1YVBA

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords falcipain 2
total genus 61
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yvbA00
4QRGA 4WA6A 5A24A 3F5VA 4BPVA 1X9YA 2BDLA 3HHAA 3BPMA 3OF8A 2R9FA 2AVWA 3H89A 4DMYA 2HD5A 1F2AA 1TL9A 1PPNA 2O6XA 4PP1A 3V6CA 3HWNA 1ME4A 4X6HA 1MEGA 3ZUAA 1A6RA 3NHEA 4I05A 1YK8A 1QMYA 2CIOA 2BDZA 2FO5A 2E02A 2ATOA 2NQIA 8PCHA 2DZYA 2XU3A 2P7UA 3S3QA 2DC7A 3KW9A 4YVAA 3TNXA 4FIPA 1TU6A 1DEUA 1GECE 3BPFA 1MDWA 2XU1A 1TLOA 3LFYA 2FQ9A 2YJ9A 2R9NA 1SP4B 3K8UA 1XKGA 1NB3A 2WBFX 3I3TA 5J94A 1U9VA 2FUDA 3HHIA 1NQCA 2NQGA 3PNRA 1BGOA 4MZSA 3P5XA 4YYSA 3S3RA 1THEA 1EF7A 2AYNA 4OEMA 3CH3X 2HHNA 2F7DA 4XR7A 1EWLA 2AIMA 1CSBB 3PDFA 1GLOA 1KHQA 1AU2A 1CV8A 2AYOA 3MTNA 3PBHA 3N3GA 4G54A 3QT4A 3BOWA 1Q6KA 2XU4A 1EWOA 3KSEA 5CVMA 1AECA 3HD3A 1AYVA 1KFXL 3CBJA 4P6GA 1Y4HA 4YYUA 5K16A 3V6EA 1ITOA 1AYWA 2P0RA 4BSQA 3KKUA 2E01A 3BWKA 1YALA 3N3KA 1GCBA 4X6JA 4YV8A 3IHPA 3IUTA 3CH2X 4QRXA 4XUIA 3IMAA 3DF0A 1ZCMA 4N8WA 2G8EA 3USVA 3H8BA 1PCIA 4QH6A 3C9EA 9PAPA 2P86A 4DMXA 2DCDA 1PE6A 4YYRA 2Y5BA 1MIRA 4YYQA 4PP2E 2NQAA 1YK7A 2AS8A 2B1MA 2OULA 3KFQA 3BC3A 2FYEA 2DCCA 2DCBA 1EWMA 1F2BA 4I04A 1U5IA 2PNSA 2R9OA 2PREA 3RVXA 5CVOB 3CBKA 1Y08A 2JQGR 2IPPB 2PBHA 4YYVA 1EWPA 1MHWA 1CJLA 1BQIA 7PCKA 1PPOA 4W4UA 3D6SA 3AI8A 3F75A 2E00A 2DCAA 3OISA 1U9XA 1QDQA 2G6DA 1U9QX 4MZOA 4P6EA 2DZZA 1PADA 2PADA 3KWBX 4CDFB 2R6NA 3OF9A 2FT2A 2FRQA 1JQPA 1K3BB 1CS8A 5JA7A 3K9MA 3WXGA 1IWDA 1PIPA 2G7YA 4BS6A 1PXVA 1M6DA 4FK5A 1U9WA 1YT7A 1HUCB 1BP4A 3N4CA 4OELA 3OVXA 1VSNA 3O0UA 2NQDB 1NPZA 3B79A 3IEJA 1CTEA 3H6SA 1MEMA 1PBHA 6PADA 2GHUA 1POPA 4AXLA 3U8EA 5EGWA 5JH3A 2GFOA 3P5UA 1CPJA 1AYUA 3H8CA 4MSXA 1YVBA 4KLBA 2AUZA 4PI3A 2DJGB 4AXMA 2YJCA 2VHSA 1NB5A 5CHVA 3IOQA 4X6IA 5FPWA 2C0YA 3M99A 4CDCB 3OVZA 3P5WA 3MORA 3O1GA 3QJ3A 3BCNA 1QXPA 1DF0A 1NLJA 4Q8HA 2HH5A 3RVWA 3WXFA 3GCBA 1F29A 2AUXA 1KXRA 2DJFB 3KWZA 1CVZA 1ME3A 4PADA 5EF4A 1MS6A 4CZWA 5PADA 1AU3A 2DC6A 2Y6EA 3P5VA 2JQFR 4W5BA 4Q8GA 4YYWA 3MHHA 1VJVA 1AU4A 1ZIVA 1NL6A 5CHTA 1GMYA 2YJBA 2F1GA 2ARYA 1STFE 1KHPA 1AU0A 2VHFA 1ICFA 1CQDA 2FRAA 4K7CA 4QBBA 1S4VA 2G8JA 1QOLA 2ACTA 2R9CA 3RVVA 2H7JA 3LXSA 3PW3A 4QRVA 2E03A 4HWYA 1O0EA 1BY8A 2HXZA 3IV2A 1AIMA 3K24A 2OP3A 3WXEA 4N79A 1ATKA 4I07A 4ZUXU 4W5CA 2AU1A 2DC9A 3I06A 4CDEB 3KX1A 3QSDA 3MHSA 2FTDA 3ERVA 2OZ2A 1FH0A 1SNKA 2XU5A 3E1ZB 2R9MA 1CB5A 3H7DA 1KFUL 4CDDB 4BQVA 2DC8A 2CB5A 5CVNB 4N4ZA 4FJCA 2YJ8A 2YJ2A 5F02A 2IBIA 1PPDA 1F2CA 1PPPA 2B1NA 4BS5A 4RY2A
chains in the Genus database with same CATH superfamily
4QRGA 4WA6A 5A24A 3F5VA 4BPVA 1X9YA 2BDLA 2FE8A 3HHAA 3BPMA 3OF8A 2R9FA 2BTWB 2AVWA 2BTWA 3H89A 4DMYA 2HD5A 1F2AA 1TL9A 1PPNA 1DKIA 4HXDB 2O6XA 4PP1A 3V6CA 3HWNA 1ME4A 4X6HA 1MEGA 3ZUAA 1A6RA 3NHEA 4I05A 1YK8A 1QMYA 2CIOA 2BDZA 2FO5A 2E02A 3B21A 2ATOA 2NQIA 4RF0A 8PCHA 2DZYA 2XU3A 2P7UA 3ZNHA 3S3QA 2DC7A 3KW9A 4YVAA 3TNXA 4FIPA 1TU6A 1DEUA 1GECE 3BPFA 1MDWA 2XU1A 4REZA 4D8EA 3BY4A 1TLOA 3LFYA 2FQ9A 2YJ9A 2R9NA 1SP4B 3K8UA 1XKGA 1NB3A 2WBFX 3I3TA 5J94A 1U9VA 2FUDA 3HHIA 1NQCA 5E6JA 2J7QA 2NQGA 3PNRA 1BGOA 4MZSA 3P5XA 4YYSA 3S3RA 1THEA 1EF7A 4BOQA 2AYNA 4OEMA 3CH3X 2HHNA 2F7DA 4XR7A 1EWLA 2AIMA 1CSBB 3PDFA 1GLOA 3W31A 1KHQA 1AU2A 1CV8A 2BU3A 2AYOA 3MTNA 3PBHA 3N3GA 4G54A 3QT4A 3BOWA 1Q6KA 2XU4A 1EWOA 3KSEA 5CVMA 5EZQA 1AECA 4D8IA 3HD3A 1AYVA 1KFXL 3CBJA 3MP2A 1Y4HA 4P6GA 4YYUA 2JTCA 5K16A 3V6EA 1ITOA 1AYWA 2P0RA 4BSQA 3KKUA 2E01A 3BWKA 1YALA 3N3KA 1GCBA 4X6JA 4YV8A 3IHPA 3IUTA 3CH2X 4QRXA 4XUIA 4P16A 3IMAA 3DF0A 1ZCMA 4N8WA 2G8EA 3USVA 3H8BA 1PCIA 4QH6A 3C9EA 9PAPA 2P86A 4DMXA 2DCDA 1PE6A 4YYRA 2Y5BA 1MIRA 4YYQA 4PP2E 4OVZB 2NQAA 1YK7A 2AS8A 2B1MA 2OULA 3KFQA 3BC3A 5EZSA 2FYEA 2DCCA 2DCBA 1EWMA 1F2BA 4I04A 3PHXA 1U5IA 2PNSA 2R9OA 4M0WA 2PREA 3RVXA 5CVOB 3CBKA 2J7QC 1Y08A 2JQGR 2IPPB 1UKFA 2PBHA 3MJ5A 3E9SA 4YYVA 2UZJA 1EWPA 1MHWA 1CJLA 1BQIA 4IP3A 7PCKA 1PPOA 4W4UA 3D6SA 3AI8A 4MI7A 3F75A 4ZTBA 2E00A 2DCAA 3OISA 1U9XA 1QDQA 2G6DA 1U9QX 4MZOA 3PHUA 4P6EA 2DZZA 1PADA 2PADA 3KWBX 4CDFB 2R6NA 3OF9A 2FT2A 2FRQA 1JQPA 1K3BB 1CS8A 5JA7A 4GUAA 3K9MA 3WXGA 3O65A 1IWDA 1PIPA 2G7YA 4MM3B 4BS6A 1PXVA 1M6DA 4FK5A 1U9WA 3IFUA 1YT7A 1HUCB 3PHWA 1BP4A 3N4CA 4OELA 4XZXA 3OVXA 1VSNA 3O0UA 1YZBA 2NQDB 1NPZA 3B79A 3IEJA 1CTEA 3H6SA 1MEMA 1PBHA 6PADA 2GHUA 1POPA 4AXLA 3BBAA 3U8EA 5EGWA 5JH3A 3PSEA 2GFOA 3P5UA 4BOZA 1CPJA 1AYUA 3H8CA 3MTVA 4MSXA 4OVZA 1YVBA 4KLBA 2Z84A 2AUZA 4PI3A 2DJGB 4AXMA 2YJCA 2VHSA 1NB5A 5CHVA 3IOQA 4WURA 4X6IA 5FPWA 2C0YA 3M99A 4CDCB 3OVZA 3W30A 3P5WA 3MORA 4BOSA 3O1GA 3TMPA 3QJ3A 4IUMA 3BCNA 4RKXA 1QXPA 1DF0A 1NLJA 4Q8HA 2HH5A 3RVWA 3WXFA 3GCBA 1F29A 2AUXA 3BB7A 1KXRA 2DJFB 5JZEA 1PVJA 3KWZA 4RNAA 5KO3A 1CVZA 1ME3A 4PADA 3PRMA 5EF4A 1MS6A 4CZWA 5PADA 1AU3A 2DC6A 2Y6EA 3P5VA 2JQFR 4W5BA 4Q8GA 4YYWA 4A5UA 3MHHA 1VJVA 1AU4A 1ZIVA 1NL6A 5CHTA 3PT2A 2AGAA 1GMYA 2YJBA 2F1GA 4BOUA 2ARYA 1STFE 1KHPA 3TRKA 1AU0A 2VHFA 1ICFA 1CQDA 2FRAA 4K7CA 4BOPA 4QBBA 1S4VA 2G8JA 1QOLA 2ACTA 2R9CA 3RVVA 2H7JA 3LXSA 3PW3A 4QRVA 2E03A 4HWYA 4OW0A 1O0EA 1BY8A 2HXZA 3IV2A 1AIMA 3K24A 2OP3A 3WXEA 4N79A 1ATKA 4R3DA 4I07A 4ZUXU 4W5CA 2AU1A 2DC9A 3I06A 4CDEB 3PRPA 3KX1A 3QSDA 3MHSA 2FTDA 3ERVA 3OQCA 2OZ2A 1FH0A 1SNKA 2XU5A 4PT5A 3E1ZB 2R9MA 4D8BA 1CB5A 3H7DA 1KFUL 4CDDB 4BQVA 2DC8A 2CB5A 2DOSA 5CVNB 4N4ZA 4FJCA 2YJ8A 2HWKA 2YJ2A 3C0RA 5F02A 2JRIA 2IBIA 3RNVA 4RF1A 1PPDA 1F2CA 1PPPA 2B1NA 4BS5A 4RY2A
chains in the Genus database with same CATH topology
4QRGA 4WA6A 5A24A 3F5VA 4BPVA 1X9YA 2BDLA 3HHAA 3BPMA 3OF8A 2R9FA 2AVWA 4NV7A 3H89A 4DMYA 2HD5A 1F2AA 1TL9A 1PPNA 2O6XA 4PP1A 3V6CA 3HWNA 1ME4A 4X6HA 1MEGA 1W5RA 3ZUAA 1A6RA 3NHEA 4I05A 1YK8A 1QMYA 2CIOA 2BDZA 2FO5A 2E02A 2ATOA 2NQIA 8PCHA 2DZYA 2XU3A 2P7UA 3S3QA 2DC7A 3KW9A 4YVAA 3TNXA 4FIPA 1TU6A 1DEUA 1GECE 3BPFA 1MDWA 2XU1A 1TLOA 3LFYA 2FQ9A 3LTWA 2YJ9A 2R9NA 1SP4B 3K8UA 2VFCA 1XKGA 1NB3A 2WBFX 3I3TA 5J94A 1U9VA 2FUDA 3HHIA 1NQCA 2NQGA 3PNRA 1BGOA 4MZSA 3P5XA 4YYSA 3S3RA 1THEA 1EF7A 2AYNA 4OEMA 3CH3X 4NV8A 2HHNA 2F7DA 4XR7A 1EWLA 2AIMA 1CSBB 3PDFA 1GLOA 1KHQA 1AU2A 1CV8A 2AYOA 3MTNA 3PBHA 3N3GA 4G54A 3QT4A 3BOWA 1Q6KA 2XU4A 1EWOA 3KSEA 5CVMA 1AECA 3HD3A 1AYVA 1KFXL 3CBJA 4P6GA 1Y4HA 4YYUA 5K16A 3V6EA 1ITOA 1AYWA 2P0RA 4BSQA 3KKUA 2E01A 3BWKA 1YALA 3N3KA 1GCBA 4X6JA 4YV8A 3IHPA 3IUTA 3CH2X 4QRXA 4XUIA 3IMAA 3DF0A 1ZCMA 4N8WA 2G8EA 3USVA 3H8BA 1PCIA 4QH6A 3C9EA 9PAPA 2P86A 4DMXA 2DCDA 1PE6A 4YYRA 2Y5BA 1MIRA 4YYQA 4PP2E 2NQAA 1YK7A 2AS8A 2B1MA 2OULA 3KFQA 3BC3A 2FYEA 2DCCA 2DCBA 1EWMA 1F2BA 4I04A 1U5IA 2PNSA 2R9OA 2PREA 3RVXA 5CVOB 3CBKA 1Y08A 2JQGR 2IPPB 2PBHA 4YYVA 1EWPA 1MHWA 1CJLA 1BQIA 7PCKA 1PPOA 4W4UA 3D6SA 3AI8A 3F75A 2E00A 2DCAA 3OISA 1U9XA 1QDQA 2G6DA 1U9QX 4MZOA 4P6EA 2DZZA 1PADA 2PADA 3KWBX 4CDFB 2R6NA 3OF9A 2FT2A 2FRQA 1JQPA 1K3BB 1CS8A 5JA7A 3K9MA 4BGFA 3WXGA 1IWDA 1PIPA 2G7YA 4BS6A 1PXVA 4GUZA 1M6DA 4FK5A 1W4TA 1U9WA 1YT7A 1HUCB 1BP4A 3N4CA 4OELA 3OVXA 1VSNA 3O0UA 1E2TA 2NQDB 1NPZA 3B79A 3IEJA 1CTEA 3H6SA 1MEMA 1PBHA 6PADA 2GHUA 1POPA 4AXLA 3U8EA 5EGWA 5JH3A 2GFOA 3P5UA 1CPJA 1AYUA 3H8CA 4MSXA 1YVBA 4KLBA 2AUZA 4PI3A 1GX3A 2DJGB 4AXMA 2YJCA 2VHSA 1NB5A 5CHVA 3IOQA 4X6IA 5FPWA 2C0YA 3M99A 4CDCB 3OVZA 4C5PA 3P5WA 3MORA 3O1GA 3QJ3A 3BCNA 1QXPA 1DF0A 1NLJA 4Q8HA 2HH5A 3RVWA 3WXFA 3GCBA 1F29A 2AUXA 1W6FA 1KXRA 2DJFB 3KWZA 1CVZA 1ME3A 4PADA 5EF4A 1MS6A 4CZWA 5PADA 1AU3A 2DC6A 2Y6EA 3P5VA 2JQFR 4W5BA 4Q8GA 4YYWA 3MHHA 1VJVA 1AU4A 1ZIVA 1NL6A 5CHTA 1GMYA 2YJBA 2F1GA 2ARYA 1STFE 1KHPA 3D9WA 1AU0A 2VHFA 1ICFA 1CQDA 2FRAA 4K7CA 4QBBA 1S4VA 2G8JA 1QOLA 2ACTA 2R9CA 3RVVA 2H7JA 3LXSA 3PW3A 4QRVA 4B55A 2BSZA 2E03A 4HWYA 2VFBA 1O0EA 1BY8A 2HXZA 3IV2A 1AIMA 3K24A 2OP3A 3WXEA 4N79A 1ATKA 4I07A 4ZUXU 4W5CA 2AU1A 2DC9A 3I06A 4CDEB 3KX1A 3QSDA 3MHSA 2FTDA 3ERVA 2OZ2A 1FH0A 1SNKA 2XU5A 3E1ZB 2R9MA 1CB5A 3H7DA 1KFUL 4CDDB 4BQVA 2DC8A 2CB5A 5CVNB 4N4ZA 4FJCA 2YJ8A 2YJ2A 5F02A 2IBIA 1PPDA 1F2CA 1PPPA 2B1NA 4BS5A 4RY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRG A;  4WA6 A;  5A24 A;  3F5V A;  4BPV A;  1X9Y A;  2BDL A;  3HHA A;  3BPM A;  3OF8 A;  2R9F A;  2AVW A;  3H89 A;  4DMY A;  2HD5 A;  1F2A A;  1TL9 A;  1PPN A;  2O6X A;  4PP1 A;  3V6C A;  3HWN A;  1ME4 A;  4X6H A;  1MEG A;  3ZUA A;  1A6R A;  3NHE A;  4I05 A;  1YK8 A;  1QMY A;  2CIO A;  2BDZ A;  2FO5 A;  2E02 A;  2ATO A;  2NQI A;  8PCH A;  2DZY A;  2XU3 A;  2P7U A;  3S3Q A;  2DC7 A;  3KW9 A;  4YVA A;  3TNX A;  4FIP A;  1TU6 A;  1DEU A;  1GEC E;  3BPF A;  1MDW A;  2XU1 A;  1TLO A;  3LFY A;  2FQ9 A;  2YJ9 A;  2R9N A;  1SP4 B;  3K8U A;  1XKG A;  1NB3 A;  2WBF X;  3I3T A;  5J94 A;  1U9V A;  2FUD A;  3HHI A;  1NQC A;  2NQG A;  3PNR A;  1BGO A;  4MZS A;  3P5X A;  4YYS A;  3S3R A;  1THE A;  1EF7 A;  2AYN A;  4OEM A;  3CH3 X;  2HHN A;  2F7D A;  4XR7 A;  1EWL A;  2AIM A;  1CSB B;  3PDF A;  1GLO A;  1KHQ A;  1AU2 A;  1CV8 A;  2AYO A;  3MTN A;  3PBH A;  3N3G A;  4G54 A;  3QT4 A;  3BOW A;  1Q6K A;  2XU4 A;  1EWO A;  3KSE A;  5CVM A;  1AEC A;  3HD3 A;  1AYV A;  1KFX L;  3CBJ A;  4P6G A;  1Y4H A;  4YYU A;  5K16 A;  3V6E A;  1ITO A;  1AYW A;  2P0R A;  4BSQ A;  3KKU A;  2E01 A;  3BWK A;  1YAL A;  3N3K A;  1GCB A;  4X6J A;  4YV8 A;  3IHP A;  3IUT A;  3CH2 X;  4QRX A;  4XUI A;  3IMA A;  3DF0 A;  1ZCM A;  4N8W A;  2G8E A;  3USV A;  3H8B A;  1PCI A;  4QH6 A;  3C9E A;  9PAP A;  2P86 A;  4DMX A;  2DCD A;  1PE6 A;  4YYR A;  2Y5B A;  1MIR A;  4YYQ A;  4PP2 E;  2NQA A;  1YK7 A;  2AS8 A;  2B1M A;  2OUL A;  3KFQ A;  3BC3 A;  2FYE A;  2DCC A;  2DCB A;  1EWM A;  1F2B A;  4I04 A;  1U5I A;  2PNS A;  2R9O A;  2PRE A;  3RVX A;  5CVO B;  3CBK A;  1Y08 A;  2JQG R;  2IPP B;  2PBH A;  4YYV A;  1EWP A;  1MHW A;  1CJL A;  1BQI A;  7PCK A;  1PPO A;  4W4U A;  3D6S A;  3AI8 A;  3F75 A;  2E00 A;  2DCA A;  3OIS A;  1U9X A;  1QDQ A;  2G6D A;  1U9Q X;  4MZO A;  4P6E A;  2DZZ A;  1PAD A;  2PAD A;  3KWB X;  4CDF B;  2R6N A;  3OF9 A;  2FT2 A;  2FRQ A;  1JQP A;  1K3B B;  1CS8 A;  5JA7 A;  3K9M A;  3WXG A;  1IWD A;  1PIP A;  2G7Y A;  4BS6 A;  1PXV A;  1M6D A;  4FK5 A;  1U9W A;  1YT7 A;  1HUC B;  1BP4 A;  3N4C A;  4OEL A;  3OVX A;  1VSN A;  3O0U A;  2NQD B;  1NPZ A;  3B79 A;  3IEJ A;  1CTE A;  3H6S A;  1MEM A;  1PBH A;  6PAD A;  2GHU A;  1POP A;  4AXL A;  3U8E A;  5EGW A;  5JH3 A;  2GFO A;  3P5U A;  1CPJ A;  1AYU A;  3H8C A;  4MSX A;  1YVB A;  4KLB A;  2AUZ A;  4PI3 A;  2DJG B;  4AXM A;  2YJC A;  2VHS A;  1NB5 A;  5CHV A;  3IOQ A;  4X6I A;  5FPW A;  2C0Y A;  3M99 A;  4CDC B;  3OVZ A;  3P5W A;  3MOR A;  3O1G A;  3QJ3 A;  3BCN A;  1QXP A;  1DF0 A;  1NLJ A;  4Q8H A;  2HH5 A;  3RVW A;  3WXF A;  3GCB A;  1F29 A;  2AUX A;  1KXR A;  2DJF B;  3KWZ A;  1CVZ A;  1ME3 A;  4PAD A;  5EF4 A;  1MS6 A;  4CZW A;  5PAD A;  1AU3 A;  2DC6 A;  2Y6E A;  3P5V A;  2JQF R;  4W5B A;  4Q8G A;  4YYW A;  3MHH A;  1VJV A;  1AU4 A;  1ZIV A;  1NL6 A;  5CHT A;  1GMY A;  2YJB A;  2F1G A;  2ARY A;  1STF E;  1KHP A;  1AU0 A;  2VHF A;  1ICF A;  1CQD A;  2FRA A;  4K7C A;  4QBB A;  1S4V A;  2G8J A;  1QOL A;  2ACT A;  2R9C A;  3RVV A;  2H7J A;  3LXS A;  3PW3 A;  4QRV A;  2E03 A;  4HWY A;  1O0E A;  1BY8 A;  2HXZ A;  3IV2 A;  1AIM A;  3K24 A;  2OP3 A;  3WXE A;  4N79 A;  1ATK A;  4I07 A;  4ZUX U;  4W5C A;  2AU1 A;  2DC9 A;  3I06 A;  4CDE B;  3KX1 A;  3QSD A;  3MHS A;  2FTD A;  3ERV A;  2OZ2 A;  1FH0 A;  1SNK A;  2XU5 A;  3E1Z B;  2R9M A;  1CB5 A;  3H7D A;  1KFU L;  4CDD B;  4BQV A;  2DC8 A;  2CB5 A;  5CVN B;  4N4Z A;  4FJC A;  2YJ8 A;  2YJ2 A;  5F02 A;  2IBI A;  1PPD A;  1F2C A;  1PPP A;  2B1N A;  4BS5 A;  4RY2 A; 
#chains in the Genus database with same CATH topology
 4QRG A;  4WA6 A;  5A24 A;  3F5V A;  4BPV A;  1X9Y A;  2BDL A;  2FE8 A;  3HHA A;  3BPM A;  3OF8 A;  2R9F A;  2BTW B;  2AVW A;  2BTW A;  3H89 A;  4DMY A;  2HD5 A;  1F2A A;  1TL9 A;  1PPN A;  1DKI A;  4HXD B;  2O6X A;  4PP1 A;  3V6C A;  3HWN A;  1ME4 A;  4X6H A;  1MEG A;  3ZUA A;  1A6R A;  3NHE A;  4I05 A;  1YK8 A;  1QMY A;  2CIO A;  2BDZ A;  2FO5 A;  2E02 A;  3B21 A;  2ATO A;  2NQI A;  4RF0 A;  8PCH A;  2DZY A;  2XU3 A;  2P7U A;  3ZNH A;  3S3Q A;  2DC7 A;  3KW9 A;  4YVA A;  3TNX A;  4FIP A;  1TU6 A;  1DEU A;  1GEC E;  3BPF A;  1MDW A;  2XU1 A;  4REZ A;  4D8E A;  3BY4 A;  1TLO A;  3LFY A;  2FQ9 A;  2YJ9 A;  2R9N A;  1SP4 B;  3K8U A;  1XKG A;  1NB3 A;  2WBF X;  3I3T A;  5J94 A;  1U9V A;  2FUD A;  3HHI A;  1NQC A;  5E6J A;  2J7Q A;  2NQG A;  3PNR A;  1BGO A;  4MZS A;  3P5X A;  4YYS A;  3S3R A;  1THE A;  1EF7 A;  4BOQ A;  2AYN A;  4OEM A;  3CH3 X;  2HHN A;  2F7D A;  4XR7 A;  1EWL A;  2AIM A;  1CSB B;  3PDF A;  1GLO A;  3W31 A;  1KHQ A;  1AU2 A;  1CV8 A;  2BU3 A;  2AYO A;  3MTN A;  3PBH A;  3N3G A;  4G54 A;  3QT4 A;  3BOW A;  1Q6K A;  2XU4 A;  1EWO A;  3KSE A;  5CVM A;  5EZQ A;  1AEC A;  4D8I A;  3HD3 A;  1AYV A;  1KFX L;  3CBJ A;  3MP2 A;  1Y4H A;  4P6G A;  4YYU A;  2JTC A;  5K16 A;  3V6E A;  1ITO A;  1AYW A;  2P0R A;  4BSQ A;  3KKU A;  2E01 A;  3BWK A;  1YAL A;  3N3K A;  1GCB A;  4X6J A;  4YV8 A;  3IHP A;  3IUT A;  3CH2 X;  4QRX A;  4XUI A;  4P16 A;  3IMA A;  3DF0 A;  1ZCM A;  4N8W A;  2G8E A;  3USV A;  3H8B A;  1PCI A;  4QH6 A;  3C9E A;  9PAP A;  2P86 A;  4DMX A;  2DCD A;  1PE6 A;  4YYR A;  2Y5B A;  1MIR A;  4YYQ A;  4PP2 E;  4OVZ B;  2NQA A;  1YK7 A;  2AS8 A;  2B1M A;  2OUL A;  3KFQ A;  3BC3 A;  5EZS A;  2FYE A;  2DCC A;  2DCB A;  1EWM A;  1F2B A;  4I04 A;  3PHX A;  1U5I A;  2PNS A;  2R9O A;  4M0W A;  2PRE A;  3RVX A;  5CVO B;  3CBK A;  2J7Q C;  1Y08 A;  2JQG R;  2IPP B;  1UKF A;  2PBH A;  3MJ5 A;  3E9S A;  4YYV A;  2UZJ A;  1EWP A;  1MHW A;  1CJL A;  1BQI A;  4IP3 A;  7PCK A;  1PPO A;  4W4U A;  3D6S A;  3AI8 A;  4MI7 A;  3F75 A;  4ZTB A;  2E00 A;  2DCA A;  3OIS A;  1U9X A;  1QDQ A;  2G6D A;  1U9Q X;  4MZO A;  3PHU A;  4P6E A;  2DZZ A;  1PAD A;  2PAD A;  3KWB X;  4CDF B;  2R6N A;  3OF9 A;  2FT2 A;  2FRQ A;  1JQP A;  1K3B B;  1CS8 A;  5JA7 A;  4GUA A;  3K9M A;  3WXG A;  3O65 A;  1IWD A;  1PIP A;  2G7Y A;  4MM3 B;  4BS6 A;  1PXV A;  1M6D A;  4FK5 A;  1U9W A;  3IFU A;  1YT7 A;  1HUC B;  3PHW A;  1BP4 A;  3N4C A;  4OEL A;  4XZX A;  3OVX A;  1VSN A;  3O0U A;  1YZB A;  2NQD B;  1NPZ A;  3B79 A;  3IEJ A;  1CTE A;  3H6S A;  1MEM A;  1PBH A;  6PAD A;  2GHU A;  1POP A;  4AXL A;  3BBA A;  3U8E A;  5EGW A;  5JH3 A;  3PSE A;  2GFO A;  3P5U A;  4BOZ A;  1CPJ A;  1AYU A;  3H8C A;  3MTV A;  4MSX A;  4OVZ A;  1YVB A;  4KLB A;  2Z84 A;  2AUZ A;  4PI3 A;  2DJG B;  4AXM A;  2YJC A;  2VHS A;  1NB5 A;  5CHV A;  3IOQ A;  4WUR A;  4X6I A;  5FPW A;  2C0Y A;  3M99 A;  4CDC B;  3OVZ A;  3W30 A;  3P5W A;  3MOR A;  4BOS A;  3O1G A;  3TMP A;  3QJ3 A;  4IUM A;  3BCN A;  4RKX A;  1QXP A;  1DF0 A;  1NLJ A;  4Q8H A;  2HH5 A;  3RVW A;  3WXF A;  3GCB A;  1F29 A;  2AUX A;  3BB7 A;  1KXR A;  2DJF B;  5JZE A;  1PVJ A;  3KWZ A;  4RNA A;  5KO3 A;  1CVZ A;  1ME3 A;  4PAD A;  3PRM A;  5EF4 A;  1MS6 A;  4CZW A;  5PAD A;  1AU3 A;  2DC6 A;  2Y6E A;  3P5V A;  2JQF R;  4W5B A;  4Q8G A;  4YYW A;  4A5U A;  3MHH A;  1VJV A;  1AU4 A;  1ZIV A;  1NL6 A;  5CHT A;  3PT2 A;  2AGA A;  1GMY A;  2YJB A;  2F1G A;  4BOU A;  2ARY A;  1STF E;  1KHP A;  3TRK A;  1AU0 A;  2VHF A;  1ICF A;  1CQD A;  2FRA A;  4K7C A;  4BOP A;  4QBB A;  1S4V A;  2G8J A;  1QOL A;  2ACT A;  2R9C A;  3RVV A;  2H7J A;  3LXS A;  3PW3 A;  4QRV A;  2E03 A;  4HWY A;  4OW0 A;  1O0E A;  1BY8 A;  2HXZ A;  3IV2 A;  1AIM A;  3K24 A;  2OP3 A;  3WXE A;  4N79 A;  1ATK A;  4R3D A;  4I07 A;  4ZUX U;  4W5C A;  2AU1 A;  2DC9 A;  3I06 A;  4CDE B;  3PRP A;  3KX1 A;  3QSD A;  3MHS A;  2FTD A;  3ERV A;  3OQC A;  2OZ2 A;  1FH0 A;  1SNK A;  2XU5 A;  4PT5 A;  3E1Z B;  2R9M A;  4D8B A;  1CB5 A;  3H7D A;  1KFU L;  4CDD B;  4BQV A;  2DC8 A;  2CB5 A;  2DOS A;  5CVN B;  4N4Z A;  4FJC A;  2YJ8 A;  2HWK A;  2YJ2 A;  3C0R A;  5F02 A;  2JRI A;  2IBI A;  3RNV A;  4RF1 A;  1PPD A;  1F2C A;  1PPP A;  2B1N A;  4BS5 A;  4RY2 A; 
#chains in the Genus database with same CATH homology
 4QRG A;  4WA6 A;  5A24 A;  3F5V A;  4BPV A;  1X9Y A;  2BDL A;  3HHA A;  3BPM A;  3OF8 A;  2R9F A;  2AVW A;  4NV7 A;  3H89 A;  4DMY A;  2HD5 A;  1F2A A;  1TL9 A;  1PPN A;  2O6X A;  4PP1 A;  3V6C A;  3HWN A;  1ME4 A;  4X6H A;  1MEG A;  1W5R A;  3ZUA A;  1A6R A;  3NHE A;  4I05 A;  1YK8 A;  1QMY A;  2CIO A;  2BDZ A;  2FO5 A;  2E02 A;  2ATO A;  2NQI A;  8PCH A;  2DZY A;  2XU3 A;  2P7U A;  3S3Q A;  2DC7 A;  3KW9 A;  4YVA A;  3TNX A;  4FIP A;  1TU6 A;  1DEU A;  1GEC E;  3BPF A;  1MDW A;  2XU1 A;  1TLO A;  3LFY A;  2FQ9 A;  3LTW A;  2YJ9 A;  2R9N A;  1SP4 B;  3K8U A;  2VFC A;  1XKG A;  1NB3 A;  2WBF X;  3I3T A;  5J94 A;  1U9V A;  2FUD A;  3HHI A;  1NQC A;  2NQG A;  3PNR A;  1BGO A;  4MZS A;  3P5X A;  4YYS A;  3S3R A;  1THE A;  1EF7 A;  2AYN A;  4OEM A;  3CH3 X;  4NV8 A;  2HHN A;  2F7D A;  4XR7 A;  1EWL A;  2AIM A;  1CSB B;  3PDF A;  1GLO A;  1KHQ A;  1AU2 A;  1CV8 A;  2AYO A;  3MTN A;  3PBH A;  3N3G A;  4G54 A;  3QT4 A;  3BOW A;  1Q6K A;  2XU4 A;  1EWO A;  3KSE A;  5CVM A;  1AEC A;  3HD3 A;  1AYV A;  1KFX L;  3CBJ A;  4P6G A;  1Y4H A;  4YYU A;  5K16 A;  3V6E A;  1ITO A;  1AYW A;  2P0R A;  4BSQ A;  3KKU A;  2E01 A;  3BWK A;  1YAL A;  3N3K A;  1GCB A;  4X6J A;  4YV8 A;  3IHP A;  3IUT A;  3CH2 X;  4QRX A;  4XUI A;  3IMA A;  3DF0 A;  1ZCM A;  4N8W A;  2G8E A;  3USV A;  3H8B A;  1PCI A;  4QH6 A;  3C9E A;  9PAP A;  2P86 A;  4DMX A;  2DCD A;  1PE6 A;  4YYR A;  2Y5B A;  1MIR A;  4YYQ A;  4PP2 E;  2NQA A;  1YK7 A;  2AS8 A;  2B1M A;  2OUL A;  3KFQ A;  3BC3 A;  2FYE A;  2DCC A;  2DCB A;  1EWM A;  1F2B A;  4I04 A;  1U5I A;  2PNS A;  2R9O A;  2PRE A;  3RVX A;  5CVO B;  3CBK A;  1Y08 A;  2JQG R;  2IPP B;  2PBH A;  4YYV A;  1EWP A;  1MHW A;  1CJL A;  1BQI A;  7PCK A;  1PPO A;  4W4U A;  3D6S A;  3AI8 A;  3F75 A;  2E00 A;  2DCA A;  3OIS A;  1U9X A;  1QDQ A;  2G6D A;  1U9Q X;  4MZO A;  4P6E A;  2DZZ A;  1PAD A;  2PAD A;  3KWB X;  4CDF B;  2R6N A;  3OF9 A;  2FT2 A;  2FRQ A;  1JQP A;  1K3B B;  1CS8 A;  5JA7 A;  3K9M A;  4BGF A;  3WXG A;  1IWD A;  1PIP A;  2G7Y A;  4BS6 A;  1PXV A;  4GUZ A;  1M6D A;  4FK5 A;  1W4T A;  1U9W A;  1YT7 A;  1HUC B;  1BP4 A;  3N4C A;  4OEL A;  3OVX A;  1VSN A;  3O0U A;  1E2T A;  2NQD B;  1NPZ A;  3B79 A;  3IEJ A;  1CTE A;  3H6S A;  1MEM A;  1PBH A;  6PAD A;  2GHU A;  1POP A;  4AXL A;  3U8E A;  5EGW A;  5JH3 A;  2GFO A;  3P5U A;  1CPJ A;  1AYU A;  3H8C A;  4MSX A;  1YVB A;  4KLB A;  2AUZ A;  4PI3 A;  1GX3 A;  2DJG B;  4AXM A;  2YJC A;  2VHS A;  1NB5 A;  5CHV A;  3IOQ A;  4X6I A;  5FPW A;  2C0Y A;  3M99 A;  4CDC B;  3OVZ A;  4C5P A;  3P5W A;  3MOR A;  3O1G A;  3QJ3 A;  3BCN A;  1QXP A;  1DF0 A;  1NLJ A;  4Q8H A;  2HH5 A;  3RVW A;  3WXF A;  3GCB A;  1F29 A;  2AUX A;  1W6F A;  1KXR A;  2DJF B;  3KWZ A;  1CVZ A;  1ME3 A;  4PAD A;  5EF4 A;  1MS6 A;  4CZW A;  5PAD A;  1AU3 A;  2DC6 A;  2Y6E A;  3P5V A;  2JQF R;  4W5B A;  4Q8G A;  4YYW A;  3MHH A;  1VJV A;  1AU4 A;  1ZIV A;  1NL6 A;  5CHT A;  1GMY A;  2YJB A;  2F1G A;  2ARY A;  1STF E;  1KHP A;  3D9W A;  1AU0 A;  2VHF A;  1ICF A;  1CQD A;  2FRA A;  4K7C A;  4QBB A;  1S4V A;  2G8J A;  1QOL A;  2ACT A;  2R9C A;  3RVV A;  2H7J A;  3LXS A;  3PW3 A;  4QRV A;  4B55 A;  2BSZ A;  2E03 A;  4HWY A;  2VFB A;  1O0E A;  1BY8 A;  2HXZ A;  3IV2 A;  1AIM A;  3K24 A;  2OP3 A;  3WXE A;  4N79 A;  1ATK A;  4I07 A;  4ZUX U;  4W5C A;  2AU1 A;  2DC9 A;  3I06 A;  4CDE B;  3KX1 A;  3QSD A;  3MHS A;  2FTD A;  3ERV A;  2OZ2 A;  1FH0 A;  1SNK A;  2XU5 A;  3E1Z B;  2R9M A;  1CB5 A;  3H7D A;  1KFU L;  4CDD B;  4BQV A;  2DC8 A;  2CB5 A;  5CVN B;  4N4Z A;  4FJC A;  2YJ8 A;  2YJ2 A;  5F02 A;  2IBI A;  1PPD A;  1F2C A;  1PPP A;  2B1N A;  4BS5 A;  4RY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...