2R9MA

Cathepsin s complexed with compound 15
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9mA00
1MHWA 2WBFX 1VJVA 2DJFB 1X9YA 4AXMA 1MS6A 5JA7A 2G6DA 3KFQA 4W5BA 3USVA 1CQDA 2DC7A 4CDCB 4YYUA 3OF9A 3QSDA 3KX1A 4OELA 5JH3A 4BPVA 3B79A 4QH6A 1MIRA 2DCCA 4CZWA 3H8BA 2GFOA 4Q8GA 4XR7A 5K16A 4N79A 1F2BA 2PNSA 7PCKA 1EWOA 3QJ3A 4QRXA 2OZ2A 4N8WA 4YYRA 1Y4HA 4QRGA 3F5VA 4X6IA 3IHPA 4MZSA 1BQIA 1YK8A 1QMYA 3H8CA 4K7CA 4PP1A 3OF8A 3IV2A 2FO5A 1CJLA 3DF0A 3I3TA 2DZYA 1EWMA 3O1GA 4YYVA 2DC9A 5F02A 1AU3A 1PADA 1QOLA 3K9MA 1SNKA 2ARYA 1CSBB 1DF0A 2PBHA 2NQIA 2E03A 1M6DA 1SP4B 1QDQA 4YV8A 3S3RA 2P86A 4FJCA 2NQGA 1GECE 4OEMA 2FTDA 3MORA 1ME3A 2VHFA 4KLBA 3WXEA 1PBHA 2YJ8A 3HHAA 2P0RA 2DJGB 3E1ZB 2YJ2A 2E00A 2AU1A 1CS8A 1CB5A 1YK7A 1KFUL 4PI3A 3I06A 1KHPA 1PXVA 1NLJA 3U8EA 1AECA 1TU6A 1KFXL 3PW3A 3NHEA 1NPZA 2XU4A 3M99A 3HHIA 1NB5A 1YT7A 3AI8A 3QT4A 4QRVA 3KKUA 1F29A 3KW9A 6PADA 2FRAA 1GMYA 1U9XA 2P7UA 2AYOA 4YYQA 1CVZA 3CH3X 3BWKA 1U9WA 3N3KA 2HD5A 2H7JA 4BQVA 1ITOA 1PE6A 1NL6A 1A6RA 1ME4A 2FUDA 3H89A 3KSEA 2IPPB 2PADA 4YVAA 2YJBA 2PREA 1KHQA 1IWDA 4I05A 2XU1A 2DC6A 4FIPA 4QBBA 3HWNA 1NB3A 3WXGA 4HWYA 1U5IA 4YYSA 4BSQA 3BPMA 2R9FA 3BOWA 3BC3A 3PDFA 1TL9A 3PNRA 4MZOA 1BP4A 1DEUA 4CDDB 4FK5A 3MHSA 1FH0A 3LXSA 2R6NA 9PAPA 3GCBA 3MHHA 2Y5BA 1U9VA 4N4ZA 4WA6A 4RY2A 1STFE 5EGWA 2B1NA 2JQFR 4PADA 1VSNA 3CBKA 3BPFA 2XU5A 3K24A 1JQPA 2G8JA 2G7YA 2Y6EA 4I04A 2R9OA 2OULA 1CPJA 3MTNA 4PP2E 4BS6A 1O0EA 3F75A 3OVZA 1AIMA 4XUIA 1PIPA 1YVBA 5EF4A 2FRQA 2DCAA 4ZUXU 1Y08A 3BCNA 2AIMA 2JQGR 3K8UA 1S4VA 5CVOB 4I07A 2C0YA 2E02A 2NQDB 4AXLA 3RVVA 2FYEA 1PPDA 3P5UA 4Q8HA 4MSXA 8PCHA 2FQ9A 2HXZA 3V6EA 3IOQA 2XU3A 3IUTA 2YJCA 2YJ9A 2HH5A 2OP3A 3H7DA 1PCIA 1ICFA 5A24A 3ZUAA 3N4CA 1QXPA 5CHVA 1ATKA 2DC8A 3V6CA 3IEJA 1AYUA 3C9EA 2F7DA 1BY8A 4P6GA 4CDEB 3N3GA 2GHUA 3CBJA 2CB5A 2G8EA 1EWLA 3S3QA 1POPA 3OISA 2AS8A 4BS5A 3RVXA 1PPPA 3KWZA 3PBHA 3WXFA 5CVNB 4DMYA 3D6SA 5CVMA 1AU0A 1CTEA 2NQAA 1HUCB 1BGOA 2AVWA 4X6JA 1NQCA 1AU2A 2ACTA 1AU4A 4G54A 4W4UA 5PADA 2AUXA 2BDLA 4CDFB 1CV8A 3H6SA 3IMAA 1F2AA 3HD3A 1THEA 4P6EA 2B1MA 3LFYA 2E01A 2VHSA 2F1GA 1MEGA 2AYNA 3ERVA 2O6XA 2FT2A 5CHTA 2R9CA 1GCBA 1Q6KA 3OVXA 5FPWA 1MDWA 1K3BB 3KWBX 4DMXA 2DCDA 3O0UA 1EWPA 1F2CA 1PPOA 1U9QX 3CH2X 1AYWA 2CIOA 1TLOA 3P5XA 3P5VA 1GLOA 3TNXA 2DZZA 3RVWA 2AUZA 2HHNA 1ZCMA 2BDZA 2R9NA 3P5WA 4X6HA 1AYVA 1YALA 4YYWA 1PPNA 1XKGA 5J94A 2DCBA 2ATOA 1EF7A 2R9MA 1KXRA 2IBIA 1ZIVA 4W5CA 1MEMA
chains in the Genus database with same CATH superfamily
1MHWA 2WBFX 1VJVA 2UZJA 5EZQA 2DJFB 4IUMA 1X9YA 4AXMA 1MS6A 5JA7A 2G6DA 3KFQA 4W5BA 3USVA 1CQDA 2DC7A 4CDCB 4YYUA 3OF9A 3QSDA 3KX1A 4OELA 5JH3A 4BPVA 1DKIA 3B79A 4QH6A 1MIRA 2DCCA 4CZWA 3H8BA 2GFOA 4D8IA 4Q8GA 4XR7A 5K16A 4N79A 1F2BA 2PNSA 7PCKA 3PHXA 1EWOA 3QJ3A 4QRXA 2OZ2A 4N8WA 4YYRA 1Y4HA 4QRGA 5JZEA 3F5VA 4X6IA 3IHPA 4MZSA 1BQIA 1YK8A 1QMYA 3H8CA 4K7CA 4PP1A 3OF8A 3IV2A 2FO5A 4BOUA 1CJLA 3DF0A 3I3TA 2DZYA 1EWMA 5KO3A 3O1GA 4YYVA 2DC9A 5F02A 1AU3A 1PADA 1QOLA 3K9MA 1SNKA 2ARYA 1CSBB 1DF0A 2PBHA 2NQIA 2E03A 1M6DA 1SP4B 3PSEA 4D8EA 4OVZA 1QDQA 4YV8A 3S3RA 2P86A 4FJCA 2NQGA 1GECE 4OEMA 2FTDA 3MORA 3W31A 4RKXA 1ME3A 2VHFA 4KLBA 3WXEA 1PBHA 2YJ8A 3HHAA 4REZA 2P0RA 2DJGB 2BTWA 3E1ZB 2YJ2A 2E00A 2AU1A 1CS8A 1CB5A 2JRIA 3E9SA 1YK7A 1KFUL 4PI3A 3I06A 1KHPA 1PXVA 1NLJA 3U8EA 1AECA 1TU6A 1KFXL 4P16A 3PW3A 3NHEA 1NPZA 2XU4A 3M99A 4WURA 3HHIA 1PVJA 1NB5A 1YT7A 4IP3A 3AI8A 3QT4A 4QRVA 3KKUA 1F29A 3KW9A 6PADA 2FRAA 3MP2A 3B21A 1GMYA 1U9XA 3BY4A 4XZXA 4A5UA 2P7UA 4M0WA 2AYOA 2BTWB 2AGAA 4YYQA 3IFUA 1CVZA 3CH3X 3BWKA 1U9WA 3N3KA 3MTVA 2HD5A 2H7JA 4BQVA 1ITOA 1PE6A 1NL6A 1A6RA 1ME4A 2FUDA 3H89A 3KSEA 2IPPB 4RF0A 2PADA 4YVAA 2YJBA 2PREA 1KHQA 1IWDA 4I05A 2XU1A 2DC6A 4FIPA 4QBBA 4OW0A 3HWNA 1NB3A 3WXGA 4HWYA 1U5IA 4YYSA 3PRPA 3PRMA 4BSQA 3BPMA 2J7QA 2R9FA 3BOWA 2DOSA 3BC3A 2JTCA 3PDFA 1TL9A 3PNRA 4MZOA 1BP4A 1DEUA 4CDDB 4FK5A 3MHSA 1FH0A 3LXSA 2R6NA 9PAPA 3GCBA 3MHHA 2Y5BA 1U9VA 4N4ZA 4WA6A 4RY2A 1STFE 5EGWA 4ZTBA 2B1NA 2JQFR 4PADA 4BOPA 1VSNA 3CBKA 3PHUA 3BPFA 2XU5A 3K24A 1JQPA 2G8JA 2G7YA 2Y6EA 4I04A 2R9OA 2OULA 1CPJA 3MTNA 4PP2E 4BS6A 1O0EA 3F75A 3OVZA 3BBAA 1AIMA 4XUIA 1PIPA 1YVBA 3MJ5A 3C0RA 5EF4A 2FRQA 2DCAA 4ZUXU 1Y08A 3PHWA 1YZBA 2AIMA 3BCNA 2JQGR 3K8UA 1S4VA 5CVOB 4I07A 2C0YA 2E02A 2NQDB 4AXLA 3RVVA 2FYEA 1PPDA 3P5UA 4Q8HA 4MSXA 8PCHA 2FQ9A 2HXZA 3V6EA 3IOQA 5EZSA 2XU3A 3IUTA 2YJCA 2YJ9A 2HH5A 2OP3A 3H7DA 1PCIA 1ICFA 5A24A 3ZUAA 3N4CA 1QXPA 3ZNHA 5CHVA 1ATKA 3OQCA 2DC8A 3TRKA 3V6CA 3IEJA 1AYUA 3C9EA 2F7DA 1BY8A 4P6GA 4CDEB 3N3GA 2GHUA 3CBJA 2CB5A 1UKFA 2G8EA 1EWLA 3S3QA 1POPA 3OISA 2BU3A 4BOZA 2AS8A 4GUAA 4BS5A 3RVXA 1PPPA 3KWZA 3PBHA 3WXFA 5CVNB 4DMYA 3D6SA 5CVMA 1AU0A 1CTEA 2NQAA 1HUCB 1BGOA 2AVWA 4X6JA 1NQCA 1AU2A 2J7QC 2ACTA 1AU4A 4G54A 4W4UA 5PADA 2AUXA 2BDLA 3TMPA 4CDFB 1CV8A 3H6SA 3IMAA 1F2AA 4D8BA 3HD3A 2FE8A 1THEA 3RNVA 4P6EA 3O65A 2B1MA 5E6JA 3LFYA 3BB7A 2E01A 2VHSA 2F1GA 1MEGA 4RNAA 2AYNA 3ERVA 2O6XA 2FT2A 5CHTA 2R9CA 1GCBA 2Z84A 1Q6KA 2HWKA 3OVXA 4BOQA 5FPWA 1MDWA 1K3BB 3KWBX 4DMXA 2DCDA 3O0UA 1EWPA 4RF1A 1F2CA 1PPOA 1U9QX 3CH2X 1AYWA 2CIOA 1TLOA 3P5XA 3P5VA 3PT2A 1GLOA 3TNXA 2DZZA 3RVWA 4MI7A 2AUZA 2HHNA 1ZCMA 2BDZA 2R9NA 3P5WA 4X6HA 1AYVA 1YALA 4MM3B 4PT5A 4YYWA 1PPNA 3W30A 1XKGA 5J94A 2DCBA 4HXDB 2ATOA 1EF7A 4R3DA 2R9MA 4OVZB 1KXRA 2IBIA 1ZIVA 4W5CA 1MEMA 4BOSA
chains in the Genus database with same CATH topology
1MHWA 2WBFX 1VJVA 2DJFB 1X9YA 4AXMA 1MS6A 5JA7A 2G6DA 3KFQA 4W5BA 3USVA 1CQDA 2DC7A 4CDCB 4YYUA 3OF9A 3QSDA 3KX1A 4OELA 5JH3A 4BPVA 3B79A 4QH6A 1MIRA 2DCCA 4CZWA 3H8BA 2GFOA 4Q8GA 4XR7A 5K16A 4N79A 1F2BA 2PNSA 7PCKA 1EWOA 3QJ3A 4QRXA 2OZ2A 4N8WA 4YYRA 1Y4HA 4QRGA 3F5VA 4X6IA 3IHPA 4MZSA 1BQIA 1YK8A 1QMYA 3H8CA 4K7CA 4PP1A 3OF8A 3IV2A 2FO5A 1CJLA 3DF0A 3I3TA 2DZYA 1EWMA 3O1GA 4YYVA 2DC9A 5F02A 3D9WA 1AU3A 1PADA 1QOLA 3K9MA 1SNKA 2ARYA 1CSBB 1DF0A 2PBHA 2NQIA 2E03A 1M6DA 4NV7A 1SP4B 1QDQA 4YV8A 3S3RA 2P86A 4FJCA 2NQGA 1GECE 4OEMA 2FTDA 3MORA 1ME3A 2VHFA 4BGFA 4KLBA 3WXEA 1PBHA 2YJ8A 3HHAA 2P0RA 2DJGB 3E1ZB 2YJ2A 2E00A 2AU1A 1CS8A 1CB5A 1YK7A 1KFUL 4PI3A 3I06A 1KHPA 1PXVA 1NLJA 3U8EA 1AECA 1TU6A 1KFXL 3PW3A 3NHEA 1NPZA 2XU4A 3M99A 3HHIA 1W6FA 1YT7A 1NB5A 3AI8A 3QT4A 4QRVA 3KKUA 1F29A 2BSZA 3KW9A 6PADA 2FRAA 1GMYA 1U9XA 2P7UA 2AYOA 4YYQA 1CVZA 3CH3X 3BWKA 1U9WA 3N3KA 2HD5A 2H7JA 4BQVA 1ITOA 1PE6A 1NL6A 1A6RA 1ME4A 2FUDA 3H89A 3KSEA 2IPPB 2PADA 2VFCA 4YVAA 2YJBA 2PREA 1KHQA 1IWDA 4I05A 2XU1A 2DC6A 4FIPA 4NV8A 4QBBA 3HWNA 1NB3A 3WXGA 4HWYA 1U5IA 4YYSA 4BSQA 3BPMA 2R9FA 3BOWA 3BC3A 1W4TA 3PDFA 3LTWA 1TL9A 3PNRA 4MZOA 1BP4A 1DEUA 4CDDB 4FK5A 3MHSA 1FH0A 3LXSA 2R6NA 9PAPA 3GCBA 3MHHA 2Y5BA 1U9VA 4N4ZA 4WA6A 4RY2A 1STFE 5EGWA 2B1NA 2JQFR 4PADA 1VSNA 3CBKA 3BPFA 2XU5A 3K24A 1JQPA 2G8JA 4GUZA 2G7YA 2Y6EA 4I04A 2R9OA 2OULA 1CPJA 3MTNA 4PP2E 4BS6A 1O0EA 3F75A 3OVZA 1E2TA 1AIMA 4XUIA 1PIPA 1YVBA 5EF4A 2FRQA 2DCAA 4ZUXU 1Y08A 3BCNA 2AIMA 2JQGR 3K8UA 1S4VA 5CVOB 4I07A 2C0YA 2E02A 2NQDB 4AXLA 3RVVA 2FYEA 1PPDA 3P5UA 4Q8HA 4MSXA 8PCHA 2FQ9A 2HXZA 4B55A 3V6EA 3IOQA 2XU3A 3IUTA 2YJCA 2YJ9A 2HH5A 2OP3A 3H7DA 1PCIA 1ICFA 5A24A 3ZUAA 3N4CA 1QXPA 5CHVA 1ATKA 2DC8A 3V6CA 3IEJA 1AYUA 3C9EA 2F7DA 1BY8A 4P6GA 4CDEB 1W5RA 3N3GA 4C5PA 2GHUA 3CBJA 2CB5A 2G8EA 1EWLA 3S3QA 1POPA 3OISA 2AS8A 4BS5A 3RVXA 1PPPA 3KWZA 3PBHA 3WXFA 5CVNB 4DMYA 3D6SA 5CVMA 1AU0A 1CTEA 2NQAA 1HUCB 1BGOA 2AVWA 4X6JA 1NQCA 1AU2A 2ACTA 1AU4A 4G54A 4W4UA 5PADA 2AUXA 2BDLA 4CDFB 1CV8A 3H6SA 3IMAA 1F2AA 3HD3A 1THEA 4P6EA 2B1MA 3LFYA 2E01A 2VHSA 2F1GA 1MEGA 2AYNA 3ERVA 2O6XA 2FT2A 5CHTA 2R9CA 1GCBA 1Q6KA 3OVXA 5FPWA 1MDWA 1K3BB 3KWBX 4DMXA 2DCDA 3O0UA 1EWPA 1F2CA 1PPOA 1U9QX 3CH2X 1AYWA 2CIOA 1TLOA 3P5XA 3P5VA 1GLOA 1GX3A 3TNXA 2DZZA 3RVWA 2AUZA 2HHNA 1ZCMA 2BDZA 2R9NA 2VFBA 3P5WA 4X6HA 1AYVA 1YALA 4YYWA 1PPNA 1XKGA 5J94A 2DCBA 2ATOA 1EF7A 2R9MA 1KXRA 2IBIA 1ZIVA 4W5CA 1MEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHW A;  2WBF X;  1VJV A;  2DJF B;  1X9Y A;  4AXM A;  1MS6 A;  5JA7 A;  2G6D A;  3KFQ A;  4W5B A;  3USV A;  1CQD A;  2DC7 A;  4CDC B;  4YYU A;  3OF9 A;  3QSD A;  3KX1 A;  4OEL A;  5JH3 A;  4BPV A;  3B79 A;  4QH6 A;  1MIR A;  2DCC A;  4CZW A;  3H8B A;  2GFO A;  4Q8G A;  4XR7 A;  5K16 A;  4N79 A;  1F2B A;  2PNS A;  7PCK A;  1EWO A;  3QJ3 A;  4QRX A;  2OZ2 A;  4N8W A;  4YYR A;  1Y4H A;  4QRG A;  3F5V A;  4X6I A;  3IHP A;  4MZS A;  1BQI A;  1YK8 A;  1QMY A;  3H8C A;  4K7C A;  4PP1 A;  3OF8 A;  3IV2 A;  2FO5 A;  1CJL A;  3DF0 A;  3I3T A;  2DZY A;  1EWM A;  3O1G A;  4YYV A;  2DC9 A;  5F02 A;  1AU3 A;  1PAD A;  1QOL A;  3K9M A;  1SNK A;  2ARY A;  1CSB B;  1DF0 A;  2PBH A;  2NQI A;  2E03 A;  1M6D A;  1SP4 B;  1QDQ A;  4YV8 A;  3S3R A;  2P86 A;  4FJC A;  2NQG A;  1GEC E;  4OEM A;  2FTD A;  3MOR A;  1ME3 A;  2VHF A;  4KLB A;  3WXE A;  1PBH A;  2YJ8 A;  3HHA A;  2P0R A;  2DJG B;  3E1Z B;  2YJ2 A;  2E00 A;  2AU1 A;  1CS8 A;  1CB5 A;  1YK7 A;  1KFU L;  4PI3 A;  3I06 A;  1KHP A;  1PXV A;  1NLJ A;  3U8E A;  1AEC A;  1TU6 A;  1KFX L;  3PW3 A;  3NHE A;  1NPZ A;  2XU4 A;  3M99 A;  3HHI A;  1NB5 A;  1YT7 A;  3AI8 A;  3QT4 A;  4QRV A;  3KKU A;  1F29 A;  3KW9 A;  6PAD A;  2FRA A;  1GMY A;  1U9X A;  2P7U A;  2AYO A;  4YYQ A;  1CVZ A;  3CH3 X;  3BWK A;  1U9W A;  3N3K A;  2HD5 A;  2H7J A;  4BQV A;  1ITO A;  1PE6 A;  1NL6 A;  1A6R A;  1ME4 A;  2FUD A;  3H89 A;  3KSE A;  2IPP B;  2PAD A;  4YVA A;  2YJB A;  2PRE A;  1KHQ A;  1IWD A;  4I05 A;  2XU1 A;  2DC6 A;  4FIP A;  4QBB A;  3HWN A;  1NB3 A;  3WXG A;  4HWY A;  1U5I A;  4YYS A;  4BSQ A;  3BPM A;  2R9F A;  3BOW A;  3BC3 A;  3PDF A;  1TL9 A;  3PNR A;  4MZO A;  1BP4 A;  1DEU A;  4CDD B;  4FK5 A;  3MHS A;  1FH0 A;  3LXS A;  2R6N A;  9PAP A;  3GCB A;  3MHH A;  2Y5B A;  1U9V A;  4N4Z A;  4WA6 A;  4RY2 A;  1STF E;  5EGW A;  2B1N A;  2JQF R;  4PAD A;  1VSN A;  3CBK A;  3BPF A;  2XU5 A;  3K24 A;  1JQP A;  2G8J A;  2G7Y A;  2Y6E A;  4I04 A;  2R9O A;  2OUL A;  1CPJ A;  3MTN A;  4PP2 E;  4BS6 A;  1O0E A;  3F75 A;  3OVZ A;  1AIM A;  4XUI A;  1PIP A;  1YVB A;  5EF4 A;  2FRQ A;  2DCA A;  4ZUX U;  1Y08 A;  3BCN A;  2AIM A;  2JQG R;  3K8U A;  1S4V A;  5CVO B;  4I07 A;  2C0Y A;  2E02 A;  2NQD B;  4AXL A;  3RVV A;  2FYE A;  1PPD A;  3P5U A;  4Q8H A;  4MSX A;  8PCH A;  2FQ9 A;  2HXZ A;  3V6E A;  3IOQ A;  2XU3 A;  3IUT A;  2YJC A;  2YJ9 A;  2HH5 A;  2OP3 A;  3H7D A;  1PCI A;  1ICF A;  5A24 A;  3ZUA A;  3N4C A;  1QXP A;  5CHV A;  1ATK A;  2DC8 A;  3V6C A;  3IEJ A;  1AYU A;  3C9E A;  2F7D A;  1BY8 A;  4P6G A;  4CDE B;  3N3G A;  2GHU A;  3CBJ A;  2CB5 A;  2G8E A;  1EWL A;  3S3Q A;  1POP A;  3OIS A;  2AS8 A;  4BS5 A;  3RVX A;  1PPP A;  3KWZ A;  3PBH A;  3WXF A;  5CVN B;  4DMY A;  3D6S A;  5CVM A;  1AU0 A;  1CTE A;  2NQA A;  1HUC B;  1BGO A;  2AVW A;  4X6J A;  1NQC A;  1AU2 A;  2ACT A;  1AU4 A;  4G54 A;  4W4U A;  5PAD A;  2AUX A;  2BDL A;  4CDF B;  1CV8 A;  3H6S A;  3IMA A;  1F2A A;  3HD3 A;  1THE A;  4P6E A;  2B1M A;  3LFY A;  2E01 A;  2VHS A;  2F1G A;  1MEG A;  2AYN A;  3ERV A;  2O6X A;  2FT2 A;  5CHT A;  2R9C A;  1GCB A;  1Q6K A;  3OVX A;  5FPW A;  1MDW A;  1K3B B;  3KWB X;  4DMX A;  2DCD A;  3O0U A;  1EWP A;  1F2C A;  1PPO A;  1U9Q X;  3CH2 X;  1AYW A;  2CIO A;  1TLO A;  3P5X A;  3P5V A;  1GLO A;  3TNX A;  2DZZ A;  3RVW A;  2AUZ A;  2HHN A;  1ZCM A;  2BDZ A;  2R9N A;  3P5W A;  4X6H A;  1AYV A;  1YAL A;  4YYW A;  1PPN A;  1XKG A;  5J94 A;  2DCB A;  2ATO A;  1EF7 A;  2R9M A;  1KXR A;  2IBI A;  1ZIV A;  4W5C A;  1MEM A; 
#chains in the Genus database with same CATH topology
 1MHW A;  2WBF X;  1VJV A;  2UZJ A;  5EZQ A;  2DJF B;  4IUM A;  1X9Y A;  4AXM A;  1MS6 A;  5JA7 A;  2G6D A;  3KFQ A;  4W5B A;  3USV A;  1CQD A;  2DC7 A;  4CDC B;  4YYU A;  3OF9 A;  3QSD A;  3KX1 A;  4OEL A;  5JH3 A;  4BPV A;  1DKI A;  3B79 A;  4QH6 A;  1MIR A;  2DCC A;  4CZW A;  3H8B A;  2GFO A;  4D8I A;  4Q8G A;  4XR7 A;  5K16 A;  4N79 A;  1F2B A;  2PNS A;  7PCK A;  3PHX A;  1EWO A;  3QJ3 A;  4QRX A;  2OZ2 A;  4N8W A;  4YYR A;  1Y4H A;  4QRG A;  5JZE A;  3F5V A;  4X6I A;  3IHP A;  4MZS A;  1BQI A;  1YK8 A;  1QMY A;  3H8C A;  4K7C A;  4PP1 A;  3OF8 A;  3IV2 A;  2FO5 A;  4BOU A;  1CJL A;  3DF0 A;  3I3T A;  2DZY A;  1EWM A;  5KO3 A;  3O1G A;  4YYV A;  2DC9 A;  5F02 A;  1AU3 A;  1PAD A;  1QOL A;  3K9M A;  1SNK A;  2ARY A;  1CSB B;  1DF0 A;  2PBH A;  2NQI A;  2E03 A;  1M6D A;  1SP4 B;  3PSE A;  4D8E A;  4OVZ A;  1QDQ A;  4YV8 A;  3S3R A;  2P86 A;  4FJC A;  2NQG A;  1GEC E;  4OEM A;  2FTD A;  3MOR A;  3W31 A;  4RKX A;  1ME3 A;  2VHF A;  4KLB A;  3WXE A;  1PBH A;  2YJ8 A;  3HHA A;  4REZ A;  2P0R A;  2DJG B;  2BTW A;  3E1Z B;  2YJ2 A;  2E00 A;  2AU1 A;  1CS8 A;  1CB5 A;  2JRI A;  3E9S A;  1YK7 A;  1KFU L;  4PI3 A;  3I06 A;  1KHP A;  1PXV A;  1NLJ A;  3U8E A;  1AEC A;  1TU6 A;  1KFX L;  4P16 A;  3PW3 A;  3NHE A;  1NPZ A;  2XU4 A;  3M99 A;  4WUR A;  3HHI A;  1PVJ A;  1NB5 A;  1YT7 A;  4IP3 A;  3AI8 A;  3QT4 A;  4QRV A;  3KKU A;  1F29 A;  3KW9 A;  6PAD A;  2FRA A;  3MP2 A;  3B21 A;  1GMY A;  1U9X A;  3BY4 A;  4XZX A;  4A5U A;  2P7U A;  4M0W A;  2AYO A;  2BTW B;  2AGA A;  4YYQ A;  3IFU A;  1CVZ A;  3CH3 X;  3BWK A;  1U9W A;  3N3K A;  3MTV A;  2HD5 A;  2H7J A;  4BQV A;  1ITO A;  1PE6 A;  1NL6 A;  1A6R A;  1ME4 A;  2FUD A;  3H89 A;  3KSE A;  2IPP B;  4RF0 A;  2PAD A;  4YVA A;  2YJB A;  2PRE A;  1KHQ A;  1IWD A;  4I05 A;  2XU1 A;  2DC6 A;  4FIP A;  4QBB A;  4OW0 A;  3HWN A;  1NB3 A;  3WXG A;  4HWY A;  1U5I A;  4YYS A;  3PRP A;  3PRM A;  4BSQ A;  3BPM A;  2J7Q A;  2R9F A;  3BOW A;  2DOS A;  3BC3 A;  2JTC A;  3PDF A;  1TL9 A;  3PNR A;  4MZO A;  1BP4 A;  1DEU A;  4CDD B;  4FK5 A;  3MHS A;  1FH0 A;  3LXS A;  2R6N A;  9PAP A;  3GCB A;  3MHH A;  2Y5B A;  1U9V A;  4N4Z A;  4WA6 A;  4RY2 A;  1STF E;  5EGW A;  4ZTB A;  2B1N A;  2JQF R;  4PAD A;  4BOP A;  1VSN A;  3CBK A;  3PHU A;  3BPF A;  2XU5 A;  3K24 A;  1JQP A;  2G8J A;  2G7Y A;  2Y6E A;  4I04 A;  2R9O A;  2OUL A;  1CPJ A;  3MTN A;  4PP2 E;  4BS6 A;  1O0E A;  3F75 A;  3OVZ A;  3BBA A;  1AIM A;  4XUI A;  1PIP A;  1YVB A;  3MJ5 A;  3C0R A;  5EF4 A;  2FRQ A;  2DCA A;  4ZUX U;  1Y08 A;  3PHW A;  1YZB A;  2AIM A;  3BCN A;  2JQG R;  3K8U A;  1S4V A;  5CVO B;  4I07 A;  2C0Y A;  2E02 A;  2NQD B;  4AXL A;  3RVV A;  2FYE A;  1PPD A;  3P5U A;  4Q8H A;  4MSX A;  8PCH A;  2FQ9 A;  2HXZ A;  3V6E A;  3IOQ A;  5EZS A;  2XU3 A;  3IUT A;  2YJC A;  2YJ9 A;  2HH5 A;  2OP3 A;  3H7D A;  1PCI A;  1ICF A;  5A24 A;  3ZUA A;  3N4C A;  1QXP A;  3ZNH A;  5CHV A;  1ATK A;  3OQC A;  2DC8 A;  3TRK A;  3V6C A;  3IEJ A;  1AYU A;  3C9E A;  2F7D A;  1BY8 A;  4P6G A;  4CDE B;  3N3G A;  2GHU A;  3CBJ A;  2CB5 A;  1UKF A;  2G8E A;  1EWL A;  3S3Q A;  1POP A;  3OIS A;  2BU3 A;  4BOZ A;  2AS8 A;  4GUA A;  4BS5 A;  3RVX A;  1PPP A;  3KWZ A;  3PBH A;  3WXF A;  5CVN B;  4DMY A;  3D6S A;  5CVM A;  1AU0 A;  1CTE A;  2NQA A;  1HUC B;  1BGO A;  2AVW A;  4X6J A;  1NQC A;  1AU2 A;  2J7Q C;  2ACT A;  1AU4 A;  4G54 A;  4W4U A;  5PAD A;  2AUX A;  2BDL A;  3TMP A;  4CDF B;  1CV8 A;  3H6S A;  3IMA A;  1F2A A;  4D8B A;  3HD3 A;  2FE8 A;  1THE A;  3RNV A;  4P6E A;  3O65 A;  2B1M A;  5E6J A;  3LFY A;  3BB7 A;  2E01 A;  2VHS A;  2F1G A;  1MEG A;  4RNA A;  2AYN A;  3ERV A;  2O6X A;  2FT2 A;  5CHT A;  2R9C A;  1GCB A;  2Z84 A;  1Q6K A;  2HWK A;  3OVX A;  4BOQ A;  5FPW A;  1MDW A;  1K3B B;  3KWB X;  4DMX A;  2DCD A;  3O0U A;  1EWP A;  4RF1 A;  1F2C A;  1PPO A;  1U9Q X;  3CH2 X;  1AYW A;  2CIO A;  1TLO A;  3P5X A;  3P5V A;  3PT2 A;  1GLO A;  3TNX A;  2DZZ A;  3RVW A;  4MI7 A;  2AUZ A;  2HHN A;  1ZCM A;  2BDZ A;  2R9N A;  3P5W A;  4X6H A;  1AYV A;  1YAL A;  4MM3 B;  4PT5 A;  4YYW A;  1PPN A;  3W30 A;  1XKG A;  5J94 A;  2DCB A;  4HXD B;  2ATO A;  1EF7 A;  4R3D A;  2R9M A;  4OVZ B;  1KXR A;  2IBI A;  1ZIV A;  4W5C A;  1MEM A;  4BOS A; 
#chains in the Genus database with same CATH homology
 1MHW A;  2WBF X;  1VJV A;  2DJF B;  1X9Y A;  4AXM A;  1MS6 A;  5JA7 A;  2G6D A;  3KFQ A;  4W5B A;  3USV A;  1CQD A;  2DC7 A;  4CDC B;  4YYU A;  3OF9 A;  3QSD A;  3KX1 A;  4OEL A;  5JH3 A;  4BPV A;  3B79 A;  4QH6 A;  1MIR A;  2DCC A;  4CZW A;  3H8B A;  2GFO A;  4Q8G A;  4XR7 A;  5K16 A;  4N79 A;  1F2B A;  2PNS A;  7PCK A;  1EWO A;  3QJ3 A;  4QRX A;  2OZ2 A;  4N8W A;  4YYR A;  1Y4H A;  4QRG A;  3F5V A;  4X6I A;  3IHP A;  4MZS A;  1BQI A;  1YK8 A;  1QMY A;  3H8C A;  4K7C A;  4PP1 A;  3OF8 A;  3IV2 A;  2FO5 A;  1CJL A;  3DF0 A;  3I3T A;  2DZY A;  1EWM A;  3O1G A;  4YYV A;  2DC9 A;  5F02 A;  3D9W A;  1AU3 A;  1PAD A;  1QOL A;  3K9M A;  1SNK A;  2ARY A;  1CSB B;  1DF0 A;  2PBH A;  2NQI A;  2E03 A;  1M6D A;  4NV7 A;  1SP4 B;  1QDQ A;  4YV8 A;  3S3R A;  2P86 A;  4FJC A;  2NQG A;  1GEC E;  4OEM A;  2FTD A;  3MOR A;  1ME3 A;  2VHF A;  4BGF A;  4KLB A;  3WXE A;  1PBH A;  2YJ8 A;  3HHA A;  2P0R A;  2DJG B;  3E1Z B;  2YJ2 A;  2E00 A;  2AU1 A;  1CS8 A;  1CB5 A;  1YK7 A;  1KFU L;  4PI3 A;  3I06 A;  1KHP A;  1PXV A;  1NLJ A;  3U8E A;  1AEC A;  1TU6 A;  1KFX L;  3PW3 A;  3NHE A;  1NPZ A;  2XU4 A;  3M99 A;  3HHI A;  1W6F A;  1YT7 A;  1NB5 A;  3AI8 A;  3QT4 A;  4QRV A;  3KKU A;  1F29 A;  2BSZ A;  3KW9 A;  6PAD A;  2FRA A;  1GMY A;  1U9X A;  2P7U A;  2AYO A;  4YYQ A;  1CVZ A;  3CH3 X;  3BWK A;  1U9W A;  3N3K A;  2HD5 A;  2H7J A;  4BQV A;  1ITO A;  1PE6 A;  1NL6 A;  1A6R A;  1ME4 A;  2FUD A;  3H89 A;  3KSE A;  2IPP B;  2PAD A;  2VFC A;  4YVA A;  2YJB A;  2PRE A;  1KHQ A;  1IWD A;  4I05 A;  2XU1 A;  2DC6 A;  4FIP A;  4NV8 A;  4QBB A;  3HWN A;  1NB3 A;  3WXG A;  4HWY A;  1U5I A;  4YYS A;  4BSQ A;  3BPM A;  2R9F A;  3BOW A;  3BC3 A;  1W4T A;  3PDF A;  3LTW A;  1TL9 A;  3PNR A;  4MZO A;  1BP4 A;  1DEU A;  4CDD B;  4FK5 A;  3MHS A;  1FH0 A;  3LXS A;  2R6N A;  9PAP A;  3GCB A;  3MHH A;  2Y5B A;  1U9V A;  4N4Z A;  4WA6 A;  4RY2 A;  1STF E;  5EGW A;  2B1N A;  2JQF R;  4PAD A;  1VSN A;  3CBK A;  3BPF A;  2XU5 A;  3K24 A;  1JQP A;  2G8J A;  4GUZ A;  2G7Y A;  2Y6E A;  4I04 A;  2R9O A;  2OUL A;  1CPJ A;  3MTN A;  4PP2 E;  4BS6 A;  1O0E A;  3F75 A;  3OVZ A;  1E2T A;  1AIM A;  4XUI A;  1PIP A;  1YVB A;  5EF4 A;  2FRQ A;  2DCA A;  4ZUX U;  1Y08 A;  3BCN A;  2AIM A;  2JQG R;  3K8U A;  1S4V A;  5CVO B;  4I07 A;  2C0Y A;  2E02 A;  2NQD B;  4AXL A;  3RVV A;  2FYE A;  1PPD A;  3P5U A;  4Q8H A;  4MSX A;  8PCH A;  2FQ9 A;  2HXZ A;  4B55 A;  3V6E A;  3IOQ A;  2XU3 A;  3IUT A;  2YJC A;  2YJ9 A;  2HH5 A;  2OP3 A;  3H7D A;  1PCI A;  1ICF A;  5A24 A;  3ZUA A;  3N4C A;  1QXP A;  5CHV A;  1ATK A;  2DC8 A;  3V6C A;  3IEJ A;  1AYU A;  3C9E A;  2F7D A;  1BY8 A;  4P6G A;  4CDE B;  1W5R A;  3N3G A;  4C5P A;  2GHU A;  3CBJ A;  2CB5 A;  2G8E A;  1EWL A;  3S3Q A;  1POP A;  3OIS A;  2AS8 A;  4BS5 A;  3RVX A;  1PPP A;  3KWZ A;  3PBH A;  3WXF A;  5CVN B;  4DMY A;  3D6S A;  5CVM A;  1AU0 A;  1CTE A;  2NQA A;  1HUC B;  1BGO A;  2AVW A;  4X6J A;  1NQC A;  1AU2 A;  2ACT A;  1AU4 A;  4G54 A;  4W4U A;  5PAD A;  2AUX A;  2BDL A;  4CDF B;  1CV8 A;  3H6S A;  3IMA A;  1F2A A;  3HD3 A;  1THE A;  4P6E A;  2B1M A;  3LFY A;  2E01 A;  2VHS A;  2F1G A;  1MEG A;  2AYN A;  3ERV A;  2O6X A;  2FT2 A;  5CHT A;  2R9C A;  1GCB A;  1Q6K A;  3OVX A;  5FPW A;  1MDW A;  1K3B B;  3KWB X;  4DMX A;  2DCD A;  3O0U A;  1EWP A;  1F2C A;  1PPO A;  1U9Q X;  3CH2 X;  1AYW A;  2CIO A;  1TLO A;  3P5X A;  3P5V A;  1GLO A;  1GX3 A;  3TNX A;  2DZZ A;  3RVW A;  2AUZ A;  2HHN A;  1ZCM A;  2BDZ A;  2R9N A;  2VFB A;  3P5W A;  4X6H A;  1AYV A;  1YAL A;  4YYW A;  1PPN A;  1XKG A;  5J94 A;  2DCB A;  2ATO A;  1EF7 A;  2R9M A;  1KXR A;  2IBI A;  1ZIV A;  4W5C A;  1MEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...