1AYWA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent benzyloxybenzoylcarbohydrazide inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Design of potent and selective human cathepsin K inhibitors that span the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1997-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1aywA00
1EF7A 3MHSA 1AYVA 4W4UA 1PADA 2E03A 1VSNA 3BWKA 2ATOA 4BS6A 2GHUA 1AU3A 1EWMA 1U9XA 5F02A 1NLJA 3U8EA 1CSBB 3IV2A 4I04A 3HWNA 1PE6A 5EF4A 1AU2A 1IWDA 2IPPB 1KFXL 3N3GA 1VJVA 1KXRA 2FUDA 2FT2A 2OULA 2AU1A 4MZSA 3IHPA 3KKUA 1MEGA 1M6DA 4WA6A 1KHPA 2WBFX 1U9QX 3CH3X 4PP1A 3K9MA 1YT7A 2DCAA 4AXMA 2R6NA 2NQGA 4YYUA 3P5XA 4MSXA 3PNRA 5CVMA 1Q6KA 1PPPA 3WXFA 3O1GA 1U9WA 4CDCB 3IUTA 3MTNA 1PIPA 3KSEA 1GMYA 5A24A 4W5BA 5PADA 1S4VA 2Y5BA 1U5IA 3F5VA 2DCDA 4MZOA 1BP4A 2CIOA 1AIMA 1U9VA 3H8CA 3B79A 4W5CA 3S3QA 2PREA 1NPZA 4OEMA 2YJBA 2DC6A 4OELA 1X9YA 2PNSA 1BY8A 3BC3A 1MEMA 3KWZA 1AECA 2XU5A 2G6DA 4BS5A 1ME4A 4BQVA 4RY2A 5EGWA 3V6CA 1AU0A 5K16A 1PCIA 2AIMA 1GLOA 1KFUL 2E02A 1F29A 4XUIA 2DJFB 2HHNA 1CQDA 9PAPA 3K24A 3P5WA 1NB5A 3BPMA 3HHAA 2PBHA 3LFYA 2AS8A 1GECE 2YJ9A 3HD3A 1DEUA 5CHVA 4YYVA 2DC7A 4HWYA 5J94A 4CZWA 2YJ2A 4FK5A 3IEJA 1NL6A 3O0UA 3PDFA 2OP3A 4K7CA 4PADA 2AUZA 1YK8A 2DJGB 1TL9A 3OVXA 1F2AA 3D6SA 1CTEA 2BDLA 1XKGA 2B1MA 3IMAA 4CDFB 3CBKA 3S3RA 4YVAA 2HD5A 2YJCA 2AUXA 3OISA 2FRAA 2B1NA 1PPNA 3I06A 2P86A 1YVBA 3N4CA 1YALA 3LXSA 3PBHA 3PW3A 2F1GA 3DF0A 3BOWA 3KW9A 2FO5A 4G54A 3BPFA 8PCHA 2NQDB 1GCBA 2XU3A 4QRVA 2HH5A 3KX1A 3WXGA 3OVZA 1AYUA 2JQGR 2FRQA 3HHIA 1THEA 1ZCMA 2F7DA 2R9OA 3AI8A 1QDQA 1CPJA 2DZZA 3NHEA 2BDZA 4YV8A 3GCBA 4KLBA 1Y4HA 2FTDA 1EWPA 3BCNA 3E1ZB 2AYNA 1Y08A 4AXLA 4CDEB 1MIRA 5FPWA 3H89A 1ICFA 4PP2E 2NQIA 1HUCB 4DMXA 1ME3A 2OZ2A 2R9MA 5CVNB 3MORA 1EWLA 4QBBA 1PPOA 1PBHA 2DCCA 2R9FA 3H7DA 4N8WA 2DCBA 2JQFR 1SP4B 5JH3A 3I3TA 2IBIA 2XU4A 1O0EA 2AYOA 2O6XA 4QH6A 2CB5A 1PPDA 3N3KA 3TNXA 2FQ9A 3MHHA 1EWOA 5CHTA 2XU1A 2DZYA 1MHWA 3QT4A 4I05A 7PCKA 2YJ8A 1NQCA 2H7JA 2R9CA 4XR7A 3OF9A 4YYRA 4Q8GA 2VHSA 2ARYA 3RVXA 1DF0A 2G8JA 3CBJA 1CJLA 2E00A 2E01A 4N79A 5CVOB 2DC9A 4X6HA 2R9NA 2GFOA 2C0YA 3OF8A 4BPVA 1CV8A 3M99A 1CB5A 2G7YA 3H8BA 1ATKA 2P7UA 1KHQA 4YYWA 4CDDB 2VHFA 5JA7A 4P6EA 3QSDA 3ZUAA 4YYQA 1JQPA 3H6SA 3WXEA 1AYWA 2G8EA 4I07A 1POPA 1BGOA 1F2CA 3V6EA 3P5UA 1QMYA 3ERVA 4Q8HA 3F75A 4DMYA 2AVWA 4FJCA 3K8UA 4X6IA 1FH0A 3KWBX 1SNKA 6PADA 1CS8A 4QRGA 1K3BB 1MDWA 3KFQA 4FIPA 2PADA 1CVZA 1MS6A 2FYEA 2ACTA 4ZUXU 3CH2X 4P6GA 1ZIVA 1F2BA 2DC8A 1PXVA 3USVA 1AU4A 4N4ZA 4QRXA 1BQIA 2HXZA 4YYSA 4BSQA 2Y6EA 3P5VA 1NB3A 2P0RA 4X6JA 4PI3A 1TU6A 3RVWA 3RVVA 1YK7A 3QJ3A 1A6RA 1QXPA 3C9EA 1STFE 1ITOA 2NQAA 3IOQA 1QOLA 1TLOA
chains in the Genus database with same CATH superfamily
1EF7A 3MHSA 1AYVA 4W4UA 1PADA 2E03A 1VSNA 3BWKA 2ATOA 4BS6A 2GHUA 1AU3A 5KO3A 4M0WA 1EWMA 1U9XA 5F02A 1NLJA 3U8EA 1CSBB 3IV2A 2JRIA 4I04A 3HWNA 1PE6A 5EF4A 1AU2A 1IWDA 2IPPB 1KFXL 3N3GA 1VJVA 1KXRA 2FUDA 2FT2A 2FE8A 2OULA 2AU1A 4XZXA 4MZSA 3IHPA 3KKUA 4PT5A 1MEGA 1M6DA 4WA6A 1KHPA 2WBFX 1U9QX 3CH3X 4PP1A 3K9MA 1YT7A 2DCAA 4AXMA 2R6NA 2NQGA 3MJ5A 4YYUA 3P5XA 4MSXA 3PNRA 5CVMA 1Q6KA 1PPPA 3WXFA 3O1GA 1U9WA 3MTVA 4CDCB 3IUTA 3MTNA 1PIPA 3KSEA 1GMYA 5A24A 5JZEA 4W5BA 5PADA 1S4VA 2Y5BA 1U5IA 3F5VA 2DCDA 4MZOA 1BP4A 3PSEA 2CIOA 1AIMA 1U9VA 3H8CA 3B79A 4W5CA 3S3QA 3PHWA 2PREA 1NPZA 4OEMA 2YJBA 2DC6A 4OELA 2BTWA 1X9YA 2PNSA 1BY8A 3BC3A 1MEMA 3KWZA 1AECA 3E9SA 2XU5A 3BY4A 4P16A 2G6DA 3W31A 4BS5A 1ME4A 4BQVA 4RY2A 5EGWA 3V6CA 1AU0A 5K16A 1PCIA 3TRKA 3IFUA 2AIMA 1GLOA 1KFUL 4BOUA 2E02A 1F29A 4XUIA 2DJFB 2HHNA 1CQDA 9PAPA 3K24A 3P5WA 1NB5A 4GUAA 4RNAA 3BPMA 3HHAA 2PBHA 3LFYA 3RNVA 2AS8A 1GECE 2YJ9A 3HD3A 1DEUA 2Z84A 5CHVA 4YYVA 2DC7A 4HWYA 4OVZB 5J94A 4CZWA 2YJ2A 4FK5A 3IEJA 1NL6A 3O0UA 3PDFA 4RKXA 2OP3A 4K7CA 4PADA 2AUZA 3MP2A 1YK8A 2DJGB 1TL9A 3OVXA 1F2AA 3D6SA 1CTEA 2BDLA 1XKGA 2B1MA 3IMAA 4CDFB 3CBKA 3S3RA 4YVAA 2HD5A 4BOSA 2YJCA 2AUXA 3OISA 2FRAA 2B1NA 5EZSA 1PPNA 3I06A 2P86A 1YVBA 3N4CA 1YALA 3LXSA 3PBHA 3PW3A 2F1GA 3DF0A 3BOWA 4D8EA 3KW9A 2FO5A 4G54A 3BPFA 8PCHA 3BBAA 2NQDB 1GCBA 2XU3A 4QRVA 4HXDB 2HH5A 3KX1A 3WXGA 3BB7A 3OVZA 5E6JA 1AYUA 2JQGR 4MM3B 2FRQA 3HHIA 1THEA 3O65A 1ZCMA 2F7DA 2R9OA 3AI8A 1QDQA 1CPJA 2DZZA 3NHEA 2BDZA 3PT2A 4YV8A 3GCBA 4KLBA 1Y4HA 3TMPA 2FTDA 1EWPA 3BCNA 3E1ZB 2AYNA 5EZQA 1Y08A 4AXLA 4CDEB 2JTCA 1MIRA 5FPWA 3H89A 1ICFA 4PP2E 3PRMA 2NQIA 1HUCB 4DMXA 1ME3A 2OZ2A 2R9MA 1PVJA 5CVNB 3MORA 4MI7A 1EWLA 4QBBA 1PPOA 4RF1A 1PBHA 2DCCA 2R9FA 3H7DA 4N8WA 2AGAA 2DCBA 2JQFR 1SP4B 5JH3A 4WURA 3I3TA 2IBIA 4OW0A 2XU4A 1O0EA 2AYOA 1UKFA 2O6XA 4QH6A 2CB5A 1PPDA 3N3KA 3TNXA 2FQ9A 3MHHA 1EWOA 3B21A 5CHTA 4BOPA 2XU1A 4RF0A 2DZYA 1MHWA 3QT4A 4I05A 7PCKA 2YJ8A 1NQCA 2H7JA 2R9CA 4XR7A 3OF9A 4YYRA 2BTWB 4Q8GA 2VHSA 2ARYA 2J7QA 3RVXA 1DF0A 4R3DA 2G8JA 2J7QC 3CBJA 2HWKA 1CJLA 2E00A 2E01A 3C0RA 4N79A 4A5UA 4IP3A 5CVOB 2DC9A 1DKIA 4X6HA 2R9NA 4D8BA 2GFOA 4REZA 2C0YA 3PRPA 3OF8A 4BOZA 4BPVA 1CV8A 3M99A 1CB5A 2G7YA 3H8BA 1ATKA 2P7UA 1KHQA 4YYWA 4CDDB 2VHFA 5JA7A 4P6EA 3QSDA 3ZUAA 4YYQA 1JQPA 3H6SA 3WXEA 1AYWA 2G8EA 3OQCA 4I07A 1POPA 1BGOA 1F2CA 4BOQA 3PHUA 3V6EA 3P5UA 1QMYA 3ERVA 4Q8HA 3F75A 4DMYA 2AVWA 4FJCA 3K8UA 4X6IA 1FH0A 2UZJA 4IUMA 3KWBX 1SNKA 6PADA 1CS8A 4QRGA 1K3BB 4OVZA 1MDWA 3KFQA 2BU3A 4FIPA 2PADA 1CVZA 1MS6A 2FYEA 2ACTA 4ZUXU 3CH2X 4P6GA 1ZIVA 1F2BA 2DC8A 4D8IA 1PXVA 4ZTBA 1YZBA 3USVA 1AU4A 4N4ZA 4QRXA 1BQIA 2HXZA 4YYSA 4BSQA 2Y6EA 3P5VA 1NB3A 2P0RA 3ZNHA 4X6JA 4PI3A 1TU6A 3RVWA 3RVVA 2DOSA 1YK7A 3QJ3A 1A6RA 3W30A 1QXPA 3C9EA 1STFE 1ITOA 2NQAA 3PHXA 3IOQA 1QOLA 1TLOA
chains in the Genus database with same CATH topology
1EF7A 3MHSA 1AYVA 4W4UA 1PADA 2E03A 1VSNA 3BWKA 2ATOA 4BS6A 2GHUA 1AU3A 1EWMA 1U9XA 5F02A 1NLJA 3U8EA 1CSBB 3IV2A 4I04A 3HWNA 1PE6A 5EF4A 1AU2A 1IWDA 2IPPB 1KFXL 3N3GA 1VJVA 1KXRA 2FUDA 2FT2A 2OULA 4NV8A 2AU1A 4MZSA 3IHPA 3KKUA 1MEGA 1M6DA 4WA6A 1KHPA 2WBFX 1U9QX 3CH3X 4PP1A 3K9MA 1YT7A 2DCAA 4AXMA 2R6NA 2NQGA 4YYUA 3P5XA 4MSXA 3PNRA 5CVMA 1Q6KA 1PPPA 3WXFA 3O1GA 4B55A 1U9WA 4CDCB 4NV7A 3IUTA 3MTNA 1PIPA 3KSEA 1GMYA 5A24A 2BSZA 4W5BA 5PADA 1S4VA 2Y5BA 1U5IA 3F5VA 2DCDA 4MZOA 1BP4A 2CIOA 1AIMA 1U9VA 3H8CA 3B79A 4W5CA 3S3QA 2PREA 1NPZA 4OEMA 2YJBA 2DC6A 4OELA 1X9YA 2PNSA 1BY8A 3BC3A 1MEMA 1W5RA 3KWZA 1AECA 2XU5A 2G6DA 4BS5A 1ME4A 4BQVA 4RY2A 5EGWA 3V6CA 1AU0A 5K16A 1PCIA 2AIMA 1GLOA 1KFUL 2E02A 1F29A 4XUIA 2DJFB 2HHNA 1CQDA 9PAPA 3K24A 3P5WA 1NB5A 3BPMA 3HHAA 2PBHA 3LFYA 2AS8A 1GECE 2YJ9A 3HD3A 1DEUA 5CHVA 4C5PA 4YYVA 2DC7A 4HWYA 5J94A 4CZWA 2YJ2A 4FK5A 3IEJA 2VFBA 1NL6A 3O0UA 3PDFA 2OP3A 4K7CA 4PADA 2AUZA 4GUZA 1YK8A 2DJGB 1TL9A 3OVXA 1F2AA 3D6SA 1CTEA 2BDLA 1XKGA 1GX3A 2B1MA 2VFCA 3IMAA 4CDFB 3CBKA 3S3RA 4YVAA 2HD5A 2YJCA 2AUXA 3OISA 2FRAA 2B1NA 1PPNA 3I06A 2P86A 1YVBA 3N4CA 1YALA 3LXSA 3PBHA 3PW3A 2F1GA 3DF0A 3BOWA 3KW9A 2FO5A 4G54A 3BPFA 8PCHA 2NQDB 1GCBA 2XU3A 4QRVA 2HH5A 3KX1A 3WXGA 3OVZA 1AYUA 2JQGR 2FRQA 3HHIA 1THEA 1ZCMA 2F7DA 2R9OA 3AI8A 1QDQA 1CPJA 2DZZA 3NHEA 2BDZA 1W4TA 4YV8A 3GCBA 4KLBA 1Y4HA 2FTDA 1EWPA 3BCNA 3E1ZB 2AYNA 1Y08A 4AXLA 4CDEB 1MIRA 5FPWA 3H89A 1ICFA 4PP2E 2NQIA 1HUCB 4DMXA 1ME3A 2OZ2A 2R9MA 5CVNB 3MORA 1EWLA 4QBBA 1PPOA 1PBHA 2DCCA 2R9FA 3H7DA 4N8WA 2DCBA 2JQFR 1SP4B 5JH3A 3I3TA 2IBIA 2XU4A 1O0EA 2AYOA 2O6XA 4QH6A 2CB5A 1PPDA 3N3KA 3TNXA 2FQ9A 3MHHA 1EWOA 4BGFA 3LTWA 5CHTA 2XU1A 2DZYA 1MHWA 3QT4A 4I05A 7PCKA 2YJ8A 1NQCA 2H7JA 2R9CA 4XR7A 3OF9A 4YYRA 4Q8GA 2VHSA 2ARYA 3RVXA 1DF0A 1E2TA 2G8JA 3CBJA 1CJLA 2E00A 2E01A 4N79A 5CVOB 2DC9A 4X6HA 2R9NA 2GFOA 2C0YA 3OF8A 4BPVA 1CV8A 3M99A 1CB5A 2G7YA 3H8BA 1ATKA 2P7UA 1KHQA 4YYWA 4CDDB 2VHFA 5JA7A 4P6EA 3QSDA 3ZUAA 4YYQA 1JQPA 3H6SA 3WXEA 1AYWA 2G8EA 4I07A 1POPA 1BGOA 1F2CA 3V6EA 3P5UA 1QMYA 3ERVA 4Q8HA 3F75A 4DMYA 2AVWA 4FJCA 3K8UA 4X6IA 1FH0A 3KWBX 1SNKA 6PADA 1CS8A 4QRGA 1K3BB 1MDWA 3KFQA 4FIPA 2PADA 1CVZA 1MS6A 2FYEA 2ACTA 4ZUXU 3CH2X 4P6GA 1ZIVA 1F2BA 2DC8A 1PXVA 1W6FA 3USVA 1AU4A 4N4ZA 4QRXA 1BQIA 2HXZA 4YYSA 4BSQA 2Y6EA 3P5VA 1NB3A 2P0RA 4X6JA 4PI3A 1TU6A 3RVWA 3RVVA 1YK7A 3QJ3A 1A6RA 1QXPA 3C9EA 1STFE 1ITOA 2NQAA 3IOQA 1QOLA 1TLOA 3D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF7 A;  3MHS A;  1AYV A;  4W4U A;  1PAD A;  2E03 A;  1VSN A;  3BWK A;  2ATO A;  4BS6 A;  2GHU A;  1AU3 A;  1EWM A;  1U9X A;  5F02 A;  1NLJ A;  3U8E A;  1CSB B;  3IV2 A;  4I04 A;  3HWN A;  1PE6 A;  5EF4 A;  1AU2 A;  1IWD A;  2IPP B;  1KFX L;  3N3G A;  1VJV A;  1KXR A;  2FUD A;  2FT2 A;  2OUL A;  2AU1 A;  4MZS A;  3IHP A;  3KKU A;  1MEG A;  1M6D A;  4WA6 A;  1KHP A;  2WBF X;  1U9Q X;  3CH3 X;  4PP1 A;  3K9M A;  1YT7 A;  2DCA A;  4AXM A;  2R6N A;  2NQG A;  4YYU A;  3P5X A;  4MSX A;  3PNR A;  5CVM A;  1Q6K A;  1PPP A;  3WXF A;  3O1G A;  1U9W A;  4CDC B;  3IUT A;  3MTN A;  1PIP A;  3KSE A;  1GMY A;  5A24 A;  4W5B A;  5PAD A;  1S4V A;  2Y5B A;  1U5I A;  3F5V A;  2DCD A;  4MZO A;  1BP4 A;  2CIO A;  1AIM A;  1U9V A;  3H8C A;  3B79 A;  4W5C A;  3S3Q A;  2PRE A;  1NPZ A;  4OEM A;  2YJB A;  2DC6 A;  4OEL A;  1X9Y A;  2PNS A;  1BY8 A;  3BC3 A;  1MEM A;  3KWZ A;  1AEC A;  2XU5 A;  2G6D A;  4BS5 A;  1ME4 A;  4BQV A;  4RY2 A;  5EGW A;  3V6C A;  1AU0 A;  5K16 A;  1PCI A;  2AIM A;  1GLO A;  1KFU L;  2E02 A;  1F29 A;  4XUI A;  2DJF B;  2HHN A;  1CQD A;  9PAP A;  3K24 A;  3P5W A;  1NB5 A;  3BPM A;  3HHA A;  2PBH A;  3LFY A;  2AS8 A;  1GEC E;  2YJ9 A;  3HD3 A;  1DEU A;  5CHV A;  4YYV A;  2DC7 A;  4HWY A;  5J94 A;  4CZW A;  2YJ2 A;  4FK5 A;  3IEJ A;  1NL6 A;  3O0U A;  3PDF A;  2OP3 A;  4K7C A;  4PAD A;  2AUZ A;  1YK8 A;  2DJG B;  1TL9 A;  3OVX A;  1F2A A;  3D6S A;  1CTE A;  2BDL A;  1XKG A;  2B1M A;  3IMA A;  4CDF B;  3CBK A;  3S3R A;  4YVA A;  2HD5 A;  2YJC A;  2AUX A;  3OIS A;  2FRA A;  2B1N A;  1PPN A;  3I06 A;  2P86 A;  1YVB A;  3N4C A;  1YAL A;  3LXS A;  3PBH A;  3PW3 A;  2F1G A;  3DF0 A;  3BOW A;  3KW9 A;  2FO5 A;  4G54 A;  3BPF A;  8PCH A;  2NQD B;  1GCB A;  2XU3 A;  4QRV A;  2HH5 A;  3KX1 A;  3WXG A;  3OVZ A;  1AYU A;  2JQG R;  2FRQ A;  3HHI A;  1THE A;  1ZCM A;  2F7D A;  2R9O A;  3AI8 A;  1QDQ A;  1CPJ A;  2DZZ A;  3NHE A;  2BDZ A;  4YV8 A;  3GCB A;  4KLB A;  1Y4H A;  2FTD A;  1EWP A;  3BCN A;  3E1Z B;  2AYN A;  1Y08 A;  4AXL A;  4CDE B;  1MIR A;  5FPW A;  3H89 A;  1ICF A;  4PP2 E;  2NQI A;  1HUC B;  4DMX A;  1ME3 A;  2OZ2 A;  2R9M A;  5CVN B;  3MOR A;  1EWL A;  4QBB A;  1PPO A;  1PBH A;  2DCC A;  2R9F A;  3H7D A;  4N8W A;  2DCB A;  2JQF R;  1SP4 B;  5JH3 A;  3I3T A;  2IBI A;  2XU4 A;  1O0E A;  2AYO A;  2O6X A;  4QH6 A;  2CB5 A;  1PPD A;  3N3K A;  3TNX A;  2FQ9 A;  3MHH A;  1EWO A;  5CHT A;  2XU1 A;  2DZY A;  1MHW A;  3QT4 A;  4I05 A;  7PCK A;  2YJ8 A;  1NQC A;  2H7J A;  2R9C A;  4XR7 A;  3OF9 A;  4YYR A;  4Q8G A;  2VHS A;  2ARY A;  3RVX A;  1DF0 A;  2G8J A;  3CBJ A;  1CJL A;  2E00 A;  2E01 A;  4N79 A;  5CVO B;  2DC9 A;  4X6H A;  2R9N A;  2GFO A;  2C0Y A;  3OF8 A;  4BPV A;  1CV8 A;  3M99 A;  1CB5 A;  2G7Y A;  3H8B A;  1ATK A;  2P7U A;  1KHQ A;  4YYW A;  4CDD B;  2VHF A;  5JA7 A;  4P6E A;  3QSD A;  3ZUA A;  4YYQ A;  1JQP A;  3H6S A;  3WXE A;  1AYW A;  2G8E A;  4I07 A;  1POP A;  1BGO A;  1F2C A;  3V6E A;  3P5U A;  1QMY A;  3ERV A;  4Q8H A;  3F75 A;  4DMY A;  2AVW A;  4FJC A;  3K8U A;  4X6I A;  1FH0 A;  3KWB X;  1SNK A;  6PAD A;  1CS8 A;  4QRG A;  1K3B B;  1MDW A;  3KFQ A;  4FIP A;  2PAD A;  1CVZ A;  1MS6 A;  2FYE A;  2ACT A;  4ZUX U;  3CH2 X;  4P6G A;  1ZIV A;  1F2B A;  2DC8 A;  1PXV A;  3USV A;  1AU4 A;  4N4Z A;  4QRX A;  1BQI A;  2HXZ A;  4YYS A;  4BSQ A;  2Y6E A;  3P5V A;  1NB3 A;  2P0R A;  4X6J A;  4PI3 A;  1TU6 A;  3RVW A;  3RVV A;  1YK7 A;  3QJ3 A;  1A6R A;  1QXP A;  3C9E A;  1STF E;  1ITO A;  2NQA A;  3IOQ A;  1QOL A;  1TLO A; 
#chains in the Genus database with same CATH topology
 1EF7 A;  3MHS A;  1AYV A;  4W4U A;  1PAD A;  2E03 A;  1VSN A;  3BWK A;  2ATO A;  4BS6 A;  2GHU A;  1AU3 A;  5KO3 A;  4M0W A;  1EWM A;  1U9X A;  5F02 A;  1NLJ A;  3U8E A;  1CSB B;  3IV2 A;  2JRI A;  4I04 A;  3HWN A;  1PE6 A;  5EF4 A;  1AU2 A;  1IWD A;  2IPP B;  1KFX L;  3N3G A;  1VJV A;  1KXR A;  2FUD A;  2FT2 A;  2FE8 A;  2OUL A;  2AU1 A;  4XZX A;  4MZS A;  3IHP A;  3KKU A;  4PT5 A;  1MEG A;  1M6D A;  4WA6 A;  1KHP A;  2WBF X;  1U9Q X;  3CH3 X;  4PP1 A;  3K9M A;  1YT7 A;  2DCA A;  4AXM A;  2R6N A;  2NQG A;  3MJ5 A;  4YYU A;  3P5X A;  4MSX A;  3PNR A;  5CVM A;  1Q6K A;  1PPP A;  3WXF A;  3O1G A;  1U9W A;  3MTV A;  4CDC B;  3IUT A;  3MTN A;  1PIP A;  3KSE A;  1GMY A;  5A24 A;  5JZE A;  4W5B A;  5PAD A;  1S4V A;  2Y5B A;  1U5I A;  3F5V A;  2DCD A;  4MZO A;  1BP4 A;  3PSE A;  2CIO A;  1AIM A;  1U9V A;  3H8C A;  3B79 A;  4W5C A;  3S3Q A;  3PHW A;  2PRE A;  1NPZ A;  4OEM A;  2YJB A;  2DC6 A;  4OEL A;  2BTW A;  1X9Y A;  2PNS A;  1BY8 A;  3BC3 A;  1MEM A;  3KWZ A;  1AEC A;  3E9S A;  2XU5 A;  3BY4 A;  4P16 A;  2G6D A;  3W31 A;  4BS5 A;  1ME4 A;  4BQV A;  4RY2 A;  5EGW A;  3V6C A;  1AU0 A;  5K16 A;  1PCI A;  3TRK A;  3IFU A;  2AIM A;  1GLO A;  1KFU L;  4BOU A;  2E02 A;  1F29 A;  4XUI A;  2DJF B;  2HHN A;  1CQD A;  9PAP A;  3K24 A;  3P5W A;  1NB5 A;  4GUA A;  4RNA A;  3BPM A;  3HHA A;  2PBH A;  3LFY A;  3RNV A;  2AS8 A;  1GEC E;  2YJ9 A;  3HD3 A;  1DEU A;  2Z84 A;  5CHV A;  4YYV A;  2DC7 A;  4HWY A;  4OVZ B;  5J94 A;  4CZW A;  2YJ2 A;  4FK5 A;  3IEJ A;  1NL6 A;  3O0U A;  3PDF A;  4RKX A;  2OP3 A;  4K7C A;  4PAD A;  2AUZ A;  3MP2 A;  1YK8 A;  2DJG B;  1TL9 A;  3OVX A;  1F2A A;  3D6S A;  1CTE A;  2BDL A;  1XKG A;  2B1M A;  3IMA A;  4CDF B;  3CBK A;  3S3R A;  4YVA A;  2HD5 A;  4BOS A;  2YJC A;  2AUX A;  3OIS A;  2FRA A;  2B1N A;  5EZS A;  1PPN A;  3I06 A;  2P86 A;  1YVB A;  3N4C A;  1YAL A;  3LXS A;  3PBH A;  3PW3 A;  2F1G A;  3DF0 A;  3BOW A;  4D8E A;  3KW9 A;  2FO5 A;  4G54 A;  3BPF A;  8PCH A;  3BBA A;  2NQD B;  1GCB A;  2XU3 A;  4QRV A;  4HXD B;  2HH5 A;  3KX1 A;  3WXG A;  3BB7 A;  3OVZ A;  5E6J A;  1AYU A;  2JQG R;  4MM3 B;  2FRQ A;  3HHI A;  1THE A;  3O65 A;  1ZCM A;  2F7D A;  2R9O A;  3AI8 A;  1QDQ A;  1CPJ A;  2DZZ A;  3NHE A;  2BDZ A;  3PT2 A;  4YV8 A;  3GCB A;  4KLB A;  1Y4H A;  3TMP A;  2FTD A;  1EWP A;  3BCN A;  3E1Z B;  2AYN A;  5EZQ A;  1Y08 A;  4AXL A;  4CDE B;  2JTC A;  1MIR A;  5FPW A;  3H89 A;  1ICF A;  4PP2 E;  3PRM A;  2NQI A;  1HUC B;  4DMX A;  1ME3 A;  2OZ2 A;  2R9M A;  1PVJ A;  5CVN B;  3MOR A;  4MI7 A;  1EWL A;  4QBB A;  1PPO A;  4RF1 A;  1PBH A;  2DCC A;  2R9F A;  3H7D A;  4N8W A;  2AGA A;  2DCB A;  2JQF R;  1SP4 B;  5JH3 A;  4WUR A;  3I3T A;  2IBI A;  4OW0 A;  2XU4 A;  1O0E A;  2AYO A;  1UKF A;  2O6X A;  4QH6 A;  2CB5 A;  1PPD A;  3N3K A;  3TNX A;  2FQ9 A;  3MHH A;  1EWO A;  3B21 A;  5CHT A;  4BOP A;  2XU1 A;  4RF0 A;  2DZY A;  1MHW A;  3QT4 A;  4I05 A;  7PCK A;  2YJ8 A;  1NQC A;  2H7J A;  2R9C A;  4XR7 A;  3OF9 A;  4YYR A;  2BTW B;  4Q8G A;  2VHS A;  2ARY A;  2J7Q A;  3RVX A;  1DF0 A;  4R3D A;  2G8J A;  2J7Q C;  3CBJ A;  2HWK A;  1CJL A;  2E00 A;  2E01 A;  3C0R A;  4N79 A;  4A5U A;  4IP3 A;  5CVO B;  2DC9 A;  1DKI A;  4X6H A;  2R9N A;  4D8B A;  2GFO A;  4REZ A;  2C0Y A;  3PRP A;  3OF8 A;  4BOZ A;  4BPV A;  1CV8 A;  3M99 A;  1CB5 A;  2G7Y A;  3H8B A;  1ATK A;  2P7U A;  1KHQ A;  4YYW A;  4CDD B;  2VHF A;  5JA7 A;  4P6E A;  3QSD A;  3ZUA A;  4YYQ A;  1JQP A;  3H6S A;  3WXE A;  1AYW A;  2G8E A;  3OQC A;  4I07 A;  1POP A;  1BGO A;  1F2C A;  4BOQ A;  3PHU A;  3V6E A;  3P5U A;  1QMY A;  3ERV A;  4Q8H A;  3F75 A;  4DMY A;  2AVW A;  4FJC A;  3K8U A;  4X6I A;  1FH0 A;  2UZJ A;  4IUM A;  3KWB X;  1SNK A;  6PAD A;  1CS8 A;  4QRG A;  1K3B B;  4OVZ A;  1MDW A;  3KFQ A;  2BU3 A;  4FIP A;  2PAD A;  1CVZ A;  1MS6 A;  2FYE A;  2ACT A;  4ZUX U;  3CH2 X;  4P6G A;  1ZIV A;  1F2B A;  2DC8 A;  4D8I A;  1PXV A;  4ZTB A;  1YZB A;  3USV A;  1AU4 A;  4N4Z A;  4QRX A;  1BQI A;  2HXZ A;  4YYS A;  4BSQ A;  2Y6E A;  3P5V A;  1NB3 A;  2P0R A;  3ZNH A;  4X6J A;  4PI3 A;  1TU6 A;  3RVW A;  3RVV A;  2DOS A;  1YK7 A;  3QJ3 A;  1A6R A;  3W30 A;  1QXP A;  3C9E A;  1STF E;  1ITO A;  2NQA A;  3PHX A;  3IOQ A;  1QOL A;  1TLO A; 
#chains in the Genus database with same CATH homology
 1EF7 A;  3MHS A;  1AYV A;  4W4U A;  1PAD A;  2E03 A;  1VSN A;  3BWK A;  2ATO A;  4BS6 A;  2GHU A;  1AU3 A;  1EWM A;  1U9X A;  5F02 A;  1NLJ A;  3U8E A;  1CSB B;  3IV2 A;  4I04 A;  3HWN A;  1PE6 A;  5EF4 A;  1AU2 A;  1IWD A;  2IPP B;  1KFX L;  3N3G A;  1VJV A;  1KXR A;  2FUD A;  2FT2 A;  2OUL A;  4NV8 A;  2AU1 A;  4MZS A;  3IHP A;  3KKU A;  1MEG A;  1M6D A;  4WA6 A;  1KHP A;  2WBF X;  1U9Q X;  3CH3 X;  4PP1 A;  3K9M A;  1YT7 A;  2DCA A;  4AXM A;  2R6N A;  2NQG A;  4YYU A;  3P5X A;  4MSX A;  3PNR A;  5CVM A;  1Q6K A;  1PPP A;  3WXF A;  3O1G A;  4B55 A;  1U9W A;  4CDC B;  4NV7 A;  3IUT A;  3MTN A;  1PIP A;  3KSE A;  1GMY A;  5A24 A;  2BSZ A;  4W5B A;  5PAD A;  1S4V A;  2Y5B A;  1U5I A;  3F5V A;  2DCD A;  4MZO A;  1BP4 A;  2CIO A;  1AIM A;  1U9V A;  3H8C A;  3B79 A;  4W5C A;  3S3Q A;  2PRE A;  1NPZ A;  4OEM A;  2YJB A;  2DC6 A;  4OEL A;  1X9Y A;  2PNS A;  1BY8 A;  3BC3 A;  1MEM A;  1W5R A;  3KWZ A;  1AEC A;  2XU5 A;  2G6D A;  4BS5 A;  1ME4 A;  4BQV A;  4RY2 A;  5EGW A;  3V6C A;  1AU0 A;  5K16 A;  1PCI A;  2AIM A;  1GLO A;  1KFU L;  2E02 A;  1F29 A;  4XUI A;  2DJF B;  2HHN A;  1CQD A;  9PAP A;  3K24 A;  3P5W A;  1NB5 A;  3BPM A;  3HHA A;  2PBH A;  3LFY A;  2AS8 A;  1GEC E;  2YJ9 A;  3HD3 A;  1DEU A;  5CHV A;  4C5P A;  4YYV A;  2DC7 A;  4HWY A;  5J94 A;  4CZW A;  2YJ2 A;  4FK5 A;  3IEJ A;  2VFB A;  1NL6 A;  3O0U A;  3PDF A;  2OP3 A;  4K7C A;  4PAD A;  2AUZ A;  4GUZ A;  1YK8 A;  2DJG B;  1TL9 A;  3OVX A;  1F2A A;  3D6S A;  1CTE A;  2BDL A;  1XKG A;  1GX3 A;  2B1M A;  2VFC A;  3IMA A;  4CDF B;  3CBK A;  3S3R A;  4YVA A;  2HD5 A;  2YJC A;  2AUX A;  3OIS A;  2FRA A;  2B1N A;  1PPN A;  3I06 A;  2P86 A;  1YVB A;  3N4C A;  1YAL A;  3LXS A;  3PBH A;  3PW3 A;  2F1G A;  3DF0 A;  3BOW A;  3KW9 A;  2FO5 A;  4G54 A;  3BPF A;  8PCH A;  2NQD B;  1GCB A;  2XU3 A;  4QRV A;  2HH5 A;  3KX1 A;  3WXG A;  3OVZ A;  1AYU A;  2JQG R;  2FRQ A;  3HHI A;  1THE A;  1ZCM A;  2F7D A;  2R9O A;  3AI8 A;  1QDQ A;  1CPJ A;  2DZZ A;  3NHE A;  2BDZ A;  1W4T A;  4YV8 A;  3GCB A;  4KLB A;  1Y4H A;  2FTD A;  1EWP A;  3BCN A;  3E1Z B;  2AYN A;  1Y08 A;  4AXL A;  4CDE B;  1MIR A;  5FPW A;  3H89 A;  1ICF A;  4PP2 E;  2NQI A;  1HUC B;  4DMX A;  1ME3 A;  2OZ2 A;  2R9M A;  5CVN B;  3MOR A;  1EWL A;  4QBB A;  1PPO A;  1PBH A;  2DCC A;  2R9F A;  3H7D A;  4N8W A;  2DCB A;  2JQF R;  1SP4 B;  5JH3 A;  3I3T A;  2IBI A;  2XU4 A;  1O0E A;  2AYO A;  2O6X A;  4QH6 A;  2CB5 A;  1PPD A;  3N3K A;  3TNX A;  2FQ9 A;  3MHH A;  1EWO A;  4BGF A;  3LTW A;  5CHT A;  2XU1 A;  2DZY A;  1MHW A;  3QT4 A;  4I05 A;  7PCK A;  2YJ8 A;  1NQC A;  2H7J A;  2R9C A;  4XR7 A;  3OF9 A;  4YYR A;  4Q8G A;  2VHS A;  2ARY A;  3RVX A;  1DF0 A;  1E2T A;  2G8J A;  3CBJ A;  1CJL A;  2E00 A;  2E01 A;  4N79 A;  5CVO B;  2DC9 A;  4X6H A;  2R9N A;  2GFO A;  2C0Y A;  3OF8 A;  4BPV A;  1CV8 A;  3M99 A;  1CB5 A;  2G7Y A;  3H8B A;  1ATK A;  2P7U A;  1KHQ A;  4YYW A;  4CDD B;  2VHF A;  5JA7 A;  4P6E A;  3QSD A;  3ZUA A;  4YYQ A;  1JQP A;  3H6S A;  3WXE A;  1AYW A;  2G8E A;  4I07 A;  1POP A;  1BGO A;  1F2C A;  3V6E A;  3P5U A;  1QMY A;  3ERV A;  4Q8H A;  3F75 A;  4DMY A;  2AVW A;  4FJC A;  3K8U A;  4X6I A;  1FH0 A;  3KWB X;  1SNK A;  6PAD A;  1CS8 A;  4QRG A;  1K3B B;  1MDW A;  3KFQ A;  4FIP A;  2PAD A;  1CVZ A;  1MS6 A;  2FYE A;  2ACT A;  4ZUX U;  3CH2 X;  4P6G A;  1ZIV A;  1F2B A;  2DC8 A;  1PXV A;  1W6F A;  3USV A;  1AU4 A;  4N4Z A;  4QRX A;  1BQI A;  2HXZ A;  4YYS A;  4BSQ A;  2Y6E A;  3P5V A;  1NB3 A;  2P0R A;  4X6J A;  4PI3 A;  1TU6 A;  3RVW A;  3RVV A;  1YK7 A;  3QJ3 A;  1A6R A;  1QXP A;  3C9E A;  1STF E;  1ITO A;  2NQA A;  3IOQ A;  1QOL A;  1TLO A;  3D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...