4PI3A

Crystal structure analysis of cruzain bound to vinyl sulfone analog of wrr-483 (wrr-666)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Synthesis and Evaluation of Oxyguanidine Analogues of the Cysteine Protease Inhibitor WRR-483 against Cruzain.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4pi3A00
3IOQA 4WA6A 2G7YA 3QT4A 1FH0A 5EGWA 4G54A 2E00A 3MTNA 2O6XA 3CH3X 4KLBA 2FRAA 1KHPA 4BS5A 1CPJA 3RVWA 1KHQA 1STFE 2DC8A 4BQVA 1QXPA 2FQ9A 2DCBA 1EF7A 2G8JA 2PNSA 1M6DA 1MEGA 1YVBA 2XU4A 3KWZA 2ACTA 1SNKA 4W5CA 4XR7A 3I3TA 3KWBX 4PP1A 9PAPA 1VSNA 3HWNA 1ZIVA 4XUIA 3HHAA 3N4CA 1F2AA 1S4VA 3QSDA 4N79A 1EWPA 1X9YA 1A6RA 1HUCB 4N4ZA 3ERVA 2AU1A 1AIMA 1PPNA 2YJ9A 3M99A 4QRXA 2DC6A 1CB5A 1Y4HA 1ICFA 2AUXA 2NQGA 1QOLA 3CH2X 2DJGB 2AVWA 3RVXA 3USVA 3H6SA 3P5WA 3N3KA 1QDQA 4BPVA 2PBHA 3IUTA 4DMYA 3LFYA 3LXSA 1Y08A 1AU4A 3OF9A 3IV2A 4QH6A 2XU1A 3I06A 2FYEA 5CVMA 2F1GA 3BPFA 4YYVA 2VHFA 4CDDB 1BQIA 2DJFB 2H7JA 3IEJA 4PI3A 4BSQA 2ATOA 4QRVA 1AU2A 1NB3A 1NLJA 2FRQA 5CHTA 3F75A 4CDCB 2E01A 1GECE 2P0RA 5J94A 1PPPA 1IWDA 2NQIA 4MSXA 1DF0A 2G8EA 1PCIA 2FUDA 3BCNA 1CSBB 1TL9A 5FPWA 3CBJA 1PADA 2R9CA 3D6SA 4AXMA 2YJ8A 2OP3A 3IHPA 3HHIA 5PADA 5CVNB 2R9OA 2YJBA 3P5UA 3PBHA 4MZOA 4AXLA 2XU3A 2AS8A 2DZYA 3O1GA 4OEMA 1ITOA 1VJVA 1PXVA 3O0UA 4OELA 4P6GA 2B1NA 4PADA 2R6NA 4CZWA 3OF8A 1KXRA 2B1MA 4X6IA 3OVXA 2FO5A 2YJ2A 4YYWA 3MHHA 1THEA 4FIPA 5JA7A 3PNRA 3V6EA 6PADA 2F7DA 2YJCA 3BPMA 3H8CA 2DCAA 1AYVA 3MORA 1AU0A 2IPPB 3WXEA 3KW9A 1MDWA 4YYRA 4QBBA 3V6CA 2FT2A 1ATKA 3C9EA 1NL6A 2HHNA 3GCBA 1TU6A 2OZ2A 4N8WA 3H7DA 2CIOA 5F02A 1Q6KA 1JQPA 1QMYA 4HWYA 3P5VA 4YYUA 2Y5BA 2GFOA 3QJ3A 3H89A 1YT7A 3BC3A 4I07A 4FJCA 4ZUXU 2NQDB 2IBIA 3KKUA 1PBHA 1F29A 2Y6EA 4I05A 1NQCA 4YYQA 1CQDA 2DCCA 3OVZA 2E02A 3PDFA 2JQGR 2HD5A 1PPOA 2FTDA 1XKGA 3TNXA 3E1ZB 1CVZA 1GCBA 4DMXA 1SP4B 4BS6A 4W4UA 1PPDA 2G6DA 4W5BA 1NB5A 3ZUAA 2BDLA 1GMYA 2PADA 2CB5A 2PREA 1PIPA 4P6EA 1NPZA 2AIMA 2AYNA 4CDEB 3NHEA 4K7CA 3B79A 1F2CA 1AECA 2R9MA 2JQFR 1MS6A 2DZZA 4Q8GA 1MIRA 1EWOA 1PE6A 4RY2A 3RVVA 4YV8A 2HXZA 3P5XA 3K8UA 5JH3A 2HH5A 1BP4A 1BGOA 5K16A 4PP2E 3DF0A 1MEMA 2DC9A 5EF4A 2OULA 1AYWA 1U9WA 2GHUA 3K9MA 3BOWA 3S3RA 2XU5A 1AU3A 2WBFX 4Q8HA 4X6HA 3BWKA 5CVOB 3F5VA 2ARYA 1YALA 2P86A 2DC7A 3U8EA 3K24A 3PW3A 3S3QA 1YK7A 1CS8A 1MHWA 5A24A 1ME3A 1U9QX 1O0EA 1ME4A 1CTEA 2NQAA 2R9NA 3HD3A 1EWLA 1TLOA 3KX1A 1KFUL 1GLOA 3IMAA 2DCDA 1AYUA 4I04A 1KFXL 5CHVA 3WXFA 1K3BB 3N3GA 2C0YA 3CBKA 1U9XA 3KSEA 2R9FA 1DEUA 2VHSA 1CV8A 2P7UA 1F2BA 2AYOA 3WXGA 1POPA 4X6JA 4YVAA 4MZSA 3H8BA 3AI8A 7PCKA 2AUZA 8PCHA 4CDFB 3OISA 3KFQA 1EWMA 1YK8A 1BY8A 4YYSA 1ZCMA 1U9VA 4QRGA 2E03A 1CJLA 3MHSA 4FK5A 2BDZA 1U5IA
chains in the Genus database with same CATH superfamily
3IOQA 4WA6A 2G7YA 3QT4A 1FH0A 5EGWA 4G54A 2E00A 3MTNA 2O6XA 3CH3X 4KLBA 2FRAA 1KHPA 4BS5A 1CPJA 3IFUA 3RVWA 1KHQA 1STFE 2DC8A 4BQVA 5JZEA 1QXPA 2J7QC 2FQ9A 2DCBA 1EF7A 3W30A 2G8JA 2PNSA 1M6DA 4D8BA 1MEGA 2HWKA 1YVBA 2XU4A 3KWZA 2ACTA 1SNKA 4W5CA 4XR7A 3I3TA 3PSEA 1YZBA 3KWBX 3RNVA 3BB7A 4PP1A 3PHWA 9PAPA 1VSNA 4MI7A 3HWNA 1ZIVA 4XUIA 3HHAA 3N4CA 1F2AA 1S4VA 3QSDA 5E6JA 4N79A 1EWPA 4P16A 1X9YA 1A6RA 1HUCB 4N4ZA 4M0WA 3ERVA 2AU1A 1AIMA 1PPNA 4REZA 4D8EA 2YJ9A 3M99A 4QRXA 2DC6A 1CB5A 3O65A 1Y4HA 1ICFA 2AUXA 2NQGA 1QOLA 3CH2X 4XZXA 2DJGB 5KO3A 2AVWA 3RVXA 3USVA 3H6SA 3P5WA 3N3KA 3MP2A 1QDQA 4BPVA 4ZTBA 4D8IA 2PBHA 3IUTA 4DMYA 3LFYA 3LXSA 1Y08A 1AU4A 3OF9A 3IV2A 4QH6A 2XU1A 3I06A 2FYEA 5CVMA 2F1GA 4GUAA 3C0RA 3BPFA 4YYVA 2VHFA 4CDDB 1BQIA 2DJFB 2H7JA 3IEJA 4PI3A 4BSQA 2ATOA 4QRVA 1AU2A 1NB3A 1NLJA 3TMPA 2BTWB 4BOUA 3OQCA 2FRQA 5CHTA 4BOSA 3F75A 4CDCB 4BOPA 3PHUA 2E01A 1GECE 2P0RA 5J94A 1PPPA 3MTVA 1IWDA 2NQIA 2BTWA 4MSXA 1DF0A 2G8EA 1PCIA 2FUDA 3BCNA 1CSBB 1TL9A 2BU3A 5FPWA 3CBJA 1PADA 2R9CA 3D6SA 4AXMA 2YJ8A 2OP3A 3IHPA 3HHIA 5PADA 5CVNB 2R9OA 2YJBA 3P5UA 3PBHA 4MZOA 4AXLA 2XU3A 2AS8A 2DZYA 3O1GA 4OEMA 1ITOA 1VJVA 1PXVA 3MJ5A 3O0UA 4OELA 4P6GA 2B1NA 4PADA 2R6NA 4CZWA 5EZSA 3OF8A 1KXRA 4MM3B 2B1MA 4X6IA 2Z84A 3OVXA 2FO5A 2YJ2A 4YYWA 3MHHA 1THEA 4FIPA 5JA7A 3PNRA 4RKXA 3V6EA 6PADA 2F7DA 2YJCA 3BPMA 3H8CA 3ZNHA 2DCAA 1AYVA 3MORA 1AU0A 2IPPB 3WXEA 3KW9A 1MDWA 4YYRA 4QBBA 3V6CA 2FT2A 1ATKA 2UZJA 3W31A 3C9EA 1NL6A 2HHNA 3GCBA 1TU6A 2OZ2A 4N8WA 3H7DA 2CIOA 2FE8A 5F02A 1Q6KA 1JQPA 1QMYA 4HWYA 3P5VA 4A5UA 4BOQA 4RF1A 4YYUA 2Y5BA 2GFOA 3QJ3A 3H89A 3PT2A 1YT7A 3BC3A 4I07A 4FJCA 4ZUXU 2NQDB 2IBIA 3KKUA 1PBHA 1F29A 2Y6EA 4I05A 1NQCA 4YYQA 1CQDA 2DCCA 3OVZA 2E02A 2DOSA 3PDFA 2JQGR 2HD5A 1PPOA 2FTDA 1XKGA 3TNXA 3E1ZB 1CVZA 1GCBA 4DMXA 1SP4B 4BS6A 4W4UA 1PPDA 2G6DA 4W5BA 1NB5A 3ZUAA 2JTCA 2BDLA 1GMYA 2PADA 2CB5A 2PREA 1PIPA 4P6EA 1NPZA 2AIMA 2AYNA 4R3DA 4CDEB 3NHEA 4K7CA 4IUMA 3B79A 1F2CA 1AECA 3PHXA 2R9MA 2JQFR 1MS6A 2DZZA 4Q8GA 1MIRA 1EWOA 1PE6A 4RY2A 4OVZB 3RVVA 4YV8A 2HXZA 3P5XA 3K8UA 5JH3A 2HH5A 4BOZA 1BP4A 1BGOA 1PVJA 5K16A 4PP2E 3DF0A 1MEMA 4OVZA 2AGAA 2DC9A 5EF4A 2OULA 1AYWA 1U9WA 2GHUA 3K9MA 3BOWA 3S3RA 2XU5A 1AU3A 2WBFX 3E9SA 4Q8HA 4X6HA 3BWKA 3B21A 5CVOB 3F5VA 2ARYA 1YALA 2P86A 2DC7A 4OW0A 3K24A 3U8EA 3PW3A 1UKFA 3S3QA 1YK7A 1CS8A 2JRIA 1MHWA 3PRMA 5A24A 1ME3A 1U9QX 4IP3A 1O0EA 1ME4A 1CTEA 4RF0A 2NQAA 1DKIA 2R9NA 3HD3A 1EWLA 1TLOA 3KX1A 4HXDB 1KFUL 1GLOA 3IMAA 2DCDA 1AYUA 4I04A 1KFXL 5CHVA 3WXFA 1K3BB 3N3GA 2C0YA 3TRKA 3CBKA 1U9XA 3KSEA 3BBAA 2R9FA 1DEUA 2VHSA 1CV8A 2P7UA 1F2BA 2AYOA 3WXGA 1POPA 4X6JA 4YVAA 4MZSA 4WURA 3H8BA 3AI8A 7PCKA 3BY4A 2AUZA 8PCHA 5EZQA 4CDFB 3OISA 3KFQA 1EWMA 1YK8A 1BY8A 4YYSA 1ZCMA 4PT5A 1U9VA 3PRPA 2J7QA 4QRGA 2E03A 4RNAA 1CJLA 3MHSA 4FK5A 2BDZA 1U5IA
chains in the Genus database with same CATH topology
3IOQA 4WA6A 2G7YA 3QT4A 1FH0A 5EGWA 4G54A 2E00A 3MTNA 2O6XA 3CH3X 4KLBA 2FRAA 1KHPA 4BS5A 1CPJA 3RVWA 1KHQA 1STFE 2DC8A 4BQVA 1QXPA 2FQ9A 2DCBA 1EF7A 3LTWA 2G8JA 2PNSA 1M6DA 1MEGA 1YVBA 2XU4A 3KWZA 2ACTA 1SNKA 4W5CA 4XR7A 3I3TA 4NV8A 3D9WA 3KWBX 4PP1A 9PAPA 1VSNA 3HWNA 1ZIVA 4XUIA 3HHAA 3N4CA 1F2AA 1S4VA 3QSDA 4N79A 1EWPA 4B55A 1X9YA 1A6RA 1HUCB 4N4ZA 3ERVA 2AU1A 1AIMA 1PPNA 2YJ9A 3M99A 4QRXA 2DC6A 1CB5A 1Y4HA 1ICFA 2AUXA 2NQGA 1QOLA 3CH2X 2DJGB 2AVWA 3RVXA 3USVA 3H6SA 3P5WA 3N3KA 1QDQA 4BPVA 2PBHA 3IUTA 4DMYA 3LFYA 3LXSA 1Y08A 1AU4A 3OF9A 3IV2A 4QH6A 2XU1A 3I06A 2FYEA 5CVMA 2F1GA 3BPFA 4YYVA 2VHFA 4CDDB 1BQIA 2DJFB 2H7JA 3IEJA 4PI3A 4BSQA 2ATOA 4QRVA 1AU2A 1NB3A 1NLJA 2FRQA 5CHTA 3F75A 4CDCB 2E01A 1GECE 2P0RA 5J94A 1PPPA 1IWDA 2NQIA 4MSXA 1DF0A 2G8EA 1PCIA 2FUDA 3BCNA 1CSBB 1TL9A 5FPWA 3CBJA 1PADA 2R9CA 3D6SA 4AXMA 2YJ8A 2OP3A 3IHPA 3HHIA 5PADA 5CVNB 2R9OA 4BGFA 2YJBA 3P5UA 3PBHA 4MZOA 4AXLA 2XU3A 2AS8A 2DZYA 3O1GA 4OEMA 1ITOA 1VJVA 1PXVA 3O0UA 4OELA 1W6FA 4P6GA 2VFCA 2B1NA 4PADA 2R6NA 4CZWA 3OF8A 1KXRA 2B1MA 4X6IA 3OVXA 2FO5A 2VFBA 2YJ2A 1GX3A 4YYWA 3MHHA 1THEA 4FIPA 5JA7A 3PNRA 3V6EA 6PADA 2F7DA 2YJCA 3BPMA 3H8CA 2DCAA 1AYVA 3MORA 1AU0A 2IPPB 3WXEA 3KW9A 1MDWA 4YYRA 4QBBA 3V6CA 2FT2A 1ATKA 3C9EA 1NL6A 2HHNA 3GCBA 1TU6A 2OZ2A 4N8WA 3H7DA 2CIOA 5F02A 1Q6KA 1JQPA 1QMYA 4HWYA 3P5VA 4C5PA 4YYUA 2Y5BA 2GFOA 3QJ3A 3H89A 1YT7A 3BC3A 4I07A 4FJCA 4ZUXU 2NQDB 2IBIA 3KKUA 1PBHA 1F29A 4I05A 2Y6EA 2BSZA 1NQCA 4YYQA 1CQDA 2DCCA 3OVZA 2E02A 3PDFA 4GUZA 2JQGR 2HD5A 1PPOA 2FTDA 1XKGA 3TNXA 3E1ZB 1CVZA 1GCBA 4DMXA 1SP4B 4BS6A 4W4UA 1PPDA 2G6DA 4W5BA 1NB5A 3ZUAA 2BDLA 1GMYA 2PADA 2CB5A 2PREA 1PIPA 4P6EA 1NPZA 2AIMA 2AYNA 4CDEB 3NHEA 4K7CA 3B79A 1F2CA 1AECA 1E2TA 1W4TA 2R9MA 2JQFR 1MS6A 2DZZA 4Q8GA 1MIRA 1EWOA 1PE6A 4RY2A 3RVVA 4YV8A 2HXZA 3P5XA 3K8UA 5JH3A 2HH5A 1W5RA 1BP4A 1BGOA 5K16A 4PP2E 3DF0A 1MEMA 2DC9A 5EF4A 2OULA 1AYWA 1U9WA 2GHUA 3K9MA 3BOWA 3S3RA 2XU5A 1AU3A 2WBFX 4Q8HA 4X6HA 3BWKA 5CVOB 3F5VA 2ARYA 1YALA 2P86A 2DC7A 3U8EA 3K24A 3PW3A 3S3QA 1YK7A 1CS8A 1MHWA 5A24A 1ME3A 1U9QX 1O0EA 1ME4A 1CTEA 2NQAA 2R9NA 3HD3A 1EWLA 1TLOA 3KX1A 1KFUL 1GLOA 3IMAA 2DCDA 1AYUA 4NV7A 4I04A 1KFXL 5CHVA 3WXFA 1K3BB 3N3GA 2C0YA 3CBKA 1U9XA 3KSEA 2R9FA 1DEUA 2VHSA 1CV8A 2P7UA 1F2BA 2AYOA 3WXGA 1POPA 4X6JA 4YVAA 4MZSA 3H8BA 3AI8A 7PCKA 2AUZA 8PCHA 4CDFB 3OISA 3KFQA 1EWMA 1YK8A 1BY8A 4YYSA 1ZCMA 1U9VA 4QRGA 2E03A 1CJLA 3MHSA 4FK5A 2BDZA 1U5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOQ A;  4WA6 A;  2G7Y A;  3QT4 A;  1FH0 A;  5EGW A;  4G54 A;  2E00 A;  3MTN A;  2O6X A;  3CH3 X;  4KLB A;  2FRA A;  1KHP A;  4BS5 A;  1CPJ A;  3RVW A;  1KHQ A;  1STF E;  2DC8 A;  4BQV A;  1QXP A;  2FQ9 A;  2DCB A;  1EF7 A;  2G8J A;  2PNS A;  1M6D A;  1MEG A;  1YVB A;  2XU4 A;  3KWZ A;  2ACT A;  1SNK A;  4W5C A;  4XR7 A;  3I3T A;  3KWB X;  4PP1 A;  9PAP A;  1VSN A;  3HWN A;  1ZIV A;  4XUI A;  3HHA A;  3N4C A;  1F2A A;  1S4V A;  3QSD A;  4N79 A;  1EWP A;  1X9Y A;  1A6R A;  1HUC B;  4N4Z A;  3ERV A;  2AU1 A;  1AIM A;  1PPN A;  2YJ9 A;  3M99 A;  4QRX A;  2DC6 A;  1CB5 A;  1Y4H A;  1ICF A;  2AUX A;  2NQG A;  1QOL A;  3CH2 X;  2DJG B;  2AVW A;  3RVX A;  3USV A;  3H6S A;  3P5W A;  3N3K A;  1QDQ A;  4BPV A;  2PBH A;  3IUT A;  4DMY A;  3LFY A;  3LXS A;  1Y08 A;  1AU4 A;  3OF9 A;  3IV2 A;  4QH6 A;  2XU1 A;  3I06 A;  2FYE A;  5CVM A;  2F1G A;  3BPF A;  4YYV A;  2VHF A;  4CDD B;  1BQI A;  2DJF B;  2H7J A;  3IEJ A;  4PI3 A;  4BSQ A;  2ATO A;  4QRV A;  1AU2 A;  1NB3 A;  1NLJ A;  2FRQ A;  5CHT A;  3F75 A;  4CDC B;  2E01 A;  1GEC E;  2P0R A;  5J94 A;  1PPP A;  1IWD A;  2NQI A;  4MSX A;  1DF0 A;  2G8E A;  1PCI A;  2FUD A;  3BCN A;  1CSB B;  1TL9 A;  5FPW A;  3CBJ A;  1PAD A;  2R9C A;  3D6S A;  4AXM A;  2YJ8 A;  2OP3 A;  3IHP A;  3HHI A;  5PAD A;  5CVN B;  2R9O A;  2YJB A;  3P5U A;  3PBH A;  4MZO A;  4AXL A;  2XU3 A;  2AS8 A;  2DZY A;  3O1G A;  4OEM A;  1ITO A;  1VJV A;  1PXV A;  3O0U A;  4OEL A;  4P6G A;  2B1N A;  4PAD A;  2R6N A;  4CZW A;  3OF8 A;  1KXR A;  2B1M A;  4X6I A;  3OVX A;  2FO5 A;  2YJ2 A;  4YYW A;  3MHH A;  1THE A;  4FIP A;  5JA7 A;  3PNR A;  3V6E A;  6PAD A;  2F7D A;  2YJC A;  3BPM A;  3H8C A;  2DCA A;  1AYV A;  3MOR A;  1AU0 A;  2IPP B;  3WXE A;  3KW9 A;  1MDW A;  4YYR A;  4QBB A;  3V6C A;  2FT2 A;  1ATK A;  3C9E A;  1NL6 A;  2HHN A;  3GCB A;  1TU6 A;  2OZ2 A;  4N8W A;  3H7D A;  2CIO A;  5F02 A;  1Q6K A;  1JQP A;  1QMY A;  4HWY A;  3P5V A;  4YYU A;  2Y5B A;  2GFO A;  3QJ3 A;  3H89 A;  1YT7 A;  3BC3 A;  4I07 A;  4FJC A;  4ZUX U;  2NQD B;  2IBI A;  3KKU A;  1PBH A;  1F29 A;  2Y6E A;  4I05 A;  1NQC A;  4YYQ A;  1CQD A;  2DCC A;  3OVZ A;  2E02 A;  3PDF A;  2JQG R;  2HD5 A;  1PPO A;  2FTD A;  1XKG A;  3TNX A;  3E1Z B;  1CVZ A;  1GCB A;  4DMX A;  1SP4 B;  4BS6 A;  4W4U A;  1PPD A;  2G6D A;  4W5B A;  1NB5 A;  3ZUA A;  2BDL A;  1GMY A;  2PAD A;  2CB5 A;  2PRE A;  1PIP A;  4P6E A;  1NPZ A;  2AIM A;  2AYN A;  4CDE B;  3NHE A;  4K7C A;  3B79 A;  1F2C A;  1AEC A;  2R9M A;  2JQF R;  1MS6 A;  2DZZ A;  4Q8G A;  1MIR A;  1EWO A;  1PE6 A;  4RY2 A;  3RVV A;  4YV8 A;  2HXZ A;  3P5X A;  3K8U A;  5JH3 A;  2HH5 A;  1BP4 A;  1BGO A;  5K16 A;  4PP2 E;  3DF0 A;  1MEM A;  2DC9 A;  5EF4 A;  2OUL A;  1AYW A;  1U9W A;  2GHU A;  3K9M A;  3BOW A;  3S3R A;  2XU5 A;  1AU3 A;  2WBF X;  4Q8H A;  4X6H A;  3BWK A;  5CVO B;  3F5V A;  2ARY A;  1YAL A;  2P86 A;  2DC7 A;  3U8E A;  3K24 A;  3PW3 A;  3S3Q A;  1YK7 A;  1CS8 A;  1MHW A;  5A24 A;  1ME3 A;  1U9Q X;  1O0E A;  1ME4 A;  1CTE A;  2NQA A;  2R9N A;  3HD3 A;  1EWL A;  1TLO A;  3KX1 A;  1KFU L;  1GLO A;  3IMA A;  2DCD A;  1AYU A;  4I04 A;  1KFX L;  5CHV A;  3WXF A;  1K3B B;  3N3G A;  2C0Y A;  3CBK A;  1U9X A;  3KSE A;  2R9F A;  1DEU A;  2VHS A;  1CV8 A;  2P7U A;  1F2B A;  2AYO A;  3WXG A;  1POP A;  4X6J A;  4YVA A;  4MZS A;  3H8B A;  3AI8 A;  7PCK A;  2AUZ A;  8PCH A;  4CDF B;  3OIS A;  3KFQ A;  1EWM A;  1YK8 A;  1BY8 A;  4YYS A;  1ZCM A;  1U9V A;  4QRG A;  2E03 A;  1CJL A;  3MHS A;  4FK5 A;  2BDZ A;  1U5I A; 
#chains in the Genus database with same CATH topology
 3IOQ A;  4WA6 A;  2G7Y A;  3QT4 A;  1FH0 A;  5EGW A;  4G54 A;  2E00 A;  3MTN A;  2O6X A;  3CH3 X;  4KLB A;  2FRA A;  1KHP A;  4BS5 A;  1CPJ A;  3IFU A;  3RVW A;  1KHQ A;  1STF E;  2DC8 A;  4BQV A;  5JZE A;  1QXP A;  2J7Q C;  2FQ9 A;  2DCB A;  1EF7 A;  3W30 A;  2G8J A;  2PNS A;  1M6D A;  4D8B A;  1MEG A;  2HWK A;  1YVB A;  2XU4 A;  3KWZ A;  2ACT A;  1SNK A;  4W5C A;  4XR7 A;  3I3T A;  3PSE A;  1YZB A;  3KWB X;  3RNV A;  3BB7 A;  4PP1 A;  3PHW A;  9PAP A;  1VSN A;  4MI7 A;  3HWN A;  1ZIV A;  4XUI A;  3HHA A;  3N4C A;  1F2A A;  1S4V A;  3QSD A;  5E6J A;  4N79 A;  1EWP A;  4P16 A;  1X9Y A;  1A6R A;  1HUC B;  4N4Z A;  4M0W A;  3ERV A;  2AU1 A;  1AIM A;  1PPN A;  4REZ A;  4D8E A;  2YJ9 A;  3M99 A;  4QRX A;  2DC6 A;  1CB5 A;  3O65 A;  1Y4H A;  1ICF A;  2AUX A;  2NQG A;  1QOL A;  3CH2 X;  4XZX A;  2DJG B;  5KO3 A;  2AVW A;  3RVX A;  3USV A;  3H6S A;  3P5W A;  3N3K A;  3MP2 A;  1QDQ A;  4BPV A;  4ZTB A;  4D8I A;  2PBH A;  3IUT A;  4DMY A;  3LFY A;  3LXS A;  1Y08 A;  1AU4 A;  3OF9 A;  3IV2 A;  4QH6 A;  2XU1 A;  3I06 A;  2FYE A;  5CVM A;  2F1G A;  4GUA A;  3C0R A;  3BPF A;  4YYV A;  2VHF A;  4CDD B;  1BQI A;  2DJF B;  2H7J A;  3IEJ A;  4PI3 A;  4BSQ A;  2ATO A;  4QRV A;  1AU2 A;  1NB3 A;  1NLJ A;  3TMP A;  2BTW B;  4BOU A;  3OQC A;  2FRQ A;  5CHT A;  4BOS A;  3F75 A;  4CDC B;  4BOP A;  3PHU A;  2E01 A;  1GEC E;  2P0R A;  5J94 A;  1PPP A;  3MTV A;  1IWD A;  2NQI A;  2BTW A;  4MSX A;  1DF0 A;  2G8E A;  1PCI A;  2FUD A;  3BCN A;  1CSB B;  1TL9 A;  2BU3 A;  5FPW A;  3CBJ A;  1PAD A;  2R9C A;  3D6S A;  4AXM A;  2YJ8 A;  2OP3 A;  3IHP A;  3HHI A;  5PAD A;  5CVN B;  2R9O A;  2YJB A;  3P5U A;  3PBH A;  4MZO A;  4AXL A;  2XU3 A;  2AS8 A;  2DZY A;  3O1G A;  4OEM A;  1ITO A;  1VJV A;  1PXV A;  3MJ5 A;  3O0U A;  4OEL A;  4P6G A;  2B1N A;  4PAD A;  2R6N A;  4CZW A;  5EZS A;  3OF8 A;  1KXR A;  4MM3 B;  2B1M A;  4X6I A;  2Z84 A;  3OVX A;  2FO5 A;  2YJ2 A;  4YYW A;  3MHH A;  1THE A;  4FIP A;  5JA7 A;  3PNR A;  4RKX A;  3V6E A;  6PAD A;  2F7D A;  2YJC A;  3BPM A;  3H8C A;  3ZNH A;  2DCA A;  1AYV A;  3MOR A;  1AU0 A;  2IPP B;  3WXE A;  3KW9 A;  1MDW A;  4YYR A;  4QBB A;  3V6C A;  2FT2 A;  1ATK A;  2UZJ A;  3W31 A;  3C9E A;  1NL6 A;  2HHN A;  3GCB A;  1TU6 A;  2OZ2 A;  4N8W A;  3H7D A;  2CIO A;  2FE8 A;  5F02 A;  1Q6K A;  1JQP A;  1QMY A;  4HWY A;  3P5V A;  4A5U A;  4BOQ A;  4RF1 A;  4YYU A;  2Y5B A;  2GFO A;  3QJ3 A;  3H89 A;  3PT2 A;  1YT7 A;  3BC3 A;  4I07 A;  4FJC A;  4ZUX U;  2NQD B;  2IBI A;  3KKU A;  1PBH A;  1F29 A;  2Y6E A;  4I05 A;  1NQC A;  4YYQ A;  1CQD A;  2DCC A;  3OVZ A;  2E02 A;  2DOS A;  3PDF A;  2JQG R;  2HD5 A;  1PPO A;  2FTD A;  1XKG A;  3TNX A;  3E1Z B;  1CVZ A;  1GCB A;  4DMX A;  1SP4 B;  4BS6 A;  4W4U A;  1PPD A;  2G6D A;  4W5B A;  1NB5 A;  3ZUA A;  2JTC A;  2BDL A;  1GMY A;  2PAD A;  2CB5 A;  2PRE A;  1PIP A;  4P6E A;  1NPZ A;  2AIM A;  2AYN A;  4R3D A;  4CDE B;  3NHE A;  4K7C A;  4IUM A;  3B79 A;  1F2C A;  1AEC A;  3PHX A;  2R9M A;  2JQF R;  1MS6 A;  2DZZ A;  4Q8G A;  1MIR A;  1EWO A;  1PE6 A;  4RY2 A;  4OVZ B;  3RVV A;  4YV8 A;  2HXZ A;  3P5X A;  3K8U A;  5JH3 A;  2HH5 A;  4BOZ A;  1BP4 A;  1BGO A;  1PVJ A;  5K16 A;  4PP2 E;  3DF0 A;  1MEM A;  4OVZ A;  2AGA A;  2DC9 A;  5EF4 A;  2OUL A;  1AYW A;  1U9W A;  2GHU A;  3K9M A;  3BOW A;  3S3R A;  2XU5 A;  1AU3 A;  2WBF X;  3E9S A;  4Q8H A;  4X6H A;  3BWK A;  3B21 A;  5CVO B;  3F5V A;  2ARY A;  1YAL A;  2P86 A;  2DC7 A;  4OW0 A;  3K24 A;  3U8E A;  3PW3 A;  1UKF A;  3S3Q A;  1YK7 A;  1CS8 A;  2JRI A;  1MHW A;  3PRM A;  5A24 A;  1ME3 A;  1U9Q X;  4IP3 A;  1O0E A;  1ME4 A;  1CTE A;  4RF0 A;  2NQA A;  1DKI A;  2R9N A;  3HD3 A;  1EWL A;  1TLO A;  3KX1 A;  4HXD B;  1KFU L;  1GLO A;  3IMA A;  2DCD A;  1AYU A;  4I04 A;  1KFX L;  5CHV A;  3WXF A;  1K3B B;  3N3G A;  2C0Y A;  3TRK A;  3CBK A;  1U9X A;  3KSE A;  3BBA A;  2R9F A;  1DEU A;  2VHS A;  1CV8 A;  2P7U A;  1F2B A;  2AYO A;  3WXG A;  1POP A;  4X6J A;  4YVA A;  4MZS A;  4WUR A;  3H8B A;  3AI8 A;  7PCK A;  3BY4 A;  2AUZ A;  8PCH A;  5EZQ A;  4CDF B;  3OIS A;  3KFQ A;  1EWM A;  1YK8 A;  1BY8 A;  4YYS A;  1ZCM A;  4PT5 A;  1U9V A;  3PRP A;  2J7Q A;  4QRG A;  2E03 A;  4RNA A;  1CJL A;  3MHS A;  4FK5 A;  2BDZ A;  1U5I A; 
#chains in the Genus database with same CATH homology
 3IOQ A;  4WA6 A;  2G7Y A;  3QT4 A;  1FH0 A;  5EGW A;  4G54 A;  2E00 A;  3MTN A;  2O6X A;  3CH3 X;  4KLB A;  2FRA A;  1KHP A;  4BS5 A;  1CPJ A;  3RVW A;  1KHQ A;  1STF E;  2DC8 A;  4BQV A;  1QXP A;  2FQ9 A;  2DCB A;  1EF7 A;  3LTW A;  2G8J A;  2PNS A;  1M6D A;  1MEG A;  1YVB A;  2XU4 A;  3KWZ A;  2ACT A;  1SNK A;  4W5C A;  4XR7 A;  3I3T A;  4NV8 A;  3D9W A;  3KWB X;  4PP1 A;  9PAP A;  1VSN A;  3HWN A;  1ZIV A;  4XUI A;  3HHA A;  3N4C A;  1F2A A;  1S4V A;  3QSD A;  4N79 A;  1EWP A;  4B55 A;  1X9Y A;  1A6R A;  1HUC B;  4N4Z A;  3ERV A;  2AU1 A;  1AIM A;  1PPN A;  2YJ9 A;  3M99 A;  4QRX A;  2DC6 A;  1CB5 A;  1Y4H A;  1ICF A;  2AUX A;  2NQG A;  1QOL A;  3CH2 X;  2DJG B;  2AVW A;  3RVX A;  3USV A;  3H6S A;  3P5W A;  3N3K A;  1QDQ A;  4BPV A;  2PBH A;  3IUT A;  4DMY A;  3LFY A;  3LXS A;  1Y08 A;  1AU4 A;  3OF9 A;  3IV2 A;  4QH6 A;  2XU1 A;  3I06 A;  2FYE A;  5CVM A;  2F1G A;  3BPF A;  4YYV A;  2VHF A;  4CDD B;  1BQI A;  2DJF B;  2H7J A;  3IEJ A;  4PI3 A;  4BSQ A;  2ATO A;  4QRV A;  1AU2 A;  1NB3 A;  1NLJ A;  2FRQ A;  5CHT A;  3F75 A;  4CDC B;  2E01 A;  1GEC E;  2P0R A;  5J94 A;  1PPP A;  1IWD A;  2NQI A;  4MSX A;  1DF0 A;  2G8E A;  1PCI A;  2FUD A;  3BCN A;  1CSB B;  1TL9 A;  5FPW A;  3CBJ A;  1PAD A;  2R9C A;  3D6S A;  4AXM A;  2YJ8 A;  2OP3 A;  3IHP A;  3HHI A;  5PAD A;  5CVN B;  2R9O A;  4BGF A;  2YJB A;  3P5U A;  3PBH A;  4MZO A;  4AXL A;  2XU3 A;  2AS8 A;  2DZY A;  3O1G A;  4OEM A;  1ITO A;  1VJV A;  1PXV A;  3O0U A;  4OEL A;  1W6F A;  4P6G A;  2VFC A;  2B1N A;  4PAD A;  2R6N A;  4CZW A;  3OF8 A;  1KXR A;  2B1M A;  4X6I A;  3OVX A;  2FO5 A;  2VFB A;  2YJ2 A;  1GX3 A;  4YYW A;  3MHH A;  1THE A;  4FIP A;  5JA7 A;  3PNR A;  3V6E A;  6PAD A;  2F7D A;  2YJC A;  3BPM A;  3H8C A;  2DCA A;  1AYV A;  3MOR A;  1AU0 A;  2IPP B;  3WXE A;  3KW9 A;  1MDW A;  4YYR A;  4QBB A;  3V6C A;  2FT2 A;  1ATK A;  3C9E A;  1NL6 A;  2HHN A;  3GCB A;  1TU6 A;  2OZ2 A;  4N8W A;  3H7D A;  2CIO A;  5F02 A;  1Q6K A;  1JQP A;  1QMY A;  4HWY A;  3P5V A;  4C5P A;  4YYU A;  2Y5B A;  2GFO A;  3QJ3 A;  3H89 A;  1YT7 A;  3BC3 A;  4I07 A;  4FJC A;  4ZUX U;  2NQD B;  2IBI A;  3KKU A;  1PBH A;  1F29 A;  4I05 A;  2Y6E A;  2BSZ A;  1NQC A;  4YYQ A;  1CQD A;  2DCC A;  3OVZ A;  2E02 A;  3PDF A;  4GUZ A;  2JQG R;  2HD5 A;  1PPO A;  2FTD A;  1XKG A;  3TNX A;  3E1Z B;  1CVZ A;  1GCB A;  4DMX A;  1SP4 B;  4BS6 A;  4W4U A;  1PPD A;  2G6D A;  4W5B A;  1NB5 A;  3ZUA A;  2BDL A;  1GMY A;  2PAD A;  2CB5 A;  2PRE A;  1PIP A;  4P6E A;  1NPZ A;  2AIM A;  2AYN A;  4CDE B;  3NHE A;  4K7C A;  3B79 A;  1F2C A;  1AEC A;  1E2T A;  1W4T A;  2R9M A;  2JQF R;  1MS6 A;  2DZZ A;  4Q8G A;  1MIR A;  1EWO A;  1PE6 A;  4RY2 A;  3RVV A;  4YV8 A;  2HXZ A;  3P5X A;  3K8U A;  5JH3 A;  2HH5 A;  1W5R A;  1BP4 A;  1BGO A;  5K16 A;  4PP2 E;  3DF0 A;  1MEM A;  2DC9 A;  5EF4 A;  2OUL A;  1AYW A;  1U9W A;  2GHU A;  3K9M A;  3BOW A;  3S3R A;  2XU5 A;  1AU3 A;  2WBF X;  4Q8H A;  4X6H A;  3BWK A;  5CVO B;  3F5V A;  2ARY A;  1YAL A;  2P86 A;  2DC7 A;  3U8E A;  3K24 A;  3PW3 A;  3S3Q A;  1YK7 A;  1CS8 A;  1MHW A;  5A24 A;  1ME3 A;  1U9Q X;  1O0E A;  1ME4 A;  1CTE A;  2NQA A;  2R9N A;  3HD3 A;  1EWL A;  1TLO A;  3KX1 A;  1KFU L;  1GLO A;  3IMA A;  2DCD A;  1AYU A;  4NV7 A;  4I04 A;  1KFX L;  5CHV A;  3WXF A;  1K3B B;  3N3G A;  2C0Y A;  3CBK A;  1U9X A;  3KSE A;  2R9F A;  1DEU A;  2VHS A;  1CV8 A;  2P7U A;  1F2B A;  2AYO A;  3WXG A;  1POP A;  4X6J A;  4YVA A;  4MZS A;  3H8B A;  3AI8 A;  7PCK A;  2AUZ A;  8PCH A;  4CDF B;  3OIS A;  3KFQ A;  1EWM A;  1YK8 A;  1BY8 A;  4YYS A;  1ZCM A;  1U9V A;  4QRG A;  2E03 A;  1CJL A;  3MHS A;  4FK5 A;  2BDZ A;  1U5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...