1YVBA

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords falcipain 2
total genus 61
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yvbA00
4DMYA 3KSEA 1MHWA 3HHAA 1Q6KA 4Q8GA 4W4UA 1ME4A 1NL6A 1AECA 3HHIA 3NHEA 2CIOA 2G8JA 2R9CA 2DZZA 5FPWA 3K8UA 2G8EA 1KHQA 1CTEA 3ZUAA 3LXSA 2P7UA 2HHNA 2DC7A 2JQGR 3HWNA 1QDQA 2E01A 1DF0A 3K24A 2XU5A 1EWPA 3F75A 1CQDA 5K16A 2H7JA 2AUXA 4PP2E 4QH6A 4QBBA 3O0UA 4AXMA 1PPNA 4QRGA 3OISA 1Y08A 3P5WA 4RY2A 3O1GA 4BS6A 2E00A 1SP4B 1NQCA 3F5VA 4W5CA 2FTDA 5JA7A 4YYWA 2FUDA 2FO5A 2R9NA 1K3BB 1BQIA 4QRVA 2DC9A 2FRAA 1POPA 5CVNB 4X6IA 1DEUA 2DZYA 2DCBA 2XU3A 1KHPA 2DCCA 3P5XA 1NB5A 4YYQA 2R9OA 3AI8A 4PADA 7PCKA 2JQFR 2YJCA 4YYSA 1BP4A 2HD5A 1EWOA 1CVZA 4W5BA 1AU3A 2VHFA 2AVWA 3QT4A 1AYVA 3BWKA 3P5VA 3BPFA 2WBFX 9PAPA 2HXZA 3WXFA 4BPVA 3ERVA 3N4CA 2R9MA 4YYRA 2Y6EA 4N8WA 1KFUL 3P5UA 1BY8A 4N4ZA 1MDWA 1X9YA 4PI3A 2AYOA 2E03A 5JH3A 1TL9A 2B1MA 4XR7A 1CV8A 1BGOA 1YALA 5F02A 1MEMA 4BQVA 1YVBA 1U9WA 2Y5BA 3KWBX 2BDLA 1U5IA 6PADA 1ITOA 2FYEA 2DC6A 1KFXL 3OF9A 2DCAA 2XU1A 5CHVA 2YJ8A 2P86A 2IBIA 1QMYA 4I07A 1GCBA 3PDFA 2DCDA 3CH2X 2NQGA 4FJCA 3BC3A 3DF0A 3K9MA 2G6DA 3GCBA 3KFQA 4MZSA 1NLJA 2ARYA 1S4VA 2F1GA 3I06A 1GLOA 2XU4A 4WA6A 2F7DA 1PPPA 1PE6A 2ACTA 3I3TA 1MS6A 3PW3A 3OVXA 2OZ2A 4CDFB 8PCHA 3H89A 1CS8A 2PADA 2VHSA 4FIPA 2YJ9A 3N3KA 2AIMA 1O0EA 1A6RA 2CB5A 1QOLA 3H8CA 3V6CA 2C0YA 4OEMA 1MIRA 2B1NA 1PCIA 1THEA 1PIPA 1PPOA 4BS5A 3HD3A 5CHTA 1Y4HA 1EF7A 5EGWA 4BSQA 1SNKA 4N79A 5EF4A 2OP3A 1ME3A 3MHHA 4CDEB 3WXEA 3IEJA 3IHPA 2ATOA 1VJVA 1PXVA 1YK7A 3OF8A 1ATKA 2AU1A 3S3RA 2FRQA 1F2CA 4YYUA 2OULA 2P0RA 3OVZA 4MZOA 3CBJA 3BPMA 1AYWA 3IV2A 3WXGA 1KXRA 1ZCMA 1PPDA 4X6HA 2GHUA 1U9QX 1YT7A 3BCNA 3B79A 3IMAA 4OELA 4DMXA 1AIMA 1U9XA 3MTNA 3RVXA 1F2BA 3CH3X 3BOWA 2FT2A 5J94A 2DC8A 4YV8A 1AU4A 5CVMA 1AU2A 3IOQA 3TNXA 3LFYA 2YJBA 4YYVA 3H8BA 3KWZA 3RVVA 1EWMA 1AYUA 2E02A 2BDZA 2AS8A 2YJ2A 1PBHA 2FQ9A 4CDCB 4P6GA 4KLBA 2DJGB 4YVAA 2AYNA 1PADA 1STFE 2NQAA 2GFOA 1QXPA 1CPJA 3PNRA 1GECE 4QRXA 4G54A 3M99A 2DJFB 2PBHA 2G7YA 1EWLA 3IUTA 3USVA 2HH5A 4P6EA 4Q8HA 2NQIA 3C9EA 3N3GA 3H7DA 1U9VA 1NB3A 1F29A 4PP1A 3KW9A 2IPPB 2NQDB 2R6NA 3RVWA 3V6EA 4FK5A 1GMYA 4XUIA 1HUCB 4MSXA 1CSBB 3E1ZB 2R9FA 3QSDA 4ZUXU 4X6JA 3MHSA 3CBKA 1TLOA 4CZWA 1ICFA 1MEGA 4HWYA 4I04A 3S3QA 3KX1A 4AXLA 5CVOB 1XKGA 1YK8A 4K7CA 3QJ3A 4I05A 1CB5A 3U8EA 1TU6A 1NPZA 3KKUA 2AUZA 5PADA 1F2AA 1JQPA 4CDDB 1IWDA 3PBHA 1M6DA 2PNSA 1CJLA 1AU0A 5A24A 3MORA 1FH0A 3D6SA 1VSNA 2O6XA 1ZIVA 3H6SA 2PREA
chains in the Genus database with same CATH superfamily
4MM3B 4DMYA 3KSEA 3TRKA 1MHWA 3HHAA 1Q6KA 4Q8GA 4W4UA 2JTCA 1ME4A 1NL6A 1AECA 3HHIA 3NHEA 2CIOA 2G8JA 3MJ5A 2R9CA 2DZZA 5FPWA 3K8UA 2G8EA 1KHQA 1CTEA 3ZUAA 3LXSA 2P7UA 2HHNA 2DC7A 2JQGR 3HWNA 5KO3A 1QDQA 2E01A 1DF0A 3K24A 2XU5A 1EWPA 3F75A 3PT2A 1CQDA 1PVJA 5K16A 2H7JA 2AUXA 4PP2E 4QH6A 4QBBA 3O0UA 4AXMA 1PPNA 4QRGA 3OISA 1Y08A 4MI7A 2BTWA 3P5WA 3ZNHA 4RY2A 3O1GA 4BS6A 2E00A 1SP4B 1NQCA 3F5VA 3OQCA 4W5CA 2FTDA 3E9SA 5JA7A 4YYWA 2FUDA 2FO5A 2R9NA 1K3BB 1BQIA 4QRVA 2DC9A 2FRAA 1POPA 4X6IA 5CVNB 1DEUA 2DZYA 4RF0A 2DCBA 2XU3A 1KHPA 2DCCA 3P5XA 1NB5A 4YYQA 2R9OA 3AI8A 4PADA 7PCKA 2JQFR 2YJCA 4YYSA 1BP4A 2HD5A 1EWOA 1CVZA 4W5BA 1AU3A 2VHFA 2AVWA 3QT4A 1AYVA 1DKIA 3BWKA 3P5VA 3BPFA 2WBFX 9PAPA 3PHWA 2HXZA 3WXFA 4BPVA 3ERVA 3N4CA 2R9MA 4BOZA 4YYRA 2Y6EA 4N8WA 1KFUL 3P5UA 1BY8A 4N4ZA 1MDWA 1X9YA 4PI3A 2AYOA 2E03A 2HWKA 5JH3A 1TL9A 2B1MA 4XR7A 3RNVA 1CV8A 1BGOA 2UZJA 1YALA 5F02A 1MEMA 4BQVA 1YVBA 1U9WA 3B21A 4ZTBA 2BTWB 2Y5BA 3KWBX 2BDLA 1U5IA 6PADA 1ITOA 2FYEA 2DC6A 1KFXL 3OF9A 2J7QC 2DCAA 4R3DA 4M0WA 2XU1A 5CHVA 2YJ8A 2P86A 2IBIA 1QMYA 4I07A 1GCBA 3PDFA 2DCDA 4RKXA 3CH2X 2NQGA 4FJCA 3BC3A 3DF0A 3K9MA 2G6DA 3GCBA 1YZBA 5E6JA 3KFQA 4MZSA 1NLJA 2ARYA 1S4VA 2F1GA 3I06A 4IUMA 1GLOA 2XU4A 4WA6A 2F7DA 1PPPA 1PE6A 2ACTA 3I3TA 2JRIA 1MS6A 3PW3A 3OVXA 2OZ2A 4RF1A 4CDFB 8PCHA 3BY4A 3H89A 1CS8A 2PADA 2VHSA 4FIPA 2YJ9A 3N3KA 2AIMA 1O0EA 1A6RA 2J7QA 2CB5A 1QOLA 3H8CA 3V6CA 2C0YA 4OEMA 1MIRA 2B1NA 2Z84A 1PCIA 1THEA 3PHXA 1PIPA 1PPOA 4BS5A 2AGAA 3HD3A 5CHTA 1Y4HA 4A5UA 1EF7A 5EGWA 4BSQA 3PRPA 4BOQA 1SNKA 4N79A 5EF4A 2OP3A 1ME3A 3BBAA 3MHHA 4WURA 3BB7A 4CDEB 3WXEA 3IEJA 3IHPA 3C0RA 2ATOA 1VJVA 1PXVA 1YK7A 3OF8A 1ATKA 2AU1A 3S3RA 2FRQA 1F2CA 4YYUA 2OULA 5EZQA 2P0RA 3OVZA 4BOUA 3PRMA 4MZOA 3CBJA 3BPMA 1AYWA 3IV2A 3WXGA 1KXRA 3O65A 1ZCMA 1PPDA 4X6HA 2GHUA 1U9QX 1YT7A 3BCNA 3B79A 3IMAA 4OELA 4DMXA 1AIMA 2FE8A 1U9XA 3MTNA 3RVXA 1F2BA 3CH3X 3BOWA 2FT2A 5J94A 2DC8A 4YV8A 1AU4A 5CVMA 2BU3A 1AU2A 3W31A 3IOQA 3TNXA 4XZXA 3LFYA 4PT5A 5EZSA 4OVZA 2YJBA 4YYVA 3H8BA 3KWZA 3RVVA 1EWMA 1AYUA 2E02A 2BDZA 2AS8A 2YJ2A 1PBHA 2FQ9A 4CDCB 4P6GA 4KLBA 2DJGB 3W30A 4D8IA 4OVZB 4YVAA 2AYNA 1PADA 1STFE 3MP2A 4P16A 2NQAA 2GFOA 1QXPA 1CPJA 3PNRA 3IFUA 1GECE 3TMPA 4QRXA 4G54A 2DOSA 3M99A 2DJFB 2PBHA 4IP3A 4BOSA 2G7YA 1EWLA 4GUAA 3IUTA 3USVA 2HH5A 4P6EA 4HXDB 4D8EA 4Q8HA 2NQIA 3C9EA 3N3GA 3H7DA 1U9VA 1NB3A 3PSEA 1F29A 4PP1A 3KW9A 2IPPB 4D8BA 2NQDB 2R6NA 3RVWA 3V6EA 4FK5A 1GMYA 4XUIA 1HUCB 4MSXA 1CSBB 3E1ZB 2R9FA 3PHUA 3QSDA 4ZUXU 4X6JA 3MHSA 3CBKA 1TLOA 4CZWA 1ICFA 1UKFA 1MEGA 4HWYA 4I04A 3S3QA 3KX1A 4AXLA 5CVOB 1XKGA 1YK8A 4K7CA 3QJ3A 4OW0A 4I05A 4RNAA 1CB5A 3U8EA 1TU6A 1NPZA 5JZEA 3KKUA 2AUZA 5PADA 3MTVA 1F2AA 1JQPA 4CDDB 1IWDA 3PBHA 1M6DA 2PNSA 4BOPA 1CJLA 1AU0A 4REZA 5A24A 3MORA 1FH0A 3D6SA 1VSNA 2O6XA 1ZIVA 3H6SA 2PREA
chains in the Genus database with same CATH topology
4DMYA 3KSEA 1MHWA 3HHAA 1Q6KA 4Q8GA 4W4UA 1ME4A 1NL6A 1AECA 3HHIA 3NHEA 2CIOA 2G8JA 2R9CA 2DZZA 5FPWA 3K8UA 2G8EA 1KHQA 1CTEA 3ZUAA 3LXSA 2P7UA 3LTWA 2HHNA 2DC7A 2JQGR 3HWNA 1QDQA 2E01A 1DF0A 3K24A 2XU5A 1EWPA 3F75A 1CQDA 1W5RA 5K16A 2H7JA 2AUXA 4PP2E 4QH6A 4QBBA 3O0UA 4AXMA 1PPNA 4QRGA 3OISA 1Y08A 3P5WA 4RY2A 1W4TA 3O1GA 4BS6A 2E00A 1SP4B 1NQCA 3F5VA 4W5CA 2FTDA 5JA7A 4YYWA 2FUDA 2FO5A 2R9NA 1K3BB 1BQIA 4QRVA 2DC9A 2FRAA 1POPA 5CVNB 4X6IA 1DEUA 2DZYA 2DCBA 2XU3A 1KHPA 2DCCA 3P5XA 1NB5A 4YYQA 2R9OA 3AI8A 4PADA 7PCKA 2JQFR 2YJCA 4YYSA 1BP4A 2HD5A 1EWOA 1CVZA 4W5BA 1AU3A 2VHFA 2AVWA 3QT4A 1AYVA 3BWKA 3P5VA 3BPFA 2WBFX 9PAPA 2HXZA 3WXFA 4BPVA 3ERVA 3N4CA 2R9MA 4YYRA 2Y6EA 2VFCA 4N8WA 1KFUL 3P5UA 1BY8A 4N4ZA 1MDWA 1X9YA 4PI3A 2AYOA 2E03A 5JH3A 1TL9A 2B1MA 4XR7A 1CV8A 1BGOA 1YALA 5F02A 1MEMA 4BQVA 1YVBA 1U9WA 2Y5BA 3KWBX 2BDLA 1U5IA 6PADA 1ITOA 2FYEA 2DC6A 1KFXL 3OF9A 2DCAA 2XU1A 5CHVA 2YJ8A 2P86A 2IBIA 1QMYA 4I07A 1GCBA 3PDFA 2DCDA 3CH2X 2NQGA 4FJCA 3BC3A 3DF0A 3K9MA 2G6DA 3GCBA 3KFQA 4MZSA 1NLJA 2ARYA 1S4VA 2F1GA 3I06A 1GLOA 2XU4A 4WA6A 2F7DA 1PPPA 1PE6A 2ACTA 3I3TA 1MS6A 3PW3A 3OVXA 2OZ2A 4CDFB 8PCHA 3H89A 1CS8A 2PADA 2VHSA 4FIPA 2YJ9A 3N3KA 2AIMA 1O0EA 1A6RA 2CB5A 1QOLA 3H8CA 3V6CA 2C0YA 4OEMA 1MIRA 2B1NA 1PCIA 1THEA 1PIPA 1PPOA 4BS5A 4GUZA 3HD3A 5CHTA 1Y4HA 1EF7A 5EGWA 4BSQA 1SNKA 4N79A 5EF4A 2OP3A 1ME3A 3MHHA 4B55A 4CDEB 3WXEA 3D9WA 3IEJA 3IHPA 2ATOA 1VJVA 1PXVA 1YK7A 3OF8A 1ATKA 2AU1A 3S3RA 2FRQA 1F2CA 4YYUA 2OULA 2P0RA 3OVZA 1W6FA 4MZOA 3CBJA 3BPMA 1AYWA 3IV2A 3WXGA 1KXRA 1ZCMA 1PPDA 4X6HA 2GHUA 1U9QX 1YT7A 3BCNA 3B79A 3IMAA 4OELA 4DMXA 1AIMA 1U9XA 3MTNA 3RVXA 1F2BA 3CH3X 3BOWA 2FT2A 5J94A 2DC8A 4YV8A 1AU4A 5CVMA 1AU2A 3IOQA 3TNXA 3LFYA 2YJBA 1E2TA 3H8BA 4YYVA 3KWZA 3RVVA 1EWMA 1AYUA 2E02A 2BDZA 2AS8A 2YJ2A 1PBHA 2FQ9A 4CDCB 4P6GA 4KLBA 2DJGB 4NV8A 4NV7A 4YVAA 2AYNA 1PADA 1STFE 2NQAA 2GFOA 1QXPA 1CPJA 3PNRA 1GECE 2BSZA 4G54A 4QRXA 3M99A 2DJFB 2PBHA 2G7YA 4C5PA 1EWLA 3IUTA 3USVA 2HH5A 4P6EA 4Q8HA 2NQIA 3C9EA 3N3GA 3H7DA 1U9VA 1NB3A 1F29A 4PP1A 3KW9A 2IPPB 2NQDB 2R6NA 3RVWA 3V6EA 4FK5A 1GMYA 4XUIA 1HUCB 4MSXA 1CSBB 3E1ZB 2R9FA 3QSDA 4ZUXU 4X6JA 3MHSA 3CBKA 1TLOA 4CZWA 1ICFA 1MEGA 4HWYA 4I04A 3S3QA 3KX1A 4AXLA 5CVOB 1XKGA 1YK8A 4K7CA 3QJ3A 4I05A 1CB5A 3U8EA 1TU6A 1NPZA 3KKUA 2AUZA 5PADA 1F2AA 1JQPA 4CDDB 1IWDA 3PBHA 1M6DA 2PNSA 1CJLA 1GX3A 1AU0A 5A24A 2VFBA 3MORA 1FH0A 3D6SA 1VSNA 2O6XA 1ZIVA 3H6SA 4BGFA 2PREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMY A;  3KSE A;  1MHW A;  3HHA A;  1Q6K A;  4Q8G A;  4W4U A;  1ME4 A;  1NL6 A;  1AEC A;  3HHI A;  3NHE A;  2CIO A;  2G8J A;  2R9C A;  2DZZ A;  5FPW A;  3K8U A;  2G8E A;  1KHQ A;  1CTE A;  3ZUA A;  3LXS A;  2P7U A;  2HHN A;  2DC7 A;  2JQG R;  3HWN A;  1QDQ A;  2E01 A;  1DF0 A;  3K24 A;  2XU5 A;  1EWP A;  3F75 A;  1CQD A;  5K16 A;  2H7J A;  2AUX A;  4PP2 E;  4QH6 A;  4QBB A;  3O0U A;  4AXM A;  1PPN A;  4QRG A;  3OIS A;  1Y08 A;  3P5W A;  4RY2 A;  3O1G A;  4BS6 A;  2E00 A;  1SP4 B;  1NQC A;  3F5V A;  4W5C A;  2FTD A;  5JA7 A;  4YYW A;  2FUD A;  2FO5 A;  2R9N A;  1K3B B;  1BQI A;  4QRV A;  2DC9 A;  2FRA A;  1POP A;  5CVN B;  4X6I A;  1DEU A;  2DZY A;  2DCB A;  2XU3 A;  1KHP A;  2DCC A;  3P5X A;  1NB5 A;  4YYQ A;  2R9O A;  3AI8 A;  4PAD A;  7PCK A;  2JQF R;  2YJC A;  4YYS A;  1BP4 A;  2HD5 A;  1EWO A;  1CVZ A;  4W5B A;  1AU3 A;  2VHF A;  2AVW A;  3QT4 A;  1AYV A;  3BWK A;  3P5V A;  3BPF A;  2WBF X;  9PAP A;  2HXZ A;  3WXF A;  4BPV A;  3ERV A;  3N4C A;  2R9M A;  4YYR A;  2Y6E A;  4N8W A;  1KFU L;  3P5U A;  1BY8 A;  4N4Z A;  1MDW A;  1X9Y A;  4PI3 A;  2AYO A;  2E03 A;  5JH3 A;  1TL9 A;  2B1M A;  4XR7 A;  1CV8 A;  1BGO A;  1YAL A;  5F02 A;  1MEM A;  4BQV A;  1YVB A;  1U9W A;  2Y5B A;  3KWB X;  2BDL A;  1U5I A;  6PAD A;  1ITO A;  2FYE A;  2DC6 A;  1KFX L;  3OF9 A;  2DCA A;  2XU1 A;  5CHV A;  2YJ8 A;  2P86 A;  2IBI A;  1QMY A;  4I07 A;  1GCB A;  3PDF A;  2DCD A;  3CH2 X;  2NQG A;  4FJC A;  3BC3 A;  3DF0 A;  3K9M A;  2G6D A;  3GCB A;  3KFQ A;  4MZS A;  1NLJ A;  2ARY A;  1S4V A;  2F1G A;  3I06 A;  1GLO A;  2XU4 A;  4WA6 A;  2F7D A;  1PPP A;  1PE6 A;  2ACT A;  3I3T A;  1MS6 A;  3PW3 A;  3OVX A;  2OZ2 A;  4CDF B;  8PCH A;  3H89 A;  1CS8 A;  2PAD A;  2VHS A;  4FIP A;  2YJ9 A;  3N3K A;  2AIM A;  1O0E A;  1A6R A;  2CB5 A;  1QOL A;  3H8C A;  3V6C A;  2C0Y A;  4OEM A;  1MIR A;  2B1N A;  1PCI A;  1THE A;  1PIP A;  1PPO A;  4BS5 A;  3HD3 A;  5CHT A;  1Y4H A;  1EF7 A;  5EGW A;  4BSQ A;  1SNK A;  4N79 A;  5EF4 A;  2OP3 A;  1ME3 A;  3MHH A;  4CDE B;  3WXE A;  3IEJ A;  3IHP A;  2ATO A;  1VJV A;  1PXV A;  1YK7 A;  3OF8 A;  1ATK A;  2AU1 A;  3S3R A;  2FRQ A;  1F2C A;  4YYU A;  2OUL A;  2P0R A;  3OVZ A;  4MZO A;  3CBJ A;  3BPM A;  1AYW A;  3IV2 A;  3WXG A;  1KXR A;  1ZCM A;  1PPD A;  4X6H A;  2GHU A;  1U9Q X;  1YT7 A;  3BCN A;  3B79 A;  3IMA A;  4OEL A;  4DMX A;  1AIM A;  1U9X A;  3MTN A;  3RVX A;  1F2B A;  3CH3 X;  3BOW A;  2FT2 A;  5J94 A;  2DC8 A;  4YV8 A;  1AU4 A;  5CVM A;  1AU2 A;  3IOQ A;  3TNX A;  3LFY A;  2YJB A;  4YYV A;  3H8B A;  3KWZ A;  3RVV A;  1EWM A;  1AYU A;  2E02 A;  2BDZ A;  2AS8 A;  2YJ2 A;  1PBH A;  2FQ9 A;  4CDC B;  4P6G A;  4KLB A;  2DJG B;  4YVA A;  2AYN A;  1PAD A;  1STF E;  2NQA A;  2GFO A;  1QXP A;  1CPJ A;  3PNR A;  1GEC E;  4QRX A;  4G54 A;  3M99 A;  2DJF B;  2PBH A;  2G7Y A;  1EWL A;  3IUT A;  3USV A;  2HH5 A;  4P6E A;  4Q8H A;  2NQI A;  3C9E A;  3N3G A;  3H7D A;  1U9V A;  1NB3 A;  1F29 A;  4PP1 A;  3KW9 A;  2IPP B;  2NQD B;  2R6N A;  3RVW A;  3V6E A;  4FK5 A;  1GMY A;  4XUI A;  1HUC B;  4MSX A;  1CSB B;  3E1Z B;  2R9F A;  3QSD A;  4ZUX U;  4X6J A;  3MHS A;  3CBK A;  1TLO A;  4CZW A;  1ICF A;  1MEG A;  4HWY A;  4I04 A;  3S3Q A;  3KX1 A;  4AXL A;  5CVO B;  1XKG A;  1YK8 A;  4K7C A;  3QJ3 A;  4I05 A;  1CB5 A;  3U8E A;  1TU6 A;  1NPZ A;  3KKU A;  2AUZ A;  5PAD A;  1F2A A;  1JQP A;  4CDD B;  1IWD A;  3PBH A;  1M6D A;  2PNS A;  1CJL A;  1AU0 A;  5A24 A;  3MOR A;  1FH0 A;  3D6S A;  1VSN A;  2O6X A;  1ZIV A;  3H6S A;  2PRE A; 
#chains in the Genus database with same CATH topology
 4MM3 B;  4DMY A;  3KSE A;  3TRK A;  1MHW A;  3HHA A;  1Q6K A;  4Q8G A;  4W4U A;  2JTC A;  1ME4 A;  1NL6 A;  1AEC A;  3HHI A;  3NHE A;  2CIO A;  2G8J A;  3MJ5 A;  2R9C A;  2DZZ A;  5FPW A;  3K8U A;  2G8E A;  1KHQ A;  1CTE A;  3ZUA A;  3LXS A;  2P7U A;  2HHN A;  2DC7 A;  2JQG R;  3HWN A;  5KO3 A;  1QDQ A;  2E01 A;  1DF0 A;  3K24 A;  2XU5 A;  1EWP A;  3F75 A;  3PT2 A;  1CQD A;  1PVJ A;  5K16 A;  2H7J A;  2AUX A;  4PP2 E;  4QH6 A;  4QBB A;  3O0U A;  4AXM A;  1PPN A;  4QRG A;  3OIS A;  1Y08 A;  4MI7 A;  2BTW A;  3P5W A;  3ZNH A;  4RY2 A;  3O1G A;  4BS6 A;  2E00 A;  1SP4 B;  1NQC A;  3F5V A;  3OQC A;  4W5C A;  2FTD A;  3E9S A;  5JA7 A;  4YYW A;  2FUD A;  2FO5 A;  2R9N A;  1K3B B;  1BQI A;  4QRV A;  2DC9 A;  2FRA A;  1POP A;  4X6I A;  5CVN B;  1DEU A;  2DZY A;  4RF0 A;  2DCB A;  2XU3 A;  1KHP A;  2DCC A;  3P5X A;  1NB5 A;  4YYQ A;  2R9O A;  3AI8 A;  4PAD A;  7PCK A;  2JQF R;  2YJC A;  4YYS A;  1BP4 A;  2HD5 A;  1EWO A;  1CVZ A;  4W5B A;  1AU3 A;  2VHF A;  2AVW A;  3QT4 A;  1AYV A;  1DKI A;  3BWK A;  3P5V A;  3BPF A;  2WBF X;  9PAP A;  3PHW A;  2HXZ A;  3WXF A;  4BPV A;  3ERV A;  3N4C A;  2R9M A;  4BOZ A;  4YYR A;  2Y6E A;  4N8W A;  1KFU L;  3P5U A;  1BY8 A;  4N4Z A;  1MDW A;  1X9Y A;  4PI3 A;  2AYO A;  2E03 A;  2HWK A;  5JH3 A;  1TL9 A;  2B1M A;  4XR7 A;  3RNV A;  1CV8 A;  1BGO A;  2UZJ A;  1YAL A;  5F02 A;  1MEM A;  4BQV A;  1YVB A;  1U9W A;  3B21 A;  4ZTB A;  2BTW B;  2Y5B A;  3KWB X;  2BDL A;  1U5I A;  6PAD A;  1ITO A;  2FYE A;  2DC6 A;  1KFX L;  3OF9 A;  2J7Q C;  2DCA A;  4R3D A;  4M0W A;  2XU1 A;  5CHV A;  2YJ8 A;  2P86 A;  2IBI A;  1QMY A;  4I07 A;  1GCB A;  3PDF A;  2DCD A;  4RKX A;  3CH2 X;  2NQG A;  4FJC A;  3BC3 A;  3DF0 A;  3K9M A;  2G6D A;  3GCB A;  1YZB A;  5E6J A;  3KFQ A;  4MZS A;  1NLJ A;  2ARY A;  1S4V A;  2F1G A;  3I06 A;  4IUM A;  1GLO A;  2XU4 A;  4WA6 A;  2F7D A;  1PPP A;  1PE6 A;  2ACT A;  3I3T A;  2JRI A;  1MS6 A;  3PW3 A;  3OVX A;  2OZ2 A;  4RF1 A;  4CDF B;  8PCH A;  3BY4 A;  3H89 A;  1CS8 A;  2PAD A;  2VHS A;  4FIP A;  2YJ9 A;  3N3K A;  2AIM A;  1O0E A;  1A6R A;  2J7Q A;  2CB5 A;  1QOL A;  3H8C A;  3V6C A;  2C0Y A;  4OEM A;  1MIR A;  2B1N A;  2Z84 A;  1PCI A;  1THE A;  3PHX A;  1PIP A;  1PPO A;  4BS5 A;  2AGA A;  3HD3 A;  5CHT A;  1Y4H A;  4A5U A;  1EF7 A;  5EGW A;  4BSQ A;  3PRP A;  4BOQ A;  1SNK A;  4N79 A;  5EF4 A;  2OP3 A;  1ME3 A;  3BBA A;  3MHH A;  4WUR A;  3BB7 A;  4CDE B;  3WXE A;  3IEJ A;  3IHP A;  3C0R A;  2ATO A;  1VJV A;  1PXV A;  1YK7 A;  3OF8 A;  1ATK A;  2AU1 A;  3S3R A;  2FRQ A;  1F2C A;  4YYU A;  2OUL A;  5EZQ A;  2P0R A;  3OVZ A;  4BOU A;  3PRM A;  4MZO A;  3CBJ A;  3BPM A;  1AYW A;  3IV2 A;  3WXG A;  1KXR A;  3O65 A;  1ZCM A;  1PPD A;  4X6H A;  2GHU A;  1U9Q X;  1YT7 A;  3BCN A;  3B79 A;  3IMA A;  4OEL A;  4DMX A;  1AIM A;  2FE8 A;  1U9X A;  3MTN A;  3RVX A;  1F2B A;  3CH3 X;  3BOW A;  2FT2 A;  5J94 A;  2DC8 A;  4YV8 A;  1AU4 A;  5CVM A;  2BU3 A;  1AU2 A;  3W31 A;  3IOQ A;  3TNX A;  4XZX A;  3LFY A;  4PT5 A;  5EZS A;  4OVZ A;  2YJB A;  4YYV A;  3H8B A;  3KWZ A;  3RVV A;  1EWM A;  1AYU A;  2E02 A;  2BDZ A;  2AS8 A;  2YJ2 A;  1PBH A;  2FQ9 A;  4CDC B;  4P6G A;  4KLB A;  2DJG B;  3W30 A;  4D8I A;  4OVZ B;  4YVA A;  2AYN A;  1PAD A;  1STF E;  3MP2 A;  4P16 A;  2NQA A;  2GFO A;  1QXP A;  1CPJ A;  3PNR A;  3IFU A;  1GEC E;  3TMP A;  4QRX A;  4G54 A;  2DOS A;  3M99 A;  2DJF B;  2PBH A;  4IP3 A;  4BOS A;  2G7Y A;  1EWL A;  4GUA A;  3IUT A;  3USV A;  2HH5 A;  4P6E A;  4HXD B;  4D8E A;  4Q8H A;  2NQI A;  3C9E A;  3N3G A;  3H7D A;  1U9V A;  1NB3 A;  3PSE A;  1F29 A;  4PP1 A;  3KW9 A;  2IPP B;  4D8B A;  2NQD B;  2R6N A;  3RVW A;  3V6E A;  4FK5 A;  1GMY A;  4XUI A;  1HUC B;  4MSX A;  1CSB B;  3E1Z B;  2R9F A;  3PHU A;  3QSD A;  4ZUX U;  4X6J A;  3MHS A;  3CBK A;  1TLO A;  4CZW A;  1ICF A;  1UKF A;  1MEG A;  4HWY A;  4I04 A;  3S3Q A;  3KX1 A;  4AXL A;  5CVO B;  1XKG A;  1YK8 A;  4K7C A;  3QJ3 A;  4OW0 A;  4I05 A;  4RNA A;  1CB5 A;  3U8E A;  1TU6 A;  1NPZ A;  5JZE A;  3KKU A;  2AUZ A;  5PAD A;  3MTV A;  1F2A A;  1JQP A;  4CDD B;  1IWD A;  3PBH A;  1M6D A;  2PNS A;  4BOP A;  1CJL A;  1AU0 A;  4REZ A;  5A24 A;  3MOR A;  1FH0 A;  3D6S A;  1VSN A;  2O6X A;  1ZIV A;  3H6S A;  2PRE A; 
#chains in the Genus database with same CATH homology
 4DMY A;  3KSE A;  1MHW A;  3HHA A;  1Q6K A;  4Q8G A;  4W4U A;  1ME4 A;  1NL6 A;  1AEC A;  3HHI A;  3NHE A;  2CIO A;  2G8J A;  2R9C A;  2DZZ A;  5FPW A;  3K8U A;  2G8E A;  1KHQ A;  1CTE A;  3ZUA A;  3LXS A;  2P7U A;  3LTW A;  2HHN A;  2DC7 A;  2JQG R;  3HWN A;  1QDQ A;  2E01 A;  1DF0 A;  3K24 A;  2XU5 A;  1EWP A;  3F75 A;  1CQD A;  1W5R A;  5K16 A;  2H7J A;  2AUX A;  4PP2 E;  4QH6 A;  4QBB A;  3O0U A;  4AXM A;  1PPN A;  4QRG A;  3OIS A;  1Y08 A;  3P5W A;  4RY2 A;  1W4T A;  3O1G A;  4BS6 A;  2E00 A;  1SP4 B;  1NQC A;  3F5V A;  4W5C A;  2FTD A;  5JA7 A;  4YYW A;  2FUD A;  2FO5 A;  2R9N A;  1K3B B;  1BQI A;  4QRV A;  2DC9 A;  2FRA A;  1POP A;  5CVN B;  4X6I A;  1DEU A;  2DZY A;  2DCB A;  2XU3 A;  1KHP A;  2DCC A;  3P5X A;  1NB5 A;  4YYQ A;  2R9O A;  3AI8 A;  4PAD A;  7PCK A;  2JQF R;  2YJC A;  4YYS A;  1BP4 A;  2HD5 A;  1EWO A;  1CVZ A;  4W5B A;  1AU3 A;  2VHF A;  2AVW A;  3QT4 A;  1AYV A;  3BWK A;  3P5V A;  3BPF A;  2WBF X;  9PAP A;  2HXZ A;  3WXF A;  4BPV A;  3ERV A;  3N4C A;  2R9M A;  4YYR A;  2Y6E A;  2VFC A;  4N8W A;  1KFU L;  3P5U A;  1BY8 A;  4N4Z A;  1MDW A;  1X9Y A;  4PI3 A;  2AYO A;  2E03 A;  5JH3 A;  1TL9 A;  2B1M A;  4XR7 A;  1CV8 A;  1BGO A;  1YAL A;  5F02 A;  1MEM A;  4BQV A;  1YVB A;  1U9W A;  2Y5B A;  3KWB X;  2BDL A;  1U5I A;  6PAD A;  1ITO A;  2FYE A;  2DC6 A;  1KFX L;  3OF9 A;  2DCA A;  2XU1 A;  5CHV A;  2YJ8 A;  2P86 A;  2IBI A;  1QMY A;  4I07 A;  1GCB A;  3PDF A;  2DCD A;  3CH2 X;  2NQG A;  4FJC A;  3BC3 A;  3DF0 A;  3K9M A;  2G6D A;  3GCB A;  3KFQ A;  4MZS A;  1NLJ A;  2ARY A;  1S4V A;  2F1G A;  3I06 A;  1GLO A;  2XU4 A;  4WA6 A;  2F7D A;  1PPP A;  1PE6 A;  2ACT A;  3I3T A;  1MS6 A;  3PW3 A;  3OVX A;  2OZ2 A;  4CDF B;  8PCH A;  3H89 A;  1CS8 A;  2PAD A;  2VHS A;  4FIP A;  2YJ9 A;  3N3K A;  2AIM A;  1O0E A;  1A6R A;  2CB5 A;  1QOL A;  3H8C A;  3V6C A;  2C0Y A;  4OEM A;  1MIR A;  2B1N A;  1PCI A;  1THE A;  1PIP A;  1PPO A;  4BS5 A;  4GUZ A;  3HD3 A;  5CHT A;  1Y4H A;  1EF7 A;  5EGW A;  4BSQ A;  1SNK A;  4N79 A;  5EF4 A;  2OP3 A;  1ME3 A;  3MHH A;  4B55 A;  4CDE B;  3WXE A;  3D9W A;  3IEJ A;  3IHP A;  2ATO A;  1VJV A;  1PXV A;  1YK7 A;  3OF8 A;  1ATK A;  2AU1 A;  3S3R A;  2FRQ A;  1F2C A;  4YYU A;  2OUL A;  2P0R A;  3OVZ A;  1W6F A;  4MZO A;  3CBJ A;  3BPM A;  1AYW A;  3IV2 A;  3WXG A;  1KXR A;  1ZCM A;  1PPD A;  4X6H A;  2GHU A;  1U9Q X;  1YT7 A;  3BCN A;  3B79 A;  3IMA A;  4OEL A;  4DMX A;  1AIM A;  1U9X A;  3MTN A;  3RVX A;  1F2B A;  3CH3 X;  3BOW A;  2FT2 A;  5J94 A;  2DC8 A;  4YV8 A;  1AU4 A;  5CVM A;  1AU2 A;  3IOQ A;  3TNX A;  3LFY A;  2YJB A;  1E2T A;  3H8B A;  4YYV A;  3KWZ A;  3RVV A;  1EWM A;  1AYU A;  2E02 A;  2BDZ A;  2AS8 A;  2YJ2 A;  1PBH A;  2FQ9 A;  4CDC B;  4P6G A;  4KLB A;  2DJG B;  4NV8 A;  4NV7 A;  4YVA A;  2AYN A;  1PAD A;  1STF E;  2NQA A;  2GFO A;  1QXP A;  1CPJ A;  3PNR A;  1GEC E;  2BSZ A;  4G54 A;  4QRX A;  3M99 A;  2DJF B;  2PBH A;  2G7Y A;  4C5P A;  1EWL A;  3IUT A;  3USV A;  2HH5 A;  4P6E A;  4Q8H A;  2NQI A;  3C9E A;  3N3G A;  3H7D A;  1U9V A;  1NB3 A;  1F29 A;  4PP1 A;  3KW9 A;  2IPP B;  2NQD B;  2R6N A;  3RVW A;  3V6E A;  4FK5 A;  1GMY A;  4XUI A;  1HUC B;  4MSX A;  1CSB B;  3E1Z B;  2R9F A;  3QSD A;  4ZUX U;  4X6J A;  3MHS A;  3CBK A;  1TLO A;  4CZW A;  1ICF A;  1MEG A;  4HWY A;  4I04 A;  3S3Q A;  3KX1 A;  4AXL A;  5CVO B;  1XKG A;  1YK8 A;  4K7C A;  3QJ3 A;  4I05 A;  1CB5 A;  3U8E A;  1TU6 A;  1NPZ A;  3KKU A;  2AUZ A;  5PAD A;  1F2A A;  1JQP A;  4CDD B;  1IWD A;  3PBH A;  1M6D A;  2PNS A;  1CJL A;  1GX3 A;  1AU0 A;  5A24 A;  2VFB A;  3MOR A;  1FH0 A;  3D6S A;  1VSN A;  2O6X A;  1ZIV A;  3H6S A;  4BGF A;  2PRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...