBH A;  2IPP B;  1ME3 A;  2BU3 A;  2NQA A;  5EGW A;  1PPP A;  3C0R A;  4OEL A;  4CZW A;  1KFX L;  2H7J A;  1NL6 A;  2DC7 A;  1NQC A;  1Y4H A;  2E00 A;  4OW0 A;  4BOP A;  2HHN A;  2DZZ A;  4P16 A;  1QMY A;  2OZ2 A;  3BWK A;  4CDD B;  3OQC A;  2E03 A;  2HD5 A;  4Q8H A;  4XR7 A;  3HD3 A;  1QDQ A;  2NQI A;  1EWP A;  3RVX A;  2FRQ A;  1AYV A;  3QSD A;  4QRX A;  4OVZ A;  4R3D A;  4YYV A;  3PRM A;  5CVN B;  2GHU A;  1MHW A;  1EF7 A;  1AYU A;  1POP A;  3TRK A;  2Y5B A;  2YJC A;  3DF0 A;  4RF1 A;  1BGO A;  5JH3 A;  2F7D A;  2YJ2 A;  3V6C A;  1KHP A;  3BC3 A;  5JA7 A;  3MJ5 A;  1AEC A;  3CBJ A;  3W30 A;  4XUI A;  3CBK A;  3RVW A;  2AUZ A;  2AVW A;  3PT2 A;  2YJ9 A;  2AYN A;  2Z84 A;  3MOR A;  3LFY A;  1PPO A;  1XKG A;  4G54 A;  1SNK A;  3IHP A;  4FIP A;  1NB5 A;  3KWZ A;  3P5V A;  1PPD A;  4N79 A;  2J7Q A;  3BPF A;  1CSB B;  3IUT A;  4IUM A;  2DJG B;  1CQD A;  3K8U A;  1YK7 A;  4PT5 A;  4BOS A;  2FE8 A;  1U5I A;  1KHQ A;  1NPZ A;  1AIM A;  2NQG A;  3F5V A;  1QXP A;  4QRV A;  1TL9 A;  2DCD A;  3M99 A;  4PP2 E;  5JZE A;  2G8J A;  1ZCM A;  4BOZ A; 
#chains in the Genus database with same CATH homology
 4NV7 A;  1QOL A;  2BDL A;  1KFU L;  3P5W A;  2DC9 A;  2FQ9 A;  3H7D A;  4BS6 A;  1F2B A;  1EWM A;  4QRG A;  4I04 A;  1K3B B;  1FH0 A;  3WXG A;  3N3K A;  1MIR A;  2XU3 A;  4AXM A;  4P6G A;  4DMX A;  1CB5 A;  1AU0 A;  1EWL A;  1JQP A;  2R9O A;  2FT2 A;  2YJB A;  2PNS A;  3D6S A;  1NLJ A;  4KLB A;  4PI3 A;  2R9C A;  1PXV A;  1F2C A;  3PW3 A;  1CPJ A;  1NB3 A;  3N4C A;  4QBB A;  4BGF A;  3PNR A;  4X6I A;  2HH5 A;  2WBF X;  9PAP A;  1AYW A;  1SP4 B;  3RVV A;  2NQD B;  1STF E;  1MEM A;  2AU1 A;  4K7C A;  3KW9 A;  3I3T A;  2O6X A;  3TNX A;  2FYE A;  3OVZ A;  4BPV A;  4PAD A;  1M6D A;  3S3Q A;  1PPN A;  2G7Y A;  1YAL A;  3N3G A;  4NV8 A;  2ARY A;  1Y08 A;  1CS8 A;  4MSX A;  5PAD A;  5K16 A;  4YYU A;  3BOW A;  1GX3 A;  7PCK A;  3GCB A;  4CDC B;  1HUC B;  2FRA A;  4W4U A;  2E01 A;  3NHE A;  3BCN A;  4BS5 A;  2VHF A;  4AXL A;  1YK8 A;  1S4V A;  1U9W A;  4W5C A;  1MS6 A;  3E1Z B;  2R9M A;  3HWN A;  4P6E A;  4Q8G A;  1CVZ A;  3WXF A;  1ICF A;  4C5P A;  2AIM A;  3CH3 X;  3OIS A;  2IBI A;  2DJF B;  3V6E A;  5F02 A;  3K9M A;  3LTW A;  3HHA A;  2PBH A;  3QJ3 A;  3USV A;  2VHS A;  1ZIV A;  1CTE A;  6PAD A;  4ZUX U;  4BSQ A;  2F1G A;  2JQF R;  2P7U A;  3U8E A;  4I07 A;  4CDE B;  2OP3 A;  2DC6 A;  2XU4 A;  4YYQ A;  3ERV A;  4FK5 A;  2R9F A;  1GMY A;  3I06 A;  3HHI A;  5CVO B;  3H89 A;  3IEJ A;  2XU5 A;  1AU4 A;  2ATO A;  3O1G A;  4MZS A;  2PRE A;  1U9X A;  2YJ8 A;  3KFQ A;  5FPW A;  4QH6 A;  2FUD A;  2VFB A;  3O0U A;  2E02 A;  3P5U A;  4BQV A;  4FJC A;  3S3R A;  3H6S A;  5EF4 A;  1TU6 A;  1YT7 A;  1CV8 A;  2AYO A;  3IOQ A;  1BQI A;  5A24 A;  8PCH A;  3B79 A;  3KSE A;  4CDF B;  4N8W A;  2P0R A;  1CJL A;  1AU3 A;  3WXE A;  1EWO A;  2ACT A;  3BPM A;  1ITO A;  1PAD A;  3C9E A;  1F29 A;  3OF8 A;  2FTD A;  3QT4 A;  4PP1 A;  1O0E A;  2B1N A;  2VFC A;  4HWY A;  3MHS A;  2FO5 A;  3F75 A;  1AU2 A;  1X9Y A;  2CB5 A;  1VJV A;  1MDW A;  4X6H A;  2Y6E A;  3OF9 A;  1F2A A;  3CH2 X;  4YYR A;  1PIP A;  1GCB A;  4WA6 A;  3LXS A;  2G6D A;  1ME4 A;  3PDF A;  3KWB X;  2DC8 A;  4YVA A;  2CIO A;  2BDZ A;  2XU1 A;  4YYW A;  2P86 A;  3MHH A;  1A6R A;  4YYS A;  4N4Z A;  2OUL A;  3MTN A;  4DMY A;  2PAD A;  2DZY A;  4I05 A;  2DCA A;  3KKU A;  1MEG A;  1THE A;  5CHV A;  3P5X A;  2GFO A;  1DF0 A;  4MZO A;  1VSN A;  2R6N A;  2DCC A;  2HXZ A;  3H8C A;  1TLO A;  2G8E A;  3IMA A;  1GLO A;  4GUZ A;  2AUX A;  5CVM A;  5J94 A;  1GEC E;  2JQG R;  2B1M A;  4RY2 A;  3ZUA A;  3K24 A;  1DEU A;  1IWD A;  3OVX A;  1YVB A;  4X6J A;  3H8B A;  2DCB A;  4OEM A;  1BY8 A;  3KX1 A;  1PCI A;  4W5B A;  1U9V A;  2AS8 A;  2R9N A;  3IV2 A;  2C0Y A;  1PE6 A;  1Q6K A;  3D9W A;  1PBH A;  5CHT A;  4YV8 A;  1ATK A;  1BP4 A;  3AI8 A;  1U9Q X;  1KXR A;  3PBH A;  2IPP B;  1ME3 A;  2NQA A;  5EGW A;  1PPP A;  4OEL A;  4CZW A;  1KFX L;  2H7J A;  1NL6 A;  2DC7 A;  1NQC A;  1Y4H A;  2E00 A;  2HHN A;  2DZZ A;  1QMY A;  2OZ2 A;  3BWK A;  4CDD B;  2E03 A;  2HD5 A;  4Q8H A;  4XR7 A;  3HD3 A;  1QDQ A;  2NQI A;  1EWP A;  3RVX A;  2FRQ A;  1AYV A;  3QSD A;  4QRX A;  1W4T A;  4YYV A;  5CVN B;  2GHU A;  1MHW A;  1EF7 A;  1AYU A;  1POP A;  2Y5B A;  2YJC A;  3DF0 A;  1BGO A;  5JH3 A;  2F7D A;  2YJ2 A;  3V6C A;  1KHP A;  1W5R A;  3BC3 A;  5JA7 A;  1AEC A;  3CBJ A;  4XUI A;  3CBK A;  3RVW A;  2AUZ A;  2AVW A;  2YJ9 A;  2AYN A;  3MOR A;  3LFY A;  1PPO A;  1XKG A;  4G54 A;  1SNK A;  3IHP A;  4FIP A;  1NB5 A;  3KWZ A;  3P5V A;  1PPD A;  4N79 A;  3BPF A;  1CSB B;  3IUT A;  2DJG B;  1CQD A;  3K8U A;  1E2T A;  1YK7 A;  1U5I A;  1KHQ A;  1NPZ A;  1AIM A;  2NQG A;  4B55 A;  3F5V A;  1QXP A;  1W6F A;  4QRV A;  1TL9 A;  2DCD A;  3M99 A;  4PP2 E;  2G8J A;  2BSZ A;  1ZCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...