1YVBA

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yvbA00
2B1NA 3AI8A 3QSDA 1ITOA 2G6DA 3WXGA 3K8UA 2AS8A 3CBJA 3V6EA 1ME3A 2FO5A 2VHSA 3KWBX 1EWPA 2YJ9A 2OZ2A 3PNRA 5CVOB 4QRXA 3BWKA 1AYUA 2CB5A 3P5WA 2R9FA 3PW3A 5FPWA 1YALA 3K24A 5CHVA 4YYSA 3KKUA 3IEJA 4QH6A 4I07A 1YVBA 1GMYA 4BS6A 3DF0A 2FRAA 4QRGA 3IHPA 1K3BB 1XKGA 3D6SA 3KFQA 1DF0A 5A24A 2XU4A 2GFOA 1CV8A 2DZZA 1PIPA 3F75A 1U9VA 1ME4A 2DZYA 1U9QX 2FQ9A 2R6NA 3N4CA 1AYVA 1YK8A 1O0EA 2FRQA 3H8CA 4YYRA 1CSBB 3H6SA 1NB5A 4N79A 3OVZA 2DC9A 3GCBA 3HHAA 2JQFR 1VSNA 2DJFB 5K16A 2DC8A 3LFYA 1CPJA 2FT2A 1QMYA 1IWDA 1EWMA 3IMAA 1X9YA 4W5CA 3HD3A 3KX1A 3HWNA 3WXFA 4CZWA 2FUDA 3N3KA 3MHHA 4CDDB 1CTEA 1BP4A 4MZSA 1QDQA 2R9MA 1GCBA 5CVMA 3MHSA 2DCAA 1PPNA 4OELA 2OULA 1A6RA 2P86A 3O1GA 5EGWA 2AU1A 1S4VA 1PE6A 2IPPB 1QXPA 1Q6KA 1ATKA 3TNXA 1SP4B 2FTDA 4YYWA 2JQGR 2HD5A 2PNSA 3U8EA 2OP3A 4K7CA 1PXVA 1NB3A 2E00A 2Y5BA 3ZUAA 2AYNA 3OVXA 5J94A 2HXZA 2F1GA 4G54A 1NLJA 8PCHA 4KLBA 6PADA 2BDZA 2P0RA 3MORA 3MTNA 7PCKA 4CDEB 3BPMA 2NQDB 3S3RA 2YJCA 1YT7A 4W4UA 4CDCB 2YJ2A 2DCDA 4AXMA 3USVA 3RVXA 2CIOA 2NQAA 4HWYA 2XU1A 4Q8GA 1GECE 2NQIA 1VJVA 1MEGA 3H7DA 2IBIA 3P5VA 2AVWA 3I3TA 2AYOA 4DMYA 4N8WA 3CH2X 2DC6A 3CBKA 4PADA 9PAPA 3RVWA 1PCIA 2DC7A 2DCBA 4OEMA 4PI3A 4XR7A 1F2AA 4I05A 1CQDA 1FH0A 5PADA 1PPOA 2FYEA 2G8EA 1AECA 2R9CA 4MSXA 2E01A 1BGOA 3NHEA 3IUTA 3BPFA 3P5UA 5F02A 2PADA 1YK7A 1CB5A 2G7YA 4YYQA 4WA6A 4BS5A 1ZCMA 4W5BA 1KXRA 1MS6A 1BQIA 4FJCA 4BPVA 4MZOA 3V6CA 1HUCB 4I04A 2P7UA 1SNKA 3OF9A 2VHFA 2WBFX 1CJLA 5JH3A 2R9OA 1F2CA 3B79A 1Y08A 4P6EA 4BQVA 1MEMA 3O0UA 4YVAA 2PREA 1PADA 3RVVA 3KWZA 4PP2E 2AIMA 2PBHA 1MIRA 5CHTA 3P5XA 4YYUA 3LXSA 2C0YA 2XU3A 4BSQA 4X6IA 1CS8A 1THEA 1QOLA 4P6GA 3QJ3A 2BDLA 3H89A 2ACTA 2ATOA 2AUXA 2NQGA 4FK5A 1NPZA 3E1ZB 3KSEA 1F29A 1PBHA 1CVZA 3N3GA 3OF8A 3I06A 3OISA 3F5VA 1F2BA 4Q8HA 1KFXL 2B1MA 4YV8A 1M6DA 4QBBA 1EWLA 4YYVA 1AU4A 2F7DA 4FIPA 3S3QA 2AUZA 5CVNB 3IV2A 1ZIVA 2E03A 1KFUL 2ARYA 1STFE 4X6HA 1ICFA 1KHQA 2E02A 2H7JA 3IOQA 1TL9A 3M99A 3BC3A 2GHUA 1Y4HA 1TLOA 1U5IA 1PPDA 2O6XA 3BOWA 1MHWA 5JA7A 1AU0A 2G8JA 2XU5A 1AU2A 1AU3A 1DEUA 3HHIA 2DCCA 3ERVA 1EF7A 4N4ZA 4CDFB 3CH3X 1KHPA 1GLOA 4PP1A 1U9WA 1NQCA 3K9MA 1POPA 2YJ8A 4XUIA 4ZUXU 2DJGB 4DMXA 3PBHA 3C9EA 3QT4A 1NL6A 1EWOA 2Y6EA 5EF4A 3PDFA 1PPPA 3BCNA 1AYWA 1U9XA 3WXEA 1BY8A 4X6JA 3H8BA 1TU6A 2R9NA 1JQPA 3KW9A 4RY2A 2HH5A 1MDWA 4QRVA 4AXLA 2YJBA 1AIMA 2HHNA
chains in the Genus database with same CATH superfamily
2B1NA 3AI8A 3QSDA 2FE8A 1ITOA 2G6DA 3WXGA 3W31A 3K8UA 2AS8A 3PHUA 3CBJA 3V6EA 1ME3A 2FO5A 2VHSA 3KWBX 1EWPA 2YJ9A 2OZ2A 3PNRA 5CVOB 4QRXA 3BWKA 2AGAA 1AYUA 2CB5A 3P5WA 2R9FA 4RNAA 3PW3A 5FPWA 1YALA 3K24A 3MJ5A 4HXDB 5CHVA 4RF1A 4YYSA 3KKUA 3IEJA 4QH6A 4I07A 1YVBA 1GMYA 4BS6A 3DF0A 2FRAA 4QRGA 3IHPA 1K3BB 1XKGA 3D6SA 3KFQA 1DF0A 5A24A 2XU4A 4RKXA 2GFOA 1CV8A 4BOPA 2DZZA 1PIPA 3F75A 1U9VA 1ME4A 2DZYA 1U9QX 2FQ9A 2R6NA 3N4CA 1AYVA 1YK8A 4BOSA 4BOUA 1O0EA 2FRQA 3H8CA 4YYRA 1CSBB 3PHXA 3H6SA 3B21A 1NB5A 4N79A 3OVZA 2DC9A 3GCBA 3HHAA 2JQFR 1VSNA 2DJFB 5K16A 2DC8A 1PVJA 3LFYA 1CPJA 2FT2A 3PHWA 1QMYA 1IWDA 1EWMA 3ZNHA 3IMAA 3MP2A 1X9YA 4D8EA 4W5CA 3HD3A 3KX1A 3HWNA 3WXFA 4CZWA 2FUDA 3N3KA 3MHHA 4CDDB 1CTEA 1BP4A 4MZSA 3TRKA 3W30A 1QDQA 4REZA 2R9MA 1GCBA 5CVMA 3MHSA 2DCAA 1PPNA 4D8IA 4OELA 2OULA 1A6RA 2P86A 1DKIA 3O1GA 5EGWA 2AU1A 1S4VA 1PE6A 4M0WA 2IPPB 1QXPA 1Q6KA 1ATKA 3TNXA 1SP4B 2FTDA 4YYWA 2JQGR 2HD5A 5KO3A 5EZQA 2PNSA 3U8EA 2OP3A 4K7CA 1PXVA 1NB3A 2E00A 2Y5BA 3ZUAA 2AYNA 3OVXA 5J94A 2HXZA 2F1GA 4G54A 1NLJA 8PCHA 4KLBA 6PADA 2BDZA 2P0RA 3MORA 3MTNA 7PCKA 4CDEB 3BPMA 2UZJA 3OQCA 2NQDB 3S3RA 2YJCA 1YT7A 4W4UA 2JRIA 4CDCB 2J7QA 2YJ2A 2DCDA 2BU3A 4AXMA 3USVA 4PT5A 3RVXA 2CIOA 2NQAA 4HWYA 4MI7A 2XU1A 4Q8GA 2DOSA 3RNVA 1GECE 2NQIA 1VJVA 1MEGA 3H7DA 2IBIA 3P5VA 2AVWA 3I3TA 2AYOA 3TMPA 4DMYA 4N8WA 3CH2X 2DC6A 3CBKA 2BTWB 2Z84A 3O65A 4PADA 9PAPA 3RVWA 1PCIA 2DC7A 2DCBA 4OEMA 4PI3A 4XR7A 1F2AA 4I05A 1CQDA 1FH0A 5PADA 1PPOA 2FYEA 2G8EA 1AECA 2R9CA 4MSXA 1YZBA 1BGOA 2E01A 3NHEA 3IUTA 3BPFA 3P5UA 3BBAA 4IUMA 5F02A 2BTWA 2PADA 1YK7A 1CB5A 2G7YA 4YYQA 4WA6A 4BS5A 1ZCMA 4W5BA 1KXRA 1MS6A 1BQIA 4FJCA 4BPVA 4MZOA 3V6CA 1HUCB 4I04A 2P7UA 1SNKA 5JZEA 4A5UA 3OF9A 2VHFA 2WBFX 4RF0A 1CJLA 5JH3A 2R9OA 1F2CA 3B79A 1Y08A 4P6EA 4BQVA 1MEMA 3PRMA 3O0UA 4YVAA 2PREA 1PADA 3RVVA 3KWZA 4PP2E 2AIMA 2PBHA 1MIRA 4OVZB 5CHTA 3P5XA 4YYUA 3LXSA 2C0YA 2XU3A 4BSQA 3C0RA 4X6IA 1CS8A 1THEA 1QOLA 4P6GA 3QJ3A 2BDLA 3H89A 3BY4A 2ACTA 2ATOA 4P16A 3PRPA 2AUXA 2NQGA 4FK5A 4OVZA 1NPZA 3E1ZB 3KSEA 1F29A 1PBHA 1CVZA 3N3GA 3OF8A 3I06A 3E9SA 3OISA 3PSEA 3F5VA 1F2BA 4Q8HA 1KFXL 2B1MA 4YV8A 1M6DA 4QBBA 4WURA 1EWLA 4YYVA 1AU4A 2F7DA 4FIPA 4OW0A 4BOZA 3S3QA 2AUZA 5CVNB 3IV2A 1ZIVA 2E03A 2JTCA 1KFUL 2J7QC 2ARYA 1STFE 4X6HA 1ICFA 1KHQA 1UKFA 2E02A 5E6JA 4IP3A 2H7JA 3IOQA 1TL9A 3M99A 3BC3A 2GHUA 1Y4HA 4MM3B 1TLOA 1U5IA 1PPDA 2O6XA 4ZTBA 3BOWA 1MHWA 5JA7A 1AU0A 2G8JA 2XU5A 3IFUA 1AU2A 1AU3A 1DEUA 3HHIA 2DCCA 3ERVA 1EF7A 4N4ZA 4D8BA 5EZSA 4CDFB 4R3DA 3CH3X 1KHPA 1GLOA 4PP1A 3MTVA 1U9WA 1NQCA 3K9MA 1POPA 2YJ8A 4XUIA 4ZUXU 2DJGB 4DMXA 3PBHA 3C9EA 3BB7A 3QT4A 4XZXA 1NL6A 1EWOA 2Y6EA 4GUAA 5EF4A 3PDFA 1PPPA 2HWKA 3BCNA 1AYWA 1U9XA 3WXEA 1BY8A 4X6JA 3H8BA 1TU6A 2R9NA 1JQPA 3KW9A 4RY2A 2HH5A 1MDWA 4QRVA 4BOQA 4AXLA 2YJBA 3PT2A 1AIMA 2HHNA
chains in the Genus database with same CATH topology
2B1NA 3AI8A 3QSDA 1GX3A 1ITOA 2G6DA 3WXGA 3K8UA 2AS8A 3CBJA 3V6EA 1ME3A 2FO5A 2VHSA 3KWBX 1EWPA 2YJ9A 2OZ2A 3PNRA 5CVOB 4QRXA 3BWKA 1AYUA 2CB5A 3P5WA 2R9FA 1W4TA 3PW3A 5FPWA 1YALA 3K24A 5CHVA 2BSZA 4YYSA 3KKUA 3IEJA 4QH6A 4I07A 1YVBA 1GMYA 4BS6A 3DF0A 2FRAA 4QRGA 3IHPA 1K3BB 1XKGA 3D6SA 3KFQA 1DF0A 5A24A 2XU4A 4NV7A 2GFOA 1CV8A 2VFBA 2DZZA 1PIPA 3F75A 1U9VA 1ME4A 2DZYA 1U9QX 2FQ9A 2R6NA 3N4CA 1AYVA 1YK8A 1O0EA 2FRQA 3H8CA 4YYRA 1CSBB 3H6SA 1NB5A 4N79A 3OVZA 2DC9A 3GCBA 3HHAA 2JQFR 1VSNA 2DJFB 5K16A 2DC8A 3LFYA 1CPJA 2FT2A 1QMYA 1IWDA 1EWMA 3IMAA 1X9YA 4W5CA 3HD3A 3KX1A 3HWNA 3WXFA 4CZWA 2FUDA 3N3KA 3MHHA 4CDDB 1CTEA 1BP4A 4MZSA 1QDQA 2R9MA 1GCBA 5CVMA 3MHSA 2DCAA 1PPNA 4OELA 2OULA 1A6RA 2P86A 3O1GA 5EGWA 2AU1A 1S4VA 1PE6A 2IPPB 1QXPA 1Q6KA 1ATKA 3TNXA 1SP4B 2FTDA 4YYWA 2JQGR 2HD5A 2PNSA 3U8EA 2OP3A 4K7CA 1PXVA 1NB3A 2E00A 2Y5BA 3ZUAA 2AYNA 3OVXA 5J94A 2HXZA 2F1GA 4G54A 1NLJA 8PCHA 4KLBA 6PADA 2BDZA 2P0RA 3MORA 3MTNA 4B55A 7PCKA 4CDEB 3BPMA 2NQDB 3S3RA 2YJCA 1YT7A 4W4UA 4CDCB 2YJ2A 2DCDA 4AXMA 3USVA 3RVXA 2CIOA 2NQAA 4HWYA 2XU1A 4Q8GA 1GECE 2NQIA 1VJVA 1MEGA 3H7DA 2IBIA 3P5VA 2AVWA 3I3TA 2AYOA 4DMYA 4N8WA 4C5PA 3CH2X 1W6FA 2DC6A 3CBKA 3LTWA 4PADA 9PAPA 3RVWA 1PCIA 2DC7A 2DCBA 4OEMA 4PI3A 4XR7A 1F2AA 4I05A 1CQDA 4GUZA 1FH0A 5PADA 1PPOA 2FYEA 2G8EA 1AECA 2R9CA 4MSXA 2E01A 1BGOA 3NHEA 3IUTA 3BPFA 3P5UA 5F02A 1E2TA 2PADA 1YK7A 1CB5A 2G7YA 4YYQA 4WA6A 4BS5A 1ZCMA 4W5BA 1KXRA 1MS6A 1BQIA 4FJCA 4BPVA 4MZOA 3V6CA 1HUCB 4I04A 2P7UA 1SNKA 3OF9A 2VHFA 2WBFX 1CJLA 5JH3A 2R9OA 1F2CA 3B79A 1Y08A 4P6EA 4BQVA 1MEMA 3O0UA 4YVAA 2PREA 1PADA 3RVVA 3KWZA 4PP2E 2AIMA 2PBHA 1MIRA 5CHTA 3P5XA 4YYUA 3LXSA 2C0YA 2XU3A 4BSQA 4X6IA 1CS8A 1THEA 1QOLA 4P6GA 3QJ3A 2BDLA 3H89A 2ACTA 2ATOA 2AUXA 2NQGA 4FK5A 1NPZA 3E1ZB 3KSEA 1F29A 1PBHA 1CVZA 3N3GA 3OF8A 3I06A 3OISA 3F5VA 1F2BA 4Q8HA 1KFXL 2B1MA 4YV8A 1M6DA 4QBBA 1EWLA 4YYVA 1AU4A 2F7DA 4FIPA 3S3QA 2AUZA 5CVNB 3IV2A 1ZIVA 2E03A 1KFUL 2ARYA 1STFE 4X6HA 1ICFA 1KHQA 2E02A 2H7JA 3IOQA 1TL9A 3M99A 3BC3A 2GHUA 1Y4HA 1TLOA 1U5IA 1PPDA 2O6XA 3BOWA 1MHWA 4BGFA 5JA7A 1AU0A 2G8JA 2XU5A 4NV8A 1AU2A 1AU3A 1DEUA 3HHIA 2DCCA 3ERVA 1EF7A 4N4ZA 4CDFB 3CH3X 1KHPA 1GLOA 2VFCA 4PP1A 1U9WA 1NQCA 3K9MA 1POPA 2YJ8A 4XUIA 4ZUXU 2DJGB 4DMXA 3PBHA 3C9EA 3QT4A 1NL6A 1EWOA 2Y6EA 5EF4A 3PDFA 1PPPA 3D9WA 3BCNA 1AYWA 1U9XA 3WXEA 1BY8A 4X6JA 3H8BA 1TU6A 2R9NA 1JQPA 3KW9A 4RY2A 2HH5A 1W5RA 1MDWA 4QRVA 4AXLA 2YJBA 1AIMA 2HHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1N A;  3AI8 A;  3QSD A;  1ITO A;  2G6D A;  3WXG A;  3K8U A;  2AS8 A;  3CBJ A;  3V6E A;  1ME3 A;  2FO5 A;  2VHS A;  3KWB X;  1EWP A;  2YJ9 A;  2OZ2 A;  3PNR A;  5CVO B;  4QRX A;  3BWK A;  1AYU A;  2CB5 A;  3P5W A;  2R9F A;  3PW3 A;  5FPW A;  1YAL A;  3K24 A;  5CHV A;  4YYS A;  3KKU A;  3IEJ A;  4QH6 A;  4I07 A;  1YVB A;  1GMY A;  4BS6 A;  3DF0 A;  2FRA A;  4QRG A;  3IHP A;  1K3B B;  1XKG A;  3D6S A;  3KFQ A;  1DF0 A;  5A24 A;  2XU4 A;  2GFO A;  1CV8 A;  2DZZ A;  1PIP A;  3F75 A;  1U9V A;  1ME4 A;  2DZY A;  1U9Q X;  2FQ9 A;  2R6N A;  3N4C A;  1AYV A;  1YK8 A;  1O0E A;  2FRQ A;  3H8C A;  4YYR A;  1CSB B;  3H6S A;  1NB5 A;  4N79 A;  3OVZ A;  2DC9 A;  3GCB A;  3HHA A;  2JQF R;  1VSN A;  2DJF B;  5K16 A;  2DC8 A;  3LFY A;  1CPJ A;  2FT2 A;  1QMY A;  1IWD A;  1EWM A;  3IMA A;  1X9Y A;  4W5C A;  3HD3 A;  3KX1 A;  3HWN A;  3WXF A;  4CZW A;  2FUD A;  3N3K A;  3MHH A;  4CDD B;  1CTE A;  1BP4 A;  4MZS A;  1QDQ A;  2R9M A;  1GCB A;  5CVM A;  3MHS A;  2DCA A;  1PPN A;  4OEL A;  2OUL A;  1A6R A;  2P86 A;  3O1G A;  5EGW A;  2AU1 A;  1S4V A;  1PE6 A;  2IPP B;  1QXP A;  1Q6K A;  1ATK A;  3TNX A;  1SP4 B;  2FTD A;  4YYW A;  2JQG R;  2HD5 A;  2PNS A;  3U8E A;  2OP3 A;  4K7C A;  1PXV A;  1NB3 A;  2E00 A;  2Y5B A;  3ZUA A;  2AYN A;  3OVX A;  5J94 A;  2HXZ A;  2F1G A;  4G54 A;  1NLJ A;  8PCH A;  4KLB A;  6PAD A;  2BDZ A;  2P0R A;  3MOR A;  3MTN A;  7PCK A;  4CDE B;  3BPM A;  2NQD B;  3S3R A;  2YJC A;  1YT7 A;  4W4U A;  4CDC B;  2YJ2 A;  2DCD A;  4AXM A;  3USV A;  3RVX A;  2CIO A;  2NQA A;  4HWY A;  2XU1 A;  4Q8G A;  1GEC E;  2NQI A;  1VJV A;  1MEG A;  3H7D A;  2IBI A;  3P5V A;  2AVW A;  3I3T A;  2AYO A;  4DMY A;  4N8W A;  3CH2 X;  2DC6 A;  3CBK A;  4PAD A;  9PAP A;  3RVW A;  1PCI A;  2DC7 A;  2DCB A;  4OEM A;  4PI3 A;  4XR7 A;  1F2A A;  4I05 A;  1CQD A;  1FH0 A;  5PAD A;  1PPO A;  2FYE A;  2G8E A;  1AEC A;  2R9C A;  4MSX A;  2E01 A;  1BGO A;  3NHE A;  3IUT A;  3BPF A;  3P5U A;  5F02 A;  2PAD A;  1YK7 A;  1CB5 A;  2G7Y A;  4YYQ A;  4WA6 A;  4BS5 A;  1ZCM A;  4W5B A;  1KXR A;  1MS6 A;  1BQI A;  4FJC A;  4BPV A;  4MZO A;  3V6C A;  1HUC B;  4I04 A;  2P7U A;  1SNK A;  3OF9 A;  2VHF A;  2WBF X;  1CJL A;  5JH3 A;  2R9O A;  1F2C A;  3B79 A;  1Y08 A;  4P6E A;  4BQV A;  1MEM A;  3O0U A;  4YVA A;  2PRE A;  1PAD A;  3RVV A;  3KWZ A;  4PP2 E;  2AIM A;  2PBH A;  1MIR A;  5CHT A;  3P5X A;  4YYU A;  3LXS A;  2C0Y A;  2XU3 A;  4BSQ A;  4X6I A;  1CS8 A;  1THE A;  1QOL A;  4P6G A;  3QJ3 A;  2BDL A;  3H89 A;  2ACT A;  2ATO A;  2AUX A;  2NQG A;  4FK5 A;  1NPZ A;  3E1Z B;  3KSE A;  1F29 A;  1PBH A;  1CVZ A;  3N3G A;  3OF8 A;  3I06 A;  3OIS A;  3F5V A;  1F2B A;  4Q8H A;  1KFX L;  2B1M A;  4YV8 A;  1M6D A;  4QBB A;  1EWL A;  4YYV A;  1AU4 A;  2F7D A;  4FIP A;  3S3Q A;  2AUZ A;  5CVN B;  3IV2 A;  1ZIV A;  2E03 A;  1KFU L;  2ARY A;  1STF E;  4X6H A;  1ICF A;  1KHQ A;  2E02 A;  2H7J A;  3IOQ A;  1TL9 A;  3M99 A;  3BC3 A;  2GHU A;  1Y4H A;  1TLO A;  1U5I A;  1PPD A;  2O6X A;  3BOW A;  1MHW A;  5JA7 A;  1AU0 A;  2G8J A;  2XU5 A;  1AU2 A;  1AU3 A;  1DEU A;  3HHI A;  2DCC A;  3ERV A;  1EF7 A;  4N4Z A;  4CDF B;  3CH3 X;  1KHP A;  1GLO A;  4PP1 A;  1U9W A;  1NQC A;  3K9M A;  1POP A;  2YJ8 A;  4XUI A;  4ZUX U;  2DJG B;  4DMX A;  3PBH A;  3C9E A;  3QT4 A;  1NL6 A;  1EWO A;  2Y6E A;  5EF4 A;  3PDF A;  1PPP A;  3BCN A;  1AYW A;  1U9X A;  3WXE A;  1BY8 A;  4X6J A;  3H8B A;  1TU6 A;  2R9N A;  1JQP A;  3KW9 A;  4RY2 A;  2HH5 A;  1MDW A;  4QRV A;  4AXL A;  2YJB A;  1AIM A;  2HHN A; 
#chains in the Genus database with same CATH topology
 2B1N A;  3AI8 A;  3QSD A;  2FE8 A;  1ITO A;  2G6D A;  3WXG A;  3W31 A;  3K8U A;  2AS8 A;  3PHU A;  3CBJ A;  3V6E A;  1ME3 A;  2FO5 A;  2VHS A;  3KWB X;  1EWP A;  2YJ9 A;  2OZ2 A;  3PNR A;  5CVO B;  4QRX A;  3BWK A;  2AGA A;  1AYU A;  2CB5 A;  3P5W A;  2R9F A;  4RNA A;  3PW3 A;  5FPW A;  1YAL A;  3K24 A;  3MJ5 A;  4HXD B;  5CHV A;  4RF1 A;  4YYS A;  3KKU A;  3IEJ A;  4QH6 A;  4I07 A;  1YVB A;  1GMY A;  4BS6 A;  3DF0 A;  2FRA A;  4QRG A;  3IHP A;  1K3B B;  1XKG A;  3D6S A;  3KFQ A;  1DF0 A;  5A24 A;  2XU4 A;  4RKX A;  2GFO A;  1CV8 A;  4BOP A;  2DZZ A;  1PIP A;  3F75 A;  1U9V A;  1ME4 A;  2DZY A;  1U9Q X;  2FQ9 A;  2R6N A;  3N4C A;  1AYV A;  1YK8 A;  4BOS A;  4BOU A;  1O0E A;  2FRQ A;  3H8C A;  4YYR A;  1CSB B;  3PHX A;  3H6S A;  3B21 A;  1NB5 A;  4N79 A;  3OVZ A;  2DC9 A;  3GCB A;  3HHA A;  2JQF R;  1VSN A;  2DJF B;  5K16 A;  2DC8 A;  1PVJ A;  3LFY A;  1CPJ A;  2FT2 A;  3PHW A;  1QMY A;  1IWD A;  1EWM A;  3ZNH A;  3IMA A;  3MP2 A;  1X9Y A;  4D8E A;  4W5C A;  3HD3 A;  3KX1 A;  3HWN A;  3WXF A;  4CZW A;  2FUD A;  3N3K A;  3MHH A;  4CDD B;  1CTE A;  1BP4 A;  4MZS A;  3TRK A;  3W30 A;  1QDQ A;  4REZ A;  2R9M A;  1GCB A;  5CVM A;  3MHS A;  2DCA A;  1PPN A;  4D8I A;  4OEL A;  2OUL A;  1A6R A;  2P86 A;  1DKI A;  3O1G A;  5EGW A;  2AU1 A;  1S4V A;  1PE6 A;  4M0W A;  2IPP B;  1QXP A;  1Q6K A;  1ATK A;  3TNX A;  1SP4 B;  2FTD A;  4YYW A;  2JQG R;  2HD5 A;  5KO3 A;  5EZQ A;  2PNS A;  3U8E A;  2OP3 A;  4K7C A;  1PXV A;  1NB3 A;  2E00 A;  2Y5B A;  3ZUA A;  2AYN A;  3OVX A;  5J94 A;  2HXZ A;  2F1G A;  4G54 A;  1NLJ A;  8PCH A;  4KLB A;  6PAD A;  2BDZ A;  2P0R A;  3MOR A;  3MTN A;  7PCK A;  4CDE B;  3BPM A;  2UZJ A;  3OQC A;  2NQD B;  3S3R A;  2YJC A;  1YT7 A;  4W4U A;  2JRI A;  4CDC B;  2J7Q A;  2YJ2 A;  2DCD A;  2BU3 A;  4AXM A;  3USV A;  4PT5 A;  3RVX A;  2CIO A;  2NQA A;  4HWY A;  4MI7 A;  2XU1 A;  4Q8G A;  2DOS A;  3RNV A;  1GEC E;  2NQI A;  1VJV A;  1MEG A;  3H7D A;  2IBI A;  3P5V A;  2AVW A;  3I3T A;  2AYO A;  3TMP A;  4DMY A;  4N8W A;  3CH2 X;  2DC6 A;  3CBK A;  2BTW B;  2Z84 A;  3O65 A;  4PAD A;  9PAP A;  3RVW A;  1PCI A;  2DC7 A;  2DCB A;  4OEM A;  4PI3 A;  4XR7 A;  1F2A A;  4I05 A;  1CQD A;  1FH0 A;  5PAD A;  1PPO A;  2FYE A;  2G8E A;  1AEC A;  2R9C A;  4MSX A;  1YZB A;  1BGO A;  2E01 A;  3NHE A;  3IUT A;  3BPF A;  3P5U A;  3BBA A;  4IUM A;  5F02 A;  2BTW A;  2PAD A;  1YK7 A;  1CB5 A;  2G7Y A;  4YYQ A;  4WA6 A;  4BS5 A;  1ZCM A;  4W5B A;  1KXR A;  1MS6 A;  1BQI A;  4FJC A;  4BPV A;  4MZO A;  3V6C A;  1HUC B;  4I04 A;  2P7U A;  1SNK A;  5JZE A;  4A5U A;  3OF9 A;  2VHF A;  2WBF X;  4RF0 A;  1CJL A;  5JH3 A;  2R9O A;  1F2C A;  3B79 A;  1Y08 A;  4P6E A;  4BQV A;  1MEM A;  3PRM A;  3O0U A;  4YVA A;  2PRE A;  1PAD A;  3RVV A;  3KWZ A;  4PP2 E;  2AIM A;  2PBH A;  1MIR A;  4OVZ B;  5CHT A;  3P5X A;  4YYU A;  3LXS A;  2C0Y A;  2XU3 A;  4BSQ A;  3C0R A;  4X6I A;  1CS8 A;  1THE A;  1QOL A;  4P6G A;  3QJ3 A;  2BDL A;  3H89 A;  3BY4 A;  2ACT A;  2ATO A;  4P16 A;  3PRP A;  2AUX A;  2NQG A;  4FK5 A;  4OVZ A;  1NPZ A;  3E1Z B;  3KSE A;  1F29 A;  1PBH A;  1CVZ A;  3N3G A;  3OF8 A;  3I06 A;  3E9S A;  3OIS A;  3PSE A;  3F5V A;  1F2B A;  4Q8H A;  1KFX L;  2B1M A;  4YV8 A;  1M6D A;  4QBB A;  4WUR A;  1EWL A;  4YYV A;  1AU4 A;  2F7D A;  4FIP A;  4OW0 A;  4BOZ A;  3S3Q A;  2AUZ A;  5CVN B;  3IV2 A;  1ZIV A;  2E03 A;  2JTC A;  1KFU L;  2J7Q C;  2ARY A;  1STF E;  4X6H A;  1ICF A;  1KHQ A;  1UKF A;  2E02 A;  5E6J A;  4IP3 A;  2H7J A;  3IOQ A;  1TL9 A;  3M99 A;  3BC3 A;  2GHU A;  1Y4H A;  4MM3 B;  1TLO A;  1U5I A;  1PPD A;  2O6X A;  4ZTB A;  3BOW A;  1MHW A;  5JA7 A;  1AU0 A;  2G8J A;  2XU5 A;  3IFU A;  1AU2 A;  1AU3 A;  1DEU A;  3HHI A;  2DCC A;  3ERV A;  1EF7 A;  4N4Z A;  4D8B A;  5EZS A;  4CDF B;  4R3D A;  3CH3 X;  1KHP A;  1GLO A;  4PP1 A;  3MTV A;  1U9W A;  1NQC A;  3K9M A;  1POP A;  2YJ8 A;  4XUI A;  4ZUX U;  2DJG B;  4DMX A;  3PBH A;  3C9E A;  3BB7 A;  3QT4 A;  4XZX A;  1NL6 A;  1EWO A;  2Y6E A;  4GUA A;  5EF4 A;  3PDF A;  1PPP A;  2HWK A;  3BCN A;  1AYW A;  1U9X A;  3WXE A;  1BY8 A;  4X6J A;  3H8B A;  1TU6 A;  2R9N A;  1JQP A;  3KW9 A;  4RY2 A;  2HH5 A;  1MDW A;  4QRV A;  4BOQ A;  4AXL A;  2YJB A;  3PT2 A;  1AIM A;  2HHN A; 
#chains in the Genus database with same CATH homology
 2B1N A;  3AI8 A;  3QSD A;  1GX3 A;  1ITO A;  2G6D A;  3WXG A;  3K8U A;  2AS8 A;  3CBJ A;  3V6E A;  1ME3 A;  2FO5 A;  2VHS A;  3KWB X;  1EWP A;  2YJ9 A;  2OZ2 A;  3PNR A;  5CVO B;  4QRX A;  3BWK A;  1AYU A;  2CB5 A;  3P5W A;  2R9F A;  1W4T A;  3PW3 A;  5FPW A;  1YAL A;  3K24 A;  5CHV A;  2BSZ A;  4YYS A;  3KKU A;  3IEJ A;  4QH6 A;  4I07 A;  1YVB A;  1GMY A;  4BS6 A;  3DF0 A;  2FRA A;  4QRG A;  3IHP A;  1K3B B;  1XKG A;  3D6S A;  3KFQ A;  1DF0 A;  5A24 A;  2XU4 A;  4NV7 A;  2GFO A;  1CV8 A;  2VFB A;  2DZZ A;  1PIP A;  3F75 A;  1U9V A;  1ME4 A;  2DZY A;  1U9Q X;  2FQ9 A;  2R6N A;  3N4C A;  1AYV A;  1YK8 A;  1O0E A;  2FRQ A;  3H8C A;  4YYR A;  1CSB B;  3H6S A;  1NB5 A;  4N79 A;  3OVZ A;  2DC9 A;  3GCB A;  3HHA A;  2JQF R;  1VSN A;  2DJF B;  5K16 A;  2DC8 A;  3LFY A;  1CPJ A;  2FT2 A;  1QMY A;  1IWD A;  1EWM A;  3IMA A;  1X9Y A;  4W5C A;  3HD3 A;  3KX1 A;  3HWN A;  3WXF A;  4CZW A;  2FUD A;  3N3K A;  3MHH A;  4CDD B;  1CTE A;  1BP4 A;  4MZS A;  1QDQ A;  2R9M A;  1GCB A;  5CVM A;  3MHS A;  2DCA A;  1PPN A;  4OEL A;  2OUL A;  1A6R A;  2P86 A;  3O1G A;  5EGW A;  2AU1 A;  1S4V A;  1PE6 A;  2IPP B;  1QXP A;  1Q6K A;  1ATK A;  3TNX A;  1SP4 B;  2FTD A;  4YYW A;  2JQG R;  2HD5 A;  2PNS A;  3U8E A;  2OP3 A;  4K7C A;  1PXV A;  1NB3 A;  2E00 A;  2Y5B A;  3ZUA A;  2AYN A;  3OVX A;  5J94 A;  2HXZ A;  2F1G A;  4G54 A;  1NLJ A;  8PCH A;  4KLB A;  6PAD A;  2BDZ A;  2P0R A;  3MOR A;  3MTN A;  4B55 A;  7PCK A;  4CDE B;  3BPM A;  2NQD B;  3S3R A;  2YJC A;  1YT7 A;  4W4U A;  4CDC B;  2YJ2 A;  2DCD A;  4AXM A;  3USV A;  3RVX A;  2CIO A;  2NQA A;  4HWY A;  2XU1 A;  4Q8G A;  1GEC E;  2NQI A;  1VJV A;  1MEG A;  3H7D A;  2IBI A;  3P5V A;  2AVW A;  3I3T A;  2AYO A;  4DMY A;  4N8W A;  4C5P A;  3CH2 X;  1W6F A;  2DC6 A;  3CBK A;  3LTW A;  4PAD A;  9PAP A;  3RVW A;  1PCI A;  2DC7 A;  2DCB A;  4OEM A;  4PI3 A;  4XR7 A;  1F2A A;  4I05 A;  1CQD A;  4GUZ A;  1FH0 A;  5PAD A;  1PPO A;  2FYE A;  2G8E A;  1AEC A;  2R9C A;  4MSX A;  2E01 A;  1BGO A;  3NHE A;  3IUT A;  3BPF A;  3P5U A;  5F02 A;  1E2T A;  2PAD A;  1YK7 A;  1CB5 A;  2G7Y A;  4YYQ A;  4WA6 A;  4BS5 A;  1ZCM A;  4W5B A;  1KXR A;  1MS6 A;  1BQI A;  4FJC A;  4BPV A;  4MZO A;  3V6C A;  1HUC B;  4I04 A;  2P7U A;  1SNK A;  3OF9 A;  2VHF A;  2WBF X;  1CJL A;  5JH3 A;  2R9O A;  1F2C A;  3B79 A;  1Y08 A;  4P6E A;  4BQV A;  1MEM A;  3O0U A;  4YVA A;  2PRE A;  1PAD A;  3RVV A;  3KWZ A;  4PP2 E;  2AIM A;  2PBH A;  1MIR A;  5CHT A;  3P5X A;  4YYU A;  3LXS A;  2C0Y A;  2XU3 A;  4BSQ A;  4X6I A;  1CS8 A;  1THE A;  1QOL A;  4P6G A;  3QJ3 A;  2BDL A;  3H89 A;  2ACT A;  2ATO A;  2AUX A;  2NQG A;  4FK5 A;  1NPZ A;  3E1Z B;  3KSE A;  1F29 A;  1PBH A;  1CVZ A;  3N3G A;  3OF8 A;  3I06 A;  3OIS A;  3F5V A;  1F2B A;  4Q8H A;  1KFX L;  2B1M A;  4YV8 A;  1M6D A;  4QBB A;  1EWL A;  4YYV A;  1AU4 A;  2F7D A;  4FIP A;  3S3Q A;  2AUZ A;  5CVN B;  3IV2 A;  1ZIV A;  2E03 A;  1KFU L;  2ARY A;  1STF E;  4X6H A;  1ICF A;  1KHQ A;  2E02 A;  2H7J A;  3IOQ A;  1TL9 A;  3M99 A;  3BC3 A;  2GHU A;  1Y4H A;  1TLO A;  1U5I A;  1PPD A;  2O6X A;  3BOW A;  1MHW A;  4BGF A;  5JA7 A;  1AU0 A;  2G8J A;  2XU5 A;  4NV8 A;  1AU2 A;  1AU3 A;  1DEU A;  3HHI A;  2DCC A;  3ERV A;  1EF7 A;  4N4Z A;  4CDF B;  3CH3 X;  1KHP A;  1GLO A;  2VFC A;  4PP1 A;  1U9W A;  1NQC A;  3K9M A;  1POP A;  2YJ8 A;  4XUI A;  4ZUX U;  2DJG B;  4DMX A;  3PBH A;  3C9E A;  3QT4 A;  1NL6 A;  1EWO A;  2Y6E A;  5EF4 A;  3PDF A;  1PPP A;  3D9W A;  3BCN A;  1AYW A;  1U9X A;  3WXE A;  1BY8 A;  4X6J A;  3H8B A;  1TU6 A;  2R9N A;  1JQP A;  3KW9 A;  4RY2 A;  2HH5 A;  1W5R A;  1MDW A;  4QRV A;  4AXL A;  2YJB A;  1AIM A;  2HHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...