2R9MA

Cathepsin s complexed with compound 15
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin S
publication title Design and Synthesis of Reversible Inhibitors of Cathepsin S: alpha,alpha-Disubstitution at the P1 Residue Provides Potent Inhibitors in Cellular Assays and In Vivo Models of Antigen Presentation
rcsb
source organism Homo sapiens
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2007-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2r9mA00
1BY8A 2AYNA 3H8CA 1MEGA 3PBHA 1PXVA 1YK7A 4FIPA 4N8WA 1ME3A 3V6EA 2G6DA 4ZUXU 1AECA 1U5IA 2G7YA 1KHQA 4PADA 2PREA 3D6SA 1SP4B 3V6CA 5F02A 4BS6A 1MIRA 2R6NA 3QJ3A 2GHUA 3RVWA 2FTDA 1KFUL 2PADA 1KHPA 2NQDB 3N3GA 2ARYA 1MS6A 1AIMA 2G8JA 2XU5A 5FPWA 2NQAA 2R9FA 4YYQA 2DC7A 3IHPA 2BDZA 1Q6KA 2OULA 2F7DA 3KKUA 1DF0A 3BCNA 3BPMA 1EWLA 1GECE 4BQVA 4FK5A 1YT7A 3CH2X 1TLOA 2O6XA 2AU1A 1PADA 3IV2A 2FT2A 1QOLA 4W5BA 3IUTA 1PPDA 3HHIA 3QSDA 1NQCA 3PNRA 1PPOA 3P5XA 4MZSA 2AUXA 3RVXA 4YYWA 1BP4A 2R9MA 2B1MA 3LFYA 3O1GA 1CVZA 2Y6EA 1TL9A 3MHSA 4YYSA 1TU6A 1QMYA 3KWBX 4Q8GA 4QH6A 2YJ8A 1YK8A 4YV8A 3BC3A 4QBBA 7PCKA 4CDCB 1STFE 4PP2E 1U9VA 4Q8HA 4YYUA 3QT4A 1AU4A 3H6SA 1XKGA 3IEJA 1Y4HA 2P86A 2R9CA 2PNSA 3RVVA 3MHHA 5CHTA 5A24A 3H7DA 2GFOA 3CH3X 1ICFA 3K8UA 1ME4A 3OVXA 1ZIVA 4BS5A 2DCCA 3OISA 3C9EA 4XR7A 1PPPA 1QXPA 4DMXA 1CS8A 1PIPA 1EWOA 4P6EA 3ZUAA 1YVBA 4AXMA 4FJCA 2B1NA 1K3BB 4W5CA 4K7CA 3P5WA 2DC8A 2YJBA 9PAPA 2E00A 3OVZA 1CSBB 4DMYA 3DF0A 3I06A 2E03A 4CDFB 1PBHA 1YALA 4N4ZA 3CBKA 1F2CA 1HUCB 2R9OA 2Y5BA 2BDLA 3WXEA 4BSQA 2E02A 4I05A 1ATKA 3K24A 2YJCA 2NQIA 1NPZA 2FYEA 4MZOA 2C0YA 4X6HA 1ITOA 2AUZA 1F29A 3KWZA 1IWDA 3NHEA 2FRQA 5EGWA 3F75A 4CDEB 1A6RA 2HH5A 1NB5A 3WXFA 2JQGR 1NL6A 1PCIA 4X6IA 2FRAA 3BWKA 5CHVA 3KW9A 2AIMA 1CJLA 2G8EA 4YYRA 2VHFA 3MTNA 3F5VA 4P6GA 1KFXL 2DCBA 4N79A 2HHNA 2DCDA 3S3QA 2HXZA 3USVA 2FO5A 4OEMA 2ACTA 4WA6A 3E1ZB 4QRGA 2WBFX 1M6DA 1FH0A 6PADA 1BGOA 2DZZA 1JQPA 1AU2A 5EF4A 1AYVA 3S3RA 2XU3A 1MEMA 4XUIA 1GLOA 3B79A 3O0UA 5JA7A 1X9YA 4I04A 3N3KA 4CZWA 2P7UA 3TNXA 1MHWA 1EWMA 1VJVA 4QRVA 2XU4A 1SNKA 2YJ2A 5PADA 3H8BA 3H89A 1PE6A 3OF9A 1DEUA 2CIOA 3U8EA 1GCBA 4QRXA 2DCAA 1AYUA 5CVNB 2IPPB 2IBIA 5JH3A 3KX1A 4PP1A 1AU3A 2DJGB 3MORA 3PW3A 1CQDA 5J94A 4I07A 3HWNA 4AXLA 2CB5A 1EWPA 4CDDB 1U9QX 1VSNA 4X6JA 1F2AA 3AI8A 5CVMA 1QDQA 2AVWA 1CPJA 4G54A 4W4UA 2R9NA 5K16A 3IOQA 3HHAA 3N4CA 1Y08A 3K9MA 3KFQA 2DC9A 2OZ2A 3BOWA 3WXGA 5CVOB 1CV8A 1NLJA 2AS8A 1CTEA 2PBHA 1NB3A 2E01A 1THEA 3KSEA 3BPFA 1S4VA 1BQIA 2FUDA 1CB5A 3I3TA 1MDWA 4YVAA 4YYVA 2YJ9A 2DZYA 4KLBA 2DC6A 2NQGA 4MSXA 3CBJA 3HD3A 2P0RA 2H7JA 3PDFA 4HWYA 4PI3A 1KXRA 2XU1A 1EF7A 1ZCMA 2JQFR 4RY2A 1POPA 4BPVA 2OP3A 3ERVA 2ATOA 1GMYA 1U9WA 3LXSA 1U9XA 2FQ9A 2F1GA 4OELA 3M99A 1PPNA 1AU0A 3IMAA 2AYOA 2HD5A 3P5UA 2VHSA 3OF8A 1AYWA 2DJFB 8PCHA 1F2BA 1O0EA 3GCBA 3P5VA
chains in the Genus database with same CATH superfamily
1BY8A 2AYNA 3H8CA 3W30A 4RKXA 4D8BA 1MEGA 3PBHA 1YZBA 3PRPA 1PXVA 1YK7A 4FIPA 4N8WA 1ME3A 3V6EA 2G6DA 4ZUXU 1AECA 1U5IA 2G7YA 1KHQA 2BTWA 4PADA 2JRIA 2PREA 3D6SA 1SP4B 3V6CA 5F02A 4BS6A 1MIRA 2R6NA 3QJ3A 3MJ5A 2GHUA 3RVWA 2FTDA 1KFUL 4OVZA 2PADA 4IP3A 1KHPA 2NQDB 3N3GA 2ARYA 1MS6A 1AIMA 2G8JA 2XU5A 5FPWA 2NQAA 2R9FA 4YYQA 2J7QC 2DC7A 3IHPA 4RF0A 2BDZA 1Q6KA 3BBAA 2OULA 2F7DA 3KKUA 4D8EA 4IUMA 1DF0A 2FE8A 3BCNA 3BPMA 1EWLA 1GECE 4BQVA 3PT2A 4OVZB 4FK5A 1YT7A 3CH2X 1TLOA 2O6XA 2AU1A 1PADA 3IV2A 2FT2A 3MP2A 1QOLA 4W5BA 3IUTA 1PPDA 3HHIA 3QSDA 1NQCA 4ZTBA 3PNRA 1PPOA 3P5XA 4MZSA 2AUXA 3RVXA 4YYWA 1BP4A 2J7QA 2R9MA 2B1MA 3LFYA 2UZJA 3O1GA 1CVZA 2Y6EA 1TL9A 3MHSA 4YYSA 1TU6A 1QMYA 3KWBX 1DKIA 4Q8GA 4QH6A 2YJ8A 1YK8A 4YV8A 3BC3A 4BOUA 4QBBA 7PCKA 4CDCB 1STFE 4PP2E 1U9VA 3W31A 4Q8HA 4YYUA 3QT4A 1AU4A 3H6SA 4MI7A 1XKGA 3IEJA 3PHXA 1Y4HA 2P86A 2R9CA 2PNSA 3RVVA 4BOPA 3MHHA 5CHTA 5A24A 3H7DA 2GFOA 3CH3X 1ICFA 3K8UA 1ME4A 3OVXA 5KO3A 3IFUA 1ZIVA 4BS5A 2DCCA 3OQCA 1PVJA 3OISA 3C9EA 4XR7A 3RNVA 3BB7A 1PPPA 1QXPA 4DMXA 1CS8A 1PIPA 1EWOA 4P6EA 3ZUAA 3TRKA 4BOZA 1YVBA 4AXMA 4FJCA 2B1NA 1K3BB 4W5CA 2AGAA 4K7CA 3P5WA 2DC8A 2YJBA 9PAPA 2E00A 3OVZA 1CSBB 4DMYA 3DF0A 3I06A 2E03A 4CDFB 1PBHA 1YALA 4N4ZA 5EZQA 3CBKA 1F2CA 1HUCB 2R9OA 2Y5BA 2BDLA 3WXEA 4BSQA 4M0WA 2E02A 4I05A 5E6JA 1ATKA 3K24A 2YJCA 2NQIA 4WURA 1NPZA 3PSEA 2FYEA 4MZOA 2C0YA 4X6HA 1ITOA 2AUZA 1UKFA 1F29A 3KWZA 1IWDA 3NHEA 2FRQA 5EGWA 3F75A 4BOSA 4CDEB 1A6RA 2HH5A 2JTCA 3WXFA 1NB5A 2JQGR 1NL6A 1PCIA 4X6IA 2FRAA 3BWKA 5CHVA 3KW9A 5EZSA 2Z84A 2AIMA 1CJLA 2G8EA 4YYRA 2VHFA 3MTNA 3F5VA 4P6GA 1KFXL 2DCBA 4N79A 2HHNA 2DCDA 3S3QA 2HXZA 3USVA 2FO5A 4OEMA 2ACTA 4WA6A 4RNAA 3PHWA 3ZNHA 3E1ZB 4QRGA 2WBFX 1M6DA 1FH0A 6PADA 1BGOA 2BU3A 2DZZA 1JQPA 1AU2A 5EF4A 1AYVA 3S3RA 2XU3A 1MEMA 4XUIA 1GLOA 3B79A 3O0UA 4MM3B 5JA7A 3E9SA 1X9YA 4I04A 3N3KA 4OW0A 4CZWA 2P7UA 3TNXA 1MHWA 3B21A 1EWMA 1VJVA 4QRVA 2XU4A 1SNKA 2YJ2A 5PADA 3H8BA 3H89A 1PE6A 3OF9A 1DEUA 2CIOA 3U8EA 1GCBA 4BOQA 4QRXA 2DCAA 1AYUA 5CVNB 2IPPB 2IBIA 3BY4A 5JH3A 3KX1A 4PP1A 1AU3A 2DJGB 3MORA 3PW3A 1CQDA 5J94A 4I07A 3HWNA 4AXLA 2CB5A 1EWPA 3PRMA 4CDDB 1U9QX 1VSNA 5JZEA 4X6JA 1F2AA 3AI8A 4HXDB 5CVMA 1QDQA 2AVWA 1CPJA 4G54A 4GUAA 4W4UA 2R9NA 5K16A 3IOQA 3HHAA 3N4CA 1Y08A 2BTWB 3K9MA 3KFQA 2DC9A 2OZ2A 3BOWA 3WXGA 5CVOB 1CV8A 1NLJA 2AS8A 1CTEA 2PBHA 1NB3A 2E01A 1THEA 3KSEA 3BPFA 1S4VA 1BQIA 4D8IA 2FUDA 4PT5A 1CB5A 3I3TA 1MDWA 4A5UA 4YVAA 4YYVA 2YJ9A 2DZYA 2HWKA 4KLBA 2DC6A 2NQGA 4MSXA 3CBJA 3HD3A 3PHUA 4R3DA 2P0RA 2H7JA 2DOSA 3PDFA 3C0RA 4HWYA 4PI3A 1KXRA 2XU1A 1EF7A 1ZCMA 2JQFR 4RY2A 1POPA 4BPVA 2OP3A 3ERVA 2ATOA 1GMYA 1U9WA 3LXSA 1U9XA 2FQ9A 2F1GA 4P16A 4OELA 4XZXA 3M99A 1PPNA 1AU0A 3IMAA 2AYOA 2HD5A 3MTVA 3P5UA 2VHSA 3OF8A 1AYWA 2DJFB 4RF1A 8PCHA 1F2BA 1O0EA 3GCBA 4REZA 3O65A 3P5VA 3TMPA
chains in the Genus database with same CATH topology
1BY8A 2AYNA 3H8CA 1MEGA 3PBHA 1PXVA 1YK7A 4FIPA 4N8WA 1ME3A 3V6EA 2G6DA 4ZUXU 1AECA 1U5IA 2G7YA 1KHQA 4PADA 2PREA 3D6SA 1SP4B 3V6CA 5F02A 3D9WA 4BS6A 1MIRA 2R6NA 3QJ3A 2GHUA 3RVWA 2FTDA 1KFUL 2PADA 1KHPA 2NQDB 3N3GA 2ARYA 1MS6A 1AIMA 2G8JA 2XU5A 5FPWA 2NQAA 2R9FA 4YYQA 2DC7A 3IHPA 2BDZA 1Q6KA 2OULA 2F7DA 1E2TA 3KKUA 1DF0A 3BCNA 3BPMA 1EWLA 1GECE 4BQVA 4FK5A 1YT7A 3CH2X 1TLOA 2O6XA 2AU1A 1PADA 3IV2A 2FT2A 1QOLA 4W5BA 3IUTA 1PPDA 3HHIA 3QSDA 1NQCA 3PNRA 1PPOA 3P5XA 4MZSA 2AUXA 3RVXA 4YYWA 1BP4A 2R9MA 2B1MA 3LFYA 3O1GA 1CVZA 2Y6EA 1TL9A 3MHSA 4YYSA 1TU6A 1QMYA 3KWBX 4Q8GA 4QH6A 2YJ8A 3LTWA 1YK8A 4YV8A 3BC3A 4QBBA 7PCKA 4CDCB 1STFE 4PP2E 1U9VA 4Q8HA 4YYUA 3QT4A 1AU4A 3H6SA 1XKGA 3IEJA 1Y4HA 2P86A 2R9CA 2PNSA 3RVVA 3MHHA 5CHTA 5A24A 3H7DA 2GFOA 3CH3X 1ICFA 3K8UA 1ME4A 3OVXA 1ZIVA 4BS5A 2DCCA 3OISA 3C9EA 2BSZA 4XR7A 1PPPA 1QXPA 4DMXA 1CS8A 1PIPA 1EWOA 4P6EA 3ZUAA 1YVBA 4AXMA 4FJCA 2B1NA 1K3BB 4W5CA 4K7CA 3P5WA 2DC8A 2YJBA 9PAPA 2E00A 3OVZA 1CSBB 4DMYA 3DF0A 3I06A 2E03A 4NV7A 4CDFB 1PBHA 1YALA 4N4ZA 3CBKA 1F2CA 1HUCB 2R9OA 2Y5BA 4C5PA 2BDLA 3WXEA 4BSQA 2E02A 4I05A 1ATKA 3K24A 2YJCA 2NQIA 1NPZA 2FYEA 4MZOA 2C0YA 4X6HA 1ITOA 2AUZA 1F29A 3KWZA 1IWDA 3NHEA 2FRQA 5EGWA 3F75A 4CDEB 1A6RA 2HH5A 1NB5A 3WXFA 2JQGR 1NL6A 1PCIA 4X6IA 2FRAA 3BWKA 5CHVA 3KW9A 2AIMA 1CJLA 2G8EA 4YYRA 4BGFA 2VHFA 3MTNA 3F5VA 4P6GA 1KFXL 2DCBA 4N79A 2HHNA 2DCDA 3S3QA 2HXZA 3USVA 2FO5A 4OEMA 2ACTA 4GUZA 4WA6A 3E1ZB 4QRGA 2WBFX 1M6DA 1FH0A 6PADA 1BGOA 2DZZA 1JQPA 1AU2A 5EF4A 1AYVA 3S3RA 2XU3A 1MEMA 4XUIA 1GLOA 3B79A 3O0UA 5JA7A 1X9YA 4I04A 3N3KA 4CZWA 2P7UA 3TNXA 1MHWA 1EWMA 1VJVA 4QRVA 2XU4A 1SNKA 2YJ2A 5PADA 3H8BA 3H89A 1PE6A 3OF9A 1DEUA 2CIOA 3U8EA 1GCBA 1W4TA 4QRXA 2DCAA 1AYUA 5CVNB 2IPPB 2IBIA 5JH3A 3KX1A 4PP1A 1AU3A 2DJGB 3MORA 3PW3A 1CQDA 5J94A 2VFCA 4I07A 3HWNA 4AXLA 2CB5A 1EWPA 4B55A 4CDDB 1U9QX 1VSNA 4NV8A 4X6JA 1F2AA 3AI8A 5CVMA 1QDQA 2AVWA 1CPJA 4G54A 4W4UA 2R9NA 5K16A 3IOQA 3HHAA 3N4CA 1Y08A 3K9MA 3KFQA 2DC9A 2OZ2A 3BOWA 3WXGA 5CVOB 1CV8A 1NLJA 2AS8A 1CTEA 2PBHA 1NB3A 2E01A 1THEA 3KSEA 3BPFA 1S4VA 1BQIA 1GX3A 2FUDA 1CB5A 3I3TA 1MDWA 4YVAA 4YYVA 2YJ9A 2DZYA 4KLBA 2DC6A 2NQGA 4MSXA 3CBJA 3HD3A 2P0RA 2H7JA 3PDFA 4HWYA 4PI3A 1KXRA 2XU1A 1EF7A 1ZCMA 2JQFR 4RY2A 1POPA 4BPVA 2OP3A 3ERVA 2ATOA 1GMYA 1U9WA 3LXSA 1U9XA 2FQ9A 2F1GA 4OELA 2VFBA 3M99A 1PPNA 1AU0A 3IMAA 2AYOA 2HD5A 3P5UA 2VHSA 3OF8A 1AYWA 2DJFB 8PCHA 1F2BA 1O0EA 3GCBA 3P5VA 1W6FA 1W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BY8 A;  2AYN A;  3H8C A;  1MEG A;  3PBH A;  1PXV A;  1YK7 A;  4FIP A;  4N8W A;  1ME3 A;  3V6E A;  2G6D A;  4ZUX U;  1AEC A;  1U5I A;  2G7Y A;  1KHQ A;  4PAD A;  2PRE A;  3D6S A;  1SP4 B;  3V6C A;  5F02 A;  4BS6 A;  1MIR A;  2R6N A;  3QJ3 A;  2GHU A;  3RVW A;  2FTD A;  1KFU L;  2PAD A;  1KHP A;  2NQD B;  3N3G A;  2ARY A;  1MS6 A;  1AIM A;  2G8J A;  2XU5 A;  5FPW A;  2NQA A;  2R9F A;  4YYQ A;  2DC7 A;  3IHP A;  2BDZ A;  1Q6K A;  2OUL A;  2F7D A;  3KKU A;  1DF0 A;  3BCN A;  3BPM A;  1EWL A;  1GEC E;  4BQV A;  4FK5 A;  1YT7 A;  3CH2 X;  1TLO A;  2O6X A;  2AU1 A;  1PAD A;  3IV2 A;  2FT2 A;  1QOL A;  4W5B A;  3IUT A;  1PPD A;  3HHI A;  3QSD A;  1NQC A;  3PNR A;  1PPO A;  3P5X A;  4MZS A;  2AUX A;  3RVX A;  4YYW A;  1BP4 A;  2R9M A;  2B1M A;  3LFY A;  3O1G A;  1CVZ A;  2Y6E A;  1TL9 A;  3MHS A;  4YYS A;  1TU6 A;  1QMY A;  3KWB X;  4Q8G A;  4QH6 A;  2YJ8 A;  1YK8 A;  4YV8 A;  3BC3 A;  4QBB A;  7PCK A;  4CDC B;  1STF E;  4PP2 E;  1U9V A;  4Q8H A;  4YYU A;  3QT4 A;  1AU4 A;  3H6S A;  1XKG A;  3IEJ A;  1Y4H A;  2P86 A;  2R9C A;  2PNS A;  3RVV A;  3MHH A;  5CHT A;  5A24 A;  3H7D A;  2GFO A;  3CH3 X;  1ICF A;  3K8U A;  1ME4 A;  3OVX A;  1ZIV A;  4BS5 A;  2DCC A;  3OIS A;  3C9E A;  4XR7 A;  1PPP A;  1QXP A;  4DMX A;  1CS8 A;  1PIP A;  1EWO A;  4P6E A;  3ZUA A;  1YVB A;  4AXM A;  4FJC A;  2B1N A;  1K3B B;  4W5C A;  4K7C A;  3P5W A;  2DC8 A;  2YJB A;  9PAP A;  2E00 A;  3OVZ A;  1CSB B;  4DMY A;  3DF0 A;  3I06 A;  2E03 A;  4CDF B;  1PBH A;  1YAL A;  4N4Z A;  3CBK A;  1F2C A;  1HUC B;  2R9O A;  2Y5B A;  2BDL A;  3WXE A;  4BSQ A;  2E02 A;  4I05 A;  1ATK A;  3K24 A;  2YJC A;  2NQI A;  1NPZ A;  2FYE A;  4MZO A;  2C0Y A;  4X6H A;  1ITO A;  2AUZ A;  1F29 A;  3KWZ A;  1IWD A;  3NHE A;  2FRQ A;  5EGW A;  3F75 A;  4CDE B;  1A6R A;  2HH5 A;  1NB5 A;  3WXF A;  2JQG R;  1NL6 A;  1PCI A;  4X6I A;  2FRA A;  3BWK A;  5CHV A;  3KW9 A;  2AIM A;  1CJL A;  2G8E A;  4YYR A;  2VHF A;  3MTN A;  3F5V A;  4P6G A;  1KFX L;  2DCB A;  4N79 A;  2HHN A;  2DCD A;  3S3Q A;  2HXZ A;  3USV A;  2FO5 A;  4OEM A;  2ACT A;  4WA6 A;  3E1Z B;  4QRG A;  2WBF X;  1M6D A;  1FH0 A;  6PAD A;  1BGO A;  2DZZ A;  1JQP A;  1AU2 A;  5EF4 A;  1AYV A;  3S3R A;  2XU3 A;  1MEM A;  4XUI A;  1GLO A;  3B79 A;  3O0U A;  5JA7 A;  1X9Y A;  4I04 A;  3N3K A;  4CZW A;  2P7U A;  3TNX A;  1MHW A;  1EWM A;  1VJV A;  4QRV A;  2XU4 A;  1SNK A;  2YJ2 A;  5PAD A;  3H8B A;  3H89 A;  1PE6 A;  3OF9 A;  1DEU A;  2CIO A;  3U8E A;  1GCB A;  4QRX A;  2DCA A;  1AYU A;  5CVN B;  2IPP B;  2IBI A;  5JH3 A;  3KX1 A;  4PP1 A;  1AU3 A;  2DJG B;  3MOR A;  3PW3 A;  1CQD A;  5J94 A;  4I07 A;  3HWN A;  4AXL A;  2CB5 A;  1EWP A;  4CDD B;  1U9Q X;  1VSN A;  4X6J A;  1F2A A;  3AI8 A;  5CVM A;  1QDQ A;  2AVW A;  1CPJ A;  4G54 A;  4W4U A;  2R9N A;  5K16 A;  3IOQ A;  3HHA A;  3N4C A;  1Y08 A;  3K9M A;  3KFQ A;  2DC9 A;  2OZ2 A;  3BOW A;  3WXG A;  5CVO B;  1CV8 A;  1NLJ A;  2AS8 A;  1CTE A;  2PBH A;  1NB3 A;  2E01 A;  1THE A;  3KSE A;  3BPF A;  1S4V A;  1BQI A;  2FUD A;  1CB5 A;  3I3T A;  1MDW A;  4YVA A;  4YYV A;  2YJ9 A;  2DZY A;  4KLB A;  2DC6 A;  2NQG A;  4MSX A;  3CBJ A;  3HD3 A;  2P0R A;  2H7J A;  3PDF A;  4HWY A;  4PI3 A;  1KXR A;  2XU1 A;  1EF7 A;  1ZCM A;  2JQF R;  4RY2 A;  1POP A;  4BPV A;  2OP3 A;  3ERV A;  2ATO A;  1GMY A;  1U9W A;  3LXS A;  1U9X A;  2FQ9 A;  2F1G A;  4OEL A;  3M99 A;  1PPN A;  1AU0 A;  3IMA A;  2AYO A;  2HD5 A;  3P5U A;  2VHS A;  3OF8 A;  1AYW A;  2DJF B;  8PCH A;  1F2B A;  1O0E A;  3GCB A;  3P5V A; 
#chains in the Genus database with same CATH topology
 1BY8 A;  2AYN A;  3H8C A;  3W30 A;  4RKX A;  4D8B A;  1MEG A;  3PBH A;  1YZB A;  3PRP A;  1PXV A;  1YK7 A;  4FIP A;  4N8W A;  1ME3 A;  3V6E A;  2G6D A;  4ZUX U;  1AEC A;  1U5I A;  2G7Y A;  1KHQ A;  2BTW A;  4PAD A;  2JRI A;  2PRE A;  3D6S A;  1SP4 B;  3V6C A;  5F02 A;  4BS6 A;  1MIR A;  2R6N A;  3QJ3 A;  3MJ5 A;  2GHU A;  3RVW A;  2FTD A;  1KFU L;  4OVZ A;  2PAD A;  4IP3 A;  1KHP A;  2NQD B;  3N3G A;  2ARY A;  1MS6 A;  1AIM A;  2G8J A;  2XU5 A;  5FPW A;  2NQA A;  2R9F A;  4YYQ A;  2J7Q C;  2DC7 A;  3IHP A;  4RF0 A;  2BDZ A;  1Q6K A;  3BBA A;  2OUL A;  2F7D A;  3KKU A;  4D8E A;  4IUM A;  1DF0 A;  2FE8 A;  3BCN A;  3BPM A;  1EWL A;  1GEC E;  4BQV A;  3PT2 A;  4OVZ B;  4FK5 A;  1YT7 A;  3CH2 X;  1TLO A;  2O6X A;  2AU1 A;  1PAD A;  3IV2 A;  2FT2 A;  3MP2 A;  1QOL A;  4W5B A;  3IUT A;  1PPD A;  3HHI A;  3QSD A;  1NQC A;  4ZTB A;  3PNR A;  1PPO A;  3P5X A;  4MZS A;  2AUX A;  3RVX A;  4YYW A;  1BP4 A;  2J7Q A;  2R9M A;  2B1M A;  3LFY A;  2UZJ A;  3O1G A;  1CVZ A;  2Y6E A;  1TL9 A;  3MHS A;  4YYS A;  1TU6 A;  1QMY A;  3KWB X;  1DKI A;  4Q8G A;  4QH6 A;  2YJ8 A;  1YK8 A;  4YV8 A;  3BC3 A;  4BOU A;  4QBB A;  7PCK A;  4CDC B;  1STF E;  4PP2 E;  1U9V A;  3W31 A;  4Q8H A;  4YYU A;  3QT4 A;  1AU4 A;  3H6S A;  4MI7 A;  1XKG A;  3IEJ A;  3PHX A;  1Y4H A;  2P86 A;  2R9C A;  2PNS A;  3RVV A;  4BOP A;  3MHH A;  5CHT A;  5A24 A;  3H7D A;  2GFO A;  3CH3 X;  1ICF A;  3K8U A;  1ME4 A;  3OVX A;  5KO3 A;  3IFU A;  1ZIV A;  4BS5 A;  2DCC A;  3OQC A;  1PVJ A;  3OIS A;  3C9E A;  4XR7 A;  3RNV A;  3BB7 A;  1PPP A;  1QXP A;  4DMX A;  1CS8 A;  1PIP A;  1EWO A;  4P6E A;  3ZUA A;  3TRK A;  4BOZ A;  1YVB A;  4AXM A;  4FJC A;  2B1N A;  1K3B B;  4W5C A;  2AGA A;  4K7C A;  3P5W A;  2DC8 A;  2YJB A;  9PAP A;  2E00 A;  3OVZ A;  1CSB B;  4DMY A;  3DF0 A;  3I06 A;  2E03 A;  4CDF B;  1PBH A;  1YAL A;  4N4Z A;  5EZQ A;  3CBK A;  1F2C A;  1HUC B;  2R9O A;  2Y5B A;  2BDL A;  3WXE A;  4BSQ A;  4M0W A;  2E02 A;  4I05 A;  5E6J A;  1ATK A;  3K24 A;  2YJC A;  2NQI A;  4WUR A;  1NPZ A;  3PSE A;  2FYE A;  4MZO A;  2C0Y A;  4X6H A;  1ITO A;  2AUZ A;  1UKF A;  1F29 A;  3KWZ A;  1IWD A;  3NHE A;  2FRQ A;  5EGW A;  3F75 A;  4BOS A;  4CDE B;  1A6R A;  2HH5 A;  2JTC A;  3WXF A;  1NB5 A;  2JQG R;  1NL6 A;  1PCI A;  4X6I A;  2FRA A;  3BWK A;  5CHV A;  3KW9 A;  5EZS A;  2Z84 A;  2AIM A;  1CJL A;  2G8E A;  4YYR A;  2VHF A;  3MTN A;  3F5V A;  4P6G A;  1KFX L;  2DCB A;  4N79 A;  2HHN A;  2DCD A;  3S3Q A;  2HXZ A;  3USV A;  2FO5 A;  4OEM A;  2ACT A;  4WA6 A;  4RNA A;  3PHW A;  3ZNH A;  3E1Z B;  4QRG A;  2WBF X;  1M6D A;  1FH0 A;  6PAD A;  1BGO A;  2BU3 A;  2DZZ A;  1JQP A;  1AU2 A;  5EF4 A;  1AYV A;  3S3R A;  2XU3 A;  1MEM A;  4XUI A;  1GLO A;  3B79 A;  3O0U A;  4MM3 B;  5JA7 A;  3E9S A;  1X9Y A;  4I04 A;  3N3K A;  4OW0 A;  4CZW A;  2P7U A;  3TNX A;  1MHW A;  3B21 A;  1EWM A;  1VJV A;  4QRV A;  2XU4 A;  1SNK A;  2YJ2 A;  5PAD A;  3H8B A;  3H89 A;  1PE6 A;  3OF9 A;  1DEU A;  2CIO A;  3U8E A;  1GCB A;  4BOQ A;  4QRX A;  2DCA A;  1AYU A;  5CVN B;  2IPP B;  2IBI A;  3BY4 A;  5JH3 A;  3KX1 A;  4PP1 A;  1AU3 A;  2DJG B;  3MOR A;  3PW3 A;  1CQD A;  5J94 A;  4I07 A;  3HWN A;  4AXL A;  2CB5 A;  1EWP A;  3PRM A;  4CDD B;  1U9Q X;  1VSN A;  5JZE A;  4X6J A;  1F2A A;  3AI8 A;  4HXD B;  5CVM A;  1QDQ A;  2AVW A;  1CPJ A;  4G54 A;  4GUA A;  4W4U A;  2R9N A;  5K16 A;  3IOQ A;  3HHA A;  3N4C A;  1Y08 A;  2BTW B;  3K9M A;  3KFQ A;  2DC9 A;  2OZ2 A;  3BOW A;  3WXG A;  5CVO B;  1CV8 A;  1NLJ A;  2AS8 A;  1CTE A;  2PBH A;  1NB3 A;  2E01 A;  1THE A;  3KSE A;  3BPF A;  1S4V A;  1BQI A;  4D8I A;  2FUD A;  4PT5 A;  1CB5 A;  3I3T A;  1MDW A;  4A5U A;  4YVA A;  4YYV A;  2YJ9 A;  2DZY A;  2HWK A;  4KLB A;  2DC6 A;  2NQG A;  4MSX A;  3CBJ A;  3HD3 A;  3PHU A;  4R3D A;  2P0R A;  2H7J A;  2DOS A;  3PDF A;  3C0R A;  4HWY A;  4PI3 A;  1KXR A;  2XU1 A;  1EF7 A;  1ZCM A;  2JQF R;  4RY2 A;  1POP A;  4BPV A;  2OP3 A;  3ERV A;  2ATO A;  1GMY A;  1U9W A;  3LXS A;  1U9X A;  2FQ9 A;  2F1G A;  4P16 A;  4OEL A;  4XZX A;  3M99 A;  1PPN A;  1AU0 A;  3IMA A;  2AYO A;  2HD5 A;  3MTV A;  3P5U A;  2VHS A;  3OF8 A;  1AYW A;  2DJF B;  4RF1 A;  8PCH A;  1F2B A;  1O0E A;  3GCB A;  4REZ A;  3O65 A;  3P5V A;  3TMP A; 
#chains in the Genus database with same CATH homology
 1BY8 A;  2AYN A;  3H8C A;  1MEG A;  3PBH A;  1PXV A;  1YK7 A;  4FIP A;  4N8W A;  1ME3 A;  3V6E A;  2G6D A;  4ZUX U;  1AEC A;  1U5I A;  2G7Y A;  1KHQ A;  4PAD A;  2PRE A;  3D6S A;  1SP4 B;  3V6C A;  5F02 A;  3D9W A;  4BS6 A;  1MIR A;  2R6N A;  3QJ3 A;  2GHU A;  3RVW A;  2FTD A;  1KFU L;  2PAD A;  1KHP A;  2NQD B;  3N3G A;  2ARY A;  1MS6 A;  1AIM A;  2G8J A;  2XU5 A;  5FPW A;  2NQA A;  2R9F A;  4YYQ A;  2DC7 A;  3IHP A;  2BDZ A;  1Q6K A;  2OUL A;  2F7D A;  1E2T A;  3KKU A;  1DF0 A;  3BCN A;  3BPM A;  1EWL A;  1GEC E;  4BQV A;  4FK5 A;  1YT7 A;  3CH2 X;  1TLO A;  2O6X A;  2AU1 A;  1PAD A;  3IV2 A;  2FT2 A;  1QOL A;  4W5B A;  3IUT A;  1PPD A;  3HHI A;  3QSD A;  1NQC A;  3PNR A;  1PPO A;  3P5X A;  4MZS A;  2AUX A;  3RVX A;  4YYW A;  1BP4 A;  2R9M A;  2B1M A;  3LFY A;  3O1G A;  1CVZ A;  2Y6E A;  1TL9 A;  3MHS A;  4YYS A;  1TU6 A;  1QMY A;  3KWB X;  4Q8G A;  4QH6 A;  2YJ8 A;  3LTW A;  1YK8 A;  4YV8 A;  3BC3 A;  4QBB A;  7PCK A;  4CDC B;  1STF E;  4PP2 E;  1U9V A;  4Q8H A;  4YYU A;  3QT4 A;  1AU4 A;  3H6S A;  1XKG A;  3IEJ A;  1Y4H A;  2P86 A;  2R9C A;  2PNS A;  3RVV A;  3MHH A;  5CHT A;  5A24 A;  3H7D A;  2GFO A;  3CH3 X;  1ICF A;  3K8U A;  1ME4 A;  3OVX A;  1ZIV A;  4BS5 A;  2DCC A;  3OIS A;  3C9E A;  2BSZ A;  4XR7 A;  1PPP A;  1QXP A;  4DMX A;  1CS8 A;  1PIP A;  1EWO A;  4P6E A;  3ZUA A;  1YVB A;  4AXM A;  4FJC A;  2B1N A;  1K3B B;  4W5C A;  4K7C A;  3P5W A;  2DC8 A;  2YJB A;  9PAP A;  2E00 A;  3OVZ A;  1CSB B;  4DMY A;  3DF0 A;  3I06 A;  2E03 A;  4NV7 A;  4CDF B;  1PBH A;  1YAL A;  4N4Z A;  3CBK A;  1F2C A;  1HUC B;  2R9O A;  2Y5B A;  4C5P A;  2BDL A;  3WXE A;  4BSQ A;  2E02 A;  4I05 A;  1ATK A;  3K24 A;  2YJC A;  2NQI A;  1NPZ A;  2FYE A;  4MZO A;  2C0Y A;  4X6H A;  1ITO A;  2AUZ A;  1F29 A;  3KWZ A;  1IWD A;  3NHE A;  2FRQ A;  5EGW A;  3F75 A;  4CDE B;  1A6R A;  2HH5 A;  1NB5 A;  3WXF A;  2JQG R;  1NL6 A;  1PCI A;  4X6I A;  2FRA A;  3BWK A;  5CHV A;  3KW9 A;  2AIM A;  1CJL A;  2G8E A;  4YYR A;  4BGF A;  2VHF A;  3MTN A;  3F5V A;  4P6G A;  1KFX L;  2DCB A;  4N79 A;  2HHN A;  2DCD A;  3S3Q A;  2HXZ A;  3USV A;  2FO5 A;  4OEM A;  2ACT A;  4GUZ A;  4WA6 A;  3E1Z B;  4QRG A;  2WBF X;  1M6D A;  1FH0 A;  6PAD A;  1BGO A;  2DZZ A;  1JQP A;  1AU2 A;  5EF4 A;  1AYV A;  3S3R A;  2XU3 A;  1MEM A;  4XUI A;  1GLO A;  3B79 A;  3O0U A;  5JA7 A;  1X9Y A;  4I04 A;  3N3K A;  4CZW A;  2P7U A;  3TNX A;  1MHW A;  1EWM A;  1VJV A;  4QRV A;  2XU4 A;  1SNK A;  2YJ2 A;  5PAD A;  3H8B A;  3H89 A;  1PE6 A;  3OF9 A;  1DEU A;  2CIO A;  3U8E A;  1GCB A;  1W4T A;  4QRX A;  2DCA A;  1AYU A;  5CVN B;  2IPP B;  2IBI A;  5JH3 A;  3KX1 A;  4PP1 A;  1AU3 A;  2DJG B;  3MOR A;  3PW3 A;  1CQD A;  5J94 A;  2VFC A;  4I07 A;  3HWN A;  4AXL A;  2CB5 A;  1EWP A;  4B55 A;  4CDD B;  1U9Q X;  1VSN A;  4NV8 A;  4X6J A;  1F2A A;  3AI8 A;  5CVM A;  1QDQ A;  2AVW A;  1CPJ A;  4G54 A;  4W4U A;  2R9N A;  5K16 A;  3IOQ A;  3HHA A;  3N4C A;  1Y08 A;  3K9M A;  3KFQ A;  2DC9 A;  2OZ2 A;  3BOW A;  3WXG A;  5CVO B;  1CV8 A;  1NLJ A;  2AS8 A;  1CTE A;  2PBH A;  1NB3 A;  2E01 A;  1THE A;  3KSE A;  3BPF A;  1S4V A;  1BQI A;  1GX3 A;  2FUD A;  1CB5 A;  3I3T A;  1MDW A;  4YVA A;  4YYV A;  2YJ9 A;  2DZY A;  4KLB A;  2DC6 A;  2NQG A;  4MSX A;  3CBJ A;  3HD3 A;  2P0R A;  2H7J A;  3PDF A;  4HWY A;  4PI3 A;  1KXR A;  2XU1 A;  1EF7 A;  1ZCM A;  2JQF R;  4RY2 A;  1POP A;  4BPV A;  2OP3 A;  3ERV A;  2ATO A;  1GMY A;  1U9W A;  3LXS A;  1U9X A;  2FQ9 A;  2F1G A;  4OEL A;  2VFB A;  3M99 A;  1PPN A;  1AU0 A;  3IMA A;  2AYO A;  2HD5 A;  3P5U A;  2VHS A;  3OF8 A;  1AYW A;  2DJF B;  8PCH A;  1F2B A;  1O0E A;  3GCB A;  3P5V A;  1W6F A;  1W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...