3E1ZB

Crystal structure of the parasite protesase inhibitor chagasin in complex with papain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity determinants for target proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Chagasin
total genus 69
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3e1zB00
2WBFX 1CJLA 3OISA 1PPOA 4CDCB 3KWBX 4OELA 1AYWA 1PIPA 2PBHA 2DCBA 3NHEA 1VSNA 1QXPA 3O1GA 4YYWA 2R9FA 4MZSA 3BCNA 2H7JA 3HWNA 2E01A 2NQDB 3HD3A 3PBHA 2XU3A 4XUIA 2P7UA 4YVAA 1U5IA 4X6JA 2DZYA 2HHNA 1EWMA 2R9CA 1CS8A 4XR7A 4AXLA 1ME3A 2P0RA 3RVXA 4FJCA 1BQIA 1AECA 1CTEA 2R9NA 1JQPA 2VHSA 1FH0A 1PPPA 1U9VA 4BPVA 5CVOB 3M99A 1POPA 3IV2A 2DJFB 3U8EA 1BY8A 2C0YA 3H6SA 2DCDA 5J94A 1CQDA 3MHHA 4Q8HA 1X9YA 2DC6A 2G8EA 2ATOA 3BWKA 1BGOA 1KXRA 2BDZA 3P5WA 2PNSA 1NPZA 3IUTA 2XU5A 4CDDB 1YALA 4QRGA 4OEMA 5F02A 4BQVA 2FT2A 3QSDA 4FIPA 3F5VA 5K16A 2FO5A 1EWPA 3CBKA 2HD5A 2AVWA 1AU0A 4K7CA 3CBJA 2F1GA 3CH2X 2CIOA 5FPWA 1ZCMA 4YYQA 3D6SA 4W5CA 3OVXA 4FK5A 2E00A 4PP1A 4YYUA 2DCCA 2FTDA 3N3KA 2JQGR 2OULA 3MTNA 5PADA 3H89A 2YJBA 1PADA 4W5BA 5EF4A 2ACTA 4BS5A 4BS6A 3B79A 3WXGA 4YV8A 2HH5A 3H8BA 4I04A 2XU4A 4ZUXU 1PXVA 2G6DA 4I07A 2DZZA 3V6EA 1HUCB 4QRVA 4N8WA 3MORA 1A6RA 8PCHA 5CVMA 1CV8A 4PADA 1YVBA 1IWDA 1EWOA 1BP4A 1F29A 4N79A 2AUXA 1NLJA 3CH3X 3N4CA 4YYRA 2G8JA 2FRAA 1ICFA 3I06A 3H7DA 3ERVA 1DEUA 1NL6A 2XU1A 5A24A 2YJ2A 1CVZA 3KW9A 3S3QA 2AYOA 4PI3A 1EF7A 1M6DA 3MHSA 2BDLA 4P6EA 4RY2A 4KLBA 1XKGA 4AXMA 1EWLA 2NQGA 4Q8GA 3WXEA 4QBBA 3HHAA 2OZ2A 3TNXA 1CPJA 1MEMA 1F2BA 2NQAA 4X6IA 1K3BB 1PBHA 4MSXA 2AS8A 1PE6A 4P6GA 5CHVA 9PAPA 3KFQA 2R9OA 3DF0A 4G54A 1ITOA 1NB3A 2AU1A 3F75A 3OF9A 3KSEA 3LFYA 3PNRA 1GCBA 1CB5A 1DF0A 1MDWA 1YK7A 2GFOA 3GCBA 1U9QX 3P5XA 2AYNA 1QDQA 5JH3A 1QOLA 4WA6A 3K24A 3PW3A 4PP2E 1QMYA 4HWYA 3QT4A 2PREA 2IPPB 1NQCA 2HXZA 4N4ZA 2DC7A 2FYEA 1AU3A 2E03A 3H8CA 1AIMA 3USVA 7PCKA 4I05A 1AYVA 1MS6A 1ME4A 1STFE 1PCIA 2PADA 1GECE 2F7DA 1F2AA 1Y08A 3OF8A 4YYSA 5CVNB 2DC8A 3BPMA 2CB5A 2Y5BA 2P86A 1TLOA 1THEA 3BC3A 1KHPA 4YYVA 3RVVA 4X6HA 1Y4HA 2O6XA 3KKUA 2FQ9A 1U9WA 1KHQA 3PDFA 1KFUL 3K8UA 1PPDA 2DJGB 4DMYA 2VHFA 1PPNA 1MIRA 2AUZA 1MEGA 1MHWA 3IHPA 5EGWA 6PADA 3S3RA 1SNKA 1U9XA 4CDEB 1GLOA 1AU4A 1S4VA 2R9MA 3K9MA 3BOWA 1NB5A 2DCAA 2OP3A 4BSQA 1TL9A 3IOQA 3IMAA 3N3GA 2YJ8A 2YJ9A 2E02A 5JA7A 4QH6A 1CSBB 3AI8A 1YK8A 3C9EA 3RVWA 1GMYA 3KWZA 3WXFA 1ATKA 2G7YA 2GHUA 2AIMA 3P5VA 3P5UA 2ARYA 1AYUA 1YT7A 2DC9A 1F2CA 2YJCA 1KFXL 3ZUAA 2B1NA 3QJ3A 5CHTA 1AU2A 2IBIA 2NQIA 2Y6EA 4QRXA 1SP4B 3OVZA 2R6NA 4CDFB 1O0EA 1TU6A 3O0UA 2B1MA 3E1ZB 4W4UA 3HHIA 3LXSA 1ZIVA 3BPFA 4DMXA 3IEJA 2FUDA 1VJVA 2JQFR 4MZOA 1Q6KA 3V6CA 4CZWA 2FRQA 3I3TA 3KX1A
chains in the Genus database with same CATH superfamily
2WBFX 1CJLA 3OISA 1PPOA 4CDCB 3KWBX 4OELA 2Z84A 1AYWA 1PIPA 2PBHA 4GUAA 2DCBA 3NHEA 1VSNA 1QXPA 3O1GA 4YYWA 2R9FA 4MZSA 3BCNA 2H7JA 3HWNA 2E01A 2NQDB 3HD3A 2AGAA 3PBHA 2XU3A 4XUIA 2P7UA 4YVAA 1U5IA 4PT5A 4X6JA 2DZYA 1PVJA 2HHNA 1EWMA 2R9CA 1CS8A 4XR7A 4AXLA 1ME3A 2P0RA 3RVXA 4FJCA 1BQIA 1AECA 4M0WA 1CTEA 2R9NA 3RNVA 1JQPA 2VHSA 1FH0A 1PPPA 1U9VA 4BPVA 5CVOB 3M99A 1POPA 2BU3A 5JZEA 3E9SA 3IV2A 2DJFB 3U8EA 1BY8A 4WURA 2C0YA 3H6SA 2DCDA 5J94A 1CQDA 3MHHA 4Q8HA 1X9YA 4RF1A 2DC6A 2G8EA 3C0RA 2ATOA 3BWKA 1BGOA 1KXRA 3IFUA 1YZBA 2BDZA 4MI7A 3P5WA 2BTWB 2PNSA 4OW0A 1NPZA 3IUTA 2JTCA 2XU5A 4CDDB 1YALA 4QRGA 4OEMA 5F02A 4BQVA 2FT2A 3QSDA 4FIPA 3F5VA 5K16A 3OQCA 2FO5A 1EWPA 3MTVA 3CBKA 2HD5A 2AVWA 1AU0A 4K7CA 3CBJA 3ZNHA 2F1GA 3CH2X 2CIOA 3PHWA 5FPWA 1ZCMA 4YYQA 3D6SA 4W5CA 3OVXA 4FK5A 2E00A 4XZXA 4PP1A 4YYUA 2DCCA 2FTDA 3N3KA 2JQGR 4BOZA 4D8BA 2OULA 3MTNA 5PADA 3H89A 2YJBA 1PADA 4W5BA 5EF4A 2DOSA 2ACTA 4BS5A 4BS6A 3B79A 3WXGA 4YV8A 4A5UA 2HH5A 3H8BA 4I04A 2XU4A 4ZUXU 1PXVA 2G6DA 4I07A 2DZZA 2UZJA 3V6EA 1HUCB 4QRVA 4N8WA 3MORA 1A6RA 8PCHA 4BOSA 5CVMA 1CV8A 4PADA 1YVBA 3PHXA 1IWDA 1EWOA 1BP4A 1F29A 4N79A 2AUXA 1NLJA 3CH3X 3N4CA 4YYRA 4P16A 3PHUA 2G8JA 3BBAA 2FRAA 1ICFA 3I06A 3H7DA 3ERVA 1DEUA 1NL6A 2XU1A 5A24A 2YJ2A 1CVZA 3KW9A 3S3QA 2AYOA 4OVZB 4PI3A 1EF7A 1M6DA 4REZA 3MHSA 2BDLA 4P6EA 4RY2A 4KLBA 1XKGA 4AXMA 1EWLA 2NQGA 4Q8GA 2JRIA 3O65A 3WXEA 4QBBA 3HHAA 2HWKA 2OZ2A 3TNXA 3MJ5A 1CPJA 1MEMA 1F2BA 2NQAA 4X6IA 1K3BB 1PBHA 4MSXA 2AS8A 1PE6A 4P6GA 5CHVA 9PAPA 3KFQA 2R9OA 4RKXA 3DF0A 4G54A 1ITOA 2FE8A 1NB3A 2AU1A 1UKFA 3F75A 3OF9A 3KSEA 3LFYA 3PNRA 1GCBA 1CB5A 1DF0A 1MDWA 3BB7A 5EZQA 1YK7A 2GFOA 3GCBA 1U9QX 3P5XA 2AYNA 1QDQA 5JH3A 1QOLA 4WA6A 3K24A 3PW3A 4PP2E 1QMYA 4HWYA 3QT4A 2PREA 4R3DA 2IPPB 1NQCA 2HXZA 4N4ZA 2DC7A 2FYEA 1AU3A 1DKIA 2E03A 3H8CA 1AIMA 3USVA 7PCKA 4I05A 4D8EA 1AYVA 1MS6A 1ME4A 1STFE 3BY4A 4BOUA 1PCIA 2PADA 1GECE 2F7DA 4IUMA 1F2AA 1Y08A 3OF8A 4YYSA 4HXDB 5CVNB 3PSEA 2DC8A 3BPMA 3PRMA 2CB5A 2Y5BA 4D8IA 2P86A 1TLOA 1THEA 3BC3A 1KHPA 4OVZA 4YYVA 3RVVA 4X6HA 1Y4HA 2O6XA 3KKUA 2FQ9A 1U9WA 4MM3B 1KHQA 3PDFA 1KFUL 3K8UA 1PPDA 2J7QA 2DJGB 4DMYA 4BOQA 2VHFA 1PPNA 1MIRA 2AUZA 1MEGA 1MHWA 3IHPA 4RNAA 5EGWA 6PADA 3S3RA 1SNKA 1U9XA 4CDEB 1GLOA 1AU4A 1S4VA 2R9MA 3K9MA 3BOWA 1NB5A 2DCAA 2OP3A 4BSQA 1TL9A 3IOQA 3IMAA 3PRPA 3N3GA 3MP2A 2YJ8A 2YJ9A 2E02A 5JA7A 4QH6A 1CSBB 3AI8A 1YK8A 4IP3A 3C9EA 3RVWA 1GMYA 3TRKA 3KWZA 3WXFA 5EZSA 1ATKA 2G7YA 2GHUA 2AIMA 3P5VA 3P5UA 2ARYA 1AYUA 1YT7A 2DC9A 1F2CA 2YJCA 1KFXL 3ZUAA 2B1NA 3QJ3A 5E6JA 5CHTA 1AU2A 2IBIA 2NQIA 2Y6EA 3PT2A 4QRXA 2BTWA 3B21A 1SP4B 3OVZA 3W31A 2R6NA 4RF0A 5KO3A 4CDFB 3TMPA 1O0EA 1TU6A 3O0UA 2B1MA 3E1ZB 4W4UA 3HHIA 3LXSA 1ZIVA 3BPFA 4DMXA 4ZTBA 3IEJA 2FUDA 1VJVA 2JQFR 4MZOA 1Q6KA 3V6CA 4CZWA 2FRQA 3W30A 3I3TA 4BOPA 3KX1A 2J7QC
chains in the Genus database with same CATH topology
2WBFX 1CJLA 3OISA 1PPOA 4CDCB 3KWBX 4OELA 1AYWA 1PIPA 2PBHA 2DCBA 3NHEA 1VSNA 1QXPA 3O1GA 4YYWA 2R9FA 4MZSA 3BCNA 2H7JA 3HWNA 2E01A 2NQDB 3HD3A 3PBHA 2XU3A 4XUIA 2P7UA 4YVAA 1U5IA 4X6JA 2DZYA 2HHNA 1EWMA 2R9CA 1CS8A 4XR7A 4AXLA 1ME3A 2P0RA 3RVXA 4FJCA 1BQIA 1AECA 1CTEA 2R9NA 1JQPA 2VHSA 1FH0A 3D9WA 1PPPA 1U9VA 4BPVA 5CVOB 3M99A 1POPA 4GUZA 3IV2A 2DJFB 3U8EA 1BY8A 2C0YA 3H6SA 2DCDA 5J94A 1CQDA 3MHHA 4Q8HA 1X9YA 2DC6A 2G8EA 2ATOA 3BWKA 1BGOA 1KXRA 2BDZA 3P5WA 2PNSA 1NPZA 3IUTA 2XU5A 4CDDB 1YALA 4QRGA 4OEMA 5F02A 4BQVA 2FT2A 3QSDA 4FIPA 3F5VA 5K16A 2FO5A 1EWPA 3CBKA 2HD5A 2AVWA 1AU0A 4K7CA 3CBJA 2F1GA 3CH2X 2CIOA 5FPWA 1ZCMA 4YYQA 3D6SA 4W5CA 1GX3A 3OVXA 4FK5A 2E00A 4PP1A 4YYUA 2DCCA 2FTDA 3N3KA 2JQGR 2BSZA 2OULA 3MTNA 5PADA 3H89A 2YJBA 1PADA 4W5BA 5EF4A 2ACTA 4BS5A 4BS6A 3B79A 3WXGA 4NV8A 4YV8A 4C5PA 2HH5A 3H8BA 4I04A 2XU4A 4ZUXU 1PXVA 2G6DA 4I07A 2DZZA 3V6EA 1HUCB 4QRVA 4N8WA 3MORA 1A6RA 8PCHA 5CVMA 1CV8A 4PADA 1YVBA 1IWDA 1EWOA 1BP4A 1F29A 4N79A 2AUXA 1NLJA 3CH3X 3N4CA 4YYRA 2G8JA 2FRAA 1ICFA 3I06A 3H7DA 3ERVA 1DEUA 1NL6A 2XU1A 5A24A 2YJ2A 1CVZA 3KW9A 3S3QA 4B55A 2AYOA 4PI3A 1EF7A 1M6DA 3MHSA 2BDLA 4P6EA 4RY2A 4KLBA 1XKGA 4AXMA 1EWLA 2NQGA 4Q8GA 3WXEA 4QBBA 3HHAA 2OZ2A 3TNXA 1CPJA 1MEMA 1F2BA 2NQAA 4X6IA 1K3BB 1PBHA 4MSXA 2AS8A 1PE6A 4P6GA 5CHVA 9PAPA 3KFQA 2R9OA 3DF0A 4G54A 1ITOA 1NB3A 2AU1A 3F75A 3OF9A 3KSEA 3LFYA 3PNRA 1GCBA 1CB5A 1DF0A 1MDWA 1YK7A 2GFOA 3GCBA 1U9QX 4NV7A 3P5XA 2AYNA 1QDQA 5JH3A 1QOLA 4WA6A 3K24A 3PW3A 4PP2E 1QMYA 4HWYA 3QT4A 2PREA 2IPPB 1NQCA 2HXZA 4N4ZA 2DC7A 2FYEA 1AU3A 2E03A 3LTWA 3H8CA 1AIMA 3USVA 7PCKA 4I05A 1AYVA 1MS6A 1ME4A 1STFE 1PCIA 2PADA 1GECE 2F7DA 2VFBA 1F2AA 1Y08A 3OF8A 4YYSA 5CVNB 2DC8A 3BPMA 2CB5A 2Y5BA 2P86A 1TLOA 1THEA 3BC3A 1KHPA 1W6FA 4YYVA 3RVVA 4X6HA 1Y4HA 2O6XA 3KKUA 2FQ9A 1U9WA 1KHQA 3PDFA 1KFUL 3K8UA 1PPDA 2DJGB 4DMYA 2VHFA 1PPNA 1MIRA 2AUZA 1MEGA 1MHWA 3IHPA 5EGWA 6PADA 3S3RA 1SNKA 1U9XA 4CDEB 1GLOA 1AU4A 1S4VA 2R9MA 3K9MA 3BOWA 1NB5A 2DCAA 2OP3A 4BSQA 1TL9A 3IOQA 3IMAA 3N3GA 1W4TA 2YJ8A 2VFCA 2YJ9A 2E02A 5JA7A 1W5RA 4QH6A 4BGFA 1CSBB 3AI8A 1YK8A 3C9EA 3RVWA 1GMYA 3KWZA 3WXFA 1ATKA 2G7YA 2GHUA 2AIMA 3P5VA 3P5UA 2ARYA 1AYUA 1YT7A 2DC9A 1F2CA 2YJCA 1KFXL 3ZUAA 2B1NA 3QJ3A 5CHTA 1AU2A 2IBIA 2NQIA 2Y6EA 4QRXA 1SP4B 3OVZA 2R6NA 4CDFB 1O0EA 1TU6A 3O0UA 2B1MA 3E1ZB 4W4UA 3HHIA 1E2TA 3LXSA 1ZIVA 3BPFA 4DMXA 3IEJA 2FUDA 1VJVA 2JQFR 4MZOA 1Q6KA 3V6CA 4CZWA 2FRQA 3I3TA 3KX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBF X;  1CJL A;  3OIS A;  1PPO A;  4CDC B;  3KWB X;  4OEL A;  1AYW A;  1PIP A;  2PBH A;  2DCB A;  3NHE A;  1VSN A;  1QXP A;  3O1G A;  4YYW A;  2R9F A;  4MZS A;  3BCN A;  2H7J A;  3HWN A;  2E01 A;  2NQD B;  3HD3 A;  3PBH A;  2XU3 A;  4XUI A;  2P7U A;  4YVA A;  1U5I A;  4X6J A;  2DZY A;  2HHN A;  1EWM A;  2R9C A;  1CS8 A;  4XR7 A;  4AXL A;  1ME3 A;  2P0R A;  3RVX A;  4FJC A;  1BQI A;  1AEC A;  1CTE A;  2R9N A;  1JQP A;  2VHS A;  1FH0 A;  1PPP A;  1U9V A;  4BPV A;  5CVO B;  3M99 A;  1POP A;  3IV2 A;  2DJF B;  3U8E A;  1BY8 A;  2C0Y A;  3H6S A;  2DCD A;  5J94 A;  1CQD A;  3MHH A;  4Q8H A;  1X9Y A;  2DC6 A;  2G8E A;  2ATO A;  3BWK A;  1BGO A;  1KXR A;  2BDZ A;  3P5W A;  2PNS A;  1NPZ A;  3IUT A;  2XU5 A;  4CDD B;  1YAL A;  4QRG A;  4OEM A;  5F02 A;  4BQV A;  2FT2 A;  3QSD A;  4FIP A;  3F5V A;  5K16 A;  2FO5 A;  1EWP A;  3CBK A;  2HD5 A;  2AVW A;  1AU0 A;  4K7C A;  3CBJ A;  2F1G A;  3CH2 X;  2CIO A;  5FPW A;  1ZCM A;  4YYQ A;  3D6S A;  4W5C A;  3OVX A;  4FK5 A;  2E00 A;  4PP1 A;  4YYU A;  2DCC A;  2FTD A;  3N3K A;  2JQG R;  2OUL A;  3MTN A;  5PAD A;  3H89 A;  2YJB A;  1PAD A;  4W5B A;  5EF4 A;  2ACT A;  4BS5 A;  4BS6 A;  3B79 A;  3WXG A;  4YV8 A;  2HH5 A;  3H8B A;  4I04 A;  2XU4 A;  4ZUX U;  1PXV A;  2G6D A;  4I07 A;  2DZZ A;  3V6E A;  1HUC B;  4QRV A;  4N8W A;  3MOR A;  1A6R A;  8PCH A;  5CVM A;  1CV8 A;  4PAD A;  1YVB A;  1IWD A;  1EWO A;  1BP4 A;  1F29 A;  4N79 A;  2AUX A;  1NLJ A;  3CH3 X;  3N4C A;  4YYR A;  2G8J A;  2FRA A;  1ICF A;  3I06 A;  3H7D A;  3ERV A;  1DEU A;  1NL6 A;  2XU1 A;  5A24 A;  2YJ2 A;  1CVZ A;  3KW9 A;  3S3Q A;  2AYO A;  4PI3 A;  1EF7 A;  1M6D A;  3MHS A;  2BDL A;  4P6E A;  4RY2 A;  4KLB A;  1XKG A;  4AXM A;  1EWL A;  2NQG A;  4Q8G A;  3WXE A;  4QBB A;  3HHA A;  2OZ2 A;  3TNX A;  1CPJ A;  1MEM A;  1F2B A;  2NQA A;  4X6I A;  1K3B B;  1PBH A;  4MSX A;  2AS8 A;  1PE6 A;  4P6G A;  5CHV A;  9PAP A;  3KFQ A;  2R9O A;  3DF0 A;  4G54 A;  1ITO A;  1NB3 A;  2AU1 A;  3F75 A;  3OF9 A;  3KSE A;  3LFY A;  3PNR A;  1GCB A;  1CB5 A;  1DF0 A;  1MDW A;  1YK7 A;  2GFO A;  3GCB A;  1U9Q X;  3P5X A;  2AYN A;  1QDQ A;  5JH3 A;  1QOL A;  4WA6 A;  3K24 A;  3PW3 A;  4PP2 E;  1QMY A;  4HWY A;  3QT4 A;  2PRE A;  2IPP B;  1NQC A;  2HXZ A;  4N4Z A;  2DC7 A;  2FYE A;  1AU3 A;  2E03 A;  3H8C A;  1AIM A;  3USV A;  7PCK A;  4I05 A;  1AYV A;  1MS6 A;  1ME4 A;  1STF E;  1PCI A;  2PAD A;  1GEC E;  2F7D A;  1F2A A;  1Y08 A;  3OF8 A;  4YYS A;  5CVN B;  2DC8 A;  3BPM A;  2CB5 A;  2Y5B A;  2P86 A;  1TLO A;  1THE A;  3BC3 A;  1KHP A;  4YYV A;  3RVV A;  4X6H A;  1Y4H A;  2O6X A;  3KKU A;  2FQ9 A;  1U9W A;  1KHQ A;  3PDF A;  1KFU L;  3K8U A;  1PPD A;  2DJG B;  4DMY A;  2VHF A;  1PPN A;  1MIR A;  2AUZ A;  1MEG A;  1MHW A;  3IHP A;  5EGW A;  6PAD A;  3S3R A;  1SNK A;  1U9X A;  4CDE B;  1GLO A;  1AU4 A;  1S4V A;  2R9M A;  3K9M A;  3BOW A;  1NB5 A;  2DCA A;  2OP3 A;  4BSQ A;  1TL9 A;  3IOQ A;  3IMA A;  3N3G A;  2YJ8 A;  2YJ9 A;  2E02 A;  5JA7 A;  4QH6 A;  1CSB B;  3AI8 A;  1YK8 A;  3C9E A;  3RVW A;  1GMY A;  3KWZ A;  3WXF A;  1ATK A;  2G7Y A;  2GHU A;  2AIM A;  3P5V A;  3P5U A;  2ARY A;  1AYU A;  1YT7 A;  2DC9 A;  1F2C A;  2YJC A;  1KFX L;  3ZUA A;  2B1N A;  3QJ3 A;  5CHT A;  1AU2 A;  2IBI A;  2NQI A;  2Y6E A;  4QRX A;  1SP4 B;  3OVZ A;  2R6N A;  4CDF B;  1O0E A;  1TU6 A;  3O0U A;  2B1M A;  3E1Z B;  4W4U A;  3HHI A;  3LXS A;  1ZIV A;  3BPF A;  4DMX A;  3IEJ A;  2FUD A;  1VJV A;  2JQF R;  4MZO A;  1Q6K A;  3V6C A;  4CZW A;  2FRQ A;  3I3T A;  3KX1 A; 
#chains in the Genus database with same CATH topology
 2WBF X;  1CJL A;  3OIS A;  1PPO A;  4CDC B;  3KWB X;  4OEL A;  2Z84 A;  1AYW A;  1PIP A;  2PBH A;  4GUA A;  2DCB A;  3NHE A;  1VSN A;  1QXP A;  3O1G A;  4YYW A;  2R9F A;  4MZS A;  3BCN A;  2H7J A;  3HWN A;  2E01 A;  2NQD B;  3HD3 A;  2AGA A;  3PBH A;  2XU3 A;  4XUI A;  2P7U A;  4YVA A;  1U5I A;  4PT5 A;  4X6J A;  2DZY A;  1PVJ A;  2HHN A;  1EWM A;  2R9C A;  1CS8 A;  4XR7 A;  4AXL A;  1ME3 A;  2P0R A;  3RVX A;  4FJC A;  1BQI A;  1AEC A;  4M0W A;  1CTE A;  2R9N A;  3RNV A;  1JQP A;  2VHS A;  1FH0 A;  1PPP A;  1U9V A;  4BPV A;  5CVO B;  3M99 A;  1POP A;  2BU3 A;  5JZE A;  3E9S A;  3IV2 A;  2DJF B;  3U8E A;  1BY8 A;  4WUR A;  2C0Y A;  3H6S A;  2DCD A;  5J94 A;  1CQD A;  3MHH A;  4Q8H A;  1X9Y A;  4RF1 A;  2DC6 A;  2G8E A;  3C0R A;  2ATO A;  3BWK A;  1BGO A;  1KXR A;  3IFU A;  1YZB A;  2BDZ A;  4MI7 A;  3P5W A;  2BTW B;  2PNS A;  4OW0 A;  1NPZ A;  3IUT A;  2JTC A;  2XU5 A;  4CDD B;  1YAL A;  4QRG A;  4OEM A;  5F02 A;  4BQV A;  2FT2 A;  3QSD A;  4FIP A;  3F5V A;  5K16 A;  3OQC A;  2FO5 A;  1EWP A;  3MTV A;  3CBK A;  2HD5 A;  2AVW A;  1AU0 A;  4K7C A;  3CBJ A;  3ZNH A;  2F1G A;  3CH2 X;  2CIO A;  3PHW A;  5FPW A;  1ZCM A;  4YYQ A;  3D6S A;  4W5C A;  3OVX A;  4FK5 A;  2E00 A;  4XZX A;  4PP1 A;  4YYU A;  2DCC A;  2FTD A;  3N3K A;  2JQG R;  4BOZ A;  4D8B A;  2OUL A;  3MTN A;  5PAD A;  3H89 A;  2YJB A;  1PAD A;  4W5B A;  5EF4 A;  2DOS A;  2ACT A;  4BS5 A;  4BS6 A;  3B79 A;  3WXG A;  4YV8 A;  4A5U A;  2HH5 A;  3H8B A;  4I04 A;  2XU4 A;  4ZUX U;  1PXV A;  2G6D A;  4I07 A;  2DZZ A;  2UZJ A;  3V6E A;  1HUC B;  4QRV A;  4N8W A;  3MOR A;  1A6R A;  8PCH A;  4BOS A;  5CVM A;  1CV8 A;  4PAD A;  1YVB A;  3PHX A;  1IWD A;  1EWO A;  1BP4 A;  1F29 A;  4N79 A;  2AUX A;  1NLJ A;  3CH3 X;  3N4C A;  4YYR A;  4P16 A;  3PHU A;  2G8J A;  3BBA A;  2FRA A;  1ICF A;  3I06 A;  3H7D A;  3ERV A;  1DEU A;  1NL6 A;  2XU1 A;  5A24 A;  2YJ2 A;  1CVZ A;  3KW9 A;  3S3Q A;  2AYO A;  4OVZ B;  4PI3 A;  1EF7 A;  1M6D A;  4REZ A;  3MHS A;  2BDL A;  4P6E A;  4RY2 A;  4KLB A;  1XKG A;  4AXM A;  1EWL A;  2NQG A;  4Q8G A;  2JRI A;  3O65 A;  3WXE A;  4QBB A;  3HHA A;  2HWK A;  2OZ2 A;  3TNX A;  3MJ5 A;  1CPJ A;  1MEM A;  1F2B A;  2NQA A;  4X6I A;  1K3B B;  1PBH A;  4MSX A;  2AS8 A;  1PE6 A;  4P6G A;  5CHV A;  9PAP A;  3KFQ A;  2R9O A;  4RKX A;  3DF0 A;  4G54 A;  1ITO A;  2FE8 A;  1NB3 A;  2AU1 A;  1UKF A;  3F75 A;  3OF9 A;  3KSE A;  3LFY A;  3PNR A;  1GCB A;  1CB5 A;  1DF0 A;  1MDW A;  3BB7 A;  5EZQ A;  1YK7 A;  2GFO A;  3GCB A;  1U9Q X;  3P5X A;  2AYN A;  1QDQ A;  5JH3 A;  1QOL A;  4WA6 A;  3K24 A;  3PW3 A;  4PP2 E;  1QMY A;  4HWY A;  3QT4 A;  2PRE A;  4R3D A;  2IPP B;  1NQC A;  2HXZ A;  4N4Z A;  2DC7 A;  2FYE A;  1AU3 A;  1DKI A;  2E03 A;  3H8C A;  1AIM A;  3USV A;  7PCK A;  4I05 A;  4D8E A;  1AYV A;  1MS6 A;  1ME4 A;  1STF E;  3BY4 A;  4BOU A;  1PCI A;  2PAD A;  1GEC E;  2F7D A;  4IUM A;  1F2A A;  1Y08 A;  3OF8 A;  4YYS A;  4HXD B;  5CVN B;  3PSE A;  2DC8 A;  3BPM A;  3PRM A;  2CB5 A;  2Y5B A;  4D8I A;  2P86 A;  1TLO A;  1THE A;  3BC3 A;  1KHP A;  4OVZ A;  4YYV A;  3RVV A;  4X6H A;  1Y4H A;  2O6X A;  3KKU A;  2FQ9 A;  1U9W A;  4MM3 B;  1KHQ A;  3PDF A;  1KFU L;  3K8U A;  1PPD A;  2J7Q A;  2DJG B;  4DMY A;  4BOQ A;  2VHF A;  1PPN A;  1MIR A;  2AUZ A;  1MEG A;  1MHW A;  3IHP A;  4RNA A;  5EGW A;  6PAD A;  3S3R A;  1SNK A;  1U9X A;  4CDE B;  1GLO A;  1AU4 A;  1S4V A;  2R9M A;  3K9M A;  3BOW A;  1NB5 A;  2DCA A;  2OP3 A;  4BSQ A;  1TL9 A;  3IOQ A;  3IMA A;  3PRP A;  3N3G A;  3MP2 A;  2YJ8 A;  2YJ9 A;  2E02 A;  5JA7 A;  4QH6 A;  1CSB B;  3AI8 A;  1YK8 A;  4IP3 A;  3C9E A;  3RVW A;  1GMY A;  3TRK A;  3KWZ A;  3WXF A;  5EZS A;  1ATK A;  2G7Y A;  2GHU A;  2AIM A;  3P5V A;  3P5U A;  2ARY A;  1AYU A;  1YT7 A;  2DC9 A;  1F2C A;  2YJC A;  1KFX L;  3ZUA A;  2B1N A;  3QJ3 A;  5E6J A;  5CHT A;  1AU2 A;  2IBI A;  2NQI A;  2Y6E A;  3PT2 A;  4QRX A;  2BTW A;  3B21 A;  1SP4 B;  3OVZ A;  3W31 A;  2R6N A;  4RF0 A;  5KO3 A;  4CDF B;  3TMP A;  1O0E A;  1TU6 A;  3O0U A;  2B1M A;  3E1Z B;  4W4U A;  3HHI A;  3LXS A;  1ZIV A;  3BPF A;  4DMX A;  4ZTB A;  3IEJ A;  2FUD A;  1VJV A;  2JQF R;  4MZO A;  1Q6K A;  3V6C A;  4CZW A;  2FRQ A;  3W30 A;  3I3T A;  4BOP A;  3KX1 A;  2J7Q C; 
#chains in the Genus database with same CATH homology
 2WBF X;  1CJL A;  3OIS A;  1PPO A;  4CDC B;  3KWB X;  4OEL A;  1AYW A;  1PIP A;  2PBH A;  2DCB A;  3NHE A;  1VSN A;  1QXP A;  3O1G A;  4YYW A;  2R9F A;  4MZS A;  3BCN A;  2H7J A;  3HWN A;  2E01 A;  2NQD B;  3HD3 A;  3PBH A;  2XU3 A;  4XUI A;  2P7U A;  4YVA A;  1U5I A;  4X6J A;  2DZY A;  2HHN A;  1EWM A;  2R9C A;  1CS8 A;  4XR7 A;  4AXL A;  1ME3 A;  2P0R A;  3RVX A;  4FJC A;  1BQI A;  1AEC A;  1CTE A;  2R9N A;  1JQP A;  2VHS A;  1FH0 A;  3D9W A;  1PPP A;  1U9V A;  4BPV A;  5CVO B;  3M99 A;  1POP A;  4GUZ A;  3IV2 A;  2DJF B;  3U8E A;  1BY8 A;  2C0Y A;  3H6S A;  2DCD A;  5J94 A;  1CQD A;  3MHH A;  4Q8H A;  1X9Y A;  2DC6 A;  2G8E A;  2ATO A;  3BWK A;  1BGO A;  1KXR A;  2BDZ A;  3P5W A;  2PNS A;  1NPZ A;  3IUT A;  2XU5 A;  4CDD B;  1YAL A;  4QRG A;  4OEM A;  5F02 A;  4BQV A;  2FT2 A;  3QSD A;  4FIP A;  3F5V A;  5K16 A;  2FO5 A;  1EWP A;  3CBK A;  2HD5 A;  2AVW A;  1AU0 A;  4K7C A;  3CBJ A;  2F1G A;  3CH2 X;  2CIO A;  5FPW A;  1ZCM A;  4YYQ A;  3D6S A;  4W5C A;  1GX3 A;  3OVX A;  4FK5 A;  2E00 A;  4PP1 A;  4YYU A;  2DCC A;  2FTD A;  3N3K A;  2JQG R;  2BSZ A;  2OUL A;  3MTN A;  5PAD A;  3H89 A;  2YJB A;  1PAD A;  4W5B A;  5EF4 A;  2ACT A;  4BS5 A;  4BS6 A;  3B79 A;  3WXG A;  4NV8 A;  4YV8 A;  4C5P A;  2HH5 A;  3H8B A;  4I04 A;  2XU4 A;  4ZUX U;  1PXV A;  2G6D A;  4I07 A;  2DZZ A;  3V6E A;  1HUC B;  4QRV A;  4N8W A;  3MOR A;  1A6R A;  8PCH A;  5CVM A;  1CV8 A;  4PAD A;  1YVB A;  1IWD A;  1EWO A;  1BP4 A;  1F29 A;  4N79 A;  2AUX A;  1NLJ A;  3CH3 X;  3N4C A;  4YYR A;  2G8J A;  2FRA A;  1ICF A;  3I06 A;  3H7D A;  3ERV A;  1DEU A;  1NL6 A;  2XU1 A;  5A24 A;  2YJ2 A;  1CVZ A;  3KW9 A;  3S3Q A;  4B55 A;  2AYO A;  4PI3 A;  1EF7 A;  1M6D A;  3MHS A;  2BDL A;  4P6E A;  4RY2 A;  4KLB A;  1XKG A;  4AXM A;  1EWL A;  2NQG A;  4Q8G A;  3WXE A;  4QBB A;  3HHA A;  2OZ2 A;  3TNX A;  1CPJ A;  1MEM A;  1F2B A;  2NQA A;  4X6I A;  1K3B B;  1PBH A;  4MSX A;  2AS8 A;  1PE6 A;  4P6G A;  5CHV A;  9PAP A;  3KFQ A;  2R9O A;  3DF0 A;  4G54 A;  1ITO A;  1NB3 A;  2AU1 A;  3F75 A;  3OF9 A;  3KSE A;  3LFY A;  3PNR A;  1GCB A;  1CB5 A;  1DF0 A;  1MDW A;  1YK7 A;  2GFO A;  3GCB A;  1U9Q X;  4NV7 A;  3P5X A;  2AYN A;  1QDQ A;  5JH3 A;  1QOL A;  4WA6 A;  3K24 A;  3PW3 A;  4PP2 E;  1QMY A;  4HWY A;  3QT4 A;  2PRE A;  2IPP B;  1NQC A;  2HXZ A;  4N4Z A;  2DC7 A;  2FYE A;  1AU3 A;  2E03 A;  3LTW A;  3H8C A;  1AIM A;  3USV A;  7PCK A;  4I05 A;  1AYV A;  1MS6 A;  1ME4 A;  1STF E;  1PCI A;  2PAD A;  1GEC E;  2F7D A;  2VFB A;  1F2A A;  1Y08 A;  3OF8 A;  4YYS A;  5CVN B;  2DC8 A;  3BPM A;  2CB5 A;  2Y5B A;  2P86 A;  1TLO A;  1THE A;  3BC3 A;  1KHP A;  1W6F A;  4YYV A;  3RVV A;  4X6H A;  1Y4H A;  2O6X A;  3KKU A;  2FQ9 A;  1U9W A;  1KHQ A;  3PDF A;  1KFU L;  3K8U A;  1PPD A;  2DJG B;  4DMY A;  2VHF A;  1PPN A;  1MIR A;  2AUZ A;  1MEG A;  1MHW A;  3IHP A;  5EGW A;  6PAD A;  3S3R A;  1SNK A;  1U9X A;  4CDE B;  1GLO A;  1AU4 A;  1S4V A;  2R9M A;  3K9M A;  3BOW A;  1NB5 A;  2DCA A;  2OP3 A;  4BSQ A;  1TL9 A;  3IOQ A;  3IMA A;  3N3G A;  1W4T A;  2YJ8 A;  2VFC A;  2YJ9 A;  2E02 A;  5JA7 A;  1W5R A;  4QH6 A;  4BGF A;  1CSB B;  3AI8 A;  1YK8 A;  3C9E A;  3RVW A;  1GMY A;  3KWZ A;  3WXF A;  1ATK A;  2G7Y A;  2GHU A;  2AIM A;  3P5V A;  3P5U A;  2ARY A;  1AYU A;  1YT7 A;  2DC9 A;  1F2C A;  2YJC A;  1KFX L;  3ZUA A;  2B1N A;  3QJ3 A;  5CHT A;  1AU2 A;  2IBI A;  2NQI A;  2Y6E A;  4QRX A;  1SP4 B;  3OVZ A;  2R6N A;  4CDF B;  1O0E A;  1TU6 A;  3O0U A;  2B1M A;  3E1Z B;  4W4U A;  3HHI A;  1E2T A;  3LXS A;  1ZIV A;  3BPF A;  4DMX A;  3IEJ A;  2FUD A;  1VJV A;  2JQF R;  4MZO A;  1Q6K A;  3V6C A;  4CZW A;  2FRQ A;  3I3T A;  3KX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...