4PI3A

Crystal structure analysis of cruzain bound to vinyl sulfone analog of wrr-483 (wrr-666)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Synthesis and Evaluation of Oxyguanidine Analogues of the Cysteine Protease Inhibitor WRR-483 against Cruzain.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4pi3A00
3CH2X 1BP4A 1O0EA 3V6EA 2AUZA 1STFE 5FPWA 4BSQA 3E1ZB 1NL6A 2WBFX 1GMYA 3F75A 4N79A 1ZIVA 2NQAA 1ME3A 1GCBA 4CDCB 4XUIA 3P5UA 2YJ9A 5CVMA 4QBBA 1CPJA 3I3TA 3GCBA 3TNXA 3PW3A 1KFUL 1CV8A 1DF0A 1F2CA 2DC8A 3K24A 3LXSA 3DF0A 2DZYA 2P0RA 3HWNA 3WXFA 2G8JA 2YJBA 5F02A 1AYVA 3BCNA 1QMYA 2AIMA 1K3BB 2F7DA 2NQGA 1EWOA 1PBHA 4I05A 8PCHA 1NB3A 3LFYA 3D6SA 1Q6KA 2ARYA 4YYVA 1DEUA 4W5CA 5EF4A 2R6NA 3QSDA 2H7JA 1VJVA 4DMYA 2XU5A 1TLOA 3KW9A 3PDFA 4CDFB 7PCKA 1YVBA 2IBIA 1CQDA 3IEJA 1CJLA 3AI8A 1ITOA 5JH3A 4OELA 1VSNA 2XU3A 3OF8A 1TU6A 2GHUA 1MHWA 5A24A 4P6EA 3HHAA 4QH6A 2G7YA 4K7CA 5CVNB 1YALA 3KSEA 1EF7A 1ZCMA 1CVZA 1AYUA 5JA7A 3H89A 2R9NA 1U5IA 2FUDA 1AU4A 1NPZA 4BPVA 3P5WA 2FYEA 2P7UA 1A6RA 4BS6A 1M6DA 3BC3A 3USVA 3O0UA 4CDEB 4PADA 3CBKA 2HXZA 2YJ2A 4FK5A 1KXRA 1EWPA 2DC6A 2IPPB 3H8CA 2YJ8A 1MEMA 3KX1A 4FJCA 1IWDA 2R9CA 1KHPA 3OVXA 3MHSA 4CZWA 3V6CA 1X9YA 2JQFR 1CSBB 1THEA 1BQIA 5J94A 1KFXL 4MZOA 1MIRA 1PPNA 1GECE 1BGOA 1JQPA 3HHIA 1HUCB 1PPPA 3KWBX 1PPDA 2DCCA 1NLJA 5CVOB 3IMAA 2DJFB 1QDQA 2VHFA 1AU2A 2E03A 2OULA 2XU4A 2R9OA 4BQVA 2DZZA 2AU1A 1XKGA 4W4UA 3MHHA 2ATOA 2CIOA 1PXVA 1AU0A 3WXEA 1Y08A 9PAPA 3QT4A 4YYUA 5CHTA 2P86A 2HHNA 4YVAA 3IV2A 2DCBA 4WA6A 3CH3X 1AYWA 3N3KA 4N4ZA 4XR7A 2AYNA 3P5XA 4YYSA 1AIMA 3WXGA 4HWYA 4X6JA 6PADA 3F5VA 1YK7A 1F2AA 2ACTA 1MEGA 4Q8GA 1S4VA 4I07A 1CS8A 4BS5A 3O1GA 4P6GA 2OP3A 3BPFA 3KKUA 3PNRA 1U9WA 2AYOA 4AXLA 2FRAA 2B1MA 2BDZA 4X6HA 1MS6A 4YYWA 1BY8A 2Y6EA 4YYRA 2R9MA 1NQCA 3ERVA 3H7DA 1PCIA 3QJ3A 1YT7A 3B79A 3P5VA 1EWMA 1CB5A 2E00A 2FT2A 1U9XA 1CTEA 3N4CA 2O6XA 1AU3A 2JQGR 4X6IA 3OISA 2FTDA 3S3RA 2PBHA 2DC9A 3HD3A 2B1NA 4MSXA 4PI3A 4AXMA 2Y5BA 2BDLA 2PREA 3U8EA 1EWLA 2VHSA 5K16A 2C0YA 1AECA 3IUTA 2DCAA 2DC7A 3NHEA 1U9VA 3CBJA 4FIPA 2YJCA 4CDDB 1QOLA 3ZUAA 2DJGB 3C9EA 3MORA 3M99A 1ME4A 3RVVA 2HH5A 2CB5A 3MTNA 1ATKA 3IOQA 1F2BA 4ZUXU 3OVZA 1NB5A 2R9FA 2FO5A 3K8UA 1Y4HA 3N3GA 4QRXA 4MZSA 2G8EA 2NQIA 5CHVA 4YYQA 1U9QX 2FRQA 1YK8A 1GLOA 2E02A 3K9MA 4OEMA 4DMXA 2PADA 1ICFA 2HD5A 3KFQA 3BPMA 4N8WA 1PIPA 4YV8A 2G6DA 1FH0A 3BOWA 2E01A 3H8BA 2AVWA 4QRGA 2OZ2A 3RVWA 3BWKA 5EGWA 4G54A 2DCDA 1PE6A 4I04A 2AUXA 3H6SA 5PADA 4PP2E 3KWZA 2NQDB 1SNKA 4KLBA 1SP4B 2F1GA 2GFOA 1PADA 2XU1A 3IHPA 1MDWA 4PP1A 3S3QA 4RY2A 1PPOA 4W5BA 1QXPA 3PBHA 3OF9A 3I06A 4Q8HA 1TL9A 1F29A 2PNSA 1POPA 1KHQA 4QRVA 2AS8A 3RVXA 2FQ9A
chains in the Genus database with same CATH superfamily
3CH2X 1BP4A 1O0EA 3V6EA 3PHXA 2AUZA 1STFE 4RF1A 5FPWA 3E1ZB 4BSQA 1NL6A 3BY4A 2WBFX 1GMYA 3F75A 4N79A 1ZIVA 2NQAA 1ME3A 5KO3A 1GCBA 2JTCA 4RF0A 4CDCB 4XUIA 3P5UA 2YJ9A 5CVMA 3BB7A 4QBBA 1CPJA 3MP2A 3I3TA 3GCBA 3TNXA 3PW3A 1KFUL 1CV8A 1DF0A 2BU3A 1F2CA 2DC8A 3K24A 3LXSA 3DF0A 3PRMA 2DZYA 2P0RA 3HWNA 3WXFA 2G8JA 2YJBA 5F02A 1AYVA 1YZBA 3BCNA 1QMYA 2AIMA 1K3BB 2F7DA 2NQGA 1EWOA 1PBHA 4I05A 8PCHA 1NB3A 3LFYA 2AGAA 3D6SA 1Q6KA 2ARYA 4YYVA 1DEUA 4W5CA 4BOUA 2DOSA 5EF4A 2R6NA 3QSDA 4WURA 2H7JA 1VJVA 4DMYA 2XU5A 1TLOA 3KW9A 3PDFA 4CDFB 7PCKA 4HXDB 1YVBA 2IBIA 1CQDA 3IEJA 1CJLA 3AI8A 4MM3B 4OW0A 1ITOA 3RNVA 5JH3A 4OELA 1VSNA 2XU3A 4GUAA 3W30A 3OF8A 1TU6A 2GHUA 1MHWA 5A24A 4P6EA 3HHAA 4QH6A 2G7YA 4K7CA 5CVNB 3O65A 1YALA 3KSEA 1EF7A 1ZCMA 1CVZA 1AYUA 4P16A 3C0RA 2Z84A 5JA7A 3H89A 2R9NA 1U5IA 2FUDA 1AU4A 1NPZA 4BPVA 3P5WA 5EZQA 1UKFA 2FYEA 2P7UA 1A6RA 4BS6A 1M6DA 3BC3A 3USVA 4RNAA 3O0UA 4CDEB 4PADA 3CBKA 2FE8A 2HXZA 2YJ2A 4MI7A 4BOZA 4FK5A 1KXRA 1EWPA 2DC6A 2IPPB 3H8CA 2YJ8A 1MEMA 3KX1A 4FJCA 1IWDA 2R9CA 1KHPA 3OVXA 3MHSA 4CZWA 3V6CA 1X9YA 4REZA 2JQFR 1CSBB 1THEA 1BQIA 5J94A 1KFXL 4MZOA 5JZEA 1MIRA 1PPNA 1GECE 1BGOA 1JQPA 3HHIA 1HUCB 1PPPA 3KWBX 1DKIA 3PSEA 1PPDA 2DCCA 1NLJA 5CVOB 3IMAA 2DJFB 1QDQA 2VHFA 1AU2A 4PT5A 2E03A 2OULA 2XU4A 2BTWA 2R9OA 4BQVA 4RKXA 2DZZA 2AU1A 1XKGA 4W4UA 4R3DA 2J7QC 3MHHA 2ATOA 4D8IA 2CIOA 1PXVA 1AU0A 3WXEA 1Y08A 9PAPA 3QT4A 4YYUA 5CHTA 3PT2A 2P86A 2HHNA 4YVAA 3IV2A 2DCBA 4XZXA 4WA6A 3CH3X 1AYWA 3N3KA 3PHWA 4N4ZA 4XR7A 2AYNA 3P5XA 4YYSA 1AIMA 3WXGA 4HWYA 4X6JA 4OVZA 6PADA 3F5VA 1YK7A 1F2AA 2ACTA 1MEGA 4BOSA 4Q8GA 1S4VA 4I07A 1CS8A 4BS5A 3O1GA 4P6GA 2OP3A 3BPFA 4BOPA 3KKUA 3PNRA 1U9WA 3MJ5A 2AYOA 4AXLA 2FRAA 2B1MA 2BDZA 4X6HA 1MS6A 4YYWA 1BY8A 2Y6EA 4YYRA 4IUMA 2R9MA 1NQCA 3ERVA 3H7DA 1PCIA 3QJ3A 3TRKA 1YT7A 3B79A 3P5VA 1EWMA 1CB5A 2E00A 2FT2A 1U9XA 1CTEA 4IP3A 3N4CA 4ZTBA 2O6XA 1AU3A 2UZJA 2J7QA 2JQGR 4X6IA 3OISA 5EZSA 2FTDA 3IFUA 3S3RA 2PBHA 2DC9A 3HD3A 2B1NA 4MSXA 4PI3A 4AXMA 4BOQA 2Y5BA 2BDLA 2PREA 2JRIA 3U8EA 2HWKA 1EWLA 3BBAA 2VHSA 5K16A 2C0YA 4M0WA 1AECA 3E9SA 3IUTA 3B21A 2DCAA 2DC7A 3NHEA 1U9VA 3CBJA 4FIPA 2YJCA 4CDDB 1QOLA 3ZUAA 2DJGB 3C9EA 3MORA 4A5UA 3M99A 1ME4A 3RVVA 2HH5A 3MTVA 2CB5A 3MTNA 1ATKA 3IOQA 1F2BA 3OQCA 4ZUXU 3OVZA 1NB5A 2R9FA 2FO5A 3K8UA 1Y4HA 3N3GA 4QRXA 4MZSA 2G8EA 2NQIA 5CHVA 4YYQA 1U9QX 2BTWB 2FRQA 1YK8A 1GLOA 2E02A 3K9MA 4OEMA 4DMXA 2PADA 1ICFA 2HD5A 3KFQA 3BPMA 4N8WA 1PIPA 5E6JA 4YV8A 2G6DA 1FH0A 3BOWA 3PHUA 2E01A 3H8BA 2AVWA 4QRGA 2OZ2A 3RVWA 3BWKA 5EGWA 4G54A 2DCDA 3TMPA 1PE6A 3PRPA 4I04A 2AUXA 3H6SA 5PADA 3W31A 4PP2E 3KWZA 2NQDB 1SNKA 4KLBA 1SP4B 2F1GA 2GFOA 4OVZB 1PADA 3ZNHA 2XU1A 3IHPA 4D8EA 1MDWA 4PP1A 3S3QA 4RY2A 1PPOA 4W5BA 1QXPA 3PBHA 1PVJA 3OF9A 3I06A 4Q8HA 1TL9A 1F29A 2PNSA 1POPA 1KHQA 4D8BA 4QRVA 2AS8A 3RVXA 2FQ9A
chains in the Genus database with same CATH topology
3CH2X 1BP4A 1O0EA 3V6EA 2AUZA 1STFE 5FPWA 4BSQA 3E1ZB 1NL6A 2WBFX 1GMYA 3F75A 4N79A 1ZIVA 2NQAA 1ME3A 1GCBA 2VFBA 4CDCB 4XUIA 3P5UA 2YJ9A 5CVMA 4QBBA 1CPJA 3I3TA 3GCBA 3TNXA 3PW3A 1KFUL 1CV8A 1DF0A 1F2CA 2DC8A 3K24A 3LXSA 3DF0A 2DZYA 2P0RA 3HWNA 3WXFA 2G8JA 2YJBA 5F02A 1AYVA 3BCNA 1QMYA 2AIMA 1K3BB 2F7DA 2NQGA 1EWOA 1PBHA 4I05A 8PCHA 1NB3A 3LFYA 4GUZA 3D6SA 1Q6KA 2ARYA 4YYVA 1DEUA 4W5CA 5EF4A 2R6NA 3QSDA 2H7JA 1VJVA 4DMYA 2XU5A 1TLOA 3KW9A 3PDFA 4NV7A 4CDFB 7PCKA 1YVBA 2IBIA 1CQDA 3IEJA 1CJLA 3AI8A 1ITOA 5JH3A 4OELA 1VSNA 2XU3A 3OF8A 1TU6A 2GHUA 1MHWA 5A24A 4P6EA 3HHAA 4QH6A 2G7YA 4K7CA 5CVNB 1YALA 3KSEA 1EF7A 1ZCMA 1CVZA 1AYUA 5JA7A 3D9WA 3H89A 2R9NA 1U5IA 2FUDA 1AU4A 1NPZA 4BPVA 3P5WA 2FYEA 2P7UA 1A6RA 4BS6A 1M6DA 3BC3A 3USVA 3O0UA 4CDEB 4PADA 3CBKA 2HXZA 2YJ2A 4FK5A 1KXRA 1EWPA 2DC6A 2IPPB 1W5RA 3H8CA 2YJ8A 1MEMA 3KX1A 4FJCA 1IWDA 2R9CA 1KHPA 3OVXA 3MHSA 4CZWA 3V6CA 1X9YA 2JQFR 1CSBB 1THEA 1BQIA 5J94A 1KFXL 4MZOA 1MIRA 1PPNA 1GECE 1BGOA 1JQPA 3HHIA 1HUCB 1PPPA 3KWBX 4NV8A 1PPDA 2DCCA 1NLJA 5CVOB 3IMAA 2DJFB 1QDQA 2VHFA 1AU2A 2E03A 2OULA 2XU4A 2R9OA 4BQVA 2DZZA 2AU1A 1XKGA 4W4UA 3MHHA 2ATOA 2CIOA 1PXVA 1AU0A 3WXEA 1Y08A 9PAPA 3QT4A 4BGFA 4YYUA 3LTWA 5CHTA 2P86A 2HHNA 4YVAA 3IV2A 2DCBA 4WA6A 3CH3X 1AYWA 3N3KA 4N4ZA 4XR7A 2AYNA 3P5XA 4YYSA 1AIMA 3WXGA 4HWYA 4X6JA 6PADA 3F5VA 1YK7A 1F2AA 2ACTA 1MEGA 4Q8GA 1S4VA 4I07A 1CS8A 4BS5A 3O1GA 4P6GA 2OP3A 3BPFA 3KKUA 3PNRA 1U9WA 2AYOA 4AXLA 2FRAA 2B1MA 2BDZA 4X6HA 1MS6A 4YYWA 1BY8A 2Y6EA 4YYRA 2R9MA 1NQCA 3ERVA 3H7DA 1PCIA 3QJ3A 1YT7A 3B79A 3P5VA 1EWMA 1CB5A 2E00A 2FT2A 1E2TA 2VFCA 1U9XA 1CTEA 3N4CA 2O6XA 1AU3A 2JQGR 4X6IA 3OISA 2FTDA 2BSZA 4B55A 3S3RA 2PBHA 2DC9A 3HD3A 2B1NA 4MSXA 4PI3A 4AXMA 2Y5BA 2BDLA 2PREA 3U8EA 1EWLA 2VHSA 5K16A 2C0YA 1AECA 3IUTA 2DCAA 2DC7A 3NHEA 1U9VA 3CBJA 4FIPA 2YJCA 4CDDB 1QOLA 3ZUAA 2DJGB 3C9EA 3MORA 3M99A 1ME4A 3RVVA 2HH5A 2CB5A 3MTNA 1ATKA 3IOQA 1F2BA 4ZUXU 3OVZA 1NB5A 1W4TA 2R9FA 2FO5A 3K8UA 1Y4HA 3N3GA 4QRXA 4MZSA 2G8EA 2NQIA 5CHVA 4YYQA 1U9QX 2FRQA 1YK8A 1GLOA 2E02A 3K9MA 4OEMA 4DMXA 2PADA 1ICFA 2HD5A 3KFQA 3BPMA 4N8WA 1PIPA 4YV8A 2G6DA 1FH0A 4C5PA 3BOWA 2E01A 3H8BA 2AVWA 4QRGA 2OZ2A 3RVWA 3BWKA 5EGWA 4G54A 2DCDA 1PE6A 4I04A 2AUXA 3H6SA 5PADA 4PP2E 3KWZA 2NQDB 1SNKA 4KLBA 1SP4B 2F1GA 2GFOA 1PADA 2XU1A 3IHPA 1MDWA 4PP1A 3S3QA 4RY2A 1PPOA 4W5BA 1QXPA 1GX3A 3PBHA 3OF9A 3I06A 4Q8HA 1TL9A 1F29A 2PNSA 1POPA 1KHQA 4QRVA 2AS8A 1W6FA 3RVXA 2FQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CH2 X;  1BP4 A;  1O0E A;  3V6E A;  2AUZ A;  1STF E;  5FPW A;  4BSQ A;  3E1Z B;  1NL6 A;  2WBF X;  1GMY A;  3F75 A;  4N79 A;  1ZIV A;  2NQA A;  1ME3 A;  1GCB A;  4CDC B;  4XUI A;  3P5U A;  2YJ9 A;  5CVM A;  4QBB A;  1CPJ A;  3I3T A;  3GCB A;  3TNX A;  3PW3 A;  1KFU L;  1CV8 A;  1DF0 A;  1F2C A;  2DC8 A;  3K24 A;  3LXS A;  3DF0 A;  2DZY A;  2P0R A;  3HWN A;  3WXF A;  2G8J A;  2YJB A;  5F02 A;  1AYV A;  3BCN A;  1QMY A;  2AIM A;  1K3B B;  2F7D A;  2NQG A;  1EWO A;  1PBH A;  4I05 A;  8PCH A;  1NB3 A;  3LFY A;  3D6S A;  1Q6K A;  2ARY A;  4YYV A;  1DEU A;  4W5C A;  5EF4 A;  2R6N A;  3QSD A;  2H7J A;  1VJV A;  4DMY A;  2XU5 A;  1TLO A;  3KW9 A;  3PDF A;  4CDF B;  7PCK A;  1YVB A;  2IBI A;  1CQD A;  3IEJ A;  1CJL A;  3AI8 A;  1ITO A;  5JH3 A;  4OEL A;  1VSN A;  2XU3 A;  3OF8 A;  1TU6 A;  2GHU A;  1MHW A;  5A24 A;  4P6E A;  3HHA A;  4QH6 A;  2G7Y A;  4K7C A;  5CVN B;  1YAL A;  3KSE A;  1EF7 A;  1ZCM A;  1CVZ A;  1AYU A;  5JA7 A;  3H89 A;  2R9N A;  1U5I A;  2FUD A;  1AU4 A;  1NPZ A;  4BPV A;  3P5W A;  2FYE A;  2P7U A;  1A6R A;  4BS6 A;  1M6D A;  3BC3 A;  3USV A;  3O0U A;  4CDE B;  4PAD A;  3CBK A;  2HXZ A;  2YJ2 A;  4FK5 A;  1KXR A;  1EWP A;  2DC6 A;  2IPP B;  3H8C A;  2YJ8 A;  1MEM A;  3KX1 A;  4FJC A;  1IWD A;  2R9C A;  1KHP A;  3OVX A;  3MHS A;  4CZW A;  3V6C A;  1X9Y A;  2JQF R;  1CSB B;  1THE A;  1BQI A;  5J94 A;  1KFX L;  4MZO A;  1MIR A;  1PPN A;  1GEC E;  1BGO A;  1JQP A;  3HHI A;  1HUC B;  1PPP A;  3KWB X;  1PPD A;  2DCC A;  1NLJ A;  5CVO B;  3IMA A;  2DJF B;  1QDQ A;  2VHF A;  1AU2 A;  2E03 A;  2OUL A;  2XU4 A;  2R9O A;  4BQV A;  2DZZ A;  2AU1 A;  1XKG A;  4W4U A;  3MHH A;  2ATO A;  2CIO A;  1PXV A;  1AU0 A;  3WXE A;  1Y08 A;  9PAP A;  3QT4 A;  4YYU A;  5CHT A;  2P86 A;  2HHN A;  4YVA A;  3IV2 A;  2DCB A;  4WA6 A;  3CH3 X;  1AYW A;  3N3K A;  4N4Z A;  4XR7 A;  2AYN A;  3P5X A;  4YYS A;  1AIM A;  3WXG A;  4HWY A;  4X6J A;  6PAD A;  3F5V A;  1YK7 A;  1F2A A;  2ACT A;  1MEG A;  4Q8G A;  1S4V A;  4I07 A;  1CS8 A;  4BS5 A;  3O1G A;  4P6G A;  2OP3 A;  3BPF A;  3KKU A;  3PNR A;  1U9W A;  2AYO A;  4AXL A;  2FRA A;  2B1M A;  2BDZ A;  4X6H A;  1MS6 A;  4YYW A;  1BY8 A;  2Y6E A;  4YYR A;  2R9M A;  1NQC A;  3ERV A;  3H7D A;  1PCI A;  3QJ3 A;  1YT7 A;  3B79 A;  3P5V A;  1EWM A;  1CB5 A;  2E00 A;  2FT2 A;  1U9X A;  1CTE A;  3N4C A;  2O6X A;  1AU3 A;  2JQG R;  4X6I A;  3OIS A;  2FTD A;  3S3R A;  2PBH A;  2DC9 A;  3HD3 A;  2B1N A;  4MSX A;  4PI3 A;  4AXM A;  2Y5B A;  2BDL A;  2PRE A;  3U8E A;  1EWL A;  2VHS A;  5K16 A;  2C0Y A;  1AEC A;  3IUT A;  2DCA A;  2DC7 A;  3NHE A;  1U9V A;  3CBJ A;  4FIP A;  2YJC A;  4CDD B;  1QOL A;  3ZUA A;  2DJG B;  3C9E A;  3MOR A;  3M99 A;  1ME4 A;  3RVV A;  2HH5 A;  2CB5 A;  3MTN A;  1ATK A;  3IOQ A;  1F2B A;  4ZUX U;  3OVZ A;  1NB5 A;  2R9F A;  2FO5 A;  3K8U A;  1Y4H A;  3N3G A;  4QRX A;  4MZS A;  2G8E A;  2NQI A;  5CHV A;  4YYQ A;  1U9Q X;  2FRQ A;  1YK8 A;  1GLO A;  2E02 A;  3K9M A;  4OEM A;  4DMX A;  2PAD A;  1ICF A;  2HD5 A;  3KFQ A;  3BPM A;  4N8W A;  1PIP A;  4YV8 A;  2G6D A;  1FH0 A;  3BOW A;  2E01 A;  3H8B A;  2AVW A;  4QRG A;  2OZ2 A;  3RVW A;  3BWK A;  5EGW A;  4G54 A;  2DCD A;  1PE6 A;  4I04 A;  2AUX A;  3H6S A;  5PAD A;  4PP2 E;  3KWZ A;  2NQD B;  1SNK A;  4KLB A;  1SP4 B;  2F1G A;  2GFO A;  1PAD A;  2XU1 A;  3IHP A;  1MDW A;  4PP1 A;  3S3Q A;  4RY2 A;  1PPO A;  4W5B A;  1QXP A;  3PBH A;  3OF9 A;  3I06 A;  4Q8H A;  1TL9 A;  1F29 A;  2PNS A;  1POP A;  1KHQ A;  4QRV A;  2AS8 A;  3RVX A;  2FQ9 A; 
#chains in the Genus database with same CATH topology
 3CH2 X;  1BP4 A;  1O0E A;  3V6E A;  3PHX A;  2AUZ A;  1STF E;  4RF1 A;  5FPW A;  3E1Z B;  4BSQ A;  1NL6 A;  3BY4 A;  2WBF X;  1GMY A;  3F75 A;  4N79 A;  1ZIV A;  2NQA A;  1ME3 A;  5KO3 A;  1GCB A;  2JTC A;  4RF0 A;  4CDC B;  4XUI A;  3P5U A;  2YJ9 A;  5CVM A;  3BB7 A;  4QBB A;  1CPJ A;  3MP2 A;  3I3T A;  3GCB A;  3TNX A;  3PW3 A;  1KFU L;  1CV8 A;  1DF0 A;  2BU3 A;  1F2C A;  2DC8 A;  3K24 A;  3LXS A;  3DF0 A;  3PRM A;  2DZY A;  2P0R A;  3HWN A;  3WXF A;  2G8J A;  2YJB A;  5F02 A;  1AYV A;  1YZB A;  3BCN A;  1QMY A;  2AIM A;  1K3B B;  2F7D A;  2NQG A;  1EWO A;  1PBH A;  4I05 A;  8PCH A;  1NB3 A;  3LFY A;  2AGA A;  3D6S A;  1Q6K A;  2ARY A;  4YYV A;  1DEU A;  4W5C A;  4BOU A;  2DOS A;  5EF4 A;  2R6N A;  3QSD A;  4WUR A;  2H7J A;  1VJV A;  4DMY A;  2XU5 A;  1TLO A;  3KW9 A;  3PDF A;  4CDF B;  7PCK A;  4HXD B;  1YVB A;  2IBI A;  1CQD A;  3IEJ A;  1CJL A;  3AI8 A;  4MM3 B;  4OW0 A;  1ITO A;  3RNV A;  5JH3 A;  4OEL A;  1VSN A;  2XU3 A;  4GUA A;  3W30 A;  3OF8 A;  1TU6 A;  2GHU A;  1MHW A;  5A24 A;  4P6E A;  3HHA A;  4QH6 A;  2G7Y A;  4K7C A;  5CVN B;  3O65 A;  1YAL A;  3KSE A;  1EF7 A;  1ZCM A;  1CVZ A;  1AYU A;  4P16 A;  3C0R A;  2Z84 A;  5JA7 A;  3H89 A;  2R9N A;  1U5I A;  2FUD A;  1AU4 A;  1NPZ A;  4BPV A;  3P5W A;  5EZQ A;  1UKF A;  2FYE A;  2P7U A;  1A6R A;  4BS6 A;  1M6D A;  3BC3 A;  3USV A;  4RNA A;  3O0U A;  4CDE B;  4PAD A;  3CBK A;  2FE8 A;  2HXZ A;  2YJ2 A;  4MI7 A;  4BOZ A;  4FK5 A;  1KXR A;  1EWP A;  2DC6 A;  2IPP B;  3H8C A;  2YJ8 A;  1MEM A;  3KX1 A;  4FJC A;  1IWD A;  2R9C A;  1KHP A;  3OVX A;  3MHS A;  4CZW A;  3V6C A;  1X9Y A;  4REZ A;  2JQF R;  1CSB B;  1THE A;  1BQI A;  5J94 A;  1KFX L;  4MZO A;  5JZE A;  1MIR A;  1PPN A;  1GEC E;  1BGO A;  1JQP A;  3HHI A;  1HUC B;  1PPP A;  3KWB X;  1DKI A;  3PSE A;  1PPD A;  2DCC A;  1NLJ A;  5CVO B;  3IMA A;  2DJF B;  1QDQ A;  2VHF A;  1AU2 A;  4PT5 A;  2E03 A;  2OUL A;  2XU4 A;  2BTW A;  2R9O A;  4BQV A;  4RKX A;  2DZZ A;  2AU1 A;  1XKG A;  4W4U A;  4R3D A;  2J7Q C;  3MHH A;  2ATO A;  4D8I A;  2CIO A;  1PXV A;  1AU0 A;  3WXE A;  1Y08 A;  9PAP A;  3QT4 A;  4YYU A;  5CHT A;  3PT2 A;  2P86 A;  2HHN A;  4YVA A;  3IV2 A;  2DCB A;  4XZX A;  4WA6 A;  3CH3 X;  1AYW A;  3N3K A;  3PHW A;  4N4Z A;  4XR7 A;  2AYN A;  3P5X A;  4YYS A;  1AIM A;  3WXG A;  4HWY A;  4X6J A;  4OVZ A;  6PAD A;  3F5V A;  1YK7 A;  1F2A A;  2ACT A;  1MEG A;  4BOS A;  4Q8G A;  1S4V A;  4I07 A;  1CS8 A;  4BS5 A;  3O1G A;  4P6G A;  2OP3 A;  3BPF A;  4BOP A;  3KKU A;  3PNR A;  1U9W A;  3MJ5 A;  2AYO A;  4AXL A;  2FRA A;  2B1M A;  2BDZ A;  4X6H A;  1MS6 A;  4YYW A;  1BY8 A;  2Y6E A;  4YYR A;  4IUM A;  2R9M A;  1NQC A;  3ERV A;  3H7D A;  1PCI A;  3QJ3 A;  3TRK A;  1YT7 A;  3B79 A;  3P5V A;  1EWM A;  1CB5 A;  2E00 A;  2FT2 A;  1U9X A;  1CTE A;  4IP3 A;  3N4C A;  4ZTB A;  2O6X A;  1AU3 A;  2UZJ A;  2J7Q A;  2JQG R;  4X6I A;  3OIS A;  5EZS A;  2FTD A;  3IFU A;  3S3R A;  2PBH A;  2DC9 A;  3HD3 A;  2B1N A;  4MSX A;  4PI3 A;  4AXM A;  4BOQ A;  2Y5B A;  2BDL A;  2PRE A;  2JRI A;  3U8E A;  2HWK A;  1EWL A;  3BBA A;  2VHS A;  5K16 A;  2C0Y A;  4M0W A;  1AEC A;  3E9S A;  3IUT A;  3B21 A;  2DCA A;  2DC7 A;  3NHE A;  1U9V A;  3CBJ A;  4FIP A;  2YJC A;  4CDD B;  1QOL A;  3ZUA A;  2DJG B;  3C9E A;  3MOR A;  4A5U A;  3M99 A;  1ME4 A;  3RVV A;  2HH5 A;  3MTV A;  2CB5 A;  3MTN A;  1ATK A;  3IOQ A;  1F2B A;  3OQC A;  4ZUX U;  3OVZ A;  1NB5 A;  2R9F A;  2FO5 A;  3K8U A;  1Y4H A;  3N3G A;  4QRX A;  4MZS A;  2G8E A;  2NQI A;  5CHV A;  4YYQ A;  1U9Q X;  2BTW B;  2FRQ A;  1YK8 A;  1GLO A;  2E02 A;  3K9M A;  4OEM A;  4DMX A;  2PAD A;  1ICF A;  2HD5 A;  3KFQ A;  3BPM A;  4N8W A;  1PIP A;  5E6J A;  4YV8 A;  2G6D A;  1FH0 A;  3BOW A;  3PHU A;  2E01 A;  3H8B A;  2AVW A;  4QRG A;  2OZ2 A;  3RVW A;  3BWK A;  5EGW A;  4G54 A;  2DCD A;  3TMP A;  1PE6 A;  3PRP A;  4I04 A;  2AUX A;  3H6S A;  5PAD A;  3W31 A;  4PP2 E;  3KWZ A;  2NQD B;  1SNK A;  4KLB A;  1SP4 B;  2F1G A;  2GFO A;  4OVZ B;  1PAD A;  3ZNH A;  2XU1 A;  3IHP A;  4D8E A;  1MDW A;  4PP1 A;  3S3Q A;  4RY2 A;  1PPO A;  4W5B A;  1QXP A;  3PBH A;  1PVJ A;  3OF9 A;  3I06 A;  4Q8H A;  1TL9 A;  1F29 A;  2PNS A;  1POP A;  1KHQ A;  4D8B A;  4QRV A;  2AS8 A;  3RVX A;  2FQ9 A; 
#chains in the Genus database with same CATH homology
 3CH2 X;  1BP4 A;  1O0E A;  3V6E A;  2AUZ A;  1STF E;  5FPW A;  4BSQ A;  3E1Z B;  1NL6 A;  2WBF X;  1GMY A;  3F75 A;  4N79 A;  1ZIV A;  2NQA A;  1ME3 A;  1GCB A;  2VFB A;  4CDC B;  4XUI A;  3P5U A;  2YJ9 A;  5CVM A;  4QBB A;  1CPJ A;  3I3T A;  3GCB A;  3TNX A;  3PW3 A;  1KFU L;  1CV8 A;  1DF0 A;  1F2C A;  2DC8 A;  3K24 A;  3LXS A;  3DF0 A;  2DZY A;  2P0R A;  3HWN A;  3WXF A;  2G8J A;  2YJB A;  5F02 A;  1AYV A;  3BCN A;  1QMY A;  2AIM A;  1K3B B;  2F7D A;  2NQG A;  1EWO A;  1PBH A;  4I05 A;  8PCH A;  1NB3 A;  3LFY A;  4GUZ A;  3D6S A;  1Q6K A;  2ARY A;  4YYV A;  1DEU A;  4W5C A;  5EF4 A;  2R6N A;  3QSD A;  2H7J A;  1VJV A;  4DMY A;  2XU5 A;  1TLO A;  3KW9 A;  3PDF A;  4NV7 A;  4CDF B;  7PCK A;  1YVB A;  2IBI A;  1CQD A;  3IEJ A;  1CJL A;  3AI8 A;  1ITO A;  5JH3 A;  4OEL A;  1VSN A;  2XU3 A;  3OF8 A;  1TU6 A;  2GHU A;  1MHW A;  5A24 A;  4P6E A;  3HHA A;  4QH6 A;  2G7Y A;  4K7C A;  5CVN B;  1YAL A;  3KSE A;  1EF7 A;  1ZCM A;  1CVZ A;  1AYU A;  5JA7 A;  3D9W A;  3H89 A;  2R9N A;  1U5I A;  2FUD A;  1AU4 A;  1NPZ A;  4BPV A;  3P5W A;  2FYE A;  2P7U A;  1A6R A;  4BS6 A;  1M6D A;  3BC3 A;  3USV A;  3O0U A;  4CDE B;  4PAD A;  3CBK A;  2HXZ A;  2YJ2 A;  4FK5 A;  1KXR A;  1EWP A;  2DC6 A;  2IPP B;  1W5R A;  3H8C A;  2YJ8 A;  1MEM A;  3KX1 A;  4FJC A;  1IWD A;  2R9C A;  1KHP A;  3OVX A;  3MHS A;  4CZW A;  3V6C A;  1X9Y A;  2JQF R;  1CSB B;  1THE A;  1BQI A;  5J94 A;  1KFX L;  4MZO A;  1MIR A;  1PPN A;  1GEC E;  1BGO A;  1JQP A;  3HHI A;  1HUC B;  1PPP A;  3KWB X;  4NV8 A;  1PPD A;  2DCC A;  1NLJ A;  5CVO B;  3IMA A;  2DJF B;  1QDQ A;  2VHF A;  1AU2 A;  2E03 A;  2OUL A;  2XU4 A;  2R9O A;  4BQV A;  2DZZ A;  2AU1 A;  1XKG A;  4W4U A;  3MHH A;  2ATO A;  2CIO A;  1PXV A;  1AU0 A;  3WXE A;  1Y08 A;  9PAP A;  3QT4 A;  4BGF A;  4YYU A;  3LTW A;  5CHT A;  2P86 A;  2HHN A;  4YVA A;  3IV2 A;  2DCB A;  4WA6 A;  3CH3 X;  1AYW A;  3N3K A;  4N4Z A;  4XR7 A;  2AYN A;  3P5X A;  4YYS A;  1AIM A;  3WXG A;  4HWY A;  4X6J A;  6PAD A;  3F5V A;  1YK7 A;  1F2A A;  2ACT A;  1MEG A;  4Q8G A;  1S4V A;  4I07 A;  1CS8 A;  4BS5 A;  3O1G A;  4P6G A;  2OP3 A;  3BPF A;  3KKU A;  3PNR A;  1U9W A;  2AYO A;  4AXL A;  2FRA A;  2B1M A;  2BDZ A;  4X6H A;  1MS6 A;  4YYW A;  1BY8 A;  2Y6E A;  4YYR A;  2R9M A;  1NQC A;  3ERV A;  3H7D A;  1PCI A;  3QJ3 A;  1YT7 A;  3B79 A;  3P5V A;  1EWM A;  1CB5 A;  2E00 A;  2FT2 A;  1E2T A;  2VFC A;  1U9X A;  1CTE A;  3N4C A;  2O6X A;  1AU3 A;  2JQG R;  4X6I A;  3OIS A;  2FTD A;  2BSZ A;  4B55 A;  3S3R A;  2PBH A;  2DC9 A;  3HD3 A;  2B1N A;  4MSX A;  4PI3 A;  4AXM A;  2Y5B A;  2BDL A;  2PRE A;  3U8E A;  1EWL A;  2VHS A;  5K16 A;  2C0Y A;  1AEC A;  3IUT A;  2DCA A;  2DC7 A;  3NHE A;  1U9V A;  3CBJ A;  4FIP A;  2YJC A;  4CDD B;  1QOL A;  3ZUA A;  2DJG B;  3C9E A;  3MOR A;  3M99 A;  1ME4 A;  3RVV A;  2HH5 A;  2CB5 A;  3MTN A;  1ATK A;  3IOQ A;  1F2B A;  4ZUX U;  3OVZ A;  1NB5 A;  1W4T A;  2R9F A;  2FO5 A;  3K8U A;  1Y4H A;  3N3G A;  4QRX A;  4MZS A;  2G8E A;  2NQI A;  5CHV A;  4YYQ A;  1U9Q X;  2FRQ A;  1YK8 A;  1GLO A;  2E02 A;  3K9M A;  4OEM A;  4DMX A;  2PAD A;  1ICF A;  2HD5 A;  3KFQ A;  3BPM A;  4N8W A;  1PIP A;  4YV8 A;  2G6D A;  1FH0 A;  4C5P A;  3BOW A;  2E01 A;  3H8B A;  2AVW A;  4QRG A;  2OZ2 A;  3RVW A;  3BWK A;  5EGW A;  4G54 A;  2DCD A;  1PE6 A;  4I04 A;  2AUX A;  3H6S A;  5PAD A;  4PP2 E;  3KWZ A;  2NQD B;  1SNK A;  4KLB A;  1SP4 B;  2F1G A;  2GFO A;  1PAD A;  2XU1 A;  3IHP A;  1MDW A;  4PP1 A;  3S3Q A;  4RY2 A;  1PPO A;  4W5B A;  1QXP A;  1GX3 A;  3PBH A;  3OF9 A;  3I06 A;  4Q8H A;  1TL9 A;  1F29 A;  2PNS A;  1POP A;  1KHQ A;  4QRV A;  2AS8 A;  1W6F A;  3RVX A;  2FQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...