1YVBA

The plasmodium falciparum cysteine protease falcipain-2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
b'QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords falcipain 2
publication title Structural basis for unique mechanisms of folding and hemoglobin binding by a malarial protease.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 61
structure length 241
sequence length 241
ec nomenclature ec 3.4.22.-:
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1yvbA00
1BGOA 4YV8A 3I3TA 2R9MA 4HWYA 2DCCA 3P5UA 3OVXA 4FK5A 1PADA 1AYUA 4QRVA 1M6DA 1CB5A 3P5VA 3S3QA 4BS6A 1EWLA 1PPOA 1NPZA 3RVWA 3V6EA 2P86A 3E1ZB 4BS5A 4QRGA 4K7CA 3BPFA 1ITOA 3F5VA 1EF7A 4DMYA 3MHHA 3BPMA 2F1GA 1DF0A 3IV2A 3USVA 3WXFA 2Y5BA 2WBFX 3IMAA 3CBKA 3IUTA 2NQAA 3IEJA 1MEGA 1PIPA 2FUDA 4I07A 4YYSA 1ME3A 1MIRA 1QDQA 2YJ2A 4YVAA 3QT4A 3CH2X 3OVZA 1JQPA 2XU5A 4BPVA 2DZYA 4CDCB 2HD5A 1AIMA 2G8JA 4CZWA 2DZZA 2G7YA 1YVBA 4QRXA 4W5BA 4PI3A 2AYNA 3PDFA 2P0RA 3QJ3A 2PNSA 1CS8A 2DC8A 4I04A 2IBIA 2FO5A 3IOQA 2FTDA 1IWDA 4RY2A 5A24A 7PCKA 4ZUXU 3K24A 2P7UA 1O0EA 1PPDA 1ZCMA 2F7DA 1TLOA 1S4VA 3BWKA 3QSDA 5F02A 5PADA 6PADA 1U5IA 3HHIA 4QH6A 1PBHA 3OISA 2AIMA 1MS6A 4XUIA 3P5XA 2JQFR 3KWBX 4P6GA 1A6RA 3KKUA 2R6NA 1K3BB 1MHWA 1PPPA 1CSBB 4X6JA 2YJCA 9PAPA 1QMYA 1AU3A 1QXPA 2NQIA 3S3RA 2DJFB 2C0YA 3OF9A 2PADA 4YYVA 1BQIA 1MEMA 3LXSA 3NHEA 2R9CA 3OF8A 1ZIVA 4YYWA 3U8EA 3MORA 1GMYA 4CDEB 3H7DA 3D6SA 2HXZA 3KFQA 1HUCB 4PADA 2R9FA 3PW3A 1F29A 3TNXA 2R9NA 2FT2A 5K16A 2H7JA 4X6HA 1POPA 1CVZA 4N8WA 1GCBA 2HHNA 5CVNB 3RVVA 3KW9A 2VHSA 2CIOA 3PNRA 1DEUA 3CH3X 2FYEA 2G6DA 5EF4A 3KSEA 1NLJA 4KLBA 3ERVA 3LFYA 2DJGB 2BDLA 2YJ9A 1YK8A 1STFE 2YJ8A 3CBJA 4FJCA 2Y6EA 4OELA 2R9OA 2OZ2A 1YK7A 2E02A 4Q8GA 2AUXA 2ATOA 2B1NA 1SNKA 1EWPA 1AU0A 1KHQA 2DC6A 3BOWA 2B1MA 3N3KA 5EGWA 3F75A 3BCNA 1ATKA 1AU4A 2OULA 2PREA 1KFUL 1ME4A 5CHVA 3M99A 1AYVA 4G54A 3V6CA 1NQCA 5FPWA 4CDFB 2AU1A 4X6IA 1EWMA 4N4ZA 2DC7A 4YYQA 4PP1A 3P5WA 4DMXA 3PBHA 1XKGA 4PP2E 4QBBA 3WXGA 3GCBA 2AVWA 4BSQA 2AYOA 3MHSA 4YYUA 2G8EA 2YJBA 4W4UA 1ICFA 2XU4A 3H89A 1U9QX 3K9MA 4XR7A 3HHAA 4P6EA 3N3GA 1YALA 2NQDB 2E03A 3H6SA 1F2CA 4YYRA 2FQ9A 1TU6A 1AYWA 3I06A 2ACTA 1PE6A 4W5CA 4WA6A 1CQDA 4Q8HA 4I05A 3B79A 1YT7A 1NB3A 1QOLA 1SP4B 2FRQA 1U9VA 4N79A 1CTEA 5JH3A 2E00A 1AECA 2VHFA 4CDDB 3ZUAA 1GLOA 2XU1A 1KXRA 3BC3A 1PPNA 8PCHA 5CVMA 1U9WA 5J94A 1X9YA 1FH0A 1KHPA 2PBHA 4FIPA 1AU2A 2DCDA 1KFXL 2CB5A 2E01A 4OEMA 1PXVA 1EWOA 2IPPB 4MZOA 3HD3A 2AS8A 1TL9A 5CHTA 2GHUA 2FRAA 1F2AA 2XU3A 3HWNA 3N4CA 2JQGR 4BQVA 1Y4HA 1PCIA 2BDZA 1VJVA 2DCBA 2ARYA 5CVOB 3O1GA 4AXLA 3AI8A 2OP3A 2GFOA 1MDWA 1U9XA 4MSXA 3MTNA 2DCAA 3O0UA 1NL6A 3IHPA 2NQGA 3H8BA 3H8CA 5JA7A 2DC9A 3K8UA 3KWZA 1F2BA 3C9EA 4AXMA 4MZSA 1BY8A 1Y08A 3DF0A 1CJLA 1BP4A 3KX1A 1VSNA 2O6XA 2HH5A 1NB5A 1Q6KA 1GECE 3RVXA 1CPJA 2AUZA 1CV8A 3WXEA 1THEA
chains in the Genus database with same CATH superfamily
1BGOA 4YV8A 3I3TA 2R9MA 4HWYA 2DCCA 3P5UA 3O65A 3BY4A 3OVXA 4FK5A 1PADA 1AYUA 4QRVA 1M6DA 1CB5A 3P5VA 3S3QA 4MI7A 4BS6A 1EWLA 1PPOA 1NPZA 3RVWA 3V6EA 2P86A 3E1ZB 3PHXA 4BS5A 4QRGA 4K7CA 3BPFA 1ITOA 3F5VA 4D8BA 1EF7A 4DMYA 3MHHA 3TRKA 3BPMA 2F1GA 1DF0A 3IV2A 3USVA 3WXFA 2BU3A 2Y5BA 2WBFX 3IMAA 3CBKA 3IUTA 2NQAA 3IEJA 1MEGA 1PIPA 2FUDA 4I07A 4YYSA 1ME3A 1MIRA 1QDQA 2YJ2A 4YVAA 3QT4A 3CH2X 3OVZA 1JQPA 3PHWA 2XU5A 4BPVA 2DZYA 4CDCB 4OVZA 3C0RA 4BOSA 2HD5A 1AIMA 2FE8A 4RNAA 3W31A 2G8JA 4RKXA 4CZWA 2DZZA 2G7YA 4WURA 1YVBA 4QRXA 4W5BA 4PI3A 2AYNA 4ZTBA 3B21A 3PDFA 2P0RA 3QJ3A 2J7QC 2PNSA 1CS8A 2DC8A 4I04A 3E9SA 2IBIA 2FO5A 3ZNHA 3IOQA 3PT2A 2FTDA 1IWDA 3PRPA 4RY2A 5A24A 7PCKA 4ZUXU 4OVZB 4BOUA 3K24A 2P7UA 1O0EA 1PPDA 3W30A 1ZCMA 2F7DA 2BTWB 1TLOA 1S4VA 3BWKA 3QSDA 1UKFA 5F02A 5PADA 6PADA 4A5UA 1U5IA 3HHIA 4QH6A 5E6JA 1PBHA 3OISA 2AIMA 1MS6A 4XUIA 3P5XA 2JQFR 2DOSA 3KWBX 4P6GA 3MJ5A 2J7QA 4D8IA 1A6RA 3KKUA 2R6NA 1K3BB 3OQCA 1MHWA 1PPPA 1CSBB 4X6JA 2AGAA 2YJCA 9PAPA 1QMYA 1AU3A 1QXPA 2NQIA 3S3RA 2DJFB 2C0YA 3OF9A 2PADA 4YYVA 1BQIA 1MEMA 3LXSA 3NHEA 4R3DA 2R9CA 4BOQA 3OF8A 1ZIVA 4YYWA 3IFUA 3U8EA 3MORA 1GMYA 4CDEB 4REZA 3H7DA 3D6SA 2HXZA 3KFQA 1HUCB 4PADA 2R9FA 3PW3A 1F29A 3TNXA 2R9NA 1YZBA 2FT2A 3MTVA 2H7JA 5K16A 4X6HA 1POPA 5KO3A 1CVZA 4GUAA 4N8WA 1GCBA 3PSEA 2HHNA 5CVNB 3RVVA 3KW9A 2VHSA 4BOPA 2CIOA 3PNRA 1DEUA 3CH3X 1PVJA 2FYEA 2G6DA 5EF4A 3KSEA 1NLJA 4KLBA 3ERVA 3LFYA 2DJGB 2BDLA 2YJ9A 2Z84A 2JRIA 1YK8A 1STFE 2YJ8A 3CBJA 4FJCA 2Y6EA 2R9OA 4OELA 2OZ2A 2BTWA 1YK7A 2E02A 4Q8GA 2AUXA 2ATOA 2B1NA 1SNKA 1EWPA 1AU0A 1KHQA 4OW0A 2DC6A 3BOWA 2B1MA 3N3KA 5EGWA 3F75A 2HWKA 2JTCA 3BCNA 1ATKA 1AU4A 2OULA 2PREA 1KFUL 1ME4A 5CHVA 3M99A 1AYVA 4G54A 3V6CA 1NQCA 5FPWA 4CDFB 4MM3B 2AU1A 4X6IA 1EWMA 4N4ZA 2DC7A 4YYQA 4PP1A 3P5WA 4DMXA 3PBHA 1XKGA 4PP2E 4QBBA 4M0WA 3WXGA 3GCBA 2AVWA 4PT5A 4BSQA 2AYOA 3MP2A 3MHSA 3PRMA 4YYUA 3TMPA 2G8EA 2YJBA 4W4UA 1ICFA 2XU4A 3H89A 1U9QX 3K9MA 4XR7A 3HHAA 4P6EA 3N3GA 4BOZA 1YALA 2NQDB 2E03A 3H6SA 1F2CA 4YYRA 2FQ9A 1TU6A 1AYWA 3I06A 4IP3A 2ACTA 3RNVA 1PE6A 4W5CA 4WA6A 1CQDA 4Q8HA 4I05A 3B79A 1YT7A 1NB3A 1QOLA 1SP4B 2FRQA 1U9VA 4N79A 1CTEA 5JH3A 4P16A 2E00A 1AECA 4RF1A 2VHFA 4CDDB 3BBAA 5JZEA 3ZUAA 1GLOA 2XU1A 1KXRA 3BC3A 1PPNA 8PCHA 5CVMA 1U9WA 5J94A 1X9YA 1FH0A 1KHPA 2PBHA 4FIPA 1AU2A 2DCDA 1KFXL 2CB5A 2E01A 4OEMA 1PXVA 1EWOA 2IPPB 4MZOA 3HD3A 2AS8A 1TL9A 4IUMA 5CHTA 2GHUA 2FRAA 1F2AA 2XU3A 3HWNA 3N4CA 2JQGR 4BQVA 1Y4HA 1PCIA 2BDZA 1VJVA 2DCBA 3BB7A 2ARYA 2UZJA 5CVOB 3O1GA 4AXLA 3AI8A 2OP3A 2GFOA 1MDWA 1U9XA 4XZXA 4MSXA 3MTNA 2DCAA 3O0UA 4RF0A 1NL6A 3IHPA 2NQGA 3H8BA 3H8CA 5JA7A 2DC9A 3K8UA 3KWZA 1F2BA 3C9EA 5EZSA 4AXMA 4MZSA 1BY8A 1Y08A 3DF0A 1CJLA 1BP4A 3KX1A 1VSNA 4HXDB 2O6XA 2HH5A 5EZQA 1NB5A 4D8EA 1Q6KA 1GECE 3RVXA 1CPJA 1DKIA 2AUZA 1CV8A 3WXEA 1THEA 3PHUA
chains in the Genus database with same CATH topology
1BGOA 4YV8A 3I3TA 2R9MA 4HWYA 2DCCA 3P5UA 3OVXA 4FK5A 1PADA 1AYUA 4QRVA 1M6DA 1CB5A 3P5VA 3S3QA 4BS6A 1EWLA 1PPOA 1NPZA 3RVWA 3V6EA 2P86A 3E1ZB 4C5PA 4BS5A 4QRGA 4K7CA 3BPFA 1ITOA 3F5VA 1EF7A 4DMYA 3MHHA 3BPMA 2F1GA 1DF0A 3IV2A 3USVA 3WXFA 2Y5BA 2WBFX 3IMAA 3CBKA 3IUTA 2NQAA 3IEJA 1MEGA 1PIPA 1W6FA 2FUDA 4I07A 4YYSA 1ME3A 1MIRA 1QDQA 2YJ2A 4YVAA 3QT4A 3CH2X 3OVZA 1JQPA 2XU5A 4BPVA 2DZYA 2VFBA 4CDCB 2HD5A 1AIMA 2G8JA 4CZWA 2DZZA 2G7YA 1YVBA 4QRXA 4W5BA 4PI3A 2AYNA 3PDFA 2P0RA 3QJ3A 4BGFA 2PNSA 1CS8A 2DC8A 4I04A 2IBIA 2FO5A 3IOQA 2FTDA 1IWDA 4RY2A 5A24A 1GX3A 7PCKA 4ZUXU 3K24A 2P7UA 1O0EA 1PPDA 1ZCMA 2F7DA 4NV8A 1TLOA 1S4VA 3BWKA 3QSDA 5F02A 5PADA 6PADA 1U5IA 3HHIA 4QH6A 1PBHA 1W5RA 3OISA 2AIMA 1MS6A 4XUIA 3P5XA 2JQFR 3KWBX 4P6GA 1A6RA 3KKUA 2R6NA 1K3BB 1MHWA 1PPPA 1CSBB 4X6JA 2YJCA 9PAPA 1QMYA 1AU3A 1QXPA 2NQIA 3S3RA 2DJFB 2C0YA 3OF9A 2PADA 4YYVA 1BQIA 1MEMA 3LXSA 3NHEA 2R9CA 3OF8A 1ZIVA 4YYWA 3U8EA 3MORA 1GMYA 4CDEB 3H7DA 3D6SA 2HXZA 3KFQA 1HUCB 4PADA 2R9FA 3PW3A 1F29A 3TNXA 2R9NA 2FT2A 5K16A 2H7JA 4X6HA 1POPA 1CVZA 4N8WA 1GCBA 2HHNA 5CVNB 3RVVA 3KW9A 2VHSA 2CIOA 3PNRA 1DEUA 3CH3X 2FYEA 2G6DA 5EF4A 3KSEA 1NLJA 3D9WA 4KLBA 3ERVA 3LFYA 2DJGB 2BDLA 2YJ9A 1YK8A 1STFE 2YJ8A 3CBJA 4FJCA 2Y6EA 2R9OA 4OELA 2OZ2A 1YK7A 2E02A 4Q8GA 2AUXA 2ATOA 2B1NA 2BSZA 1SNKA 1EWPA 1AU0A 1KHQA 2DC6A 3BOWA 2B1MA 3N3KA 5EGWA 3F75A 1W4TA 3BCNA 1ATKA 1AU4A 2OULA 2PREA 1KFUL 1ME4A 5CHVA 3M99A 1AYVA 4G54A 3V6CA 1NQCA 5FPWA 4CDFB 2AU1A 4X6IA 1EWMA 4N4ZA 2DC7A 4YYQA 4PP1A 3P5WA 4DMXA 3PBHA 1XKGA 4PP2E 4QBBA 3WXGA 3GCBA 2AVWA 4BSQA 2AYOA 3MHSA 4YYUA 2G8EA 2YJBA 4W4UA 1ICFA 2XU4A 3H89A 1U9QX 3K9MA 4XR7A 3HHAA 4P6EA 3N3GA 1YALA 2NQDB 2E03A 3H6SA 1F2CA 4YYRA 2FQ9A 1TU6A 1AYWA 3I06A 2ACTA 1PE6A 3LTWA 4W5CA 4WA6A 1CQDA 4Q8HA 4I05A 3B79A 1YT7A 1NB3A 1QOLA 1SP4B 2FRQA 1U9VA 4N79A 1CTEA 5JH3A 1E2TA 2E00A 1AECA 2VFCA 2VHFA 4CDDB 3ZUAA 1GLOA 2XU1A 1KXRA 3BC3A 1PPNA 8PCHA 5CVMA 1U9WA 5J94A 1X9YA 1FH0A 1KHPA 2PBHA 4FIPA 1AU2A 2DCDA 1KFXL 2CB5A 2E01A 4OEMA 1PXVA 1EWOA 2IPPB 4MZOA 3HD3A 2AS8A 1TL9A 4B55A 5CHTA 2GHUA 2FRAA 1F2AA 2XU3A 3HWNA 3N4CA 2JQGR 4BQVA 1Y4HA 1PCIA 2BDZA 1VJVA 2DCBA 2ARYA 5CVOB 3O1GA 4AXLA 3AI8A 2OP3A 2GFOA 1MDWA 1U9XA 4MSXA 3MTNA 2DCAA 3O0UA 1NL6A 3IHPA 2NQGA 3H8BA 3H8CA 5JA7A 2DC9A 3K8UA 3KWZA 1F2BA 3C9EA 4GUZA 4AXMA 4MZSA 1BY8A 1Y08A 3DF0A 1CJLA 4NV7A 1BP4A 3KX1A 1VSNA 2O6XA 2HH5A 1NB5A 1Q6KA 1GECE 3RVXA 1CPJA 2AUZA 1CV8A 3WXEA 1THEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGO A;  4YV8 A;  3I3T A;  2R9M A;  4HWY A;  2DCC A;  3P5U A;  3OVX A;  4FK5 A;  1PAD A;  1AYU A;  4QRV A;  1M6D A;  1CB5 A;  3P5V A;  3S3Q A;  4BS6 A;  1EWL A;  1PPO A;  1NPZ A;  3RVW A;  3V6E A;  2P86 A;  3E1Z B;  4BS5 A;  4QRG A;  4K7C A;  3BPF A;  1ITO A;  3F5V A;  1EF7 A;  4DMY A;  3MHH A;  3BPM A;  2F1G A;  1DF0 A;  3IV2 A;  3USV A;  3WXF A;  2Y5B A;  2WBF X;  3IMA A;  3CBK A;  3IUT A;  2NQA A;  3IEJ A;  1MEG A;  1PIP A;  2FUD A;  4I07 A;  4YYS A;  1ME3 A;  1MIR A;  1QDQ A;  2YJ2 A;  4YVA A;  3QT4 A;  3CH2 X;  3OVZ A;  1JQP A;  2XU5 A;  4BPV A;  2DZY A;  4CDC B;  2HD5 A;  1AIM A;  2G8J A;  4CZW A;  2DZZ A;  2G7Y A;  1YVB A;  4QRX A;  4W5B A;  4PI3 A;  2AYN A;  3PDF A;  2P0R A;  3QJ3 A;  2PNS A;  1CS8 A;  2DC8 A;  4I04 A;  2IBI A;  2FO5 A;  3IOQ A;  2FTD A;  1IWD A;  4RY2 A;  5A24 A;  7PCK A;  4ZUX U;  3K24 A;  2P7U A;  1O0E A;  1PPD A;  1ZCM A;  2F7D A;  1TLO A;  1S4V A;  3BWK A;  3QSD A;  5F02 A;  5PAD A;  6PAD A;  1U5I A;  3HHI A;  4QH6 A;  1PBH A;  3OIS A;  2AIM A;  1MS6 A;  4XUI A;  3P5X A;  2JQF R;  3KWB X;  4P6G A;  1A6R A;  3KKU A;  2R6N A;  1K3B B;  1MHW A;  1PPP A;  1CSB B;  4X6J A;  2YJC A;  9PAP A;  1QMY A;  1AU3 A;  1QXP A;  2NQI A;  3S3R A;  2DJF B;  2C0Y A;  3OF9 A;  2PAD A;  4YYV A;  1BQI A;  1MEM A;  3LXS A;  3NHE A;  2R9C A;  3OF8 A;  1ZIV A;  4YYW A;  3U8E A;  3MOR A;  1GMY A;  4CDE B;  3H7D A;  3D6S A;  2HXZ A;  3KFQ A;  1HUC B;  4PAD A;  2R9F A;  3PW3 A;  1F29 A;  3TNX A;  2R9N A;  2FT2 A;  5K16 A;  2H7J A;  4X6H A;  1POP A;  1CVZ A;  4N8W A;  1GCB A;  2HHN A;  5CVN B;  3RVV A;  3KW9 A;  2VHS A;  2CIO A;  3PNR A;  1DEU A;  3CH3 X;  2FYE A;  2G6D A;  5EF4 A;  3KSE A;  1NLJ A;  4KLB A;  3ERV A;  3LFY A;  2DJG B;  2BDL A;  2YJ9 A;  1YK8 A;  1STF E;  2YJ8 A;  3CBJ A;  4FJC A;  2Y6E A;  4OEL A;  2R9O A;  2OZ2 A;  1YK7 A;  2E02 A;  4Q8G A;  2AUX A;  2ATO A;  2B1N A;  1SNK A;  1EWP A;  1AU0 A;  1KHQ A;  2DC6 A;  3BOW A;  2B1M A;  3N3K A;  5EGW A;  3F75 A;  3BCN A;  1ATK A;  1AU4 A;  2OUL A;  2PRE A;  1KFU L;  1ME4 A;  5CHV A;  3M99 A;  1AYV A;  4G54 A;  3V6C A;  1NQC A;  5FPW A;  4CDF B;  2AU1 A;  4X6I A;  1EWM A;  4N4Z A;  2DC7 A;  4YYQ A;  4PP1 A;  3P5W A;  4DMX A;  3PBH A;  1XKG A;  4PP2 E;  4QBB A;  3WXG A;  3GCB A;  2AVW A;  4BSQ A;  2AYO A;  3MHS A;  4YYU A;  2G8E A;  2YJB A;  4W4U A;  1ICF A;  2XU4 A;  3H89 A;  1U9Q X;  3K9M A;  4XR7 A;  3HHA A;  4P6E A;  3N3G A;  1YAL A;  2NQD B;  2E03 A;  3H6S A;  1F2C A;  4YYR A;  2FQ9 A;  1TU6 A;  1AYW A;  3I06 A;  2ACT A;  1PE6 A;  4W5C A;  4WA6 A;  1CQD A;  4Q8H A;  4I05 A;  3B79 A;  1YT7 A;  1NB3 A;  1QOL A;  1SP4 B;  2FRQ A;  1U9V A;  4N79 A;  1CTE A;  5JH3 A;  2E00 A;  1AEC A;  2VHF A;  4CDD B;  3ZUA A;  1GLO A;  2XU1 A;  1KXR A;  3BC3 A;  1PPN A;  8PCH A;  5CVM A;  1U9W A;  5J94 A;  1X9Y A;  1FH0 A;  1KHP A;  2PBH A;  4FIP A;  1AU2 A;  2DCD A;  1KFX L;  2CB5 A;  2E01 A;  4OEM A;  1PXV A;  1EWO A;  2IPP B;  4MZO A;  3HD3 A;  2AS8 A;  1TL9 A;  5CHT A;  2GHU A;  2FRA A;  1F2A A;  2XU3 A;  3HWN A;  3N4C A;  2JQG R;  4BQV A;  1Y4H A;  1PCI A;  2BDZ A;  1VJV A;  2DCB A;  2ARY A;  5CVO B;  3O1G A;  4AXL A;  3AI8 A;  2OP3 A;  2GFO A;  1MDW A;  1U9X A;  4MSX A;  3MTN A;  2DCA A;  3O0U A;  1NL6 A;  3IHP A;  2NQG A;  3H8B A;  3H8C A;  5JA7 A;  2DC9 A;  3K8U A;  3KWZ A;  1F2B A;  3C9E A;  4AXM A;  4MZS A;  1BY8 A;  1Y08 A;  3DF0 A;  1CJL A;  1BP4 A;  3KX1 A;  1VSN A;  2O6X A;  2HH5 A;  1NB5 A;  1Q6K A;  1GEC E;  3RVX A;  1CPJ A;  2AUZ A;  1CV8 A;  3WXE A;  1THE A; 
#chains in the Genus database with same CATH topology
 1BGO A;  4YV8 A;  3I3T A;  2R9M A;  4HWY A;  2DCC A;  3P5U A;  3O65 A;  3BY4 A;  3OVX A;  4FK5 A;  1PAD A;  1AYU A;  4QRV A;  1M6D A;  1CB5 A;  3P5V A;  3S3Q A;  4MI7 A;  4BS6 A;  1EWL A;  1PPO A;  1NPZ A;  3RVW A;  3V6E A;  2P86 A;  3E1Z B;  3PHX A;  4BS5 A;  4QRG A;  4K7C A;  3BPF A;  1ITO A;  3F5V A;  4D8B A;  1EF7 A;  4DMY A;  3MHH A;  3TRK A;  3BPM A;  2F1G A;  1DF0 A;  3IV2 A;  3USV A;  3WXF A;  2BU3 A;  2Y5B A;  2WBF X;  3IMA A;  3CBK A;  3IUT A;  2NQA A;  3IEJ A;  1MEG A;  1PIP A;  2FUD A;  4I07 A;  4YYS A;  1ME3 A;  1MIR A;  1QDQ A;  2YJ2 A;  4YVA A;  3QT4 A;  3CH2 X;  3OVZ A;  1JQP A;  3PHW A;  2XU5 A;  4BPV A;  2DZY A;  4CDC B;  4OVZ A;  3C0R A;  4BOS A;  2HD5 A;  1AIM A;  2FE8 A;  4RNA A;  3W31 A;  2G8J A;  4RKX A;  4CZW A;  2DZZ A;  2G7Y A;  4WUR A;  1YVB A;  4QRX A;  4W5B A;  4PI3 A;  2AYN A;  4ZTB A;  3B21 A;  3PDF A;  2P0R A;  3QJ3 A;  2J7Q C;  2PNS A;  1CS8 A;  2DC8 A;  4I04 A;  3E9S A;  2IBI A;  2FO5 A;  3ZNH A;  3IOQ A;  3PT2 A;  2FTD A;  1IWD A;  3PRP A;  4RY2 A;  5A24 A;  7PCK A;  4ZUX U;  4OVZ B;  4BOU A;  3K24 A;  2P7U A;  1O0E A;  1PPD A;  3W30 A;  1ZCM A;  2F7D A;  2BTW B;  1TLO A;  1S4V A;  3BWK A;  3QSD A;  1UKF A;  5F02 A;  5PAD A;  6PAD A;  4A5U A;  1U5I A;  3HHI A;  4QH6 A;  5E6J A;  1PBH A;  3OIS A;  2AIM A;  1MS6 A;  4XUI A;  3P5X A;  2JQF R;  2DOS A;  3KWB X;  4P6G A;  3MJ5 A;  2J7Q A;  4D8I A;  1A6R A;  3KKU A;  2R6N A;  1K3B B;  3OQC A;  1MHW A;  1PPP A;  1CSB B;  4X6J A;  2AGA A;  2YJC A;  9PAP A;  1QMY A;  1AU3 A;  1QXP A;  2NQI A;  3S3R A;  2DJF B;  2C0Y A;  3OF9 A;  2PAD A;  4YYV A;  1BQI A;  1MEM A;  3LXS A;  3NHE A;  4R3D A;  2R9C A;  4BOQ A;  3OF8 A;  1ZIV A;  4YYW A;  3IFU A;  3U8E A;  3MOR A;  1GMY A;  4CDE B;  4REZ A;  3H7D A;  3D6S A;  2HXZ A;  3KFQ A;  1HUC B;  4PAD A;  2R9F A;  3PW3 A;  1F29 A;  3TNX A;  2R9N A;  1YZB A;  2FT2 A;  3MTV A;  2H7J A;  5K16 A;  4X6H A;  1POP A;  5KO3 A;  1CVZ A;  4GUA A;  4N8W A;  1GCB A;  3PSE A;  2HHN A;  5CVN B;  3RVV A;  3KW9 A;  2VHS A;  4BOP A;  2CIO A;  3PNR A;  1DEU A;  3CH3 X;  1PVJ A;  2FYE A;  2G6D A;  5EF4 A;  3KSE A;  1NLJ A;  4KLB A;  3ERV A;  3LFY A;  2DJG B;  2BDL A;  2YJ9 A;  2Z84 A;  2JRI A;  1YK8 A;  1STF E;  2YJ8 A;  3CBJ A;  4FJC A;  2Y6E A;  2R9O A;  4OEL A;  2OZ2 A;  2BTW A;  1YK7 A;  2E02 A;  4Q8G A;  2AUX A;  2ATO A;  2B1N A;  1SNK A;  1EWP A;  1AU0 A;  1KHQ A;  4OW0 A;  2DC6 A;  3BOW A;  2B1M A;  3N3K A;  5EGW A;  3F75 A;  2HWK A;  2JTC A;  3BCN A;  1ATK A;  1AU4 A;  2OUL A;  2PRE A;  1KFU L;  1ME4 A;  5CHV A;  3M99 A;  1AYV A;  4G54 A;  3V6C A;  1NQC A;  5FPW A;  4CDF B;  4MM3 B;  2AU1 A;  4X6I A;  1EWM A;  4N4Z A;  2DC7 A;  4YYQ A;  4PP1 A;  3P5W A;  4DMX A;  3PBH A;  1XKG A;  4PP2 E;  4QBB A;  4M0W A;  3WXG A;  3GCB A;  2AVW A;  4PT5 A;  4BSQ A;  2AYO A;  3MP2 A;  3MHS A;  3PRM A;  4YYU A;  3TMP A;  2G8E A;  2YJB A;  4W4U A;  1ICF A;  2XU4 A;  3H89 A;  1U9Q X;  3K9M A;  4XR7 A;  3HHA A;  4P6E A;  3N3G A;  4BOZ A;  1YAL A;  2NQD B;  2E03 A;  3H6S A;  1F2C A;  4YYR A;  2FQ9 A;  1TU6 A;  1AYW A;  3I06 A;  4IP3 A;  2ACT A;  3RNV A;  1PE6 A;  4W5C A;  4WA6 A;  1CQD A;  4Q8H A;  4I05 A;  3B79 A;  1YT7 A;  1NB3 A;  1QOL A;  1SP4 B;  2FRQ A;  1U9V A;  4N79 A;  1CTE A;  5JH3 A;  4P16 A;  2E00 A;  1AEC A;  4RF1 A;  2VHF A;  4CDD B;  3BBA A;  5JZE A;  3ZUA A;  1GLO A;  2XU1 A;  1KXR A;  3BC3 A;  1PPN A;  8PCH A;  5CVM A;  1U9W A;  5J94 A;  1X9Y A;  1FH0 A;  1KHP A;  2PBH A;  4FIP A;  1AU2 A;  2DCD A;  1KFX L;  2CB5 A;  2E01 A;  4OEM A;  1PXV A;  1EWO A;  2IPP B;  4MZO A;  3HD3 A;  2AS8 A;  1TL9 A;  4IUM A;  5CHT A;  2GHU A;  2FRA A;  1F2A A;  2XU3 A;  3HWN A;  3N4C A;  2JQG R;  4BQV A;  1Y4H A;  1PCI A;  2BDZ A;  1VJV A;  2DCB A;  3BB7 A;  2ARY A;  2UZJ A;  5CVO B;  3O1G A;  4AXL A;  3AI8 A;  2OP3 A;  2GFO A;  1MDW A;  1U9X A;  4XZX A;  4MSX A;  3MTN A;  2DCA A;  3O0U A;  4RF0 A;  1NL6 A;  3IHP A;  2NQG A;  3H8B A;  3H8C A;  5JA7 A;  2DC9 A;  3K8U A;  3KWZ A;  1F2B A;  3C9E A;  5EZS A;  4AXM A;  4MZS A;  1BY8 A;  1Y08 A;  3DF0 A;  1CJL A;  1BP4 A;  3KX1 A;  1VSN A;  4HXD B;  2O6X A;  2HH5 A;  5EZQ A;  1NB5 A;  4D8E A;  1Q6K A;  1GEC E;  3RVX A;  1CPJ A;  1DKI A;  2AUZ A;  1CV8 A;  3WXE A;  1THE A;  3PHU A; 
#chains in the Genus database with same CATH homology
 1BGO A;  4YV8 A;  3I3T A;  2R9M A;  4HWY A;  2DCC A;  3P5U A;  3OVX A;  4FK5 A;  1PAD A;  1AYU A;  4QRV A;  1M6D A;  1CB5 A;  3P5V A;  3S3Q A;  4BS6 A;  1EWL A;  1PPO A;  1NPZ A;  3RVW A;  3V6E A;  2P86 A;  3E1Z B;  4C5P A;  4BS5 A;  4QRG A;  4K7C A;  3BPF A;  1ITO A;  3F5V A;  1EF7 A;  4DMY A;  3MHH A;  3BPM A;  2F1G A;  1DF0 A;  3IV2 A;  3USV A;  3WXF A;  2Y5B A;  2WBF X;  3IMA A;  3CBK A;  3IUT A;  2NQA A;  3IEJ A;  1MEG A;  1PIP A;  1W6F A;  2FUD A;  4I07 A;  4YYS A;  1ME3 A;  1MIR A;  1QDQ A;  2YJ2 A;  4YVA A;  3QT4 A;  3CH2 X;  3OVZ A;  1JQP A;  2XU5 A;  4BPV A;  2DZY A;  2VFB A;  4CDC B;  2HD5 A;  1AIM A;  2G8J A;  4CZW A;  2DZZ A;  2G7Y A;  1YVB A;  4QRX A;  4W5B A;  4PI3 A;  2AYN A;  3PDF A;  2P0R A;  3QJ3 A;  4BGF A;  2PNS A;  1CS8 A;  2DC8 A;  4I04 A;  2IBI A;  2FO5 A;  3IOQ A;  2FTD A;  1IWD A;  4RY2 A;  5A24 A;  1GX3 A;  7PCK A;  4ZUX U;  3K24 A;  2P7U A;  1O0E A;  1PPD A;  1ZCM A;  2F7D A;  4NV8 A;  1TLO A;  1S4V A;  3BWK A;  3QSD A;  5F02 A;  5PAD A;  6PAD A;  1U5I A;  3HHI A;  4QH6 A;  1PBH A;  1W5R A;  3OIS A;  2AIM A;  1MS6 A;  4XUI A;  3P5X A;  2JQF R;  3KWB X;  4P6G A;  1A6R A;  3KKU A;  2R6N A;  1K3B B;  1MHW A;  1PPP A;  1CSB B;  4X6J A;  2YJC A;  9PAP A;  1QMY A;  1AU3 A;  1QXP A;  2NQI A;  3S3R A;  2DJF B;  2C0Y A;  3OF9 A;  2PAD A;  4YYV A;  1BQI A;  1MEM A;  3LXS A;  3NHE A;  2R9C A;  3OF8 A;  1ZIV A;  4YYW A;  3U8E A;  3MOR A;  1GMY A;  4CDE B;  3H7D A;  3D6S A;  2HXZ A;  3KFQ A;  1HUC B;  4PAD A;  2R9F A;  3PW3 A;  1F29 A;  3TNX A;  2R9N A;  2FT2 A;  5K16 A;  2H7J A;  4X6H A;  1POP A;  1CVZ A;  4N8W A;  1GCB A;  2HHN A;  5CVN B;  3RVV A;  3KW9 A;  2VHS A;  2CIO A;  3PNR A;  1DEU A;  3CH3 X;  2FYE A;  2G6D A;  5EF4 A;  3KSE A;  1NLJ A;  3D9W A;  4KLB A;  3ERV A;  3LFY A;  2DJG B;  2BDL A;  2YJ9 A;  1YK8 A;  1STF E;  2YJ8 A;  3CBJ A;  4FJC A;  2Y6E A;  2R9O A;  4OEL A;  2OZ2 A;  1YK7 A;  2E02 A;  4Q8G A;  2AUX A;  2ATO A;  2B1N A;  2BSZ A;  1SNK A;  1EWP A;  1AU0 A;  1KHQ A;  2DC6 A;  3BOW A;  2B1M A;  3N3K A;  5EGW A;  3F75 A;  1W4T A;  3BCN A;  1ATK A;  1AU4 A;  2OUL A;  2PRE A;  1KFU L;  1ME4 A;  5CHV A;  3M99 A;  1AYV A;  4G54 A;  3V6C A;  1NQC A;  5FPW A;  4CDF B;  2AU1 A;  4X6I A;  1EWM A;  4N4Z A;  2DC7 A;  4YYQ A;  4PP1 A;  3P5W A;  4DMX A;  3PBH A;  1XKG A;  4PP2 E;  4QBB A;  3WXG A;  3GCB A;  2AVW A;  4BSQ A;  2AYO A;  3MHS A;  4YYU A;  2G8E A;  2YJB A;  4W4U A;  1ICF A;  2XU4 A;  3H89 A;  1U9Q X;  3K9M A;  4XR7 A;  3HHA A;  4P6E A;  3N3G A;  1YAL A;  2NQD B;  2E03 A;  3H6S A;  1F2C A;  4YYR A;  2FQ9 A;  1TU6 A;  1AYW A;  3I06 A;  2ACT A;  1PE6 A;  3LTW A;  4W5C A;  4WA6 A;  1CQD A;  4Q8H A;  4I05 A;  3B79 A;  1YT7 A;  1NB3 A;  1QOL A;  1SP4 B;  2FRQ A;  1U9V A;  4N79 A;  1CTE A;  5JH3 A;  1E2T A;  2E00 A;  1AEC A;  2VFC A;  2VHF A;  4CDD B;  3ZUA A;  1GLO A;  2XU1 A;  1KXR A;  3BC3 A;  1PPN A;  8PCH A;  5CVM A;  1U9W A;  5J94 A;  1X9Y A;  1FH0 A;  1KHP A;  2PBH A;  4FIP A;  1AU2 A;  2DCD A;  1KFX L;  2CB5 A;  2E01 A;  4OEM A;  1PXV A;  1EWO A;  2IPP B;  4MZO A;  3HD3 A;  2AS8 A;  1TL9 A;  4B55 A;  5CHT A;  2GHU A;  2FRA A;  1F2A A;  2XU3 A;  3HWN A;  3N4C A;  2JQG R;  4BQV A;  1Y4H A;  1PCI A;  2BDZ A;  1VJV A;  2DCB A;  2ARY A;  5CVO B;  3O1G A;  4AXL A;  3AI8 A;  2OP3 A;  2GFO A;  1MDW A;  1U9X A;  4MSX A;  3MTN A;  2DCA A;  3O0U A;  1NL6 A;  3IHP A;  2NQG A;  3H8B A;  3H8C A;  5JA7 A;  2DC9 A;  3K8U A;  3KWZ A;  1F2B A;  3C9E A;  4GUZ A;  4AXM A;  4MZS A;  1BY8 A;  1Y08 A;  3DF0 A;  1CJL A;  4NV7 A;  1BP4 A;  3KX1 A;  1VSN A;  2O6X A;  2HH5 A;  1NB5 A;  1Q6K A;  1GEC E;  3RVX A;  1CPJ A;  2AUZ A;  1CV8 A;  3WXE A;  1THE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...