1AYWA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent benzyloxybenzoylcarbohydrazide inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN K
publication title Design of potent and selective human cathepsin K inhibitors that span the active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aywA00
3K9MA 4K7CA 1PCIA 3IEJA 4N8WA 1NB5A 3IV2A 2DJGB 2DZYA 4W5BA 4RY2A 2HHNA 1QMYA 4I07A 3CBJA 4BPVA 2HXZA 1QOLA 4I04A 1MDWA 4WA6A 2DJFB 4YYWA 3LXSA 4YVAA 3BPFA 1TL9A 2VHSA 3NHEA 1CSBB 3MTNA 3QJ3A 1PBHA 5F02A 4OEMA 2E03A 3KKUA 2ATOA 1PPNA 1ICFA 2G8JA 4PADA 5JA7A 4HWYA 2R9OA 1M6DA 1HUCB 5EF4A 4PP1A 1AU4A 2AS8A 3BPMA 1CVZA 2DCDA 3PBHA 2DZZA 4AXMA 1TU6A 4W4UA 4FIPA 2ACTA 1YT7A 1U9QX 2YJ8A 4N4ZA 1BGOA 1ATKA 2FRQA 2P86A 3KWBX 3PDFA 2G6DA 3PW3A 2B1MA 1MHWA 3PNRA 4MZSA 2YJBA 4N79A 1F2BA 3V6EA 3KX1A 1KXRA 1NB3A 3O0UA 2HD5A 1YK7A 3BCNA 3MORA 3GCBA 2BDZA 4QRVA 3AI8A 3KFQA 5EGWA 1THEA 2NQIA 1A6RA 2F7DA 2HH5A 4CDCB 4ZUXU 1JQPA 3IMAA 1XKGA 1NLJA 1PPPA 1MS6A 3B79A 2DC6A 2VHFA 4FJCA 1K3BB 2PADA 3OISA 1PPDA 3H89A 5CVOB 4QH6A 3RVVA 1BQIA 4CZWA 4QRXA 1YALA 1SP4B 1AIMA 4PP2E 1GLOA 2ARYA 4CDEB 4QBBA 3QSDA 4X6JA 3S3RA 2G7YA 2DCAA 2JQGR 5CVNB 2AUZA 1ZIVA 8PCHA 1X9YA 4Q8HA 3CH3X 2DC8A 4YYSA 3OF8A 1KFUL 1Y4HA 4QRGA 5A24A 3K8UA 3KW9A 1CV8A 1EWMA 3BOWA 1DF0A 1EWOA 1EWLA 1CJLA 2NQGA 2OZ2A 1O0EA 2AUXA 2GHUA 5J94A 1NQCA 2AYOA 6PADA 3IUTA 3C9EA 4PI3A 2DCBA 1CS8A 1BP4A 2GFOA 4BS5A 1U9WA 4MSXA 3P5UA 3BC3A 3OF9A 2AYNA 4X6HA 1Q6KA 1MEGA 1YK8A 3DF0A 2O6XA 3H8BA 4P6EA 2YJ9A 3P5VA 3F75A 1Y08A 1YVBA 7PCKA 3KSEA 2P7UA 1FH0A 4KLBA 2AU1A 2FTDA 3OVZA 2R9NA 2E02A 2R9MA 3N3GA 3HD3A 1NL6A 2FRAA 4YV8A 4YYUA 5CHVA 4W5CA 5CHTA 1CPJA 3USVA 1BY8A 3U8EA 4CDFB 1VSNA 2YJCA 4DMYA 2DCCA 1ZCMA 3K24A 2IBIA 2OULA 1AYUA 3RVXA 1DEUA 2E01A 1IWDA 2PNSA 3QT4A 5FPWA 2CB5A 1GECE 3HHAA 1PIPA 1CB5A 1QXPA 1AECA 2CIOA 2IPPB 4YYRA 4MZOA 2BDLA 3O1GA 3OVXA 2FQ9A 4CDDB 1F29A 1AYVA 3F5VA 2DC9A 1KHPA 3LFYA 4BSQA 3I06A 3P5WA 4YYQA 4YYVA 1AYWA 3E1ZB 1S4VA 2PREA 3HWNA 4AXLA 3RVWA 3HHIA 3MHSA 2XU4A 2FYEA 4X6IA 3V6CA 1PXVA 1CQDA 3N3KA 1U9XA 1EWPA 2Y5BA 1AU0A 4G54A 1EF7A 1KHQA 2B1NA 2XU5A 1ITOA 4DMXA 1MIRA 1GCBA 3WXEA 1PADA 1F2AA 4XR7A 3CBKA 3CH2X 2G8EA 1MEMA 2Y6EA 3N4CA 1U5IA 4I05A 3BWKA 1TLOA 4OELA 3ZUAA 2R9FA 3KWZA 4Q8GA 1ME3A 2WBFX 3H7DA 2XU3A 1PE6A 1VJVA 1KFXL 2R9CA 2P0RA 2R6NA 3WXFA 3H8CA 5K16A 2C0YA 1POPA 4XUIA 2FT2A 2AIMA 4BS6A 1SNKA 2F1GA 2FO5A 5PADA 2OP3A 3ERVA 1STFE 1CTEA 2YJ2A 2PBHA 1NPZA 3IHPA 2AVWA 2E00A 3TNXA 2H7JA 1U9VA 3D6SA 3P5XA 3S3QA 3MHHA 2XU1A 3IOQA 3H6SA 2NQAA 9PAPA 1AU2A 5JH3A 1F2CA 3WXGA 4FK5A 5CVMA 4P6GA 2DC7A 3I3TA 2FUDA 2JQFR 2NQDB 4BQVA 1GMYA 1AU3A 1PPOA 3M99A 1ME4A 1QDQA
chains in the Genus database with same CATH superfamily
3K9MA 4K7CA 3ZNHA 1PCIA 3IEJA 4D8IA 4N8WA 1NB5A 3IV2A 2DJGB 2DZYA 4W5BA 4RY2A 2HHNA 1QMYA 3PHUA 1UKFA 4I07A 2FE8A 2BTWB 3CBJA 4BPVA 2HXZA 1QOLA 4I04A 3TRKA 1MDWA 4WA6A 2DJFB 4YYWA 3LXSA 4YVAA 3BPFA 1TL9A 2VHSA 3NHEA 1CSBB 3MTNA 4M0WA 3QJ3A 1PBHA 5F02A 4OEMA 2E03A 3KKUA 2ATOA 1PPNA 5E6JA 1ICFA 3C0RA 2G8JA 4PADA 5JA7A 4HWYA 2R9OA 4WURA 1M6DA 1HUCB 5EF4A 4PP1A 3PHWA 1AU4A 2AS8A 3O65A 3BPMA 1CVZA 2DCDA 3E9SA 3PBHA 2DZZA 4AXMA 1TU6A 4W4UA 3MTVA 4FIPA 2ACTA 1YT7A 1U9QX 2YJ8A 4N4ZA 1BGOA 1ATKA 4MI7A 2FRQA 2P86A 2JRIA 3KWBX 3PDFA 2G6DA 3PW3A 2B1MA 1MHWA 3PNRA 4BOUA 4MZSA 2YJBA 4N79A 1F2BA 3V6EA 3KX1A 1KXRA 1NB3A 3O0UA 2HD5A 1YK7A 3BCNA 3MORA 3GCBA 2BDZA 4QRVA 3AI8A 3KFQA 5EGWA 1THEA 3OQCA 2NQIA 1A6RA 2F7DA 4BOSA 2HH5A 4CDCB 4ZUXU 1JQPA 3IMAA 1XKGA 1NLJA 1PPPA 1MS6A 4RF1A 3B79A 2DC6A 2VHFA 3BBAA 4OVZA 4FJCA 1K3BB 2PADA 3OISA 1PPDA 3H89A 5CVOB 4QH6A 3RVVA 3IFUA 1BQIA 4CZWA 4QRXA 4BOQA 1YALA 1SP4B 1AIMA 4PP2E 1DKIA 1GLOA 2ARYA 4CDEB 4QBBA 3QSDA 4X6JA 3S3RA 2G7YA 2DCAA 2JQGR 5CVNB 2AUZA 1ZIVA 4D8BA 1X9YA 8PCHA 5KO3A 4Q8HA 3CH3X 2AGAA 2DC8A 4YYSA 3OF8A 4A5UA 4P16A 1KFUL 4HXDB 1Y4HA 4QRGA 5A24A 3K8UA 3KW9A 1CV8A 4OVZB 1EWMA 3BOWA 1DF0A 1EWOA 1EWLA 1CJLA 2NQGA 2OZ2A 4BOZA 1O0EA 2AUXA 4ZTBA 2GHUA 5J94A 1NQCA 2AYOA 3B21A 6PADA 3IUTA 3C9EA 4PI3A 2DCBA 1CS8A 4RF0A 1BP4A 1YZBA 2GFOA 4BS5A 1U9WA 4MSXA 3BY4A 3PT2A 3P5UA 3MP2A 3BC3A 4IUMA 3OF9A 2AYNA 4OW0A 4X6HA 1Q6KA 3PRPA 1MEGA 1YK8A 3DF0A 2O6XA 3H8BA 4P6EA 2BU3A 2YJ9A 2UZJA 3P5VA 3F75A 3W30A 1Y08A 1YVBA 7PCKA 3KSEA 2P7UA 1FH0A 4KLBA 4GUAA 2AU1A 2FTDA 3OVZA 2DOSA 2R9NA 2E02A 2R9MA 3N3GA 3HD3A 1NL6A 2FRAA 5EZQA 3RNVA 4D8EA 4IP3A 2J7QA 4YV8A 1PVJA 4YYUA 5CHVA 2HWKA 4W5CA 5CHTA 3PRMA 1CPJA 3USVA 1BY8A 3U8EA 4CDFB 4R3DA 1VSNA 2YJCA 4DMYA 2DCCA 1ZCMA 3K24A 2IBIA 2OULA 1AYUA 3RVXA 1DEUA 2E01A 1IWDA 2PNSA 2Z84A 4BOPA 3QT4A 5FPWA 2CB5A 1GECE 4REZA 3HHAA 1PIPA 1CB5A 1QXPA 1AECA 2CIOA 2IPPB 4YYRA 4MZOA 2BDLA 3O1GA 3OVXA 3PHXA 2FQ9A 4CDDB 1F29A 1AYVA 3F5VA 2DC9A 1KHPA 4PT5A 3LFYA 4BSQA 3I06A 3P5WA 4YYQA 4YYVA 1AYWA 3E1ZB 1S4VA 2PREA 3HWNA 4AXLA 3RVWA 3HHIA 3MHSA 2XU4A 2FYEA 4X6IA 3V6CA 1PXVA 2JTCA 1CQDA 3N3KA 1U9XA 1EWPA 2Y5BA 1AU0A 4G54A 1EF7A 1KHQA 2B1NA 2XU5A 1ITOA 4DMXA 3TMPA 1MIRA 1GCBA 3WXEA 1PADA 1F2AA 3PSEA 4XR7A 3CBKA 3CH2X 2G8EA 1MEMA 2Y6EA 3N4CA 1U5IA 4I05A 3BWKA 1TLOA 4RKXA 4OELA 3ZUAA 2R9FA 3KWZA 4Q8GA 1ME3A 2WBFX 3H7DA 2XU3A 1PE6A 1VJVA 1KFXL 2R9CA 2P0RA 3MJ5A 2R6NA 3WXFA 3H8CA 5EZSA 5K16A 2C0YA 1POPA 4XUIA 2FT2A 4MM3B 2AIMA 4BS6A 1SNKA 2F1GA 5JZEA 2BTWA 2FO5A 5PADA 2OP3A 4XZXA 3ERVA 1STFE 1CTEA 2YJ2A 2PBHA 1NPZA 3IHPA 2AVWA 2E00A 3TNXA 2H7JA 1U9VA 3D6SA 3P5XA 3S3QA 3MHHA 2XU1A 3IOQA 3H6SA 2NQAA 9PAPA 3BB7A 4RNAA 1AU2A 5JH3A 1F2CA 3WXGA 4FK5A 5CVMA 3W31A 4P6GA 2DC7A 3I3TA 2FUDA 2J7QC 2JQFR 2NQDB 4BQVA 1GMYA 1AU3A 1PPOA 3M99A 1ME4A 1QDQA
chains in the Genus database with same CATH topology
3K9MA 4K7CA 1PCIA 3IEJA 4N8WA 1NB5A 3IV2A 2DJGB 2DZYA 4W5BA 4RY2A 2HHNA 1QMYA 4I07A 3CBJA 4BPVA 2HXZA 1QOLA 4I04A 1MDWA 1E2TA 4WA6A 2DJFB 4YYWA 3LXSA 4YVAA 3BPFA 1TL9A 2VHSA 3NHEA 1CSBB 3MTNA 3QJ3A 1PBHA 5F02A 4OEMA 2E03A 3KKUA 2ATOA 1PPNA 1ICFA 2G8JA 4PADA 5JA7A 4HWYA 2R9OA 1M6DA 1HUCB 5EF4A 4PP1A 1AU4A 2AS8A 3BPMA 1CVZA 2DCDA 3PBHA 2DZZA 4AXMA 1TU6A 4W4UA 4FIPA 2ACTA 4NV7A 1YT7A 1U9QX 2YJ8A 4N4ZA 1BGOA 1ATKA 2FRQA 2P86A 3KWBX 3PDFA 2G6DA 3PW3A 2B1MA 1MHWA 3PNRA 4MZSA 2YJBA 4N79A 1F2BA 3V6EA 3KX1A 1KXRA 1NB3A 3O0UA 2HD5A 1YK7A 3BCNA 3MORA 3GCBA 2BDZA 4QRVA 3AI8A 3KFQA 5EGWA 4NV8A 1THEA 2NQIA 1A6RA 2F7DA 2HH5A 4CDCB 4ZUXU 1JQPA 3IMAA 1XKGA 1NLJA 1PPPA 1MS6A 3B79A 2DC6A 2VHFA 4FJCA 1K3BB 2PADA 3OISA 4B55A 1PPDA 3H89A 5CVOB 4QH6A 3RVVA 1BQIA 4CZWA 4QRXA 1YALA 1SP4B 1AIMA 4PP2E 1GLOA 2ARYA 4CDEB 4QBBA 3QSDA 4X6JA 3S3RA 2G7YA 2DCAA 2JQGR 5CVNB 2AUZA 1ZIVA 8PCHA 1X9YA 4Q8HA 3CH3X 2DC8A 4YYSA 3OF8A 1KFUL 1Y4HA 4QRGA 5A24A 3K8UA 3KW9A 1CV8A 1EWMA 3BOWA 1DF0A 1EWOA 1EWLA 1CJLA 2NQGA 2OZ2A 1O0EA 2AUXA 2GHUA 5J94A 1NQCA 2AYOA 6PADA 3IUTA 3C9EA 4PI3A 2DCBA 1CS8A 1BP4A 1W4TA 2GFOA 4BS5A 1U9WA 4MSXA 3P5UA 3BC3A 3OF9A 2AYNA 4X6HA 1Q6KA 1MEGA 1YK8A 3DF0A 2O6XA 3H8BA 4P6EA 2YJ9A 3P5VA 3F75A 1Y08A 1YVBA 7PCKA 3KSEA 2P7UA 1FH0A 4KLBA 2AU1A 2FTDA 3OVZA 2BSZA 2R9NA 2E02A 1GX3A 2R9MA 3N3GA 3HD3A 1NL6A 2FRAA 4YV8A 4YYUA 5CHVA 4W5CA 5CHTA 1CPJA 3USVA 1BY8A 1W6FA 3U8EA 4CDFB 1VSNA 2YJCA 4DMYA 2DCCA 1ZCMA 3K24A 2IBIA 2OULA 1AYUA 2VFBA 3RVXA 1DEUA 2E01A 1IWDA 2PNSA 3QT4A 5FPWA 3D9WA 2CB5A 1GECE 3HHAA 1PIPA 1CB5A 1QXPA 1AECA 2CIOA 2IPPB 4YYRA 4MZOA 2BDLA 3O1GA 3OVXA 2FQ9A 4CDDB 1F29A 1AYVA 3F5VA 2DC9A 1KHPA 3LFYA 4BSQA 3I06A 3P5WA 4YYQA 4YYVA 1AYWA 3E1ZB 1S4VA 2PREA 3HWNA 4AXLA 3RVWA 3HHIA 3MHSA 3LTWA 2XU4A 2FYEA 4X6IA 3V6CA 1PXVA 1CQDA 3N3KA 1U9XA 1EWPA 2Y5BA 1AU0A 4G54A 1EF7A 1KHQA 2B1NA 2XU5A 1ITOA 4DMXA 2VFCA 1GCBA 1MIRA 3WXEA 1PADA 1F2AA 4XR7A 3CBKA 3CH2X 2G8EA 1MEMA 2Y6EA 3N4CA 1U5IA 4I05A 3BWKA 1TLOA 4OELA 3ZUAA 2R9FA 3KWZA 4Q8GA 1ME3A 2WBFX 3H7DA 2XU3A 1PE6A 1VJVA 1KFXL 2R9CA 2P0RA 2R6NA 3WXFA 3H8CA 5K16A 2C0YA 1POPA 4XUIA 2FT2A 2AIMA 4BS6A 1SNKA 2F1GA 2FO5A 5PADA 2OP3A 3ERVA 1STFE 1CTEA 1W5RA 2YJ2A 2PBHA 1NPZA 3IHPA 2AVWA 2E00A 3TNXA 2H7JA 4BGFA 1U9VA 3D6SA 3P5XA 3S3QA 3MHHA 4C5PA 2XU1A 3IOQA 3H6SA 2NQAA 9PAPA 1AU2A 4GUZA 5JH3A 1F2CA 3WXGA 4FK5A 5CVMA 4P6GA 2DC7A 3I3TA 2FUDA 2JQFR 2NQDB 4BQVA 1GMYA 1AU3A 1PPOA 3M99A 1ME4A 1QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9M A;  4K7C A;  1PCI A;  3IEJ A;  4N8W A;  1NB5 A;  3IV2 A;  2DJG B;  2DZY A;  4W5B A;  4RY2 A;  2HHN A;  1QMY A;  4I07 A;  3CBJ A;  4BPV A;  2HXZ A;  1QOL A;  4I04 A;  1MDW A;  4WA6 A;  2DJF B;  4YYW A;  3LXS A;  4YVA A;  3BPF A;  1TL9 A;  2VHS A;  3NHE A;  1CSB B;  3MTN A;  3QJ3 A;  1PBH A;  5F02 A;  4OEM A;  2E03 A;  3KKU A;  2ATO A;  1PPN A;  1ICF A;  2G8J A;  4PAD A;  5JA7 A;  4HWY A;  2R9O A;  1M6D A;  1HUC B;  5EF4 A;  4PP1 A;  1AU4 A;  2AS8 A;  3BPM A;  1CVZ A;  2DCD A;  3PBH A;  2DZZ A;  4AXM A;  1TU6 A;  4W4U A;  4FIP A;  2ACT A;  1YT7 A;  1U9Q X;  2YJ8 A;  4N4Z A;  1BGO A;  1ATK A;  2FRQ A;  2P86 A;  3KWB X;  3PDF A;  2G6D A;  3PW3 A;  2B1M A;  1MHW A;  3PNR A;  4MZS A;  2YJB A;  4N79 A;  1F2B A;  3V6E A;  3KX1 A;  1KXR A;  1NB3 A;  3O0U A;  2HD5 A;  1YK7 A;  3BCN A;  3MOR A;  3GCB A;  2BDZ A;  4QRV A;  3AI8 A;  3KFQ A;  5EGW A;  1THE A;  2NQI A;  1A6R A;  2F7D A;  2HH5 A;  4CDC B;  4ZUX U;  1JQP A;  3IMA A;  1XKG A;  1NLJ A;  1PPP A;  1MS6 A;  3B79 A;  2DC6 A;  2VHF A;  4FJC A;  1K3B B;  2PAD A;  3OIS A;  1PPD A;  3H89 A;  5CVO B;  4QH6 A;  3RVV A;  1BQI A;  4CZW A;  4QRX A;  1YAL A;  1SP4 B;  1AIM A;  4PP2 E;  1GLO A;  2ARY A;  4CDE B;  4QBB A;  3QSD A;  4X6J A;  3S3R A;  2G7Y A;  2DCA A;  2JQG R;  5CVN B;  2AUZ A;  1ZIV A;  8PCH A;  1X9Y A;  4Q8H A;  3CH3 X;  2DC8 A;  4YYS A;  3OF8 A;  1KFU L;  1Y4H A;  4QRG A;  5A24 A;  3K8U A;  3KW9 A;  1CV8 A;  1EWM A;  3BOW A;  1DF0 A;  1EWO A;  1EWL A;  1CJL A;  2NQG A;  2OZ2 A;  1O0E A;  2AUX A;  2GHU A;  5J94 A;  1NQC A;  2AYO A;  6PAD A;  3IUT A;  3C9E A;  4PI3 A;  2DCB A;  1CS8 A;  1BP4 A;  2GFO A;  4BS5 A;  1U9W A;  4MSX A;  3P5U A;  3BC3 A;  3OF9 A;  2AYN A;  4X6H A;  1Q6K A;  1MEG A;  1YK8 A;  3DF0 A;  2O6X A;  3H8B A;  4P6E A;  2YJ9 A;  3P5V A;  3F75 A;  1Y08 A;  1YVB A;  7PCK A;  3KSE A;  2P7U A;  1FH0 A;  4KLB A;  2AU1 A;  2FTD A;  3OVZ A;  2R9N A;  2E02 A;  2R9M A;  3N3G A;  3HD3 A;  1NL6 A;  2FRA A;  4YV8 A;  4YYU A;  5CHV A;  4W5C A;  5CHT A;  1CPJ A;  3USV A;  1BY8 A;  3U8E A;  4CDF B;  1VSN A;  2YJC A;  4DMY A;  2DCC A;  1ZCM A;  3K24 A;  2IBI A;  2OUL A;  1AYU A;  3RVX A;  1DEU A;  2E01 A;  1IWD A;  2PNS A;  3QT4 A;  5FPW A;  2CB5 A;  1GEC E;  3HHA A;  1PIP A;  1CB5 A;  1QXP A;  1AEC A;  2CIO A;  2IPP B;  4YYR A;  4MZO A;  2BDL A;  3O1G A;  3OVX A;  2FQ9 A;  4CDD B;  1F29 A;  1AYV A;  3F5V A;  2DC9 A;  1KHP A;  3LFY A;  4BSQ A;  3I06 A;  3P5W A;  4YYQ A;  4YYV A;  1AYW A;  3E1Z B;  1S4V A;  2PRE A;  3HWN A;  4AXL A;  3RVW A;  3HHI A;  3MHS A;  2XU4 A;  2FYE A;  4X6I A;  3V6C A;  1PXV A;  1CQD A;  3N3K A;  1U9X A;  1EWP A;  2Y5B A;  1AU0 A;  4G54 A;  1EF7 A;  1KHQ A;  2B1N A;  2XU5 A;  1ITO A;  4DMX A;  1MIR A;  1GCB A;  3WXE A;  1PAD A;  1F2A A;  4XR7 A;  3CBK A;  3CH2 X;  2G8E A;  1MEM A;  2Y6E A;  3N4C A;  1U5I A;  4I05 A;  3BWK A;  1TLO A;  4OEL A;  3ZUA A;  2R9F A;  3KWZ A;  4Q8G A;  1ME3 A;  2WBF X;  3H7D A;  2XU3 A;  1PE6 A;  1VJV A;  1KFX L;  2R9C A;  2P0R A;  2R6N A;  3WXF A;  3H8C A;  5K16 A;  2C0Y A;  1POP A;  4XUI A;  2FT2 A;  2AIM A;  4BS6 A;  1SNK A;  2F1G A;  2FO5 A;  5PAD A;  2OP3 A;  3ERV A;  1STF E;  1CTE A;  2YJ2 A;  2PBH A;  1NPZ A;  3IHP A;  2AVW A;  2E00 A;  3TNX A;  2H7J A;  1U9V A;  3D6S A;  3P5X A;  3S3Q A;  3MHH A;  2XU1 A;  3IOQ A;  3H6S A;  2NQA A;  9PAP A;  1AU2 A;  5JH3 A;  1F2C A;  3WXG A;  4FK5 A;  5CVM A;  4P6G A;  2DC7 A;  3I3T A;  2FUD A;  2JQF R;  2NQD B;  4BQV A;  1GMY A;  1AU3 A;  1PPO A;  3M99 A;  1ME4 A;  1QDQ A; 
#chains in the Genus database with same CATH topology
 3K9M A;  4K7C A;  3ZNH A;  1PCI A;  3IEJ A;  4D8I A;  4N8W A;  1NB5 A;  3IV2 A;  2DJG B;  2DZY A;  4W5B A;  4RY2 A;  2HHN A;  1QMY A;  3PHU A;  1UKF A;  4I07 A;  2FE8 A;  2BTW B;  3CBJ A;  4BPV A;  2HXZ A;  1QOL A;  4I04 A;  3TRK A;  1MDW A;  4WA6 A;  2DJF B;  4YYW A;  3LXS A;  4YVA A;  3BPF A;  1TL9 A;  2VHS A;  3NHE A;  1CSB B;  3MTN A;  4M0W A;  3QJ3 A;  1PBH A;  5F02 A;  4OEM A;  2E03 A;  3KKU A;  2ATO A;  1PPN A;  5E6J A;  1ICF A;  3C0R A;  2G8J A;  4PAD A;  5JA7 A;  4HWY A;  2R9O A;  4WUR A;  1M6D A;  1HUC B;  5EF4 A;  4PP1 A;  3PHW A;  1AU4 A;  2AS8 A;  3O65 A;  3BPM A;  1CVZ A;  2DCD A;  3E9S A;  3PBH A;  2DZZ A;  4AXM A;  1TU6 A;  4W4U A;  3MTV A;  4FIP A;  2ACT A;  1YT7 A;  1U9Q X;  2YJ8 A;  4N4Z A;  1BGO A;  1ATK A;  4MI7 A;  2FRQ A;  2P86 A;  2JRI A;  3KWB X;  3PDF A;  2G6D A;  3PW3 A;  2B1M A;  1MHW A;  3PNR A;  4BOU A;  4MZS A;  2YJB A;  4N79 A;  1F2B A;  3V6E A;  3KX1 A;  1KXR A;  1NB3 A;  3O0U A;  2HD5 A;  1YK7 A;  3BCN A;  3MOR A;  3GCB A;  2BDZ A;  4QRV A;  3AI8 A;  3KFQ A;  5EGW A;  1THE A;  3OQC A;  2NQI A;  1A6R A;  2F7D A;  4BOS A;  2HH5 A;  4CDC B;  4ZUX U;  1JQP A;  3IMA A;  1XKG A;  1NLJ A;  1PPP A;  1MS6 A;  4RF1 A;  3B79 A;  2DC6 A;  2VHF A;  3BBA A;  4OVZ A;  4FJC A;  1K3B B;  2PAD A;  3OIS A;  1PPD A;  3H89 A;  5CVO B;  4QH6 A;  3RVV A;  3IFU A;  1BQI A;  4CZW A;  4QRX A;  4BOQ A;  1YAL A;  1SP4 B;  1AIM A;  4PP2 E;  1DKI A;  1GLO A;  2ARY A;  4CDE B;  4QBB A;  3QSD A;  4X6J A;  3S3R A;  2G7Y A;  2DCA A;  2JQG R;  5CVN B;  2AUZ A;  1ZIV A;  4D8B A;  1X9Y A;  8PCH A;  5KO3 A;  4Q8H A;  3CH3 X;  2AGA A;  2DC8 A;  4YYS A;  3OF8 A;  4A5U A;  4P16 A;  1KFU L;  4HXD B;  1Y4H A;  4QRG A;  5A24 A;  3K8U A;  3KW9 A;  1CV8 A;  4OVZ B;  1EWM A;  3BOW A;  1DF0 A;  1EWO A;  1EWL A;  1CJL A;  2NQG A;  2OZ2 A;  4BOZ A;  1O0E A;  2AUX A;  4ZTB A;  2GHU A;  5J94 A;  1NQC A;  2AYO A;  3B21 A;  6PAD A;  3IUT A;  3C9E A;  4PI3 A;  2DCB A;  1CS8 A;  4RF0 A;  1BP4 A;  1YZB A;  2GFO A;  4BS5 A;  1U9W A;  4MSX A;  3BY4 A;  3PT2 A;  3P5U A;  3MP2 A;  3BC3 A;  4IUM A;  3OF9 A;  2AYN A;  4OW0 A;  4X6H A;  1Q6K A;  3PRP A;  1MEG A;  1YK8 A;  3DF0 A;  2O6X A;  3H8B A;  4P6E A;  2BU3 A;  2YJ9 A;  2UZJ A;  3P5V A;  3F75 A;  3W30 A;  1Y08 A;  1YVB A;  7PCK A;  3KSE A;  2P7U A;  1FH0 A;  4KLB A;  4GUA A;  2AU1 A;  2FTD A;  3OVZ A;  2DOS A;  2R9N A;  2E02 A;  2R9M A;  3N3G A;  3HD3 A;  1NL6 A;  2FRA A;  5EZQ A;  3RNV A;  4D8E A;  4IP3 A;  2J7Q A;  4YV8 A;  1PVJ A;  4YYU A;  5CHV A;  2HWK A;  4W5C A;  5CHT A;  3PRM A;  1CPJ A;  3USV A;  1BY8 A;  3U8E A;  4CDF B;  4R3D A;  1VSN A;  2YJC A;  4DMY A;  2DCC A;  1ZCM A;  3K24 A;  2IBI A;  2OUL A;  1AYU A;  3RVX A;  1DEU A;  2E01 A;  1IWD A;  2PNS A;  2Z84 A;  4BOP A;  3QT4 A;  5FPW A;  2CB5 A;  1GEC E;  4REZ A;  3HHA A;  1PIP A;  1CB5 A;  1QXP A;  1AEC A;  2CIO A;  2IPP B;  4YYR A;  4MZO A;  2BDL A;  3O1G A;  3OVX A;  3PHX A;  2FQ9 A;  4CDD B;  1F29 A;  1AYV A;  3F5V A;  2DC9 A;  1KHP A;  4PT5 A;  3LFY A;  4BSQ A;  3I06 A;  3P5W A;  4YYQ A;  4YYV A;  1AYW A;  3E1Z B;  1S4V A;  2PRE A;  3HWN A;  4AXL A;  3RVW A;  3HHI A;  3MHS A;  2XU4 A;  2FYE A;  4X6I A;  3V6C A;  1PXV A;  2JTC A;  1CQD A;  3N3K A;  1U9X A;  1EWP A;  2Y5B A;  1AU0 A;  4G54 A;  1EF7 A;  1KHQ A;  2B1N A;  2XU5 A;  1ITO A;  4DMX A;  3TMP A;  1MIR A;  1GCB A;  3WXE A;  1PAD A;  1F2A A;  3PSE A;  4XR7 A;  3CBK A;  3CH2 X;  2G8E A;  1MEM A;  2Y6E A;  3N4C A;  1U5I A;  4I05 A;  3BWK A;  1TLO A;  4RKX A;  4OEL A;  3ZUA A;  2R9F A;  3KWZ A;  4Q8G A;  1ME3 A;  2WBF X;  3H7D A;  2XU3 A;  1PE6 A;  1VJV A;  1KFX L;  2R9C A;  2P0R A;  3MJ5 A;  2R6N A;  3WXF A;  3H8C A;  5EZS A;  5K16 A;  2C0Y A;  1POP A;  4XUI A;  2FT2 A;  4MM3 B;  2AIM A;  4BS6 A;  1SNK A;  2F1G A;  5JZE A;  2BTW A;  2FO5 A;  5PAD A;  2OP3 A;  4XZX A;  3ERV A;  1STF E;  1CTE A;  2YJ2 A;  2PBH A;  1NPZ A;  3IHP A;  2AVW A;  2E00 A;  3TNX A;  2H7J A;  1U9V A;  3D6S A;  3P5X A;  3S3Q A;  3MHH A;  2XU1 A;  3IOQ A;  3H6S A;  2NQA A;  9PAP A;  3BB7 A;  4RNA A;  1AU2 A;  5JH3 A;  1F2C A;  3WXG A;  4FK5 A;  5CVM A;  3W31 A;  4P6G A;  2DC7 A;  3I3T A;  2FUD A;  2J7Q C;  2JQF R;  2NQD B;  4BQV A;  1GMY A;  1AU3 A;  1PPO A;  3M99 A;  1ME4 A;  1QDQ A; 
#chains in the Genus database with same CATH homology
 3K9M A;  4K7C A;  1PCI A;  3IEJ A;  4N8W A;  1NB5 A;  3IV2 A;  2DJG B;  2DZY A;  4W5B A;  4RY2 A;  2HHN A;  1QMY A;  4I07 A;  3CBJ A;  4BPV A;  2HXZ A;  1QOL A;  4I04 A;  1MDW A;  1E2T A;  4WA6 A;  2DJF B;  4YYW A;  3LXS A;  4YVA A;  3BPF A;  1TL9 A;  2VHS A;  3NHE A;  1CSB B;  3MTN A;  3QJ3 A;  1PBH A;  5F02 A;  4OEM A;  2E03 A;  3KKU A;  2ATO A;  1PPN A;  1ICF A;  2G8J A;  4PAD A;  5JA7 A;  4HWY A;  2R9O A;  1M6D A;  1HUC B;  5EF4 A;  4PP1 A;  1AU4 A;  2AS8 A;  3BPM A;  1CVZ A;  2DCD A;  3PBH A;  2DZZ A;  4AXM A;  1TU6 A;  4W4U A;  4FIP A;  2ACT A;  4NV7 A;  1YT7 A;  1U9Q X;  2YJ8 A;  4N4Z A;  1BGO A;  1ATK A;  2FRQ A;  2P86 A;  3KWB X;  3PDF A;  2G6D A;  3PW3 A;  2B1M A;  1MHW A;  3PNR A;  4MZS A;  2YJB A;  4N79 A;  1F2B A;  3V6E A;  3KX1 A;  1KXR A;  1NB3 A;  3O0U A;  2HD5 A;  1YK7 A;  3BCN A;  3MOR A;  3GCB A;  2BDZ A;  4QRV A;  3AI8 A;  3KFQ A;  5EGW A;  4NV8 A;  1THE A;  2NQI A;  1A6R A;  2F7D A;  2HH5 A;  4CDC B;  4ZUX U;  1JQP A;  3IMA A;  1XKG A;  1NLJ A;  1PPP A;  1MS6 A;  3B79 A;  2DC6 A;  2VHF A;  4FJC A;  1K3B B;  2PAD A;  3OIS A;  4B55 A;  1PPD A;  3H89 A;  5CVO B;  4QH6 A;  3RVV A;  1BQI A;  4CZW A;  4QRX A;  1YAL A;  1SP4 B;  1AIM A;  4PP2 E;  1GLO A;  2ARY A;  4CDE B;  4QBB A;  3QSD A;  4X6J A;  3S3R A;  2G7Y A;  2DCA A;  2JQG R;  5CVN B;  2AUZ A;  1ZIV A;  8PCH A;  1X9Y A;  4Q8H A;  3CH3 X;  2DC8 A;  4YYS A;  3OF8 A;  1KFU L;  1Y4H A;  4QRG A;  5A24 A;  3K8U A;  3KW9 A;  1CV8 A;  1EWM A;  3BOW A;  1DF0 A;  1EWO A;  1EWL A;  1CJL A;  2NQG A;  2OZ2 A;  1O0E A;  2AUX A;  2GHU A;  5J94 A;  1NQC A;  2AYO A;  6PAD A;  3IUT A;  3C9E A;  4PI3 A;  2DCB A;  1CS8 A;  1BP4 A;  1W4T A;  2GFO A;  4BS5 A;  1U9W A;  4MSX A;  3P5U A;  3BC3 A;  3OF9 A;  2AYN A;  4X6H A;  1Q6K A;  1MEG A;  1YK8 A;  3DF0 A;  2O6X A;  3H8B A;  4P6E A;  2YJ9 A;  3P5V A;  3F75 A;  1Y08 A;  1YVB A;  7PCK A;  3KSE A;  2P7U A;  1FH0 A;  4KLB A;  2AU1 A;  2FTD A;  3OVZ A;  2BSZ A;  2R9N A;  2E02 A;  1GX3 A;  2R9M A;  3N3G A;  3HD3 A;  1NL6 A;  2FRA A;  4YV8 A;  4YYU A;  5CHV A;  4W5C A;  5CHT A;  1CPJ A;  3USV A;  1BY8 A;  1W6F A;  3U8E A;  4CDF B;  1VSN A;  2YJC A;  4DMY A;  2DCC A;  1ZCM A;  3K24 A;  2IBI A;  2OUL A;  1AYU A;  2VFB A;  3RVX A;  1DEU A;  2E01 A;  1IWD A;  2PNS A;  3QT4 A;  5FPW A;  3D9W A;  2CB5 A;  1GEC E;  3HHA A;  1PIP A;  1CB5 A;  1QXP A;  1AEC A;  2CIO A;  2IPP B;  4YYR A;  4MZO A;  2BDL A;  3O1G A;  3OVX A;  2FQ9 A;  4CDD B;  1F29 A;  1AYV A;  3F5V A;  2DC9 A;  1KHP A;  3LFY A;  4BSQ A;  3I06 A;  3P5W A;  4YYQ A;  4YYV A;  1AYW A;  3E1Z B;  1S4V A;  2PRE A;  3HWN A;  4AXL A;  3RVW A;  3HHI A;  3MHS A;  3LTW A;  2XU4 A;  2FYE A;  4X6I A;  3V6C A;  1PXV A;  1CQD A;  3N3K A;  1U9X A;  1EWP A;  2Y5B A;  1AU0 A;  4G54 A;  1EF7 A;  1KHQ A;  2B1N A;  2XU5 A;  1ITO A;  4DMX A;  2VFC A;  1GCB A;  1MIR A;  3WXE A;  1PAD A;  1F2A A;  4XR7 A;  3CBK A;  3CH2 X;  2G8E A;  1MEM A;  2Y6E A;  3N4C A;  1U5I A;  4I05 A;  3BWK A;  1TLO A;  4OEL A;  3ZUA A;  2R9F A;  3KWZ A;  4Q8G A;  1ME3 A;  2WBF X;  3H7D A;  2XU3 A;  1PE6 A;  1VJV A;  1KFX L;  2R9C A;  2P0R A;  2R6N A;  3WXF A;  3H8C A;  5K16 A;  2C0Y A;  1POP A;  4XUI A;  2FT2 A;  2AIM A;  4BS6 A;  1SNK A;  2F1G A;  2FO5 A;  5PAD A;  2OP3 A;  3ERV A;  1STF E;  1CTE A;  1W5R A;  2YJ2 A;  2PBH A;  1NPZ A;  3IHP A;  2AVW A;  2E00 A;  3TNX A;  2H7J A;  4BGF A;  1U9V A;  3D6S A;  3P5X A;  3S3Q A;  3MHH A;  4C5P A;  2XU1 A;  3IOQ A;  3H6S A;  2NQA A;  9PAP A;  1AU2 A;  4GUZ A;  5JH3 A;  1F2C A;  3WXG A;  4FK5 A;  5CVM A;  4P6G A;  2DC7 A;  3I3T A;  2FUD A;  2JQF R;  2NQD B;  4BQV A;  1GMY A;  1AU3 A;  1PPO A;  3M99 A;  1ME4 A;  1QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...