2R9MA

Cathepsin s complexed with compound 15
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9mA00
2FT2A 2E00A 3B79A 3CBJA 3O0UA 5CVMA 3E1ZB 1F29A 2AS8A 3BPMA 4G54A 2F7DA 4YV8A 2E01A 2YJBA 1QOLA 2VHSA 4YYRA 2PBHA 3QJ3A 4ZUXU 2AVWA 1ATKA 1DEUA 4W5CA 1NB3A 3I06A 1CPJA 4YYQA 2AYNA 3BWKA 9PAPA 3KWBX 2P86A 2DC6A 5F02A 1YK8A 2OZ2A 1QDQA 1EWOA 3N4CA 3OF9A 3CBKA 1F2CA 3K24A 5CHVA 2OULA 2PNSA 3DF0A 1CS8A 1AU0A 1PE6A 4X6IA 1ZCMA 3WXEA 1MDWA 2BDZA 1AECA 1GMYA 2R9NA 1BP4A 2CIOA 2R9MA 2XU1A 4PADA 5CHTA 4X6JA 5EF4A 3M99A 4BQVA 3K8UA 3D6SA 4DMXA 4YYVA 1CVZA 1EWMA 1NL6A 3RVXA 2DCAA 1YVBA 4QRXA 4KLBA 2B1NA 1PPPA 2AUXA 2DJFB 1O0EA 1AYVA 2C0YA 2OP3A 2FTDA 1QMYA 1STFE 4P6GA 1AIMA 2PADA 1U9VA 2YJ2A 1MHWA 2AUZA 1ITOA 1CQDA 3P5UA 4PI3A 4BS5A 1XKGA 1PPNA 3H8CA 1QXPA 4I07A 4W4UA 2ACTA 2XU3A 4Q8HA 4CDEB 3PNRA 4QRVA 4YVAA 6PADA 3IHPA 2E03A 1KFXL 4YYSA 2G8JA 3HHAA 1PBHA 3KWZA 3KSEA 1ZIVA 1NQCA 4CDDB 3MTNA 3OF8A 2XU4A 2YJ9A 4FK5A 3LXSA 1AYUA 4FIPA 1KHQA 2HD5A 1EWLA 1A6RA 3AI8A 1F2AA 4QRGA 1BQIA 3MORA 3MHHA 1NB5A 3LFYA 2FYEA 1JQPA 1U9QX 7PCKA 2DZZA 1M6DA 4BPVA 5JH3A 1SP4B 4WA6A 1GLOA 1X9YA 2XU5A 2DZYA 3IV2A 1YALA 3HHIA 2P7UA 3K9MA 1PXVA 1S4VA 1MIRA 1U5IA 2DJGB 1THEA 2HH5A 3F75A 2HHNA 1EF7A 3H8BA 1Q6KA 4QH6A 1CV8A 3IUTA 4N8WA 5PADA 1IWDA 2Y5BA 3RVWA 1SNKA 1GECE 5EGWA 3IEJA 5CVOB 4I04A 2JQFR 3P5VA 4MZSA 3BCNA 1NLJA 4PP1A 1MS6A 4BSQA 3QT4A 3I3TA 2AIMA 1KXRA 3O1GA 1VSNA 3ZUAA 3WXGA 4I05A 1AU2A 2FUDA 3IMAA 5J94A 1F2BA 2NQAA 2E02A 1U9WA 3H7DA 3S3QA 1CTEA 4W5BA 3CH2X 2ATOA 1BY8A 3PW3A 2P0RA 4XUIA 1ICFA 1PCIA 3CH3X 1KHPA 3N3GA 1TL9A 4N79A 3QSDA 2IPPB 4X6HA 2G8EA 1DF0A 4RY2A 3H6SA 1EWPA 1AU3A 1PADA 1CJLA 1YK7A 8PCHA 3BPFA 2Y6EA 1NPZA 3HWNA 3TNXA 3IOQA 3OVXA 4CDCB 2DC8A 1VJVA 4MSXA 1AU4A 3BC3A 2VHFA 3PBHA 1MEMA 1YT7A 2FRQA 2R9FA 3N3KA 3GCBA 2DCBA 2G7YA 2YJCA 5A24A 4AXMA 1KFUL 5JA7A 1PPOA 4DMYA 1TLOA 2DC9A 2BDLA 3OISA 2DCCA 1BGOA 1POPA 2YJ8A 3KKUA 3P5WA 2O6XA 3RVVA 4AXLA 3KX1A 2AU1A 1ME4A 3BOWA 3KW9A 3P5XA 3H89A 4XR7A 5FPWA 3WXFA 1Y08A 5CVNB 2WBFX 2B1MA 2H7JA 3F5VA 4OEMA 1K3BB 2G6DA 3KFQA 2GFOA 4QBBA 1U9XA 2FO5A 2IBIA 1AYWA 3ERVA 1TU6A 3USVA 4OELA 4CZWA 3C9EA 3HD3A 3S3RA 4N4ZA 2ARYA 4K7CA 1MEGA 2GHUA 4Q8GA 4YYUA 1ME3A 3V6EA 1CB5A 1HUCB 3NHEA 4PP2E 3PDFA 1FH0A 2AYOA 2JQGR 5K16A 1PPDA 2NQDB 1Y4HA 2R9CA 4FJCA 2FRAA 2DCDA 3V6CA 4CDFB 3U8EA 2FQ9A 4HWYA 2PREA 2R6NA 3MHSA 4YYWA 2F1GA 2NQIA 2DC7A 3OVZA 4P6EA 2CB5A 2R9OA 1PIPA 2NQGA 4MZOA 1CSBB 4BS6A 2HXZA 1GCBA
chains in the Genus database with same CATH superfamily
2FT2A 2E00A 3B79A 3CBJA 3W31A 3O0UA 5CVMA 3E1ZB 1F29A 2AS8A 3BPMA 4G54A 2F7DA 4YV8A 2E01A 2YJBA 1QOLA 2VHSA 4M0WA 4YYRA 2PBHA 3QJ3A 4ZUXU 2AVWA 1ATKA 1DEUA 4W5CA 4RKXA 3IFUA 1NB3A 4MI7A 3I06A 1CPJA 4YYQA 2AYNA 3BWKA 9PAPA 3KWBX 2P86A 2DC6A 5F02A 1YK8A 2AGAA 2OZ2A 1QDQA 4GUAA 1EWOA 3N4CA 3OF9A 3CBKA 1F2CA 3K24A 5CHVA 2OULA 2PNSA 3DF0A 1CS8A 1AU0A 1PE6A 4X6IA 1ZCMA 3WXEA 1MDWA 2BDZA 3O65A 1AECA 1GMYA 2R9NA 1BP4A 2CIOA 2R9MA 2XU1A 4PADA 5EZQA 5CHTA 2BTWA 4X6JA 5EF4A 3M99A 4BQVA 5E6JA 3TMPA 3K8UA 4R3DA 4IP3A 3D6SA 3E9SA 4DMXA 4YYVA 1CVZA 2FE8A 1EWMA 3MJ5A 4D8BA 1NL6A 3RVXA 2DCAA 1YVBA 4QRXA 4KLBA 2B1NA 1PPPA 1UKFA 2AUXA 4BOQA 2DJFB 1O0EA 1AYVA 4A5UA 2C0YA 2OP3A 2FTDA 1QMYA 1STFE 4P6GA 4BOPA 1AIMA 2PADA 1U9VA 2YJ2A 5JZEA 1MHWA 2AUZA 1ITOA 1CQDA 5EZSA 3P5UA 4PI3A 4BS5A 4RF1A 1XKGA 1PPNA 3H8CA 1QXPA 4I07A 4W4UA 3OQCA 2ACTA 2XU3A 4Q8HA 4CDEB 3PNRA 4QRVA 4WURA 4YVAA 6PADA 3IHPA 2E03A 1KFXL 2BTWB 4YYSA 2G8JA 3HHAA 1PBHA 3KWZA 3KSEA 1PVJA 1ZIVA 1NQCA 4CDDB 4MM3B 3MTNA 3OF8A 2XU4A 2YJ9A 4FK5A 3LXSA 1AYUA 2BU3A 4FIPA 1DKIA 1KHQA 2HD5A 1EWLA 1A6RA 3AI8A 1F2AA 4QRGA 1BQIA 3MORA 3MHHA 1NB5A 3LFYA 2FYEA 1JQPA 1U9QX 7PCKA 2DZZA 1M6DA 4BPVA 5JH3A 1SP4B 4WA6A 1GLOA 1X9YA 2XU5A 2DZYA 3IV2A 4D8IA 1YALA 3HHIA 2P7UA 3K9MA 1PXVA 1S4VA 1MIRA 1U5IA 2DJGB 2HWKA 3PHUA 3PSEA 4IUMA 3PRMA 1THEA 2HH5A 3F75A 2HHNA 1EF7A 4OVZA 3H8BA 1Q6KA 4QH6A 1CV8A 3PHXA 3IUTA 2UZJA 4N8WA 5PADA 1IWDA 2Y5BA 3RVWA 1SNKA 1GECE 5EGWA 3IEJA 3BBAA 4OW0A 5CVOB 4I04A 2JQFR 3P5VA 3TRKA 4MZSA 3BCNA 3ZNHA 1NLJA 4PP1A 1MS6A 4BSQA 2JRIA 3QT4A 3I3TA 2AIMA 1KXRA 3O1GA 1VSNA 3C0RA 3ZUAA 3WXGA 4I05A 4RNAA 1AU2A 2FUDA 3IMAA 5J94A 1F2BA 2NQAA 4PT5A 2E02A 2Z84A 1U9WA 3H7DA 3S3QA 1CTEA 4W5BA 3CH2X 2ATOA 1BY8A 3PW3A 2P0RA 4XUIA 1ICFA 1PCIA 3CH3X 1KHPA 3N3GA 4ZTBA 1TL9A 4N79A 3QSDA 2IPPB 2J7QA 4X6HA 2G8EA 1DF0A 4RY2A 4OVZB 3H6SA 1EWPA 1GCBA 1AU3A 1PADA 1CJLA 1YK7A 8PCHA 3BPFA 2Y6EA 1NPZA 3HWNA 3TNXA 3IOQA 3OVXA 4CDCB 2DC8A 1VJVA 4MSXA 1AU4A 4RF0A 3BC3A 2VHFA 3PBHA 1MEMA 1YT7A 2FRQA 2R9FA 2J7QC 3N3KA 3GCBA 2JTCA 2DCBA 2G7YA 2YJCA 5A24A 4AXMA 1KFUL 5JA7A 3PHWA 1PPOA 4DMYA 1TLOA 2DC9A 2BDLA 3OISA 2DCCA 1BGOA 4XZXA 1POPA 2YJ8A 3KKUA 3P5WA 2DOSA 2O6XA 3RVVA 4AXLA 3KX1A 2AU1A 1ME4A 3BB7A 3BOWA 3KW9A 3W30A 3P5XA 3H89A 4XR7A 5FPWA 3WXFA 1Y08A 3RNVA 5CVNB 2WBFX 2B1MA 2H7JA 3F5VA 4OEMA 3BY4A 3B21A 1K3BB 2G6DA 3KFQA 2GFOA 3MP2A 4QBBA 1U9XA 2FO5A 2IBIA 1AYWA 3ERVA 1TU6A 4BOUA 3USVA 4OELA 4CZWA 3C9EA 3HD3A 3S3RA 4N4ZA 2ARYA 4K7CA 1MEGA 4P16A 2GHUA 4Q8GA 4YYUA 4HXDB 4BOZA 1ME3A 5KO3A 3V6EA 1CB5A 1HUCB 3NHEA 4PP2E 3PDFA 1FH0A 2AYOA 2JQGR 5K16A 1PPDA 2NQDB 4D8EA 1Y4HA 2R9CA 1YZBA 4FJCA 2FRAA 2DCDA 3V6CA 4CDFB 3PT2A 3U8EA 2FQ9A 4HWYA 2PREA 2R6NA 3MHSA 4YYWA 3PRPA 2F1GA 2NQIA 2DC7A 3OVZA 4P6EA 2CB5A 2R9OA 1PIPA 2NQGA 4MZOA 1CSBB 4BS6A 2HXZA 4BOSA 4REZA 3MTVA
chains in the Genus database with same CATH topology
2FT2A 2E00A 3B79A 3CBJA 3O0UA 5CVMA 3E1ZB 1F29A 2AS8A 1E2TA 3BPMA 4G54A 2F7DA 4YV8A 2E01A 2YJBA 1QOLA 2VHSA 4YYRA 2PBHA 3QJ3A 4ZUXU 2AVWA 2VFBA 1ATKA 1DEUA 4W5CA 1NB3A 3I06A 1CPJA 4YYQA 2AYNA 3BWKA 9PAPA 3KWBX 2P86A 2DC6A 5F02A 1YK8A 2OZ2A 1QDQA 1EWOA 3N4CA 3OF9A 3CBKA 1F2CA 3K24A 5CHVA 2OULA 2PNSA 3DF0A 1CS8A 1AU0A 1PE6A 4X6IA 1ZCMA 3WXEA 1MDWA 2BDZA 1AECA 1GMYA 2R9NA 1BP4A 2CIOA 2R9MA 2XU1A 4PADA 5CHTA 4X6JA 5EF4A 3M99A 4BQVA 1GX3A 3K8UA 3D6SA 4DMXA 4YYVA 1CVZA 1EWMA 1NL6A 3RVXA 2DCAA 1YVBA 4QRXA 4KLBA 4NV7A 2B1NA 1PPPA 2AUXA 2DJFB 1O0EA 1AYVA 2C0YA 2OP3A 2FTDA 1QMYA 1STFE 4P6GA 1AIMA 2PADA 1U9VA 2YJ2A 1MHWA 2AUZA 1ITOA 1CQDA 3P5UA 4PI3A 4BS5A 1XKGA 1PPNA 3H8CA 1QXPA 4I07A 4W4UA 2ACTA 2XU3A 3D9WA 4Q8HA 4CDEB 3PNRA 4QRVA 4YVAA 6PADA 4BGFA 3IHPA 2E03A 1KFXL 4YYSA 1W4TA 2G8JA 3HHAA 1PBHA 3KWZA 3KSEA 1ZIVA 1NQCA 4CDDB 3MTNA 3OF8A 2XU4A 2YJ9A 4FK5A 3LXSA 1AYUA 4FIPA 1KHQA 2HD5A 1EWLA 1A6RA 3AI8A 1F2AA 4QRGA 1BQIA 3MORA 3MHHA 4GUZA 1NB5A 3LFYA 2FYEA 1JQPA 1U9QX 7PCKA 2DZZA 1M6DA 4BPVA 5JH3A 1SP4B 4WA6A 1GLOA 1X9YA 2XU5A 2DZYA 3IV2A 1YALA 3HHIA 2P7UA 3K9MA 1PXVA 1S4VA 1MIRA 1W6FA 1U5IA 2DJGB 1THEA 2HH5A 3F75A 2HHNA 1EF7A 3H8BA 1Q6KA 4QH6A 1CV8A 3IUTA 4N8WA 5PADA 1IWDA 2Y5BA 3RVWA 4C5PA 1SNKA 1GECE 5EGWA 3IEJA 5CVOB 4I04A 2JQFR 3P5VA 4MZSA 3BCNA 1NLJA 4PP1A 1MS6A 4BSQA 3QT4A 3I3TA 2AIMA 1KXRA 3O1GA 1VSNA 3ZUAA 3WXGA 4I05A 1AU2A 2FUDA 3IMAA 5J94A 1F2BA 2NQAA 2E02A 1U9WA 3H7DA 3S3QA 1CTEA 4W5BA 3CH2X 2ATOA 1BY8A 3PW3A 2P0RA 4XUIA 1ICFA 3LTWA 1PCIA 3CH3X 1KHPA 3N3GA 1TL9A 4N79A 3QSDA 2IPPB 4X6HA 2G8EA 1DF0A 4RY2A 3H6SA 1EWPA 1AU3A 1PADA 1CJLA 1YK7A 8PCHA 3BPFA 2Y6EA 1NPZA 3HWNA 3TNXA 3IOQA 3OVXA 4CDCB 2DC8A 1VJVA 4MSXA 1AU4A 3BC3A 2VHFA 3PBHA 1MEMA 1YT7A 2FRQA 2R9FA 3N3KA 4NV8A 3GCBA 2DCBA 2G7YA 2YJCA 5A24A 4AXMA 1KFUL 5JA7A 2BSZA 1PPOA 4DMYA 1TLOA 2DC9A 2BDLA 3OISA 2DCCA 1BGOA 1POPA 2YJ8A 3KKUA 3P5WA 2O6XA 3RVVA 4AXLA 3KX1A 2AU1A 1ME4A 3BOWA 3KW9A 3P5XA 3H89A 4XR7A 5FPWA 3WXFA 1Y08A 5CVNB 2WBFX 2B1MA 2H7JA 3F5VA 4OEMA 1K3BB 2G6DA 3KFQA 2GFOA 4QBBA 1U9XA 2FO5A 2IBIA 1AYWA 3ERVA 1TU6A 3USVA 4OELA 4CZWA 3C9EA 3HD3A 3S3RA 4N4ZA 2VFCA 2ARYA 4K7CA 1MEGA 2GHUA 4Q8GA 4YYUA 1ME3A 3V6EA 1CB5A 1HUCB 3NHEA 4PP2E 3PDFA 1FH0A 2AYOA 2JQGR 5K16A 1PPDA 2NQDB 1Y4HA 2R9CA 4FJCA 2FRAA 2DCDA 3V6CA 4CDFB 3U8EA 2FQ9A 4HWYA 2PREA 2R6NA 4B55A 3MHSA 4YYWA 2F1GA 2NQIA 2DC7A 3OVZA 4P6EA 2CB5A 2R9OA 1PIPA 2NQGA 4MZOA 1CSBB 4BS6A 2HXZA 1W5RA 1GCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT2 A;  2E00 A;  3B79 A;  3CBJ A;  3O0U A;  5CVM A;  3E1Z B;  1F29 A;  2AS8 A;  3BPM A;  4G54 A;  2F7D A;  4YV8 A;  2E01 A;  2YJB A;  1QOL A;  2VHS A;  4YYR A;  2PBH A;  3QJ3 A;  4ZUX U;  2AVW A;  1ATK A;  1DEU A;  4W5C A;  1NB3 A;  3I06 A;  1CPJ A;  4YYQ A;  2AYN A;  3BWK A;  9PAP A;  3KWB X;  2P86 A;  2DC6 A;  5F02 A;  1YK8 A;  2OZ2 A;  1QDQ A;  1EWO A;  3N4C A;  3OF9 A;  3CBK A;  1F2C A;  3K24 A;  5CHV A;  2OUL A;  2PNS A;  3DF0 A;  1CS8 A;  1AU0 A;  1PE6 A;  4X6I A;  1ZCM A;  3WXE A;  1MDW A;  2BDZ A;  1AEC A;  1GMY A;  2R9N A;  1BP4 A;  2CIO A;  2R9M A;  2XU1 A;  4PAD A;  5CHT A;  4X6J A;  5EF4 A;  3M99 A;  4BQV A;  3K8U A;  3D6S A;  4DMX A;  4YYV A;  1CVZ A;  1EWM A;  1NL6 A;  3RVX A;  2DCA A;  1YVB A;  4QRX A;  4KLB A;  2B1N A;  1PPP A;  2AUX A;  2DJF B;  1O0E A;  1AYV A;  2C0Y A;  2OP3 A;  2FTD A;  1QMY A;  1STF E;  4P6G A;  1AIM A;  2PAD A;  1U9V A;  2YJ2 A;  1MHW A;  2AUZ A;  1ITO A;  1CQD A;  3P5U A;  4PI3 A;  4BS5 A;  1XKG A;  1PPN A;  3H8C A;  1QXP A;  4I07 A;  4W4U A;  2ACT A;  2XU3 A;  4Q8H A;  4CDE B;  3PNR A;  4QRV A;  4YVA A;  6PAD A;  3IHP A;  2E03 A;  1KFX L;  4YYS A;  2G8J A;  3HHA A;  1PBH A;  3KWZ A;  3KSE A;  1ZIV A;  1NQC A;  4CDD B;  3MTN A;  3OF8 A;  2XU4 A;  2YJ9 A;  4FK5 A;  3LXS A;  1AYU A;  4FIP A;  1KHQ A;  2HD5 A;  1EWL A;  1A6R A;  3AI8 A;  1F2A A;  4QRG A;  1BQI A;  3MOR A;  3MHH A;  1NB5 A;  3LFY A;  2FYE A;  1JQP A;  1U9Q X;  7PCK A;  2DZZ A;  1M6D A;  4BPV A;  5JH3 A;  1SP4 B;  4WA6 A;  1GLO A;  1X9Y A;  2XU5 A;  2DZY A;  3IV2 A;  1YAL A;  3HHI A;  2P7U A;  3K9M A;  1PXV A;  1S4V A;  1MIR A;  1U5I A;  2DJG B;  1THE A;  2HH5 A;  3F75 A;  2HHN A;  1EF7 A;  3H8B A;  1Q6K A;  4QH6 A;  1CV8 A;  3IUT A;  4N8W A;  5PAD A;  1IWD A;  2Y5B A;  3RVW A;  1SNK A;  1GEC E;  5EGW A;  3IEJ A;  5CVO B;  4I04 A;  2JQF R;  3P5V A;  4MZS A;  3BCN A;  1NLJ A;  4PP1 A;  1MS6 A;  4BSQ A;  3QT4 A;  3I3T A;  2AIM A;  1KXR A;  3O1G A;  1VSN A;  3ZUA A;  3WXG A;  4I05 A;  1AU2 A;  2FUD A;  3IMA A;  5J94 A;  1F2B A;  2NQA A;  2E02 A;  1U9W A;  3H7D A;  3S3Q A;  1CTE A;  4W5B A;  3CH2 X;  2ATO A;  1BY8 A;  3PW3 A;  2P0R A;  4XUI A;  1ICF A;  1PCI A;  3CH3 X;  1KHP A;  3N3G A;  1TL9 A;  4N79 A;  3QSD A;  2IPP B;  4X6H A;  2G8E A;  1DF0 A;  4RY2 A;  3H6S A;  1EWP A;  1AU3 A;  1PAD A;  1CJL A;  1YK7 A;  8PCH A;  3BPF A;  2Y6E A;  1NPZ A;  3HWN A;  3TNX A;  3IOQ A;  3OVX A;  4CDC B;  2DC8 A;  1VJV A;  4MSX A;  1AU4 A;  3BC3 A;  2VHF A;  3PBH A;  1MEM A;  1YT7 A;  2FRQ A;  2R9F A;  3N3K A;  3GCB A;  2DCB A;  2G7Y A;  2YJC A;  5A24 A;  4AXM A;  1KFU L;  5JA7 A;  1PPO A;  4DMY A;  1TLO A;  2DC9 A;  2BDL A;  3OIS A;  2DCC A;  1BGO A;  1POP A;  2YJ8 A;  3KKU A;  3P5W A;  2O6X A;  3RVV A;  4AXL A;  3KX1 A;  2AU1 A;  1ME4 A;  3BOW A;  3KW9 A;  3P5X A;  3H89 A;  4XR7 A;  5FPW A;  3WXF A;  1Y08 A;  5CVN B;  2WBF X;  2B1M A;  2H7J A;  3F5V A;  4OEM A;  1K3B B;  2G6D A;  3KFQ A;  2GFO A;  4QBB A;  1U9X A;  2FO5 A;  2IBI A;  1AYW A;  3ERV A;  1TU6 A;  3USV A;  4OEL A;  4CZW A;  3C9E A;  3HD3 A;  3S3R A;  4N4Z A;  2ARY A;  4K7C A;  1MEG A;  2GHU A;  4Q8G A;  4YYU A;  1ME3 A;  3V6E A;  1CB5 A;  1HUC B;  3NHE A;  4PP2 E;  3PDF A;  1FH0 A;  2AYO A;  2JQG R;  5K16 A;  1PPD A;  2NQD B;  1Y4H A;  2R9C A;  4FJC A;  2FRA A;  2DCD A;  3V6C A;  4CDF B;  3U8E A;  2FQ9 A;  4HWY A;  2PRE A;  2R6N A;  3MHS A;  4YYW A;  2F1G A;  2NQI A;  2DC7 A;  3OVZ A;  4P6E A;  2CB5 A;  2R9O A;  1PIP A;  2NQG A;  4MZO A;  1CSB B;  4BS6 A;  2HXZ A;  1GCB A; 
#chains in the Genus database with same CATH topology
 2FT2 A;  2E00 A;  3B79 A;  3CBJ A;  3W31 A;  3O0U A;  5CVM A;  3E1Z B;  1F29 A;  2AS8 A;  3BPM A;  4G54 A;  2F7D A;  4YV8 A;  2E01 A;  2YJB A;  1QOL A;  2VHS A;  4M0W A;  4YYR A;  2PBH A;  3QJ3 A;  4ZUX U;  2AVW A;  1ATK A;  1DEU A;  4W5C A;  4RKX A;  3IFU A;  1NB3 A;  4MI7 A;  3I06 A;  1CPJ A;  4YYQ A;  2AYN A;  3BWK A;  9PAP A;  3KWB X;  2P86 A;  2DC6 A;  5F02 A;  1YK8 A;  2AGA A;  2OZ2 A;  1QDQ A;  4GUA A;  1EWO A;  3N4C A;  3OF9 A;  3CBK A;  1F2C A;  3K24 A;  5CHV A;  2OUL A;  2PNS A;  3DF0 A;  1CS8 A;  1AU0 A;  1PE6 A;  4X6I A;  1ZCM A;  3WXE A;  1MDW A;  2BDZ A;  3O65 A;  1AEC A;  1GMY A;  2R9N A;  1BP4 A;  2CIO A;  2R9M A;  2XU1 A;  4PAD A;  5EZQ A;  5CHT A;  2BTW A;  4X6J A;  5EF4 A;  3M99 A;  4BQV A;  5E6J A;  3TMP A;  3K8U A;  4R3D A;  4IP3 A;  3D6S A;  3E9S A;  4DMX A;  4YYV A;  1CVZ A;  2FE8 A;  1EWM A;  3MJ5 A;  4D8B A;  1NL6 A;  3RVX A;  2DCA A;  1YVB A;  4QRX A;  4KLB A;  2B1N A;  1PPP A;  1UKF A;  2AUX A;  4BOQ A;  2DJF B;  1O0E A;  1AYV A;  4A5U A;  2C0Y A;  2OP3 A;  2FTD A;  1QMY A;  1STF E;  4P6G A;  4BOP A;  1AIM A;  2PAD A;  1U9V A;  2YJ2 A;  5JZE A;  1MHW A;  2AUZ A;  1ITO A;  1CQD A;  5EZS A;  3P5U A;  4PI3 A;  4BS5 A;  4RF1 A;  1XKG A;  1PPN A;  3H8C A;  1QXP A;  4I07 A;  4W4U A;  3OQC A;  2ACT A;  2XU3 A;  4Q8H A;  4CDE B;  3PNR A;  4QRV A;  4WUR A;  4YVA A;  6PAD A;  3IHP A;  2E03 A;  1KFX L;  2BTW B;  4YYS A;  2G8J A;  3HHA A;  1PBH A;  3KWZ A;  3KSE A;  1PVJ A;  1ZIV A;  1NQC A;  4CDD B;  4MM3 B;  3MTN A;  3OF8 A;  2XU4 A;  2YJ9 A;  4FK5 A;  3LXS A;  1AYU A;  2BU3 A;  4FIP A;  1DKI A;  1KHQ A;  2HD5 A;  1EWL A;  1A6R A;  3AI8 A;  1F2A A;  4QRG A;  1BQI A;  3MOR A;  3MHH A;  1NB5 A;  3LFY A;  2FYE A;  1JQP A;  1U9Q X;  7PCK A;  2DZZ A;  1M6D A;  4BPV A;  5JH3 A;  1SP4 B;  4WA6 A;  1GLO A;  1X9Y A;  2XU5 A;  2DZY A;  3IV2 A;  4D8I A;  1YAL A;  3HHI A;  2P7U A;  3K9M A;  1PXV A;  1S4V A;  1MIR A;  1U5I A;  2DJG B;  2HWK A;  3PHU A;  3PSE A;  4IUM A;  3PRM A;  1THE A;  2HH5 A;  3F75 A;  2HHN A;  1EF7 A;  4OVZ A;  3H8B A;  1Q6K A;  4QH6 A;  1CV8 A;  3PHX A;  3IUT A;  2UZJ A;  4N8W A;  5PAD A;  1IWD A;  2Y5B A;  3RVW A;  1SNK A;  1GEC E;  5EGW A;  3IEJ A;  3BBA A;  4OW0 A;  5CVO B;  4I04 A;  2JQF R;  3P5V A;  3TRK A;  4MZS A;  3BCN A;  3ZNH A;  1NLJ A;  4PP1 A;  1MS6 A;  4BSQ A;  2JRI A;  3QT4 A;  3I3T A;  2AIM A;  1KXR A;  3O1G A;  1VSN A;  3C0R A;  3ZUA A;  3WXG A;  4I05 A;  4RNA A;  1AU2 A;  2FUD A;  3IMA A;  5J94 A;  1F2B A;  2NQA A;  4PT5 A;  2E02 A;  2Z84 A;  1U9W A;  3H7D A;  3S3Q A;  1CTE A;  4W5B A;  3CH2 X;  2ATO A;  1BY8 A;  3PW3 A;  2P0R A;  4XUI A;  1ICF A;  1PCI A;  3CH3 X;  1KHP A;  3N3G A;  4ZTB A;  1TL9 A;  4N79 A;  3QSD A;  2IPP B;  2J7Q A;  4X6H A;  2G8E A;  1DF0 A;  4RY2 A;  4OVZ B;  3H6S A;  1EWP A;  1GCB A;  1AU3 A;  1PAD A;  1CJL A;  1YK7 A;  8PCH A;  3BPF A;  2Y6E A;  1NPZ A;  3HWN A;  3TNX A;  3IOQ A;  3OVX A;  4CDC B;  2DC8 A;  1VJV A;  4MSX A;  1AU4 A;  4RF0 A;  3BC3 A;  2VHF A;  3PBH A;  1MEM A;  1YT7 A;  2FRQ A;  2R9F A;  2J7Q C;  3N3K A;  3GCB A;  2JTC A;  2DCB A;  2G7Y A;  2YJC A;  5A24 A;  4AXM A;  1KFU L;  5JA7 A;  3PHW A;  1PPO A;  4DMY A;  1TLO A;  2DC9 A;  2BDL A;  3OIS A;  2DCC A;  1BGO A;  4XZX A;  1POP A;  2YJ8 A;  3KKU A;  3P5W A;  2DOS A;  2O6X A;  3RVV A;  4AXL A;  3KX1 A;  2AU1 A;  1ME4 A;  3BB7 A;  3BOW A;  3KW9 A;  3W30 A;  3P5X A;  3H89 A;  4XR7 A;  5FPW A;  3WXF A;  1Y08 A;  3RNV A;  5CVN B;  2WBF X;  2B1M A;  2H7J A;  3F5V A;  4OEM A;  3BY4 A;  3B21 A;  1K3B B;  2G6D A;  3KFQ A;  2GFO A;  3MP2 A;  4QBB A;  1U9X A;  2FO5 A;  2IBI A;  1AYW A;  3ERV A;  1TU6 A;  4BOU A;  3USV A;  4OEL A;  4CZW A;  3C9E A;  3HD3 A;  3S3R A;  4N4Z A;  2ARY A;  4K7C A;  1MEG A;  4P16 A;  2GHU A;  4Q8G A;  4YYU A;  4HXD B;  4BOZ A;  1ME3 A;  5KO3 A;  3V6E A;  1CB5 A;  1HUC B;  3NHE A;  4PP2 E;  3PDF A;  1FH0 A;  2AYO A;  2JQG R;  5K16 A;  1PPD A;  2NQD B;  4D8E A;  1Y4H A;  2R9C A;  1YZB A;  4FJC A;  2FRA A;  2DCD A;  3V6C A;  4CDF B;  3PT2 A;  3U8E A;  2FQ9 A;  4HWY A;  2PRE A;  2R6N A;  3MHS A;  4YYW A;  3PRP A;  2F1G A;  2NQI A;  2DC7 A;  3OVZ A;  4P6E A;  2CB5 A;  2R9O A;  1PIP A;  2NQG A;  4MZO A;  1CSB B;  4BS6 A;  2HXZ A;  4BOS A;  4REZ A;  3MTV A; 
#chains in the Genus database with same CATH homology
 2FT2 A;  2E00 A;  3B79 A;  3CBJ A;  3O0U A;  5CVM A;  3E1Z B;  1F29 A;  2AS8 A;  1E2T A;  3BPM A;  4G54 A;  2F7D A;  4YV8 A;  2E01 A;  2YJB A;  1QOL A;  2VHS A;  4YYR A;  2PBH A;  3QJ3 A;  4ZUX U;  2AVW A;  2VFB A;  1ATK A;  1DEU A;  4W5C A;  1NB3 A;  3I06 A;  1CPJ A;  4YYQ A;  2AYN A;  3BWK A;  9PAP A;  3KWB X;  2P86 A;  2DC6 A;  5F02 A;  1YK8 A;  2OZ2 A;  1QDQ A;  1EWO A;  3N4C A;  3OF9 A;  3CBK A;  1F2C A;  3K24 A;  5CHV A;  2OUL A;  2PNS A;  3DF0 A;  1CS8 A;  1AU0 A;  1PE6 A;  4X6I A;  1ZCM A;  3WXE A;  1MDW A;  2BDZ A;  1AEC A;  1GMY A;  2R9N A;  1BP4 A;  2CIO A;  2R9M A;  2XU1 A;  4PAD A;  5CHT A;  4X6J A;  5EF4 A;  3M99 A;  4BQV A;  1GX3 A;  3K8U A;  3D6S A;  4DMX A;  4YYV A;  1CVZ A;  1EWM A;  1NL6 A;  3RVX A;  2DCA A;  1YVB A;  4QRX A;  4KLB A;  4NV7 A;  2B1N A;  1PPP A;  2AUX A;  2DJF B;  1O0E A;  1AYV A;  2C0Y A;  2OP3 A;  2FTD A;  1QMY A;  1STF E;  4P6G A;  1AIM A;  2PAD A;  1U9V A;  2YJ2 A;  1MHW A;  2AUZ A;  1ITO A;  1CQD A;  3P5U A;  4PI3 A;  4BS5 A;  1XKG A;  1PPN A;  3H8C A;  1QXP A;  4I07 A;  4W4U A;  2ACT A;  2XU3 A;  3D9W A;  4Q8H A;  4CDE B;  3PNR A;  4QRV A;  4YVA A;  6PAD A;  4BGF A;  3IHP A;  2E03 A;  1KFX L;  4YYS A;  1W4T A;  2G8J A;  3HHA A;  1PBH A;  3KWZ A;  3KSE A;  1ZIV A;  1NQC A;  4CDD B;  3MTN A;  3OF8 A;  2XU4 A;  2YJ9 A;  4FK5 A;  3LXS A;  1AYU A;  4FIP A;  1KHQ A;  2HD5 A;  1EWL A;  1A6R A;  3AI8 A;  1F2A A;  4QRG A;  1BQI A;  3MOR A;  3MHH A;  4GUZ A;  1NB5 A;  3LFY A;  2FYE A;  1JQP A;  1U9Q X;  7PCK A;  2DZZ A;  1M6D A;  4BPV A;  5JH3 A;  1SP4 B;  4WA6 A;  1GLO A;  1X9Y A;  2XU5 A;  2DZY A;  3IV2 A;  1YAL A;  3HHI A;  2P7U A;  3K9M A;  1PXV A;  1S4V A;  1MIR A;  1W6F A;  1U5I A;  2DJG B;  1THE A;  2HH5 A;  3F75 A;  2HHN A;  1EF7 A;  3H8B A;  1Q6K A;  4QH6 A;  1CV8 A;  3IUT A;  4N8W A;  5PAD A;  1IWD A;  2Y5B A;  3RVW A;  4C5P A;  1SNK A;  1GEC E;  5EGW A;  3IEJ A;  5CVO B;  4I04 A;  2JQF R;  3P5V A;  4MZS A;  3BCN A;  1NLJ A;  4PP1 A;  1MS6 A;  4BSQ A;  3QT4 A;  3I3T A;  2AIM A;  1KXR A;  3O1G A;  1VSN A;  3ZUA A;  3WXG A;  4I05 A;  1AU2 A;  2FUD A;  3IMA A;  5J94 A;  1F2B A;  2NQA A;  2E02 A;  1U9W A;  3H7D A;  3S3Q A;  1CTE A;  4W5B A;  3CH2 X;  2ATO A;  1BY8 A;  3PW3 A;  2P0R A;  4XUI A;  1ICF A;  3LTW A;  1PCI A;  3CH3 X;  1KHP A;  3N3G A;  1TL9 A;  4N79 A;  3QSD A;  2IPP B;  4X6H A;  2G8E A;  1DF0 A;  4RY2 A;  3H6S A;  1EWP A;  1AU3 A;  1PAD A;  1CJL A;  1YK7 A;  8PCH A;  3BPF A;  2Y6E A;  1NPZ A;  3HWN A;  3TNX A;  3IOQ A;  3OVX A;  4CDC B;  2DC8 A;  1VJV A;  4MSX A;  1AU4 A;  3BC3 A;  2VHF A;  3PBH A;  1MEM A;  1YT7 A;  2FRQ A;  2R9F A;  3N3K A;  4NV8 A;  3GCB A;  2DCB A;  2G7Y A;  2YJC A;  5A24 A;  4AXM A;  1KFU L;  5JA7 A;  2BSZ A;  1PPO A;  4DMY A;  1TLO A;  2DC9 A;  2BDL A;  3OIS A;  2DCC A;  1BGO A;  1POP A;  2YJ8 A;  3KKU A;  3P5W A;  2O6X A;  3RVV A;  4AXL A;  3KX1 A;  2AU1 A;  1ME4 A;  3BOW A;  3KW9 A;  3P5X A;  3H89 A;  4XR7 A;  5FPW A;  3WXF A;  1Y08 A;  5CVN B;  2WBF X;  2B1M A;  2H7J A;  3F5V A;  4OEM A;  1K3B B;  2G6D A;  3KFQ A;  2GFO A;  4QBB A;  1U9X A;  2FO5 A;  2IBI A;  1AYW A;  3ERV A;  1TU6 A;  3USV A;  4OEL A;  4CZW A;  3C9E A;  3HD3 A;  3S3R A;  4N4Z A;  2VFC A;  2ARY A;  4K7C A;  1MEG A;  2GHU A;  4Q8G A;  4YYU A;  1ME3 A;  3V6E A;  1CB5 A;  1HUC B;  3NHE A;  4PP2 E;  3PDF A;  1FH0 A;  2AYO A;  2JQG R;  5K16 A;  1PPD A;  2NQD B;  1Y4H A;  2R9C A;  4FJC A;  2FRA A;  2DCD A;  3V6C A;  4CDF B;  3U8E A;  2FQ9 A;  4HWY A;  2PRE A;  2R6N A;  4B55 A;  3MHS A;  4YYW A;  2F1G A;  2NQI A;  2DC7 A;  3OVZ A;  4P6E A;  2CB5 A;  2R9O A;  1PIP A;  2NQG A;  4MZO A;  1CSB B;  4BS6 A;  2HXZ A;  1W5R A;  1GCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...