1YVBA

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
b'QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
total genus 61
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yvbA00
4CZWA 1BY8A 2XU5A 3C9EA 3USVA 3BPFA 1Y08A 4W4UA 4RY2A 2GHUA 3MHHA 3GCBA 4DMYA 2VHFA 3QSDA 9PAPA 3WXGA 1TL9A 4YYSA 3ERVA 1GECE 2Y5BA 4X6HA 4Q8GA 5CHVA 3RVWA 5J94A 1F2BA 3LXSA 1SNKA 3N3GA 1NB5A 2F7DA 3P5UA 3PBHA 2DC6A 2DZZA 4XUIA 2XU1A 3OVZA 3IHPA 1AIMA 4MZOA 3BOWA 3QJ3A 2DC7A 3RVXA 2YJBA 4AXLA 4DMXA 2CIOA 1CV8A 3O1GA 4W5CA 1EF7A 5CVMA 3H89A 2NQDB 3ZUAA 1EWPA 1XKGA 4YYWA 2G8EA 1KFUL 1YT7A 2HXZA 1AYWA 2E03A 4QRGA 3WXEA 3O0UA 4XR7A 2R9OA 3F5VA 1CVZA 1MEGA 3F75A 3PW3A 3RVVA 1PPPA 1IWDA 2AUZA 2OP3A 2AUXA 3OISA 3PNRA 1FH0A 1EWOA 1NQCA 4WA6A 1PBHA 3I3TA 1U9VA 3WXFA 1YVBA 2AYNA 2B1MA 1ZIVA 2ARYA 2DJFB 4QH6A 3KW9A 4QRVA 4CDDB 2O6XA 2YJ9A 4YYRA 3CH2X 1CPJA 4Q8HA 4YYVA 1MEMA 1CQDA 1GCBA 1SP4B 1ZCMA 3M99A 5FPWA 3BCNA 4PADA 3E1ZB 4PP2E 2R6NA 2HHNA 4KLBA 1AU2A 3H7DA 1KHPA 2PNSA 6PADA 3P5VA 4N8WA 4YV8A 1STFE 1M6DA 1YK7A 2GFOA 1MHWA 2G8JA 2DCBA 2FTDA 4YYUA 3HWNA 1EWLA 4N4ZA 2OULA 2OZ2A 1BP4A 5CVNB 3BWKA 3HD3A 1VSNA 1BGOA 2DCDA 2HD5A 3CBJA 2NQGA 2XU4A 3MTNA 1QOLA 4FJCA 2PADA 2H7JA 4YVAA 1CTEA 1AU4A 3IEJA 4BS6A 7PCKA 1QDQA 2YJCA 4BS5A 2FO5A 1CS8A 1U9QX 1AU0A 3CH3X 5JA7A 3K8UA 1KXRA 2P7UA 4X6IA 5EF4A 2R9FA 4BSQA 2FQ9A 8PCHA 3H8BA 4CDFB 2VHSA 1PIPA 3H8CA 3KWZA 2NQIA 1PPDA 1PE6A 2FRAA 4OELA 4I07A 4CDEB 2PREA 3S3QA 2G6DA 3OF8A 3KKUA 2JQFR 1GLOA 3IMAA 4MSXA 1AYUA 1YALA 3PDFA 1TU6A 1DEUA 4FIPA 1F2CA 2PBHA 4QRXA 1CSBB 1KFXL 4G54A 2DCCA 4I04A 2DZYA 3DF0A 1QXPA 3HHAA 3V6EA 3BC3A 4MZSA 5F02A 2FT2A 2E00A 3H6SA 2R9MA 4I05A 2G7YA 3S3RA 2BDZA 2Y6EA 3V6CA 1KHQA 3IOQA 4FK5A 3BPMA 3D6SA 4QBBA 1YK8A 1MS6A 3U8EA 2R9CA 2B1NA 2FUDA 2C0YA 1NB3A 5K16A 4W5BA 5EGWA 4ZUXU 2F1GA 1MIRA 3TNXA 2P86A 3HHIA 3OVXA 5JH3A 2DC9A 2ATOA 2ACTA 4PI3A 3QT4A 1EWMA 4OEMA 2R9NA 5PADA 1MDWA 3MORA 4HWYA 2HH5A 2WBFX 1PXVA 1Y4HA 3K9MA 5CVOB 1AU3A 4X6JA 1TLOA 3KSEA 1NLJA 4CDCB 4BQVA 1QMYA 2DC8A 4N79A 5A24A 2IPPB 2AIMA 3N3KA 3CBKA 3KWBX 4P6EA 1U9WA 1NPZA 4AXMA 3P5XA 2FRQA 1DF0A 2YJ8A 2BDLA 3I06A 1Q6KA 1O0EA 1VJVA 3NHEA 1NL6A 1HUCB 2YJ2A 3OF9A 2CB5A 1AYVA 2AVWA 1GMYA 2P0RA 2FYEA 3KX1A 1BQIA 2DCAA 1JQPA 3MHSA 3IV2A 2AU1A 1ITOA 4P6GA 2E01A 2E02A 1S4VA 2JQGR 1POPA 3AI8A 2AYOA 1PPOA 1CB5A 3IUTA 4BPVA 2DJGB 3KFQA 5CHTA 1K3BB 1X9YA 1ME4A 2NQAA 2AS8A 1ME3A 1AECA 3N4CA 2IBIA 3B79A 4K7CA 2XU3A 3K24A 1A6RA 1ICFA 1U9XA 1PCIA 1CJLA 3LFYA 4PP1A 1THEA 1F29A 1U5IA 1PPNA 1F2AA 4YYQA 1PADA 3P5WA 1ATKA
chains in the Genus database with same CATH superfamily
4CZWA 3W30A 1BY8A 2XU5A 3C9EA 2HWKA 3USVA 3BPFA 1Y08A 4W4UA 4RY2A 2GHUA 3MHHA 3GCBA 4DMYA 2VHFA 3QSDA 9PAPA 3TRKA 3WXGA 4OVZB 1TL9A 4YYSA 3ERVA 1GECE 2Y5BA 4X6HA 4BOQA 4Q8GA 5CHVA 4ZTBA 3RVWA 5J94A 1F2BA 3LXSA 1SNKA 2FE8A 3N3GA 3PSEA 1NB5A 2F7DA 2BTWA 5EZSA 3P5UA 3PBHA 2DC6A 2DZZA 4XUIA 2XU1A 3OVZA 3IHPA 1AIMA 4MZOA 3BOWA 3QJ3A 2DC7A 3RVXA 2YJBA 4AXLA 4DMXA 2CIOA 1CV8A 3O1GA 4W5CA 1EF7A 4PT5A 3PHXA 5CVMA 3H89A 2NQDB 3ZUAA 1EWPA 1XKGA 4YYWA 2G8EA 3TMPA 1KFUL 1YT7A 2HXZA 1AYWA 2E03A 4QRGA 3WXEA 3O0UA 4XR7A 2R9OA 3F5VA 2BU3A 1CVZA 1MEGA 3F75A 3PW3A 3RVVA 1PPPA 1IWDA 3MJ5A 2AUZA 2OP3A 2AUXA 3OISA 3PNRA 4BOUA 1FH0A 1EWOA 1NQCA 3C0RA 4WA6A 1PBHA 3I3TA 1U9VA 3WXFA 1YVBA 2AYNA 3PT2A 2B1MA 1ZIVA 2ARYA 2DJFB 4QH6A 3KW9A 4D8IA 4QRVA 4CDDB 5KO3A 2O6XA 2YJ9A 4YYRA 3CH2X 1CPJA 2JRIA 4Q8HA 4YYVA 1MEMA 1CQDA 1GCBA 1SP4B 1ZCMA 3M99A 5FPWA 3BCNA 4PADA 3E1ZB 4PP2E 3PHUA 2R6NA 2HHNA 4KLBA 1AU2A 3H7DA 4RF0A 1KHPA 2PNSA 6PADA 4D8EA 3P5VA 4N8WA 4YV8A 1STFE 1M6DA 2JTCA 1YK7A 2GFOA 1MHWA 2G8JA 2DCBA 2FTDA 3B21A 4YYUA 3HWNA 1EWLA 2DOSA 4N4ZA 2OULA 2OZ2A 1BP4A 5CVNB 4R3DA 3BWKA 3HD3A 1VSNA 1BGOA 2DCDA 2HD5A 3CBJA 2NQGA 2XU4A 3MTNA 3OQCA 1QOLA 4FJCA 2PADA 2H7JA 3BBAA 4YVAA 1CTEA 1AU4A 3IEJA 4BS6A 3O65A 1QDQA 7PCKA 2YJCA 4BS5A 2FO5A 3MTVA 1CS8A 2BTWB 2AGAA 1U9QX 1AU0A 3CH3X 5JA7A 3K8UA 1KXRA 2P7UA 4X6IA 5EF4A 2R9FA 4BSQA 2FQ9A 4HXDB 8PCHA 3H8BA 4CDFB 4BOSA 4P16A 2VHSA 5EZQA 1PIPA 3H8CA 3KWZA 5JZEA 2NQIA 4IUMA 2Z84A 1PPDA 1PE6A 4OVZA 2FRAA 4OELA 3PRPA 4I07A 4CDEB 2PREA 3S3QA 2G6DA 3OF8A 3KKUA 4BOZA 3PRMA 2JQFR 1GLOA 3IMAA 4MSXA 1AYUA 1YALA 3PDFA 1TU6A 1DEUA 4FIPA 1F2CA 2PBHA 4QRXA 4REZA 4MI7A 4BOPA 1CSBB 1KFXL 4G54A 2DCCA 4RNAA 4I04A 1PVJA 2DZYA 3DF0A 1QXPA 3BB7A 3HHAA 3V6EA 3BC3A 4MZSA 5F02A 2FT2A 2E00A 3H6SA 2R9MA 4I05A 3RNVA 2G7YA 3S3RA 2BDZA 2Y6EA 3V6CA 1KHQA 3IOQA 4FK5A 3BPMA 3D6SA 4QBBA 1YK8A 1MS6A 3U8EA 2R9CA 2B1NA 5E6JA 2FUDA 4MM3B 2C0YA 1NB3A 5K16A 4W5BA 5EGWA 3BY4A 4WURA 4ZUXU 2J7QA 2UZJA 2F1GA 1MIRA 3TNXA 2P86A 4XZXA 3HHIA 3OVXA 5JH3A 2DC9A 2ATOA 2ACTA 4PI3A 4GUAA 3QT4A 4OEMA 1EWMA 2R9NA 5PADA 3ZNHA 1MDWA 3MORA 4HWYA 2HH5A 2WBFX 1PXVA 1Y4HA 3K9MA 5CVOB 1AU3A 4X6JA 1TLOA 3KSEA 1NLJA 4CDCB 4BQVA 1QMYA 2DC8A 4N79A 5A24A 2IPPB 3MP2A 2AIMA 3N3KA 3CBKA 3KWBX 4P6EA 1U9WA 1NPZA 4AXMA 3P5XA 2FRQA 1DF0A 4A5UA 2YJ8A 2BDLA 3I06A 2J7QC 1Q6KA 1O0EA 1VJVA 3NHEA 1NL6A 1HUCB 2YJ2A 3OF9A 2CB5A 1AYVA 2AVWA 1GMYA 2P0RA 2FYEA 3KX1A 4OW0A 1BQIA 3IFUA 2DCAA 1JQPA 3MHSA 1YZBA 3IV2A 2AU1A 1ITOA 3E9SA 4P6GA 2E01A 2E02A 1S4VA 4RF1A 1UKFA 1POPA 2JQGR 3AI8A 2AYOA 4D8BA 1PPOA 1CB5A 3IUTA 4BPVA 2DJGB 3KFQA 5CHTA 4IP3A 1K3BB 1X9YA 1ME4A 2NQAA 2AS8A 1ME3A 1AECA 3N4CA 2IBIA 3B79A 3W31A 4K7CA 2XU3A 3K24A 3PHWA 1A6RA 1ICFA 1U9XA 1PCIA 1CJLA 3LFYA 4M0WA 4PP1A 1DKIA 1THEA 1F29A 4RKXA 1U5IA 1PPNA 1F2AA 4YYQA 1PADA 3P5WA 1ATKA
chains in the Genus database with same CATH topology
4CZWA 1BY8A 2XU5A 3C9EA 3USVA 3BPFA 1Y08A 4W4UA 4RY2A 2GHUA 3MHHA 3GCBA 4DMYA 2VHFA 3QSDA 9PAPA 3WXGA 1TL9A 4YYSA 3ERVA 1GECE 2Y5BA 4X6HA 4Q8GA 1E2TA 5CHVA 3RVWA 5J94A 1F2BA 3LXSA 1SNKA 2VFCA 3N3GA 4GUZA 1NB5A 2F7DA 3P5UA 3PBHA 2DC6A 2DZZA 4XUIA 2XU1A 3OVZA 3IHPA 1AIMA 4MZOA 3BOWA 3QJ3A 2DC7A 3RVXA 2YJBA 4AXLA 4DMXA 2CIOA 4W5CA 1CV8A 3O1GA 1EF7A 1W4TA 4B55A 5CVMA 3H89A 2NQDB 3ZUAA 1EWPA 1XKGA 4YYWA 2G8EA 1KFUL 1YT7A 2HXZA 1AYWA 2E03A 4QRGA 3WXEA 3O0UA 4XR7A 2R9OA 3F5VA 1CVZA 1MEGA 3F75A 3PW3A 3RVVA 1PPPA 1IWDA 2AUZA 2OP3A 2AUXA 3OISA 3PNRA 1FH0A 1EWOA 1NQCA 4C5PA 4WA6A 1PBHA 3I3TA 1U9VA 3WXFA 1YVBA 2AYNA 2B1MA 1ZIVA 2ARYA 2DJFB 4QH6A 3KW9A 4QRVA 4CDDB 2O6XA 2YJ9A 4YYRA 3CH2X 1CPJA 4Q8HA 4YYVA 1MEMA 1CQDA 1GCBA 1SP4B 1ZCMA 3M99A 5FPWA 3BCNA 4PADA 3E1ZB 4PP2E 2R6NA 2HHNA 4KLBA 1AU2A 3H7DA 1KHPA 2PNSA 6PADA 3P5VA 4N8WA 4YV8A 1STFE 1M6DA 1YK7A 2GFOA 1MHWA 2G8JA 2BSZA 2DCBA 2FTDA 4YYUA 3HWNA 1EWLA 4N4ZA 2OULA 2OZ2A 1BP4A 5CVNB 3BWKA 3HD3A 1VSNA 1BGOA 2DCDA 2HD5A 3CBJA 2NQGA 2XU4A 3MTNA 1QOLA 4FJCA 2PADA 2H7JA 4YVAA 1CTEA 1W6FA 1AU4A 3IEJA 4BS6A 7PCKA 1QDQA 2YJCA 4BS5A 2FO5A 4NV7A 1CS8A 1U9QX 1AU0A 3CH3X 5JA7A 3K8UA 1KXRA 2P7UA 4X6IA 5EF4A 2R9FA 4BSQA 2FQ9A 8PCHA 3H8BA 4CDFB 3LTWA 2VHSA 1PIPA 3H8CA 3KWZA 2NQIA 1PPDA 1PE6A 2FRAA 4OELA 4I07A 4CDEB 2PREA 4NV8A 3S3QA 2G6DA 3OF8A 3KKUA 2JQFR 1GLOA 3IMAA 4MSXA 1AYUA 1YALA 3PDFA 1TU6A 1DEUA 4FIPA 1F2CA 2PBHA 4QRXA 1CSBB 1KFXL 4G54A 2DCCA 4I04A 2DZYA 3DF0A 1QXPA 3HHAA 3V6EA 3BC3A 4MZSA 5F02A 2FT2A 2E00A 3H6SA 2R9MA 4I05A 2G7YA 3S3RA 2BDZA 2Y6EA 3V6CA 1KHQA 3IOQA 4FK5A 3BPMA 3D6SA 4QBBA 1YK8A 1MS6A 3U8EA 2R9CA 2B1NA 2FUDA 2C0YA 1NB3A 5K16A 4W5BA 5EGWA 4ZUXU 2F1GA 1MIRA 3TNXA 2P86A 3HHIA 3OVXA 5JH3A 2DC9A 2ATOA 2ACTA 4PI3A 3QT4A 1EWMA 4OEMA 2R9NA 5PADA 1MDWA 3MORA 4HWYA 2HH5A 2WBFX 1PXVA 1Y4HA 3K9MA 5CVOB 1AU3A 4X6JA 1TLOA 3KSEA 1NLJA 4CDCB 4BQVA 1QMYA 2DC8A 4N79A 5A24A 2IPPB 2AIMA 3N3KA 3CBKA 3KWBX 4P6EA 1U9WA 1NPZA 4AXMA 3D9WA 3P5XA 2FRQA 1DF0A 2YJ8A 2BDLA 3I06A 1Q6KA 1O0EA 1VJVA 3NHEA 1NL6A 1HUCB 2YJ2A 3OF9A 2CB5A 1AYVA 2AVWA 1GMYA 2P0RA 2FYEA 3KX1A 1BQIA 2DCAA 1JQPA 3MHSA 3IV2A 2AU1A 1ITOA 4P6GA 2E01A 2E02A 1GX3A 1S4VA 2JQGR 1POPA 3AI8A 2AYOA 1PPOA 1CB5A 3IUTA 1W5RA 4BPVA 2DJGB 2VFBA 3KFQA 5CHTA 1K3BB 1X9YA 4BGFA 1ME4A 2NQAA 2AS8A 1ME3A 1AECA 3N4CA 2IBIA 3B79A 4K7CA 2XU3A 3K24A 1A6RA 1ICFA 1U9XA 1PCIA 1CJLA 3LFYA 4PP1A 1THEA 1F29A 1U5IA 1PPNA 1F2AA 4YYQA 1PADA 3P5WA 1ATKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZW A;  1BY8 A;  2XU5 A;  3C9E A;  3USV A;  3BPF A;  1Y08 A;  4W4U A;  4RY2 A;  2GHU A;  3MHH A;  3GCB A;  4DMY A;  2VHF A;  3QSD A;  9PAP A;  3WXG A;  1TL9 A;  4YYS A;  3ERV A;  1GEC E;  2Y5B A;  4X6H A;  4Q8G A;  5CHV A;  3RVW A;  5J94 A;  1F2B A;  3LXS A;  1SNK A;  3N3G A;  1NB5 A;  2F7D A;  3P5U A;  3PBH A;  2DC6 A;  2DZZ A;  4XUI A;  2XU1 A;  3OVZ A;  3IHP A;  1AIM A;  4MZO A;  3BOW A;  3QJ3 A;  2DC7 A;  3RVX A;  2YJB A;  4AXL A;  4DMX A;  2CIO A;  1CV8 A;  3O1G A;  4W5C A;  1EF7 A;  5CVM A;  3H89 A;  2NQD B;  3ZUA A;  1EWP A;  1XKG A;  4YYW A;  2G8E A;  1KFU L;  1YT7 A;  2HXZ A;  1AYW A;  2E03 A;  4QRG A;  3WXE A;  3O0U A;  4XR7 A;  2R9O A;  3F5V A;  1CVZ A;  1MEG A;  3F75 A;  3PW3 A;  3RVV A;  1PPP A;  1IWD A;  2AUZ A;  2OP3 A;  2AUX A;  3OIS A;  3PNR A;  1FH0 A;  1EWO A;  1NQC A;  4WA6 A;  1PBH A;  3I3T A;  1U9V A;  3WXF A;  1YVB A;  2AYN A;  2B1M A;  1ZIV A;  2ARY A;  2DJF B;  4QH6 A;  3KW9 A;  4QRV A;  4CDD B;  2O6X A;  2YJ9 A;  4YYR A;  3CH2 X;  1CPJ A;  4Q8H A;  4YYV A;  1MEM A;  1CQD A;  1GCB A;  1SP4 B;  1ZCM A;  3M99 A;  5FPW A;  3BCN A;  4PAD A;  3E1Z B;  4PP2 E;  2R6N A;  2HHN A;  4KLB A;  1AU2 A;  3H7D A;  1KHP A;  2PNS A;  6PAD A;  3P5V A;  4N8W A;  4YV8 A;  1STF E;  1M6D A;  1YK7 A;  2GFO A;  1MHW A;  2G8J A;  2DCB A;  2FTD A;  4YYU A;  3HWN A;  1EWL A;  4N4Z A;  2OUL A;  2OZ2 A;  1BP4 A;  5CVN B;  3BWK A;  3HD3 A;  1VSN A;  1BGO A;  2DCD A;  2HD5 A;  3CBJ A;  2NQG A;  2XU4 A;  3MTN A;  1QOL A;  4FJC A;  2PAD A;  2H7J A;  4YVA A;  1CTE A;  1AU4 A;  3IEJ A;  4BS6 A;  7PCK A;  1QDQ A;  2YJC A;  4BS5 A;  2FO5 A;  1CS8 A;  1U9Q X;  1AU0 A;  3CH3 X;  5JA7 A;  3K8U A;  1KXR A;  2P7U A;  4X6I A;  5EF4 A;  2R9F A;  4BSQ A;  2FQ9 A;  8PCH A;  3H8B A;  4CDF B;  2VHS A;  1PIP A;  3H8C A;  3KWZ A;  2NQI A;  1PPD A;  1PE6 A;  2FRA A;  4OEL A;  4I07 A;  4CDE B;  2PRE A;  3S3Q A;  2G6D A;  3OF8 A;  3KKU A;  2JQF R;  1GLO A;  3IMA A;  4MSX A;  1AYU A;  1YAL A;  3PDF A;  1TU6 A;  1DEU A;  4FIP A;  1F2C A;  2PBH A;  4QRX A;  1CSB B;  1KFX L;  4G54 A;  2DCC A;  4I04 A;  2DZY A;  3DF0 A;  1QXP A;  3HHA A;  3V6E A;  3BC3 A;  4MZS A;  5F02 A;  2FT2 A;  2E00 A;  3H6S A;  2R9M A;  4I05 A;  2G7Y A;  3S3R A;  2BDZ A;  2Y6E A;  3V6C A;  1KHQ A;  3IOQ A;  4FK5 A;  3BPM A;  3D6S A;  4QBB A;  1YK8 A;  1MS6 A;  3U8E A;  2R9C A;  2B1N A;  2FUD A;  2C0Y A;  1NB3 A;  5K16 A;  4W5B A;  5EGW A;  4ZUX U;  2F1G A;  1MIR A;  3TNX A;  2P86 A;  3HHI A;  3OVX A;  5JH3 A;  2DC9 A;  2ATO A;  2ACT A;  4PI3 A;  3QT4 A;  1EWM A;  4OEM A;  2R9N A;  5PAD A;  1MDW A;  3MOR A;  4HWY A;  2HH5 A;  2WBF X;  1PXV A;  1Y4H A;  3K9M A;  5CVO B;  1AU3 A;  4X6J A;  1TLO A;  3KSE A;  1NLJ A;  4CDC B;  4BQV A;  1QMY A;  2DC8 A;  4N79 A;  5A24 A;  2IPP B;  2AIM A;  3N3K A;  3CBK A;  3KWB X;  4P6E A;  1U9W A;  1NPZ A;  4AXM A;  3P5X A;  2FRQ A;  1DF0 A;  2YJ8 A;  2BDL A;  3I06 A;  1Q6K A;  1O0E A;  1VJV A;  3NHE A;  1NL6 A;  1HUC B;  2YJ2 A;  3OF9 A;  2CB5 A;  1AYV A;  2AVW A;  1GMY A;  2P0R A;  2FYE A;  3KX1 A;  1BQI A;  2DCA A;  1JQP A;  3MHS A;  3IV2 A;  2AU1 A;  1ITO A;  4P6G A;  2E01 A;  2E02 A;  1S4V A;  2JQG R;  1POP A;  3AI8 A;  2AYO A;  1PPO A;  1CB5 A;  3IUT A;  4BPV A;  2DJG B;  3KFQ A;  5CHT A;  1K3B B;  1X9Y A;  1ME4 A;  2NQA A;  2AS8 A;  1ME3 A;  1AEC A;  3N4C A;  2IBI A;  3B79 A;  4K7C A;  2XU3 A;  3K24 A;  1A6R A;  1ICF A;  1U9X A;  1PCI A;  1CJL A;  3LFY A;  4PP1 A;  1THE A;  1F29 A;  1U5I A;  1PPN A;  1F2A A;  4YYQ A;  1PAD A;  3P5W A;  1ATK A; 
#chains in the Genus database with same CATH topology
 4CZW A;  3W30 A;  1BY8 A;  2XU5 A;  3C9E A;  2HWK A;  3USV A;  3BPF A;  1Y08 A;  4W4U A;  4RY2 A;  2GHU A;  3MHH A;  3GCB A;  4DMY A;  2VHF A;  3QSD A;  9PAP A;  3TRK A;  3WXG A;  4OVZ B;  1TL9 A;  4YYS A;  3ERV A;  1GEC E;  2Y5B A;  4X6H A;  4BOQ A;  4Q8G A;  5CHV A;  4ZTB A;  3RVW A;  5J94 A;  1F2B A;  3LXS A;  1SNK A;  2FE8 A;  3N3G A;  3PSE A;  1NB5 A;  2F7D A;  2BTW A;  5EZS A;  3P5U A;  3PBH A;  2DC6 A;  2DZZ A;  4XUI A;  2XU1 A;  3OVZ A;  3IHP A;  1AIM A;  4MZO A;  3BOW A;  3QJ3 A;  2DC7 A;  3RVX A;  2YJB A;  4AXL A;  4DMX A;  2CIO A;  1CV8 A;  3O1G A;  4W5C A;  1EF7 A;  4PT5 A;  3PHX A;  5CVM A;  3H89 A;  2NQD B;  3ZUA A;  1EWP A;  1XKG A;  4YYW A;  2G8E A;  3TMP A;  1KFU L;  1YT7 A;  2HXZ A;  1AYW A;  2E03 A;  4QRG A;  3WXE A;  3O0U A;  4XR7 A;  2R9O A;  3F5V A;  2BU3 A;  1CVZ A;  1MEG A;  3F75 A;  3PW3 A;  3RVV A;  1PPP A;  1IWD A;  3MJ5 A;  2AUZ A;  2OP3 A;  2AUX A;  3OIS A;  3PNR A;  4BOU A;  1FH0 A;  1EWO A;  1NQC A;  3C0R A;  4WA6 A;  1PBH A;  3I3T A;  1U9V A;  3WXF A;  1YVB A;  2AYN A;  3PT2 A;  2B1M A;  1ZIV A;  2ARY A;  2DJF B;  4QH6 A;  3KW9 A;  4D8I A;  4QRV A;  4CDD B;  5KO3 A;  2O6X A;  2YJ9 A;  4YYR A;  3CH2 X;  1CPJ A;  2JRI A;  4Q8H A;  4YYV A;  1MEM A;  1CQD A;  1GCB A;  1SP4 B;  1ZCM A;  3M99 A;  5FPW A;  3BCN A;  4PAD A;  3E1Z B;  4PP2 E;  3PHU A;  2R6N A;  2HHN A;  4KLB A;  1AU2 A;  3H7D A;  4RF0 A;  1KHP A;  2PNS A;  6PAD A;  4D8E A;  3P5V A;  4N8W A;  4YV8 A;  1STF E;  1M6D A;  2JTC A;  1YK7 A;  2GFO A;  1MHW A;  2G8J A;  2DCB A;  2FTD A;  3B21 A;  4YYU A;  3HWN A;  1EWL A;  2DOS A;  4N4Z A;  2OUL A;  2OZ2 A;  1BP4 A;  5CVN B;  4R3D A;  3BWK A;  3HD3 A;  1VSN A;  1BGO A;  2DCD A;  2HD5 A;  3CBJ A;  2NQG A;  2XU4 A;  3MTN A;  3OQC A;  1QOL A;  4FJC A;  2PAD A;  2H7J A;  3BBA A;  4YVA A;  1CTE A;  1AU4 A;  3IEJ A;  4BS6 A;  3O65 A;  1QDQ A;  7PCK A;  2YJC A;  4BS5 A;  2FO5 A;  3MTV A;  1CS8 A;  2BTW B;  2AGA A;  1U9Q X;  1AU0 A;  3CH3 X;  5JA7 A;  3K8U A;  1KXR A;  2P7U A;  4X6I A;  5EF4 A;  2R9F A;  4BSQ A;  2FQ9 A;  4HXD B;  8PCH A;  3H8B A;  4CDF B;  4BOS A;  4P16 A;  2VHS A;  5EZQ A;  1PIP A;  3H8C A;  3KWZ A;  5JZE A;  2NQI A;  4IUM A;  2Z84 A;  1PPD A;  1PE6 A;  4OVZ A;  2FRA A;  4OEL A;  3PRP A;  4I07 A;  4CDE B;  2PRE A;  3S3Q A;  2G6D A;  3OF8 A;  3KKU A;  4BOZ A;  3PRM A;  2JQF R;  1GLO A;  3IMA A;  4MSX A;  1AYU A;  1YAL A;  3PDF A;  1TU6 A;  1DEU A;  4FIP A;  1F2C A;  2PBH A;  4QRX A;  4REZ A;  4MI7 A;  4BOP A;  1CSB B;  1KFX L;  4G54 A;  2DCC A;  4RNA A;  4I04 A;  1PVJ A;  2DZY A;  3DF0 A;  1QXP A;  3BB7 A;  3HHA A;  3V6E A;  3BC3 A;  4MZS A;  5F02 A;  2FT2 A;  2E00 A;  3H6S A;  2R9M A;  4I05 A;  3RNV A;  2G7Y A;  3S3R A;  2BDZ A;  2Y6E A;  3V6C A;  1KHQ A;  3IOQ A;  4FK5 A;  3BPM A;  3D6S A;  4QBB A;  1YK8 A;  1MS6 A;  3U8E A;  2R9C A;  2B1N A;  5E6J A;  2FUD A;  4MM3 B;  2C0Y A;  1NB3 A;  5K16 A;  4W5B A;  5EGW A;  3BY4 A;  4WUR A;  4ZUX U;  2J7Q A;  2UZJ A;  2F1G A;  1MIR A;  3TNX A;  2P86 A;  4XZX A;  3HHI A;  3OVX A;  5JH3 A;  2DC9 A;  2ATO A;  2ACT A;  4PI3 A;  4GUA A;  3QT4 A;  4OEM A;  1EWM A;  2R9N A;  5PAD A;  3ZNH A;  1MDW A;  3MOR A;  4HWY A;  2HH5 A;  2WBF X;  1PXV A;  1Y4H A;  3K9M A;  5CVO B;  1AU3 A;  4X6J A;  1TLO A;  3KSE A;  1NLJ A;  4CDC B;  4BQV A;  1QMY A;  2DC8 A;  4N79 A;  5A24 A;  2IPP B;  3MP2 A;  2AIM A;  3N3K A;  3CBK A;  3KWB X;  4P6E A;  1U9W A;  1NPZ A;  4AXM A;  3P5X A;  2FRQ A;  1DF0 A;  4A5U A;  2YJ8 A;  2BDL A;  3I06 A;  2J7Q C;  1Q6K A;  1O0E A;  1VJV A;  3NHE A;  1NL6 A;  1HUC B;  2YJ2 A;  3OF9 A;  2CB5 A;  1AYV A;  2AVW A;  1GMY A;  2P0R A;  2FYE A;  3KX1 A;  4OW0 A;  1BQI A;  3IFU A;  2DCA A;  1JQP A;  3MHS A;  1YZB A;  3IV2 A;  2AU1 A;  1ITO A;  3E9S A;  4P6G A;  2E01 A;  2E02 A;  1S4V A;  4RF1 A;  1UKF A;  1POP A;  2JQG R;  3AI8 A;  2AYO A;  4D8B A;  1PPO A;  1CB5 A;  3IUT A;  4BPV A;  2DJG B;  3KFQ A;  5CHT A;  4IP3 A;  1K3B B;  1X9Y A;  1ME4 A;  2NQA A;  2AS8 A;  1ME3 A;  1AEC A;  3N4C A;  2IBI A;  3B79 A;  3W31 A;  4K7C A;  2XU3 A;  3K24 A;  3PHW A;  1A6R A;  1ICF A;  1U9X A;  1PCI A;  1CJL A;  3LFY A;  4M0W A;  4PP1 A;  1DKI A;  1THE A;  1F29 A;  4RKX A;  1U5I A;  1PPN A;  1F2A A;  4YYQ A;  1PAD A;  3P5W A;  1ATK A; 
#chains in the Genus database with same CATH homology
 4CZW A;  1BY8 A;  2XU5 A;  3C9E A;  3USV A;  3BPF A;  1Y08 A;  4W4U A;  4RY2 A;  2GHU A;  3MHH A;  3GCB A;  4DMY A;  2VHF A;  3QSD A;  9PAP A;  3WXG A;  1TL9 A;  4YYS A;  3ERV A;  1GEC E;  2Y5B A;  4X6H A;  4Q8G A;  1E2T A;  5CHV A;  3RVW A;  5J94 A;  1F2B A;  3LXS A;  1SNK A;  2VFC A;  3N3G A;  4GUZ A;  1NB5 A;  2F7D A;  3P5U A;  3PBH A;  2DC6 A;  2DZZ A;  4XUI A;  2XU1 A;  3OVZ A;  3IHP A;  1AIM A;  4MZO A;  3BOW A;  3QJ3 A;  2DC7 A;  3RVX A;  2YJB A;  4AXL A;  4DMX A;  2CIO A;  4W5C A;  1CV8 A;  3O1G A;  1EF7 A;  1W4T A;  4B55 A;  5CVM A;  3H89 A;  2NQD B;  3ZUA A;  1EWP A;  1XKG A;  4YYW A;  2G8E A;  1KFU L;  1YT7 A;  2HXZ A;  1AYW A;  2E03 A;  4QRG A;  3WXE A;  3O0U A;  4XR7 A;  2R9O A;  3F5V A;  1CVZ A;  1MEG A;  3F75 A;  3PW3 A;  3RVV A;  1PPP A;  1IWD A;  2AUZ A;  2OP3 A;  2AUX A;  3OIS A;  3PNR A;  1FH0 A;  1EWO A;  1NQC A;  4C5P A;  4WA6 A;  1PBH A;  3I3T A;  1U9V A;  3WXF A;  1YVB A;  2AYN A;  2B1M A;  1ZIV A;  2ARY A;  2DJF B;  4QH6 A;  3KW9 A;  4QRV A;  4CDD B;  2O6X A;  2YJ9 A;  4YYR A;  3CH2 X;  1CPJ A;  4Q8H A;  4YYV A;  1MEM A;  1CQD A;  1GCB A;  1SP4 B;  1ZCM A;  3M99 A;  5FPW A;  3BCN A;  4PAD A;  3E1Z B;  4PP2 E;  2R6N A;  2HHN A;  4KLB A;  1AU2 A;  3H7D A;  1KHP A;  2PNS A;  6PAD A;  3P5V A;  4N8W A;  4YV8 A;  1STF E;  1M6D A;  1YK7 A;  2GFO A;  1MHW A;  2G8J A;  2BSZ A;  2DCB A;  2FTD A;  4YYU A;  3HWN A;  1EWL A;  4N4Z A;  2OUL A;  2OZ2 A;  1BP4 A;  5CVN B;  3BWK A;  3HD3 A;  1VSN A;  1BGO A;  2DCD A;  2HD5 A;  3CBJ A;  2NQG A;  2XU4 A;  3MTN A;  1QOL A;  4FJC A;  2PAD A;  2H7J A;  4YVA A;  1CTE A;  1W6F A;  1AU4 A;  3IEJ A;  4BS6 A;  7PCK A;  1QDQ A;  2YJC A;  4BS5 A;  2FO5 A;  4NV7 A;  1CS8 A;  1U9Q X;  1AU0 A;  3CH3 X;  5JA7 A;  3K8U A;  1KXR A;  2P7U A;  4X6I A;  5EF4 A;  2R9F A;  4BSQ A;  2FQ9 A;  8PCH A;  3H8B A;  4CDF B;  3LTW A;  2VHS A;  1PIP A;  3H8C A;  3KWZ A;  2NQI A;  1PPD A;  1PE6 A;  2FRA A;  4OEL A;  4I07 A;  4CDE B;  2PRE A;  4NV8 A;  3S3Q A;  2G6D A;  3OF8 A;  3KKU A;  2JQF R;  1GLO A;  3IMA A;  4MSX A;  1AYU A;  1YAL A;  3PDF A;  1TU6 A;  1DEU A;  4FIP A;  1F2C A;  2PBH A;  4QRX A;  1CSB B;  1KFX L;  4G54 A;  2DCC A;  4I04 A;  2DZY A;  3DF0 A;  1QXP A;  3HHA A;  3V6E A;  3BC3 A;  4MZS A;  5F02 A;  2FT2 A;  2E00 A;  3H6S A;  2R9M A;  4I05 A;  2G7Y A;  3S3R A;  2BDZ A;  2Y6E A;  3V6C A;  1KHQ A;  3IOQ A;  4FK5 A;  3BPM A;  3D6S A;  4QBB A;  1YK8 A;  1MS6 A;  3U8E A;  2R9C A;  2B1N A;  2FUD A;  2C0Y A;  1NB3 A;  5K16 A;  4W5B A;  5EGW A;  4ZUX U;  2F1G A;  1MIR A;  3TNX A;  2P86 A;  3HHI A;  3OVX A;  5JH3 A;  2DC9 A;  2ATO A;  2ACT A;  4PI3 A;  3QT4 A;  1EWM A;  4OEM A;  2R9N A;  5PAD A;  1MDW A;  3MOR A;  4HWY A;  2HH5 A;  2WBF X;  1PXV A;  1Y4H A;  3K9M A;  5CVO B;  1AU3 A;  4X6J A;  1TLO A;  3KSE A;  1NLJ A;  4CDC B;  4BQV A;  1QMY A;  2DC8 A;  4N79 A;  5A24 A;  2IPP B;  2AIM A;  3N3K A;  3CBK A;  3KWB X;  4P6E A;  1U9W A;  1NPZ A;  4AXM A;  3D9W A;  3P5X A;  2FRQ A;  1DF0 A;  2YJ8 A;  2BDL A;  3I06 A;  1Q6K A;  1O0E A;  1VJV A;  3NHE A;  1NL6 A;  1HUC B;  2YJ2 A;  3OF9 A;  2CB5 A;  1AYV A;  2AVW A;  1GMY A;  2P0R A;  2FYE A;  3KX1 A;  1BQI A;  2DCA A;  1JQP A;  3MHS A;  3IV2 A;  2AU1 A;  1ITO A;  4P6G A;  2E01 A;  2E02 A;  1GX3 A;  1S4V A;  2JQG R;  1POP A;  3AI8 A;  2AYO A;  1PPO A;  1CB5 A;  3IUT A;  1W5R A;  4BPV A;  2DJG B;  2VFB A;  3KFQ A;  5CHT A;  1K3B B;  1X9Y A;  4BGF A;  1ME4 A;  2NQA A;  2AS8 A;  1ME3 A;  1AEC A;  3N4C A;  2IBI A;  3B79 A;  4K7C A;  2XU3 A;  3K24 A;  1A6R A;  1ICF A;  1U9X A;  1PCI A;  1CJL A;  3LFY A;  4PP1 A;  1THE A;  1F29 A;  1U5I A;  1PPN A;  1F2A A;  4YYQ A;  1PAD A;  3P5W A;  1ATK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...