3E1ZB

Crystal structure of the parasite protesase inhibitor chagasin in complex with papain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chagasin
publication title Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity determinants for target proteases.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase inhibitor/hydrolase
total genus 69
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3e1zB00
2YJ8A 3S3QA 2OULA 3ERVA 1ME3A 1MS6A 4QBBA 2AVWA 4W5CA 3MHHA 2DJGB 1NQCA 3PDFA 2ACTA 2YJCA 1CQDA 3RVVA 1NL6A 4XR7A 1EWOA 4QRVA 2IPPB 3D6SA 3OF9A 1AYVA 2DC8A 3QSDA 4FK5A 1DEUA 4G54A 1Q6KA 1O0EA 4X6IA 1FH0A 3KX1A 1ZCMA 2P86A 2VHSA 3CH3X 3CBKA 5J94A 3H8BA 2E00A 3HWNA 2FRAA 4MZSA 1KFXL 4W5BA 4BS6A 2DCBA 5PADA 3KFQA 1JQPA 5FPWA 3QT4A 3IMAA 4YYRA 4BS5A 3KKUA 2DC9A 1CV8A 2G8JA 3RVXA 3QJ3A 3B79A 1QMYA 3V6EA 2YJ9A 4YYSA 4P6EA 2DZYA 3IUTA 4YYQA 1NB5A 1S4VA 3I3TA 1AYUA 1AU4A 1GECE 3P5XA 3C9EA 1PIPA 4YYWA 4PADA 4YV8A 2XU3A 1Y4HA 1QDQA 3P5WA 1PBHA 1KXRA 2G6DA 1GLOA 1MHWA 2FT2A 1Y08A 3IHPA 1U5IA 2H7JA 4QRXA 2CB5A 1AECA 1EWPA 2DZZA 5CVNB 2PBHA 2OZ2A 6PADA 1THEA 5JH3A 4I05A 3CBJA 2ATOA 4CDEB 3I06A 5EGWA 5K16A 1KHPA 1F2AA 3E1ZB 1CB5A 3HHIA 3MHSA 1U9XA 2NQIA 3K9MA 4PP2E 3F5VA 1F2BA 1CSBB 3M99A 4RY2A 1GCBA 3OISA 2ARYA 1AU0A 3TNXA 3KW9A 3KWBX 3LFYA 1MDWA 2IBIA 4HWYA 1YALA 1QXPA 2XU4A 1ME4A 2E02A 1CTEA 2HD5A 2PREA 1DF0A 3H89A 3N3GA 4AXLA 1CVZA 1KFUL 2VHFA 1CS8A 2NQAA 4BQVA 2OP3A 1YT7A 2DCAA 4W4UA 2AYOA 4N79A 1YVBA 3NHEA 3K8UA 2B1MA 2DJFB 1MEMA 3PBHA 4MZOA 2JQGR 3F75A 2DC7A 4Q8GA 4X6HA 1ATKA 1PPDA 2XU5A 1U9QX 2YJBA 1YK7A 4WA6A 1ITOA 1U9VA 3P5UA 1PCIA 4OEMA 1POPA 3RVWA 1F29A 1F2CA 4I04A 3H8CA 2DC6A 3CH2X 3KSEA 2XU1A 3LXSA 1IWDA 2AUXA 3PW3A 2AU1A 2G8EA 1PPNA 1AYWA 1YK8A 5CHTA 2JQFR 1EF7A 1BGOA 4CZWA 2WBFX 3PNRA 1PPOA 5A24A 1BY8A 2YJ2A 1PXVA 4N8WA 3GCBA 3O0UA 4BPVA 2CIOA 3S3RA 1BQIA 3IOQA 3BOWA 1MIRA 4KLBA 2F1GA 1NB3A 1TLOA 1ICFA 1A6RA 3H7DA 2PNSA 1M6DA 3N4CA 4XUIA 3BCNA 3K24A 2HH5A 1AU2A 2Y6EA 2R9MA 1QOLA 2DCDA 3H6SA 5CVOB 4FJCA 3USVA 1XKGA 1VJVA 1EWMA 4I07A 4K7CA 1AIMA 4PI3A 3BC3A 2FQ9A 1SNKA 2PADA 1GMYA 1STFE 1AU3A 1TL9A 2R9OA 2NQGA 2F7DA 4AXMA 3AI8A 5CVMA 1PPPA 2R9NA 4FIPA 9PAPA 3HHAA 4OELA 2GFOA 2P0RA 3WXEA 2HHNA 4N4ZA 3V6CA 1CPJA 3MORA 1KHQA 1K3BB 3O1GA 2E01A 3OVXA 3BPMA 1X9YA 3U8EA 2BDZA 1TU6A 3OVZA 2P7UA 4YVAA 2R9CA 2GHUA 4X6JA 4DMXA 3MTNA 4MSXA 1ZIVA 2NQDB 4CDFB 1PADA 2G7YA 2FTDA 4PP1A 2R9FA 2Y5BA 1CJLA 3ZUAA 2FYEA 3DF0A 3HD3A 4CDDB 5EF4A 5JA7A 4DMYA 2E03A 3OF8A 2C0YA 3N3KA 2AIMA 3BPFA 2O6XA 4YYVA 1NPZA 4CDCB 5F02A 2BDLA 4QH6A 5CHVA 2AS8A 4YYUA 3KWZA 1PE6A 8PCHA 7PCKA 1NLJA 2FO5A 1VSNA 4BSQA 4ZUXU 2B1NA 2FUDA 1MEGA 1BP4A 2AYNA 3WXGA 3WXFA 2AUZA 4QRGA 1HUCB 4Q8HA 2FRQA 1SP4B 3P5VA 2HXZA 3BWKA 1EWLA 2R6NA 4P6GA 2DCCA 1U9WA 3IEJA 3IV2A
chains in the Genus database with same CATH superfamily
2YJ8A 3S3QA 2OULA 3ERVA 3OQCA 1ME3A 1MS6A 2AVWA 4QBBA 4W5CA 4REZA 3MHHA 2DJGB 1NQCA 3PDFA 2ACTA 4BOSA 2YJCA 1CQDA 3RVVA 1NL6A 4XR7A 1EWOA 4QRVA 1YZBA 4A5UA 2IPPB 3D6SA 3OF9A 1AYVA 2DC8A 3QSDA 4FK5A 1DEUA 4G54A 1Q6KA 1O0EA 4X6IA 1FH0A 2BTWB 3KX1A 1ZCMA 2P86A 2VHSA 3CH3X 3CBKA 5J94A 3H8BA 2E00A 3HWNA 2FRAA 4MZSA 1KFXL 4W5BA 4BS6A 2DCBA 5PADA 3KFQA 1JQPA 5FPWA 3QT4A 3IMAA 4YYRA 4BS5A 3KKUA 2DC9A 1CV8A 2G8JA 3RVXA 3QJ3A 3BY4A 3B79A 1QMYA 3V6EA 2YJ9A 4YYSA 2Z84A 4P6EA 2DZYA 3IUTA 4YYQA 1NB5A 1S4VA 2BU3A 3I3TA 1AYUA 1AU4A 1GECE 3P5XA 3C9EA 1PIPA 4YYWA 4PADA 4YV8A 2XU3A 1Y4HA 1QDQA 4WURA 3P5WA 1PBHA 1KXRA 2G6DA 4OW0A 1GLOA 3C0RA 1MHWA 2FT2A 1Y08A 3IHPA 1U5IA 2H7JA 4QRXA 2CB5A 1AECA 1EWPA 2DZZA 5CVNB 2PBHA 2OZ2A 6PADA 1THEA 5JH3A 2HWKA 4I05A 3CBJA 2ATOA 4GUAA 4CDEB 3I06A 5EGWA 2FE8A 5K16A 1KHPA 1F2AA 3MTVA 3E1ZB 1CB5A 2J7QA 3HHIA 3MHSA 1U9XA 4RF1A 2NQIA 3K9MA 3BBAA 4PP2E 3F5VA 1F2BA 4R3DA 1CSBB 4OVZB 3M99A 4RY2A 1GCBA 3OISA 2ARYA 1AU0A 3PHUA 3TNXA 3KW9A 3KWBX 3LFYA 1MDWA 2IBIA 1PVJA 4HWYA 4BOUA 1YALA 1QXPA 2XU4A 1ME4A 2E02A 1CTEA 2HD5A 2PREA 1DF0A 3H89A 4RNAA 3N3GA 4AXLA 2DOSA 1CVZA 1KFUL 4IUMA 2VHFA 1CS8A 3W30A 2NQAA 4MM3B 4BQVA 4D8IA 2OP3A 4MI7A 1YT7A 3MP2A 2DCAA 4W4UA 2AYOA 4N79A 1YVBA 3NHEA 3K8UA 2B1MA 2AGAA 1UKFA 4XZXA 2DJFB 3B21A 1MEMA 3PBHA 4MZOA 2JQGR 3F75A 2DC7A 4PT5A 4Q8GA 4X6HA 4OVZA 1ATKA 4BOZA 1PPDA 2XU5A 1U9QX 2YJBA 1YK7A 4WA6A 1ITOA 1U9VA 3P5UA 1PCIA 5E6JA 4BOPA 4OEMA 1POPA 3RVWA 2UZJA 1F29A 1F2CA 4I04A 3H8CA 2DC6A 3CH2X 3PRPA 3KSEA 2XU1A 3LXSA 1IWDA 3PHXA 2AUXA 3PW3A 2AU1A 2G8EA 1PPNA 1AYWA 1YK8A 5CHTA 2JQFR 1EF7A 1BGOA 2JRIA 4CZWA 2WBFX 3PNRA 1PPOA 5A24A 1BY8A 3TMPA 2YJ2A 4D8BA 1PXVA 4N8WA 3GCBA 3O0UA 4BPVA 2CIOA 3S3RA 4BOQA 1BQIA 2JTCA 3IOQA 3BOWA 1MIRA 4KLBA 4D8EA 2F1GA 1NB3A 1TLOA 1ICFA 1A6RA 3H7DA 2PNSA 1M6DA 3N4CA 4XUIA 3BCNA 3PHWA 3K24A 2HH5A 4RKXA 1AU2A 2Y6EA 5KO3A 2R9MA 1QOLA 2DCDA 3H6SA 5CVOB 4FJCA 3BB7A 3USVA 1XKGA 3IFUA 1VJVA 1EWMA 4I07A 4K7CA 1AIMA 4PI3A 3BC3A 2FQ9A 1SNKA 2PADA 1GMYA 1STFE 1AU3A 1TL9A 2R9OA 2NQGA 2F7DA 4AXMA 3AI8A 2J7QC 5CVMA 1PPPA 3RNVA 2R9NA 4FIPA 9PAPA 3HHAA 4OELA 2GFOA 2P0RA 3WXEA 2HHNA 3PSEA 4N4ZA 3V6CA 5EZSA 1CPJA 3MORA 1KHQA 1DKIA 1K3BB 4P16A 3O1GA 2E01A 3OVXA 3BPMA 3PRMA 3MJ5A 3ZNHA 1X9YA 3U8EA 2BDZA 1TU6A 4RF0A 3OVZA 2P7UA 4YVAA 2R9CA 2GHUA 4X6JA 4DMXA 3MTNA 4MSXA 1ZIVA 2NQDB 4CDFB 1PADA 2G7YA 2FTDA 4PP1A 2R9FA 2Y5BA 1CJLA 3ZUAA 2FYEA 3DF0A 3HD3A 4CDDB 5EF4A 5JA7A 4DMYA 2E03A 3OF8A 2C0YA 3N3KA 2AIMA 4IP3A 3BPFA 2O6XA 4YYVA 1NPZA 4CDCB 2BTWA 5F02A 4HXDB 2BDLA 4QH6A 5CHVA 2AS8A 5EZQA 4YYUA 3KWZA 5JZEA 1PE6A 8PCHA 3E9SA 3O65A 7PCKA 1NLJA 2FO5A 3W31A 1VSNA 4BSQA 4ZUXU 2B1NA 2FUDA 1MEGA 1BP4A 2AYNA 3WXGA 3WXFA 4M0WA 2AUZA 4ZTBA 4QRGA 1HUCB 4Q8HA 2FRQA 1SP4B 3P5VA 2HXZA 3BWKA 3TRKA 1EWLA 2R6NA 4P6GA 2DCCA 1U9WA 3IEJA 3PT2A 3IV2A
chains in the Genus database with same CATH topology
2YJ8A 3S3QA 2OULA 3ERVA 1ME3A 1MS6A 2AVWA 4QBBA 4W5CA 3MHHA 2DJGB 1NQCA 3PDFA 2ACTA 2YJCA 1CQDA 3RVVA 1NL6A 4XR7A 1EWOA 4QRVA 2IPPB 3D6SA 3OF9A 1AYVA 2DC8A 3QSDA 4FK5A 1DEUA 4G54A 1Q6KA 1O0EA 4X6IA 1FH0A 3KX1A 1ZCMA 2P86A 2VHSA 3CH3X 3CBKA 5J94A 3H8BA 2E00A 3HWNA 2FRAA 4MZSA 1KFXL 4W5BA 1W4TA 4BS6A 2DCBA 5PADA 3KFQA 1E2TA 1JQPA 5FPWA 3QT4A 3IMAA 4YYRA 4BS5A 3KKUA 2DC9A 1CV8A 2G8JA 3RVXA 3QJ3A 3B79A 1QMYA 3V6EA 2YJ9A 4YYSA 4P6EA 2DZYA 3IUTA 4YYQA 1NB5A 1S4VA 3I3TA 1GX3A 1AYUA 1AU4A 1GECE 3P5XA 3C9EA 1PIPA 4YYWA 4PADA 4YV8A 2XU3A 1Y4HA 1QDQA 3P5WA 1PBHA 1KXRA 2G6DA 2BSZA 1GLOA 1MHWA 2FT2A 1Y08A 3IHPA 1U5IA 2H7JA 4QRXA 2VFBA 2CB5A 1AECA 1EWPA 2DZZA 5CVNB 2PBHA 2OZ2A 6PADA 1THEA 5JH3A 4I05A 3CBJA 2ATOA 4CDEB 3I06A 5EGWA 5K16A 1KHPA 1F2AA 4GUZA 3E1ZB 1CB5A 3HHIA 3MHSA 1U9XA 2NQIA 3K9MA 4PP2E 3F5VA 1F2BA 1CSBB 3M99A 4RY2A 1GCBA 3OISA 2ARYA 1AU0A 3TNXA 3KW9A 3KWBX 3LFYA 1MDWA 2IBIA 4HWYA 1YALA 1QXPA 2XU4A 1ME4A 2E02A 1CTEA 2HD5A 2PREA 1DF0A 3H89A 3N3GA 4AXLA 1CVZA 1KFUL 2VHFA 1CS8A 2NQAA 4BQVA 2OP3A 1YT7A 2DCAA 4W4UA 2AYOA 4N79A 1YVBA 3NHEA 3K8UA 2B1MA 1W6FA 2DJFB 1MEMA 3PBHA 4MZOA 2JQGR 3F75A 2DC7A 4Q8GA 4X6HA 1ATKA 1PPDA 2XU5A 1U9QX 2YJBA 1YK7A 4WA6A 1ITOA 1U9VA 3P5UA 1PCIA 4OEMA 1POPA 3RVWA 1F29A 1F2CA 4I04A 3H8CA 2DC6A 3CH2X 3KSEA 2XU1A 3LXSA 1IWDA 2AUXA 3PW3A 2AU1A 2G8EA 1PPNA 1AYWA 1YK8A 5CHTA 2JQFR 1EF7A 1BGOA 4CZWA 2WBFX 3PNRA 1PPOA 5A24A 1BY8A 2YJ2A 1PXVA 4N8WA 3GCBA 3O0UA 4BPVA 2CIOA 3S3RA 1BQIA 4C5PA 3IOQA 3BOWA 1MIRA 4KLBA 2F1GA 1NB3A 2VFCA 1TLOA 1ICFA 1A6RA 3H7DA 2PNSA 1M6DA 3N4CA 4XUIA 3BCNA 3K24A 2HH5A 1AU2A 4B55A 2Y6EA 2R9MA 4NV7A 1QOLA 2DCDA 3H6SA 5CVOB 4FJCA 3USVA 1XKGA 1VJVA 1EWMA 4I07A 4K7CA 1AIMA 4PI3A 3BC3A 2FQ9A 1SNKA 2PADA 1GMYA 1STFE 1AU3A 1TL9A 2R9OA 4BGFA 2NQGA 2F7DA 4AXMA 3AI8A 5CVMA 1PPPA 2R9NA 4FIPA 9PAPA 3HHAA 4OELA 2GFOA 2P0RA 3LTWA 3WXEA 2HHNA 4N4ZA 3V6CA 1CPJA 3MORA 1KHQA 1K3BB 3O1GA 2E01A 3OVXA 3BPMA 1X9YA 3D9WA 3U8EA 2BDZA 1TU6A 3OVZA 2P7UA 4YVAA 2R9CA 2GHUA 4X6JA 4DMXA 3MTNA 4MSXA 1ZIVA 2NQDB 4CDFB 1PADA 2G7YA 2FTDA 4PP1A 2R9FA 2Y5BA 1CJLA 1W5RA 3ZUAA 2FYEA 3DF0A 3HD3A 4CDDB 5EF4A 5JA7A 4DMYA 2E03A 3OF8A 2C0YA 3N3KA 4NV8A 2AIMA 3BPFA 2O6XA 4YYVA 1NPZA 4CDCB 5F02A 2BDLA 4QH6A 5CHVA 2AS8A 4YYUA 3KWZA 1PE6A 8PCHA 7PCKA 1NLJA 2FO5A 1VSNA 4BSQA 4ZUXU 2B1NA 2FUDA 1MEGA 1BP4A 2AYNA 3WXGA 3WXFA 2AUZA 4QRGA 1HUCB 4Q8HA 2FRQA 1SP4B 3P5VA 2HXZA 3BWKA 1EWLA 2R6NA 4P6GA 2DCCA 1U9WA 3IEJA 3IV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ8 A;  3S3Q A;  2OUL A;  3ERV A;  1ME3 A;  1MS6 A;  4QBB A;  2AVW A;  4W5C A;  3MHH A;  2DJG B;  1NQC A;  3PDF A;  2ACT A;  2YJC A;  1CQD A;  3RVV A;  1NL6 A;  4XR7 A;  1EWO A;  4QRV A;  2IPP B;  3D6S A;  3OF9 A;  1AYV A;  2DC8 A;  3QSD A;  4FK5 A;  1DEU A;  4G54 A;  1Q6K A;  1O0E A;  4X6I A;  1FH0 A;  3KX1 A;  1ZCM A;  2P86 A;  2VHS A;  3CH3 X;  3CBK A;  5J94 A;  3H8B A;  2E00 A;  3HWN A;  2FRA A;  4MZS A;  1KFX L;  4W5B A;  4BS6 A;  2DCB A;  5PAD A;  3KFQ A;  1JQP A;  5FPW A;  3QT4 A;  3IMA A;  4YYR A;  4BS5 A;  3KKU A;  2DC9 A;  1CV8 A;  2G8J A;  3RVX A;  3QJ3 A;  3B79 A;  1QMY A;  3V6E A;  2YJ9 A;  4YYS A;  4P6E A;  2DZY A;  3IUT A;  4YYQ A;  1NB5 A;  1S4V A;  3I3T A;  1AYU A;  1AU4 A;  1GEC E;  3P5X A;  3C9E A;  1PIP A;  4YYW A;  4PAD A;  4YV8 A;  2XU3 A;  1Y4H A;  1QDQ A;  3P5W A;  1PBH A;  1KXR A;  2G6D A;  1GLO A;  1MHW A;  2FT2 A;  1Y08 A;  3IHP A;  1U5I A;  2H7J A;  4QRX A;  2CB5 A;  1AEC A;  1EWP A;  2DZZ A;  5CVN B;  2PBH A;  2OZ2 A;  6PAD A;  1THE A;  5JH3 A;  4I05 A;  3CBJ A;  2ATO A;  4CDE B;  3I06 A;  5EGW A;  5K16 A;  1KHP A;  1F2A A;  3E1Z B;  1CB5 A;  3HHI A;  3MHS A;  1U9X A;  2NQI A;  3K9M A;  4PP2 E;  3F5V A;  1F2B A;  1CSB B;  3M99 A;  4RY2 A;  1GCB A;  3OIS A;  2ARY A;  1AU0 A;  3TNX A;  3KW9 A;  3KWB X;  3LFY A;  1MDW A;  2IBI A;  4HWY A;  1YAL A;  1QXP A;  2XU4 A;  1ME4 A;  2E02 A;  1CTE A;  2HD5 A;  2PRE A;  1DF0 A;  3H89 A;  3N3G A;  4AXL A;  1CVZ A;  1KFU L;  2VHF A;  1CS8 A;  2NQA A;  4BQV A;  2OP3 A;  1YT7 A;  2DCA A;  4W4U A;  2AYO A;  4N79 A;  1YVB A;  3NHE A;  3K8U A;  2B1M A;  2DJF B;  1MEM A;  3PBH A;  4MZO A;  2JQG R;  3F75 A;  2DC7 A;  4Q8G A;  4X6H A;  1ATK A;  1PPD A;  2XU5 A;  1U9Q X;  2YJB A;  1YK7 A;  4WA6 A;  1ITO A;  1U9V A;  3P5U A;  1PCI A;  4OEM A;  1POP A;  3RVW A;  1F29 A;  1F2C A;  4I04 A;  3H8C A;  2DC6 A;  3CH2 X;  3KSE A;  2XU1 A;  3LXS A;  1IWD A;  2AUX A;  3PW3 A;  2AU1 A;  2G8E A;  1PPN A;  1AYW A;  1YK8 A;  5CHT A;  2JQF R;  1EF7 A;  1BGO A;  4CZW A;  2WBF X;  3PNR A;  1PPO A;  5A24 A;  1BY8 A;  2YJ2 A;  1PXV A;  4N8W A;  3GCB A;  3O0U A;  4BPV A;  2CIO A;  3S3R A;  1BQI A;  3IOQ A;  3BOW A;  1MIR A;  4KLB A;  2F1G A;  1NB3 A;  1TLO A;  1ICF A;  1A6R A;  3H7D A;  2PNS A;  1M6D A;  3N4C A;  4XUI A;  3BCN A;  3K24 A;  2HH5 A;  1AU2 A;  2Y6E A;  2R9M A;  1QOL A;  2DCD A;  3H6S A;  5CVO B;  4FJC A;  3USV A;  1XKG A;  1VJV A;  1EWM A;  4I07 A;  4K7C A;  1AIM A;  4PI3 A;  3BC3 A;  2FQ9 A;  1SNK A;  2PAD A;  1GMY A;  1STF E;  1AU3 A;  1TL9 A;  2R9O A;  2NQG A;  2F7D A;  4AXM A;  3AI8 A;  5CVM A;  1PPP A;  2R9N A;  4FIP A;  9PAP A;  3HHA A;  4OEL A;  2GFO A;  2P0R A;  3WXE A;  2HHN A;  4N4Z A;  3V6C A;  1CPJ A;  3MOR A;  1KHQ A;  1K3B B;  3O1G A;  2E01 A;  3OVX A;  3BPM A;  1X9Y A;  3U8E A;  2BDZ A;  1TU6 A;  3OVZ A;  2P7U A;  4YVA A;  2R9C A;  2GHU A;  4X6J A;  4DMX A;  3MTN A;  4MSX A;  1ZIV A;  2NQD B;  4CDF B;  1PAD A;  2G7Y A;  2FTD A;  4PP1 A;  2R9F A;  2Y5B A;  1CJL A;  3ZUA A;  2FYE A;  3DF0 A;  3HD3 A;  4CDD B;  5EF4 A;  5JA7 A;  4DMY A;  2E03 A;  3OF8 A;  2C0Y A;  3N3K A;  2AIM A;  3BPF A;  2O6X A;  4YYV A;  1NPZ A;  4CDC B;  5F02 A;  2BDL A;  4QH6 A;  5CHV A;  2AS8 A;  4YYU A;  3KWZ A;  1PE6 A;  8PCH A;  7PCK A;  1NLJ A;  2FO5 A;  1VSN A;  4BSQ A;  4ZUX U;  2B1N A;  2FUD A;  1MEG A;  1BP4 A;  2AYN A;  3WXG A;  3WXF A;  2AUZ A;  4QRG A;  1HUC B;  4Q8H A;  2FRQ A;  1SP4 B;  3P5V A;  2HXZ A;  3BWK A;  1EWL A;  2R6N A;  4P6G A;  2DCC A;  1U9W A;  3IEJ A;  3IV2 A; 
#chains in the Genus database with same CATH topology
 2YJ8 A;  3S3Q A;  2OUL A;  3ERV A;  3OQC A;  1ME3 A;  1MS6 A;  2AVW A;  4QBB A;  4W5C A;  4REZ A;  3MHH A;  2DJG B;  1NQC A;  3PDF A;  2ACT A;  4BOS A;  2YJC A;  1CQD A;  3RVV A;  1NL6 A;  4XR7 A;  1EWO A;  4QRV A;  1YZB A;  4A5U A;  2IPP B;  3D6S A;  3OF9 A;  1AYV A;  2DC8 A;  3QSD A;  4FK5 A;  1DEU A;  4G54 A;  1Q6K A;  1O0E A;  4X6I A;  1FH0 A;  2BTW B;  3KX1 A;  1ZCM A;  2P86 A;  2VHS A;  3CH3 X;  3CBK A;  5J94 A;  3H8B A;  2E00 A;  3HWN A;  2FRA A;  4MZS A;  1KFX L;  4W5B A;  4BS6 A;  2DCB A;  5PAD A;  3KFQ A;  1JQP A;  5FPW A;  3QT4 A;  3IMA A;  4YYR A;  4BS5 A;  3KKU A;  2DC9 A;  1CV8 A;  2G8J A;  3RVX A;  3QJ3 A;  3BY4 A;  3B79 A;  1QMY A;  3V6E A;  2YJ9 A;  4YYS A;  2Z84 A;  4P6E A;  2DZY A;  3IUT A;  4YYQ A;  1NB5 A;  1S4V A;  2BU3 A;  3I3T A;  1AYU A;  1AU4 A;  1GEC E;  3P5X A;  3C9E A;  1PIP A;  4YYW A;  4PAD A;  4YV8 A;  2XU3 A;  1Y4H A;  1QDQ A;  4WUR A;  3P5W A;  1PBH A;  1KXR A;  2G6D A;  4OW0 A;  1GLO A;  3C0R A;  1MHW A;  2FT2 A;  1Y08 A;  3IHP A;  1U5I A;  2H7J A;  4QRX A;  2CB5 A;  1AEC A;  1EWP A;  2DZZ A;  5CVN B;  2PBH A;  2OZ2 A;  6PAD A;  1THE A;  5JH3 A;  2HWK A;  4I05 A;  3CBJ A;  2ATO A;  4GUA A;  4CDE B;  3I06 A;  5EGW A;  2FE8 A;  5K16 A;  1KHP A;  1F2A A;  3MTV A;  3E1Z B;  1CB5 A;  2J7Q A;  3HHI A;  3MHS A;  1U9X A;  4RF1 A;  2NQI A;  3K9M A;  3BBA A;  4PP2 E;  3F5V A;  1F2B A;  4R3D A;  1CSB B;  4OVZ B;  3M99 A;  4RY2 A;  1GCB A;  3OIS A;  2ARY A;  1AU0 A;  3PHU A;  3TNX A;  3KW9 A;  3KWB X;  3LFY A;  1MDW A;  2IBI A;  1PVJ A;  4HWY A;  4BOU A;  1YAL A;  1QXP A;  2XU4 A;  1ME4 A;  2E02 A;  1CTE A;  2HD5 A;  2PRE A;  1DF0 A;  3H89 A;  4RNA A;  3N3G A;  4AXL A;  2DOS A;  1CVZ A;  1KFU L;  4IUM A;  2VHF A;  1CS8 A;  3W30 A;  2NQA A;  4MM3 B;  4BQV A;  4D8I A;  2OP3 A;  4MI7 A;  1YT7 A;  3MP2 A;  2DCA A;  4W4U A;  2AYO A;  4N79 A;  1YVB A;  3NHE A;  3K8U A;  2B1M A;  2AGA A;  1UKF A;  4XZX A;  2DJF B;  3B21 A;  1MEM A;  3PBH A;  4MZO A;  2JQG R;  3F75 A;  2DC7 A;  4PT5 A;  4Q8G A;  4X6H A;  4OVZ A;  1ATK A;  4BOZ A;  1PPD A;  2XU5 A;  1U9Q X;  2YJB A;  1YK7 A;  4WA6 A;  1ITO A;  1U9V A;  3P5U A;  1PCI A;  5E6J A;  4BOP A;  4OEM A;  1POP A;  3RVW A;  2UZJ A;  1F29 A;  1F2C A;  4I04 A;  3H8C A;  2DC6 A;  3CH2 X;  3PRP A;  3KSE A;  2XU1 A;  3LXS A;  1IWD A;  3PHX A;  2AUX A;  3PW3 A;  2AU1 A;  2G8E A;  1PPN A;  1AYW A;  1YK8 A;  5CHT A;  2JQF R;  1EF7 A;  1BGO A;  2JRI A;  4CZW A;  2WBF X;  3PNR A;  1PPO A;  5A24 A;  1BY8 A;  3TMP A;  2YJ2 A;  4D8B A;  1PXV A;  4N8W A;  3GCB A;  3O0U A;  4BPV A;  2CIO A;  3S3R A;  4BOQ A;  1BQI A;  2JTC A;  3IOQ A;  3BOW A;  1MIR A;  4KLB A;  4D8E A;  2F1G A;  1NB3 A;  1TLO A;  1ICF A;  1A6R A;  3H7D A;  2PNS A;  1M6D A;  3N4C A;  4XUI A;  3BCN A;  3PHW A;  3K24 A;  2HH5 A;  4RKX A;  1AU2 A;  2Y6E A;  5KO3 A;  2R9M A;  1QOL A;  2DCD A;  3H6S A;  5CVO B;  4FJC A;  3BB7 A;  3USV A;  1XKG A;  3IFU A;  1VJV A;  1EWM A;  4I07 A;  4K7C A;  1AIM A;  4PI3 A;  3BC3 A;  2FQ9 A;  1SNK A;  2PAD A;  1GMY A;  1STF E;  1AU3 A;  1TL9 A;  2R9O A;  2NQG A;  2F7D A;  4AXM A;  3AI8 A;  2J7Q C;  5CVM A;  1PPP A;  3RNV A;  2R9N A;  4FIP A;  9PAP A;  3HHA A;  4OEL A;  2GFO A;  2P0R A;  3WXE A;  2HHN A;  3PSE A;  4N4Z A;  3V6C A;  5EZS A;  1CPJ A;  3MOR A;  1KHQ A;  1DKI A;  1K3B B;  4P16 A;  3O1G A;  2E01 A;  3OVX A;  3BPM A;  3PRM A;  3MJ5 A;  3ZNH A;  1X9Y A;  3U8E A;  2BDZ A;  1TU6 A;  4RF0 A;  3OVZ A;  2P7U A;  4YVA A;  2R9C A;  2GHU A;  4X6J A;  4DMX A;  3MTN A;  4MSX A;  1ZIV A;  2NQD B;  4CDF B;  1PAD A;  2G7Y A;  2FTD A;  4PP1 A;  2R9F A;  2Y5B A;  1CJL A;  3ZUA A;  2FYE A;  3DF0 A;  3HD3 A;  4CDD B;  5EF4 A;  5JA7 A;  4DMY A;  2E03 A;  3OF8 A;  2C0Y A;  3N3K A;  2AIM A;  4IP3 A;  3BPF A;  2O6X A;  4YYV A;  1NPZ A;  4CDC B;  2BTW A;  5F02 A;  4HXD B;  2BDL A;  4QH6 A;  5CHV A;  2AS8 A;  5EZQ A;  4YYU A;  3KWZ A;  5JZE A;  1PE6 A;  8PCH A;  3E9S A;  3O65 A;  7PCK A;  1NLJ A;  2FO5 A;  3W31 A;  1VSN A;  4BSQ A;  4ZUX U;  2B1N A;  2FUD A;  1MEG A;  1BP4 A;  2AYN A;  3WXG A;  3WXF A;  4M0W A;  2AUZ A;  4ZTB A;  4QRG A;  1HUC B;  4Q8H A;  2FRQ A;  1SP4 B;  3P5V A;  2HXZ A;  3BWK A;  3TRK A;  1EWL A;  2R6N A;  4P6G A;  2DCC A;  1U9W A;  3IEJ A;  3PT2 A;  3IV2 A; 
#chains in the Genus database with same CATH homology
 2YJ8 A;  3S3Q A;  2OUL A;  3ERV A;  1ME3 A;  1MS6 A;  2AVW A;  4QBB A;  4W5C A;  3MHH A;  2DJG B;  1NQC A;  3PDF A;  2ACT A;  2YJC A;  1CQD A;  3RVV A;  1NL6 A;  4XR7 A;  1EWO A;  4QRV A;  2IPP B;  3D6S A;  3OF9 A;  1AYV A;  2DC8 A;  3QSD A;  4FK5 A;  1DEU A;  4G54 A;  1Q6K A;  1O0E A;  4X6I A;  1FH0 A;  3KX1 A;  1ZCM A;  2P86 A;  2VHS A;  3CH3 X;  3CBK A;  5J94 A;  3H8B A;  2E00 A;  3HWN A;  2FRA A;  4MZS A;  1KFX L;  4W5B A;  1W4T A;  4BS6 A;  2DCB A;  5PAD A;  3KFQ A;  1E2T A;  1JQP A;  5FPW A;  3QT4 A;  3IMA A;  4YYR A;  4BS5 A;  3KKU A;  2DC9 A;  1CV8 A;  2G8J A;  3RVX A;  3QJ3 A;  3B79 A;  1QMY A;  3V6E A;  2YJ9 A;  4YYS A;  4P6E A;  2DZY A;  3IUT A;  4YYQ A;  1NB5 A;  1S4V A;  3I3T A;  1GX3 A;  1AYU A;  1AU4 A;  1GEC E;  3P5X A;  3C9E A;  1PIP A;  4YYW A;  4PAD A;  4YV8 A;  2XU3 A;  1Y4H A;  1QDQ A;  3P5W A;  1PBH A;  1KXR A;  2G6D A;  2BSZ A;  1GLO A;  1MHW A;  2FT2 A;  1Y08 A;  3IHP A;  1U5I A;  2H7J A;  4QRX A;  2VFB A;  2CB5 A;  1AEC A;  1EWP A;  2DZZ A;  5CVN B;  2PBH A;  2OZ2 A;  6PAD A;  1THE A;  5JH3 A;  4I05 A;  3CBJ A;  2ATO A;  4CDE B;  3I06 A;  5EGW A;  5K16 A;  1KHP A;  1F2A A;  4GUZ A;  3E1Z B;  1CB5 A;  3HHI A;  3MHS A;  1U9X A;  2NQI A;  3K9M A;  4PP2 E;  3F5V A;  1F2B A;  1CSB B;  3M99 A;  4RY2 A;  1GCB A;  3OIS A;  2ARY A;  1AU0 A;  3TNX A;  3KW9 A;  3KWB X;  3LFY A;  1MDW A;  2IBI A;  4HWY A;  1YAL A;  1QXP A;  2XU4 A;  1ME4 A;  2E02 A;  1CTE A;  2HD5 A;  2PRE A;  1DF0 A;  3H89 A;  3N3G A;  4AXL A;  1CVZ A;  1KFU L;  2VHF A;  1CS8 A;  2NQA A;  4BQV A;  2OP3 A;  1YT7 A;  2DCA A;  4W4U A;  2AYO A;  4N79 A;  1YVB A;  3NHE A;  3K8U A;  2B1M A;  1W6F A;  2DJF B;  1MEM A;  3PBH A;  4MZO A;  2JQG R;  3F75 A;  2DC7 A;  4Q8G A;  4X6H A;  1ATK A;  1PPD A;  2XU5 A;  1U9Q X;  2YJB A;  1YK7 A;  4WA6 A;  1ITO A;  1U9V A;  3P5U A;  1PCI A;  4OEM A;  1POP A;  3RVW A;  1F29 A;  1F2C A;  4I04 A;  3H8C A;  2DC6 A;  3CH2 X;  3KSE A;  2XU1 A;  3LXS A;  1IWD A;  2AUX A;  3PW3 A;  2AU1 A;  2G8E A;  1PPN A;  1AYW A;  1YK8 A;  5CHT A;  2JQF R;  1EF7 A;  1BGO A;  4CZW A;  2WBF X;  3PNR A;  1PPO A;  5A24 A;  1BY8 A;  2YJ2 A;  1PXV A;  4N8W A;  3GCB A;  3O0U A;  4BPV A;  2CIO A;  3S3R A;  1BQI A;  4C5P A;  3IOQ A;  3BOW A;  1MIR A;  4KLB A;  2F1G A;  1NB3 A;  2VFC A;  1TLO A;  1ICF A;  1A6R A;  3H7D A;  2PNS A;  1M6D A;  3N4C A;  4XUI A;  3BCN A;  3K24 A;  2HH5 A;  1AU2 A;  4B55 A;  2Y6E A;  2R9M A;  4NV7 A;  1QOL A;  2DCD A;  3H6S A;  5CVO B;  4FJC A;  3USV A;  1XKG A;  1VJV A;  1EWM A;  4I07 A;  4K7C A;  1AIM A;  4PI3 A;  3BC3 A;  2FQ9 A;  1SNK A;  2PAD A;  1GMY A;  1STF E;  1AU3 A;  1TL9 A;  2R9O A;  4BGF A;  2NQG A;  2F7D A;  4AXM A;  3AI8 A;  5CVM A;  1PPP A;  2R9N A;  4FIP A;  9PAP A;  3HHA A;  4OEL A;  2GFO A;  2P0R A;  3LTW A;  3WXE A;  2HHN A;  4N4Z A;  3V6C A;  1CPJ A;  3MOR A;  1KHQ A;  1K3B B;  3O1G A;  2E01 A;  3OVX A;  3BPM A;  1X9Y A;  3D9W A;  3U8E A;  2BDZ A;  1TU6 A;  3OVZ A;  2P7U A;  4YVA A;  2R9C A;  2GHU A;  4X6J A;  4DMX A;  3MTN A;  4MSX A;  1ZIV A;  2NQD B;  4CDF B;  1PAD A;  2G7Y A;  2FTD A;  4PP1 A;  2R9F A;  2Y5B A;  1CJL A;  1W5R A;  3ZUA A;  2FYE A;  3DF0 A;  3HD3 A;  4CDD B;  5EF4 A;  5JA7 A;  4DMY A;  2E03 A;  3OF8 A;  2C0Y A;  3N3K A;  4NV8 A;  2AIM A;  3BPF A;  2O6X A;  4YYV A;  1NPZ A;  4CDC B;  5F02 A;  2BDL A;  4QH6 A;  5CHV A;  2AS8 A;  4YYU A;  3KWZ A;  1PE6 A;  8PCH A;  7PCK A;  1NLJ A;  2FO5 A;  1VSN A;  4BSQ A;  4ZUX U;  2B1N A;  2FUD A;  1MEG A;  1BP4 A;  2AYN A;  3WXG A;  3WXF A;  2AUZ A;  4QRG A;  1HUC B;  4Q8H A;  2FRQ A;  1SP4 B;  3P5V A;  2HXZ A;  3BWK A;  1EWL A;  2R6N A;  4P6G A;  2DCC A;  1U9W A;  3IEJ A;  3IV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...