4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
molecule keywords Papain-like protease
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
4OW0A 4RF1A 3MJ5A 4RF0A 3E9SA 4P16A 4OVZB 4R3DA 4REZA 3MP2A 5KO3A 4M0WA 4OVZA 4RNAA 5E6JA 4WURA 4PT5A 4MM3B 2FE8A
chains in the Genus database with same CATH superfamily
4I05A 2N9XA 1FNWA 1EWCA 1QILA 1UD7A 2AL6A 2LZ6A 2XEPA 4QH6A 2FCMA 4NSOB 2IY0B 2EKFA 3T9LA 1PPNA 2XSZA 4YTMB 3ZYYX 3WHLA 3ZUNA 4XZXA 5GKNA 2EMSA 4GRIA 1A70A 2H89B 1SGHA 1GB4A 2M0XA 1Q02A 3J81S 4I81A 4IBFA 4X6JA 3Q3FA 1MI0A 5AZHA 1R7RA 4D8IA 3VKGA 4B3TM 1OGWA 1WI0A 2DKLA 3L29A 2IBIA 5KO3A 2AGAA 1N78A 5D3IB 4YYRA 2JY8A 1NI2A 2I1JA 3CH2X 4QOZC 3AE5B 1D2NA 1BVSA 2K1FA 4MB7A 1QOLA 1TDZA 3PTFC 1JMLA 4S0RA 5CVMA 3RNCC 2PPHA 2CP8A 1BQIA 5JZEB 3OISA 1LQBA 3MP9A 2XK5B 3UQAA 3C9EA 1SF0A 2LVNC 1Q5WB 4G6ZA 4FULA 2WX0A 1C3TA 1FEHA 5E26A 4OU7A 2QCUA 1NDDA 3W1SA 3WXGA 1KF6B 1MFWA 2IPPB 3N3GA 2AQ3B 1VD2A 1YK7A 1OEYJ 2W9NA 4BFRA 3ZH9B 4ZRPA 4JWSC 4HDQA 4FWDA 1E8YA 2BWFA 2RDHA 4C56C 1C4AA 2ON8A 2IJ0A 2C5RA 1KFYB 3AXCA 4PYZA 3N3KA 3GRUA 1ENFA 2NVUI 3HIZA 1RFKA 2LVQA 2MEKA 4FVMA 2P86A 3KW6A 4DMXA 2DAGA 2KNZA 4NRVA 2M1MA 4GEWA 2FBWB 1TGUA 2KNAA 1EF5A 3GPPA 3GLHB 2R2QA 2QHOB 2NS5A 3U7ZA 1Z5CA 3LCUA 4Z6YA 1J5EM 4G4QA 1V34A 3PDFA 3ZNHB 1YOVB 4LJ6A 1HQCA 3U8EA 3VFKA 1QLBB 4MZSA 3T15A 1BGOA 3QYEA 2HJ8A 2VH2A 1Q6KA 5ITQA 4HLQA 1UUPA 4XK8F 2FS1A 2MW5A 4ANXA 2AHMA 3AOGA 1N62A 3WAPA 1MDWA 4J3OD 2NPTA 2PW9A 4W9FA 4P16A 3T3OA 4X6IA 4NNJB 3PFIA 2G7YA 4TMAB 2KHHA 2BS2B 4XBOA 2FNJB 3ZIMA 4DBGB 2XLJA 2DX5B 3OLMD 1WGLA 4WJNA 1TY0A 2KTRB 3DQVA 2IDYA 2OULA 2MJ3A 4BKSA 3TL4X 4GHLA 2Y6EA 1C77A 3WIMA 2UXDM 3C19A 3H89A 4W9IA 4ZDVA 2FOIC 2FRAA 3K9PB 4GB9A 2RPQA 3RN9C 3PSEA 3HHAA 2CHQA 4WH4A 4YYWA 1Q0WB 2RRUA 2YR0A 2KQ7A 4LJPB 1U9QX 1A5RA 2ZEQA 1ZQ9A 3O1GA 3IHPC 5ITYA 4RGMA 2PVOD 4DUYM 1KRHA 2QENA 2WHIA 1BXTA 1KYIA 2G1EA 3R2TA 4LNOA 3VUXA 1VJKA 4YY3M 4N8WA 1JW9D 5J18A 1L0YB 1T0QC 3RFZB 3E1ZB 1YJJA 2DYMA 3LVWA 5D7GA 2XU1A 3PVSA 1HNXM 2DJFB 1I4PA 3UF8A 3VVWB 2VZKD 3F92A 2DENB 3L4PA 3UIOB 2ZAOA 2R9OA 3U61B 2G4DB 2EKIA 2K6QA 2NBVB 3FUTA 1L4DB 3O0UA 1T0YA 4BS6A 3B0AA 4BB9A 4GSWA 3V76A 3S3RA 5EXPA 4MGHA 1N60A 1AUAA 2K0PA 2DZLA 3MJ5A 2KDMA 2OHFA 4GU2A 1F4IA 2KC2A 1OQYA 2M0AA 3TCAA 3RT3B 3APDA 4QRXA 3HJQA 4QNRA 5DYGA 1EE8A 2VRRB 2WXLA 2YJ9A 3K8UA 3DF0A 4LF9M 4LFAM 3OJ4B 2GLSA 4IKGA 5FTNA 1QAMA 2ACTA 5G2NA 5C2TB 5G5GA 2L83A 3MHSA 4KX6B 3PS6A 5JXVA 1GLOA 4PADA 4US9A 2R62A 4MGIE 4MT5A 1T6OA 2BB5A 2W55A 4D80A 1PGBA 3UZUA 2LVPC 3LW5F 3QARA 4NZLB 1GPXA 4YYSA 2FUG1 2PKOA 4JI2M 1ZP0B 4AI6A 4WP2A 2J7QB 4W5CA 3J7AS 1SE2A 2JNHA 2XF3A 3V3XA 3SHQA 3PZ7A 1PADA 4DV7M 4AQ7A 5E6JA 2M56B 1BUIC 2O6VD 3C8YA 2JA2A 1F0ZA 3GZNB 2RKOA 3TEXA 3KLSX 3M6AA 2YNMD 2FAZA 3T1HM 1V9JA 1C1KA 1PJIA 2XH9A 4BS5A 1ZMWA 2R45A 5C3JB 3J80S 4S17A 3DVNV 1QQWA 4EIWA 1XCQL 3RGPA 1Z5AA 1KFVA 1PDXA 1QDRA 1SB3C 1IP9A 1MVKA 5ITRA 2DCCA 4PI3A 1XMOM 1R4MI 1ZMUA 1IXSB 4ZTBA 4FD2A 3K9PA 3IEJA 2LGXA 4LF8M 3T6PA 1WXSA 4WWNA 5IO9A 3SATA 4LY6A 1AARA 2HE7A 2MJ5B 2BPSA 4C7ZA 1EWOA 2DZZA 5L83A 1QMYA 1IBXA 2Y21A 2CHXA 2K0BX 4LRTA 3SFDB 1T3TA 1KLGD 4NXMM 4GIVA 4LF6M 2DWNA 3KUZA 2IGHA 4LLGM 1F1HA 4IBJA 4WWPA 1SJHD 1F52A 1Z6TA 2D7EA 3NBIA 3TMPA 1V86A 2I1KA 4PT5A 3L08A 2ZJDA 3OG5A 4HEOA 2HTME 3E9SA 2JVCA 3GOEA 4EZLA 2YVCA 2QBYA 3BK2A 3FKYA 1GC6A 2GFOA 4GHAA 3NOBA 2R4JA 3PHWB 2M8SA 2INPE 2KD0A 2BKRB 4JI6M 4IWQA 3BY4A 2CV1A 4BSQA 2QQ8A 1LO5D 2XNAC 4FK5A 1TH2A 2CJNA 1NLJA 2JWSA 2K8HA 3Q8BA 2IGDA 1F2RI 3PHUA 2JZPA 1AU4A 1SG9A 2DLBA 2IO2B 3CWIA 1PGYA 4ANUA 3KWBX 2EA0A 3VXWA 3BZDB 1OJLA 4DBGA 4L78A 3RNVA 3FKEA 1OTRA 1GG3A 5DCNA 3DVNU 2LGIA 4DMYA 2WXNA 4JX1C 4G0NB 1YX5B 2R6NA 2MQJA 1C1YB 3A9JA 4BOSC 1QOFA 1TTEA 5FLXS 3U60B 2ZVNA 6PADA 2XGNA 1FCCC 4KIKB 1IWDA 1W5SA 5DYIA 1FNNA 4K3BA 1QOBA 3DWGC 4PK1A 5E6PA 1IBLM 2V4LA 4LJ9A 4X6HA 1T43A 1R6BX 3AH7A 3EGRA 1FIQA 3OF8A 1K8RB 4C80A 1KTKA 2Y5BA 2RSUA 2DAIA 2DHRA 2X4AA 4Q2JA 1ZDXA 2KA6B 3UIPB 5GMVA 4BOQA 1R4NI 2DHYA 2CHVA 1NB3A 1NENB 2L76A 2VQFM 4B3RM 4K0KM 4DHZE 5EQTA 2Z3XA 4KGSA 2KMMA 3NZSA 2XSZD 1VEGA 4PYUA 4JI7M 1WR1A 1KOTA 4WJQA 3ILKA 2DCDA 3NHEA 2L52A 2AQ2B 2INCC 4USAA 4P1BC 4HJKA 3L10B 3PREA 3HVDA 3A42A 4IBKA 1MS6A 3H6SA 2VF7A 4MSXA 3VK7A 4AJWA 2CEAA 3IG8A 3ZNZB 1WIAA 3OF9A 2PVGC 2JQRB 3K24A 4GDLB 1WX7A 4K1RB 1PYWD 3KH0A 1NJGA 4ITKA 3W67A 7PCKA 2Z7JA 3NZUA 1NNUC 4I5SA 4LJ4A 4C4VB 3RE8A 1FXIA 1IN4A 2KVZA 3ETRA 3IXSA 4NPNA 2BTWB 1M6DA 3FYCA 2B1NA 3KVWA 2W54A 4GDKB 1FFUA 4M9SA 3H7PA 3RVXA 4MM3A 1F9JA 1DOYA 4JV5M 2KX0A 2V9HA 3IG3A 3VDPA 2KFKB 1TS2A 1PGAA 5A24A 4BZAA 1G4AE 4LDTD 2VIIA 3IMAA 1L6VA 4OHJA 2XEWA 2BS4B 2LD9A 3GCBA 2LRWA 1PBHA 2B1MA 4FCTA 3GQ5A 1EM7A 1GECE 2NBWB 1YQBA 2L09A 3ZLZA 2XZFA 3P5VA 3M0EA 1IY2A 4JI8M 3B74A 4HDOA 3AEEB 3DBHB 5D94A 4YHHM 1WJ4A 3HX3A 1MG4A 3A4SC 3EECA 2NQAA 1XLOA 3PV1A 1V33A 4HVBA 3MTVA 4JQWC 2K25A 4F8CB 3R7QA 2V1CA 4IWOA 2KDLA 2DWMA 2KC1A 5DPSA 3BVGA 2UUAM 5EP3A 1V2YA 3AEAB 3H1UA 4M01A 1F2BA 1XHBA 2GMIC 3KWVA 1QVRA 3J2PB 2H7JA 3BBAA 1I4RA 4O1NA 5AZGA 3T8MA 1HNZM 2N1VA 1XT9B 5G5HA 2C0YA 3Q2AC 3WA0A 1N32M 1J7AA 4B08A 3GE3C 1J0GA 4YSXB 3I63C 4IW0A 3HD3A 1WYGA 3DBLB 2YFQA 2ZANA 5CHFA 1JWBD 2V3SA 5BMHA 2QNJA 4AZFA 4WJPA 4GOCA 1XC8A 3ZUAA 4M00A 3HJ8A 1THEA 4G3OA 3U8ZA 3APFA 2WYQA 1D0KA 3FTEA 1AN8A 1V49A 1IBXB 1QYRA 3TIXA 2QILA 2W82A 2I2YA 3NRZA 1J19A 4C00A 1QUTA 2L8JA 3H9DA 4QRVA 1DGFA 4ZHOA 1Z2MA 2EO2A 3GP7A 2AUZA 2C7MB 1IN8A 1QDTA 4WURA 1KFUL 2HWJA 3QK0A 4QBBA 3HU2A 3H6NA 2VDBB 3W31A 1TJEA 4ICUA 4ITQA 2I7PA 1WZ0A 4DHJD 2BYTA 1SE4A 2G5GX 3CIRB 5ITXE 1F2RC 3KVFB 2WXIA 4IM3A 4M9XA 4GN1A 2D11A 3LCVB 4KV2A 2PREA 1S3SA 4X62M 3LYYA 4GKKM 1K51A 3D6SA 2J0JA 1UM8A 3QAUA 3SMSA 3KKUA 3CGWA 3KOXE 1V5OA 4ARIA 4G50A 1IQPA 3KXEC 1JR3A 1RRBA 2Z0DB 3L13A 4W9KA 2ERCA 4HXDB 2GBJA 1MJDA 1C79A 2CV2A 3U6MA 4I04A 3R2IA 4BOZA 3PLUA 3SFEB 2ZTCA 5CHVA 1H6UA 5BYSA 5E6NA 4AOFA 1E8XA 2K8BA 4EZJA 4ZHPA 5H37D 1WMHB 4JPSA 2MHJA 1QDQA 4L4UA 3HU3A 2FNAA 1HQRD 3PHWA 3GS2A 1PIPA 3E56A 2DAEA 2F5OA 1EWYC 3MC8A 1I42A 3BYTB 1SIJA 4BVUC 4DR1M 3A1QA 3J27B 4RCOA 1XXGA 2ZVOA 3IVFA 3X0WA 5KPTA 3B08A 5EZSA 1OIZA 4DV3M 2AUXA 2KLCA 1XLPA 1ZMVA 3SU8X 2YJBA 1KHPA 1YZBA 2R18A 2LWPA 2WXFA 4I6PA 1IGDA 1TGZB 1JQJC 3B21A 2PIAA 2JF5A 1TTNA 3IT4B 4OVZA 5L8RF 3OWEB 2L05A 2OQ4A 2L0FA 4XYCA 3WCQA 1V1PA 4KGRA 3U5ZA 3R66C 3ZVVA 2J7NA 2JZ1A 5DNYA 3ZC7B 3PXGA 3SFZA 1N77A 1I35A 2WXOA 4OW0A 1UH6A 5CHTA 4WQMA 3H4MA 4CJ6A 2M17A 4DR3M 3H7PB 4JL9A 4ANRA 3EHVA 2PBHA 2YEPB 4CDCB 2ZCCA 1C7YA 5LMUM 4GMVA 1AW7A 3OVZA 1TZOA 1F77A 3U6PA 2LWXA 2CHZA 4CIZA 4XE0A 1TDHA 1BY8A 4PP1A 4F1SA 1NVMA 4PD2A 4JXJA 2HJ1A 3GLFE 1L2BA 2WDQB 3LXSA 4NSRA 4X64M 4DV2M 2IPKD 4TQ1A 1S4VA 3U30A 3ZNHA 4DHZB 3KW9A 3UGJA 1K82A 2QP9X 2ZNVC 5D6JB 4AXLA 1PCIA 3RNAC 3JR4A 4OVZB 4A9AA 1N5XA 1DEUA 2C9WB 3N32A 4F2LA 1MHHE 1AYWA 5BMGA 1POPA 1B1ZA 1AYFA 4PDIA 2VHSA 2CKHB 1AU2A 3AI5A 4CGYB 4IBIA 1FH0A 3P2BA 4CQNA 2ZTDA 2ZPNA 2ZZPB 5EXTA 4QAYA 3B7ZA 2BNKA 4KZCA 2R0IA 2MROB 3FYDA 1UNSA 3A4RA 3LQRA 4ZRKA 2JUOA 1PPOA 1L8QA 5E6OA 4AG5A 3LJ3A 1YK8A 2WBFX 1IGCA 3WAOA 4BOUA 3I57A 3P4RB 4GH9A 1P98A 3V6EB 3MORA 4LTUA 2JUJA 4RFBA 2J4XA 3KW5B 1GUAB 3RMKC 4Y28F 3FTDA 1XB2B 2WSCF 2WS3B 3EFUA 5EJCA 1SXJD 3SMPA 4LK0M 1XNRM 2FFJA 4FJCA 1D5XC 3O65A 3UQBA 4YVAA 1YSYA 2XZUA 2AYOA 2XU4A 2KRUA 3V61A 4MEMA 3C3DA 3P4PB 3WXFA 2KQSA 1TS3A 1WGHA 1YVBA 3L17A 2L4FA 3HHMA 1RFAA 2M19A 3U6DA 3MC9A 5T8IA 1NI3A 1NL6A 2M60A 1WRDB 3V6CA 4JE3B 3L25A 3KP0E 2JXTA 5F02A 1LFDA 2V0GA 2QZ4A 3RGSA 3HHWA 1FRDA 1TH3A 3AULA 1OQQA 5CVNB 3E21A 1V5TA 1VR9A 1AECA 4A5UA 1KM7A 1GVNA 2DZJA 1NV9A 3H8BA 1Q39A 3SHFA 1HQYE 1QAQA 4H2AA 3J7BA 2KZUA 3FC4A 2KDIA 3LDZE 1I4XA 3RYTA 4KLNA 4JN6A 4FADA 4BOPA 1OAIA 2KVRA 2C7NB 2E5LM 2DNAA 3H8HA 3I4VA 2QC8A 3GLFA 2R9MA 2DWQA 4YTPB 2Z0EB 1JQPA 3BC3A 2F5QA 4CZWA 1IXSA 4AW4A 3BB7A 1CQVA 2MCNB 2JY6A 1EU3A 1NSFA 1HA5A 1VJVA 2KWDA 1QQRA 3U2SC 3EIHA 4HCPB 3QWLA 4DV6M 5KHOA 1Q3CA 4JGHB 2ZPYA 2APLA 2FH0A 3U6OA 4NY0A 4GDLA 4YXDB 2L7IA 5BYRA 1T3QA 1JB0F 3ZW3A 4R7GA 1L5PA 4RH6A 1DKIA 1SE9A 1GJZA 4LDTB 2LXEA 1WJUA 1Y08A 4FW9A 2DZNB 4B7GA 1SIFA 2NQ8C 3VTVA 1U9VA 3DDCB 3R3MA 5EE0A 4A6QA 2J7QA 3FE3A 4GDKA 2BTEA 2UXCM 1EWMA 3MTNB 1FNVA 4MACA 2YJCA 4L1BA 1U9XA 1D5ZC 3HVZA 1ITOA 2KFKA 1CJLA 3L28A 3R8FA 5IA7A 1X1MA 3I5JC 5HI1A 3K9MA 1PE6A 3DHGC 3TBLD 1WJ6A 2WGSA 1TZ1A 3BCNA 5D3DA 3T1YM 4TUWA 2RPVA 4D2KA 2ZM6M 3PNYA 4HPLB 2MRPA 3J9CA 3ZJUA 1WGKA 3B2FA 4C7YA 1TIFA 3ZRFA 4G11A 4LZJA 3U6LA 1JCKB 2V1YA 3K9OB 2LGSA 3CH3X 3O65B 2DZMA 3TWKA 2DZKA 1WXAA 2HHHM 1PUTA 4LNFA 1PFDA 3NVWA 3GLGE 2WU5B 4ZRIA 3CBKA 2WX1A 3HWNA 1D0LA 4II7A 4X66M 5IZ7D 3MHHA 1GABA 5F3WA 4RF1A 1EIJA 3F75A 3PT2A 3N3KB 2BWEA 3GLHA 3CSFA 1XF5L 3C0RA 3TWMA 2J7QC 4UDUC 1V1PB 4N9F4 3FILA 5LXHA 1VSNA 4LF7M 4TKNA 1N75A 2LVAA 1NB5A 5JHBA 4KKIA 4TQ0A 1CV8A 1ET6A 4IM0A 4FIPA 4DR4M 2LVOC 3SBJA 4LGMA 2VQEM 2Y0QA 1AIMA 1L2NA 3TRKA 3AOEA 1NNJA 2PE6B 2AYNA 1FXAA 2Y5BB 2OP3A 2N9KA 4BAXA 2DC9A 3HWSA 1B9RA 1NEKB 3Q69A 5FKAC 4JI0M 2V1UA 1Z5SB 2KJRA 3SR6A 3Q3MC 3K8ZA 2K47A 2QDFA 4JI3M 3HHYA 3AEBB 1TKGA 4HPMB 1ZW7A 2F7DA 1VQ1A 4I6LB 1T5XD 4X57B 4D8EA 3DOWA 3TNXA 1X37A 3P63A 4AJYB 1VCBA 3N20C 5JHAA 2RMMA 2R2OA 4CISA 3NHEB 1TKYA 3AE8B 4L16A 2K9DA 5MPOA 2WZJA 2WLBA 1K52A 3MHVC 2FCQA 2MX2A 3AE7B 1G71A 1H4RA 2DC6A 4P1CC 3FUUA 1RLFA 2ZNVB 3PRPA 3VH4B 3U52E 2A5YB 3AJIB 4GKJM 3L2AA 2XU3A 5FR6A 1F29A 3ALBA 3I04M 2JY7A 4BQVA 3LXFA 1T0SC 1UKFA 4K3CA 1NYRA 1L0VB 1ME4A 2QJLA 4N58A 1AU0A 1TH4A 3B9PA 1ZIVA 1VEJA 2DZIA 3L54A 4LGYA 5HG2A 1EWPA 1MJGM 4S12A 1SJED 2JU6X 3GP1A 4B6WA 4XX5A 3VTUA 3B1LX 2JTCA 2B3TA 3Q8EA 2MLBA 2NQDB 5DPTA 2JRIB 4WIPA 4ZYNA 4OEMA 2BDLA 3C9PA 1L4ZB 2R65A 1DGBA 1C78A 1D3ZA 5CHVC 1A5TA 3GPYA 4KKJA 3PSEB 2X38A 1P0RA 1PQSA 1UBIA 4B7HA 3UGBB 2N7JA 1CUKA 1HE8A 4CDDB 3Q3JA 4P6GA 3KSXA 3GQ3A 4YYVA 4KT0F 1V81A 4M8MA 1R5LA 4B95A 3HU1A 5C18A 2UYZB 3ZTCA 3KS8A 2O5RA 2KTRA 4L2YA 2AWTA 2PEAA 3TEZA 2KQ4X 2N7EA 2MBBB 2R61A 2HKJA 3AV8A 3ZJTA 5G55A 1YUBA 1MG8A 2R9FA 1YD8U 4OELA 4BOSA 4I4LA 4YV8A 1JWSD 3LB8C 4RF0A 2N4FA 1F2CA 3E46A 1XEEA 4NOOB 3OQCA 3Q8GA 4LNIA 4YL8A 3D32A 3H7DA 3SDLC 2HDEA 5EP1A 3NZ3A 3ONSA 5JI2E 2AX5A 3EA6A 4A8XC 5KQDA 4M0DA 3TEYA 1JR3D 3SYLA 1ZXHA 2NQIA 1XLQA 1WYWB 3OJ3A 4YWGG 4MM3B 2LUMA 2L1AA 1GMYA 7CATA 2WQYB 1HT2E 2K39A 3JYUA 4EFOA 3GLIA 5ITUA 3P5XA 3Q8AA 1ZCMA 3PT2B 1WGNA 2OOBA 2IZVB 1C4CA 3DVGY 1U9WA 1SXJB 4F1IA 4DXGA 3RZWC 3BWKA 2K3UA 1XXHB 2DWZB 4MGKE 1IUEA 4HJGE 3Q14C 4GGQA 2I38A 3I9V1 2Z4RA 1MPEA 1O0EA 1Q10A 4XWTA 1QT9A 3KUCB 4LJ5A 2A4ZA 3SHGB 2EMTA 1C76A 3RCZA 3H8CA 5LXIB 1P7EA 2FIDA 3ZXRA 3KOWE 4FXCA 2J7OA 4KIKA 3RZFA 4XDDA 1SEBD 1IN6A 1M4VA 1XD3B 3QIJA 1IFYA 4FWGA 2HAKA 4IBCA 3KFQA 2AQ1B 1L2CA 1OKSA 2LEKA 4LRSA 3SAUA 2DZOB 3IFWB 5AUKA 2WXHA 3M63B 2L4EA 4BKGA 2JQGR 1P3QU 2VZKB 4IOIE 5EP4A 3C0RB 4W9CA 1IBKM 3B7QA 4B3MM 4AG6A 1FO4A 2FYEA 1G3IA 5FPWA 5LLIA 1P1AA 3MHSD 5FTLA 1WXMA 2L0TA 1G59A 2X49A 4G3XB 2HTHA 1XXHA 4OX9M 3KUDB 4CHTB 2KWCA 2KYWA 1NO1A 2D07B 5BPVA 2YJ8A 3AEDB 3HK0A 3APCA 4L8RC 3VLFB 2HD5B 3VDZA 1JRUA 1WM3A 2ZW0A 1E0ZA 4N4ZA 4DXAB 4FBJB 4WQOB 5EE1A 3WANA 4FJZA 2WXGA 1QANA 1YQ4B 3PBHA 3KX1A 8CATA 5DPRA 4JIOU 2BYFA 1WIVA 4A3VB 3BVMA 2REXA 1MEMA 3DZDA 2RD0A 1WX9A 1G6JA 2G4SA 1E8WA 3GRYA 1FNUA 2KT7A 2GOWA 4RGNA 2AVWA 4I8OA 4K7WA 3AL0C 1OTRB 1NVID 1GNUA 2VF8A 2JZ0A 2IO0B 1Z59A 2KHWB 2MR9A 1DGJA 3V60A 1MU5A 2JY5A 3BBZA 4XR7A 2AIMA 2ZW1A 3K2LA 4NL4H 5J94A 2J0KA 4RKXA 4Q7JA 2KWUB 2LH0A 3KDSE 3VTWA 2JX5A 5J2RA 3NBXX 3N1YC 3M7GA 3NWLA 1CZPA 3OTOM 2WXRA 2ATOA 3VQIA 1SNKA 2BB6A 5FSWA 3AM9A 2O01F 2K9XA 2JYTA 1LV7A 2KACA 1SBBB 4IUMB 4DDID 2O2VB 2KWVB 2K6BA 1QOAA 3KOYE 2CR5A 2W3SA 3P5WA 3U7DA 3BPMA 1BT0A 3DBRI 2F5SA 5EGWA 2KKCA 2XFSA 2DHZA 5CVOB 3MHZA 4JI5M 1RYJA 2K5PA 2Z59B 2BJWA 3R8BA 3AU4A 4W9JA 4WJOA 2ASQA 4ZPXA 4WWOA 1NPZA 1D6EC 1ACCA 2WU2B 4NQKE 4ASWC 4DR6M 3HM6X 1N33M 1EU4A 4XWWA 2BS3B 2BJVA 2P5TA 4BLCA 1KSFX 1SXTA 3ABVB 3I01M 2HCBA 4DK5A 4K7CA 4M0WA 4US8A 1OAOC 4I07A 1ZXIA 3VFDA 5AUIA 5EF4A 2AEHA 3GE8C 3NG0A 2JWUA 2N9PC 5C1BA 1STEA 1N5WA 1VZ8A 1WGRA 2WXQA 3A9KA 3ECIA 3QX1A 2G8JA 4UN2B 2LXCA 1VZ7A 4CHKA 2M4NA 4W5BA 4DR2M 5EXSA 2J53A 3H7SA 1OIPA 1L6UA 2L32A 4QNMA 4FN2A 3IECA 1IY0A 4LF5M 4DXFA 1UFZA 2Q5WD 2D3GA 3HZJA 3L16A 1C9FA 4ACFA 3RNBC 4IBEA 1SXJE 2ONQA 3ZQJA 4QHTA 2GBMA 3QCAA 3W1SC 1HTQA 1LM8B 3VUWA 2LHEA 1LXDA 2Y3AA 1I94M 5IOIA 1WJNA 3USVA 3M62B 5IP4D 4IG7B 1N34M 3ZRCA 2BDZA 4XC2A 3KYDD 4GITA 1DYQA 3GO8A 4DUZM 1CJEA 1KLUD 5BO4B 2KW0A 4FHKA 4G54A 3PGEA 4IJEA 4URKA 2JSVX 5HKHA 4NRWA 3KYCD 4MI7A 1CMXB 3GPXA 1Q3BA 3CSTA 1JQ4A 4KVGB 2UUCM 1ZDVA 3W9CB 3NY5A 2I7NA 3ZKJC 5IAAC 2BKFA 1PPDA 2QIEB 2WDVB 3KOZE 1Z5BA 3K1JA 5LMNM 2UXBM 2G45B 2IYDB 3HJSA 1WSPA 2BYEA 2LVOA 2PE9A 3KSEA 2KN4A 2LVQD 1L1ZA 1NJFA 2SEBD 3V6EA 4G4NA 2DBYA 1QOGA 1GAQB 1NBFC 1ESFA 2JZ3B 2IGGA 3FRIA 3TUOA 1OFHA 3SD5A 1DGHB 4II2B 2EKKA 2P7UA 5ITXA 2B3AA 4PS8A 2F4VM 2RR9A 5H92C 1SE3A 4P6VF 2X8XX 2FUHB 1YJ1A 1WZ3A 3SARA 2E6XA 3THGA 4LCDE 2BWES 2LASA 1W5TA 3DVGX 2O6VB 1E7VA 5C1ZA 4W5WA 1UGJA 3NVZA 4Q8HA 1YLAA 1UBQA 4MELA 1I4QA 3FAHA 3AE6B 3EUB2 1DGGA 5H8YE 3UK6A 5TR5A 3VAWA 3QYBA 4IBDA 2DNFA 4EEWA 4A3OA 4ZYSA 2D2QA 3JVZX 4OVVA 2W3RA 2MBOA 3A33B 1XCTL 2LXAA 5HFYA 2VHFA 2L2DA 2C96A 5EDSA 4P6EA 2N1WA 3AEGB 2DAKA 3PNVA 4IJFA 2LBCA 3R7RA 4AXMA 4OZAA 4KSLC 3JSVB 3AU5A 2PADA 3ERVA 1WFYA 3Q8CA 1TLOA 2CIOA 1EO6A 1IY1A 1XQQA 2O2VA 3LMMA 2QMTA 3OAWA 4MDKE 1ZOYB 3HUIA 4GIPA 3MC0B 3GLHE 3N4CA 3DFZA 3AOEC 2R9CA 5FTMA 1FRRA 4A90A 3P1MA 3PRMB 4PS7A 2C7HA 3FD9A 1HEZE 5FK9C 2DC8A 2P0RA 4IWPA 1WY8A 3AE4B 2J5YA 1X9YA 4GC9A 1CS8A 1Y8GA 2EJSA 1MIRA 4LCBA 1AWDA 3ZCBB 2KFJA 1ICFA 4Q8GA 3ML9A 3W5VB 1JWUD 1MHXA 3M99A 2BT6A 4IC7B 3AI8A 1S1QB 5BR8M 1XLNA 3WALA 1D5MC 1TY2A 1YIWA 1HT1E 1L7YA 2C60A 1YMHE 3A46A 1ZAEA 4FHJA 2G8EA 3FUVA 2Z84A 3SC3A 5I4DA 3JAMS 2KLGA 5BMIA 1NV8A 3I4YA 1I4WA 3AE3B 2BU3A 3RVVA 4MGZE 2XFTA 2G3QB 3KFUG 1UELA 4KODA 5KHQA 2KEBA 3FTCA 1J7KA 2MJEA 1R2YA 2DYOA 1CVZA 2G8LA 1AYVA 2OPFA 3PRZA 3QT4A 5A2QS 3ZO5B 3Q3OC 3NS8A 3PPAA 5JH5C 1GJSA 4YSYB 9PAPA 3RD2A 5IREB 2DXIA 1RWSA 1A6RA 4I6NB 4OZBA 5J17A 3SAVA 1V8CA 1DF0A 1E6EB 4MH0E 3BXWA 1EF1A 1FM0D 2C5LC 1WMHA 3QC8B 2LJIA 4GLSC 4YYUA 1R4GA 4IIWA 1OEYA 1LTMA 1MN3A 1JWMD 4MJSB 1L1TA 3D8LA 4YTNB 1XKGA 2K22A 2WNMA 2KDFB 3Q3NC 1OFFA 2HD5A 1M94A 4K81A 3E4RA 3PW3A 4DV1M 3UJNA 2K8CA 2LGYA 2KNBA 3QWZB 3AMZA 3TQSA 2OEDA 4NQLB 4XGAB 2KXJA 5EXXA 1L2DA 3NVVA 1FD6A 2KRKA 1JRPA 2OOAA 1V6EA 1R4NB 2KNVA 1D0MA 2V4IB 4M0WB 3A9KB 3U5ZB 4KLBA 1ZE3D 2KMAA 5K16A 2Y5CA 5AZFA 2CU1A 1TS4A 2MSED 2WSFF 4LJAA 1NHGC 3A98B 2DYBA 2F5NA 1CTEA 2ZBKB 5KPRA 2V3NA 1YE9A 3AB5A 4MSQB 1KXRA 2C98A 3DA1A 2LVPA 2GRIA 4HKQA 2JYEA 1SP4B 2KTFA 4QOSA 4REZA 3WHKA 3U61A 1QKZA 2Y20A 4ZRQA 2Z8YM 1VLBA 4GUAA 4QHSA 1PM5A 1VDLA 2QPAA 2JPHA 2E01A 2D7HA 1QZMA 2L7HA 1TYGB 3QJ3A 2MP2A 3IT6B 2OJWA 2QCZA 3QJZA 4KSKC 2JXXA 3HHXA 2AU1A 3SASA 1YN5A 3V05A 3IOQA 4CDFB 1QXPA 2IO3B 2JXNA 4L6V6 3BY4B 3W30A 4W9DA 4NJCA 1E9SA 2BW2A 3KSJA 2FCSA 1CSBB 1Q1OA 1S3SG 1K3BB 1WF9A 1RM6C 2BTWA 4YYQA 1PVJA 1H8CA 2O6VA 1E8ZA 1N6ZA 4BBNF 1KLVA 4EZKA 1UF0A 1NY6A 2OOBB 3KS4A 1BP4A 2XU5A 3ML8A 3U6CA 2EKEC 2LMCA 3GLIB 3T3NA 4QRGA 3ZNGC 2H5XA 3VRAB 4XDCA 2LNHC 3IBEA 1P9DU 1ME3A 3IFUA 1KFXL 1CB5A 4NJ6A 4K7UA 4B7FA 8PCHA 4PCZA 1MHWA 1LGRA 2TSSA 2GB1A 3RNFC 1U4AA 1QAOA 4HKZE 1DOXA 3AN1A 4YT0B 4KDLB 4N6EB 2OZ2A 2CS4A 3UI3A 3PHXA 2CHGA 4BPVA 3PNRA 1E5WA 1E9RA 1WHCA 1F2AA 2Z4SA 4LG2A 2DAFA 1MEGA 4A20A 1J8CA 2WP9B 2J0MA 1GB1A 2XN9C 4G4RA 4W9HA 1VZ6A 1SSNA 1TT5B 2QBYB 4M02A 3URYA 2GBNA 2D3AA 1EFUB 2XK5A 4EUTA 3D8BA 1P3QQ 2N0SB 4E3CA 1WR6E 1KHQA 2LHGA 4LF4M 4LNKA 2G9HD 1K3WA 1J7BA 3WAMA 1N61A 1R7SA 1ZGUB 3BWUD 4WWMA 3W68A 4M8NA 5CTRC 3GRRA 2YJ2A 2NMQA 1EUVB 2UZJA 1MX0A 2FQ9A 3EFCA 3QA8A 1RU3A 1VG5A 4KO8A 4KHPM 2FCNA 4ZOHC 3U6QA 2KZRA 3BVZA 5ITTA 3VR9B 2DCBA 3OVXA 3TSSA 3UINB 2R9NA 4RMAA 2N35A 2B76B 1ROEA 5EE3A 1YQ3B 3DPDA 3O13A 2YQZA 4DHJB 3I3TA 3BK1A 1HTOA 2NQGA 4FWHA 3Q6BA 2LRUA 3B7NA 4N79A 2R6FA 1KJTA 2KXEA 1NY5A 4DV0M 1RAXA 2D3CA 4DDGD 2ARYA 3X23A 1PRBA 4HLEA 3VUYA 2PMVA 4MGYE 1FCLA 3BINA 2RGOA 5FTJA 2CUZA 1JALA 1XXHE 2C99A 1TKEA 1WGGA 4DR7M 4LJ8A 3VHTC 3MP2A 2R46A 2DC7A 4DV5M 1QF6A 3IUTA 3QSDA 1BMLC 4ANWA 2BF8B 3CF0A 2GNOA 5TSSA 3CTWB 3KP1E 1C4PA 4OVUA 4HXDA 2HH5A 3S3QA 1I7HA 3M3JA 1NQCA 1WH3A 4L15A 3DCGA 4HPPA 2MBEA 3RPFC 4W4UA 1TL9A 1FFVA 2OJRA 2CE7A 2CWBA 4GC5A 2GI9A 3U60A 3F5VA 2J52A 2WXKA 2NR2A 4NAWB 2KANA 1XNQM 1JR3E 1GLNA 3SYKA 4XZ4A 2PLPA 2E3TA 1N63A 2JQFR 4MZOA 3P4SB 3BOSA 2BWBA 2MA9B 5BYQA 4RM8A 2MH8A 4WAFA 2KN5A 4NC6A 1DV0A 2KJHB 1J7CA 3A45A 3NS1A 3VDUA 1D4BA 1Y4HA 4B3SM 3TL5A 4AP4C 2E02A 4E74A 3SAWA 3RUIB 3GQ4A 1IXRC 4EE2A 1HR0M 2FIFA 4JI4M 1WM2A 2WDTB 4E71A 1I4GA 3BIID 1XMQM 1OFIA 2RDBC 4HWIB 5L95C 1ZUD2 3Q8XA 4PDGA 3PZ8A 2IBIB 3U4EG 1XWIA 3CF2A 4JYAM 2N9EB 4P17A 1EF7A 3TPZA 2JY6B 4C4VA 1TBEA 1YN4A 2CJOA 2WXJA 2UWQA 2E03A 1WRIA 1DO0A 3N1XC 3P4QB 1FXTB 3DWMA 3CBJA 3ZNID 5EP2A 5CHWA 2ZAMA 1AU3A 1UWXA 2DCAA 2DVWB 3N30A 1IYFA 1OQRA 4HL4A 3S2AA 4LFCM 2L00B 4R71A 4LZZA 1WGYA 1WXVA 3B2GA 3KQ4A 4KZ0A 3HHZA 2FUDA 3TEWA 3FRHA 2BVCA 3L0WB 4KGTA 3DBRB 3PRPB 2F5PA 3MK6A 1E90A 4DQOC 5JA7A 5EE9A 2KJ6A 2PNSA 2LTUA 2C9CA 4IM2A 3U6EA 2ICIA 3RFWA 3PZDA 1JWAD 3QAQA 4TSSA 4II3B 1E7PB 3MJWA 4MH8A 2CFOA 3ZQ4A 1UZXB 3A1QB 2HWKA 1TF0B 3PVLA 2ACZB 3FUWA 1WGDA 3AECB 4JI1M 3GB1A 4ICVA 4PP2E 3AEFB 3TE6A 3IHPA 2DENA 5C23A 2FE8A 4NAWA 2FTDA 4AKIA 3M95A 3PHXB 3W1YA 4NJ7A 2CHWA 3H4JA 2R44A 1K50A 1GC7A 4CO7A 2DZYA 4DR5M 3KWLA 2WXMA 5D2MB 1QZEA 4D81A 4JWUC 3JW0X 3HM3A 3GZNI 1WE7A 1DGHA 2O25A 4GXBA 4IDIA 4ZUXU 1UGMA 4ARCA 1CQDA 2LUEA 3B79A 3P5UA 3NUHB 2UU9M 1K53A 4LJOB 4HCNB 4TUUA 3R9XB 4M9ZA 2V6ZM 5DFLA 2RGHA 4W9GA 3AFHA 2M5ZA 3UMMA 1IBMM 3B9JA 4LJ7A 2IY1B 2XBBC 4AUQC 2LHDA 2HXZA 3GPUA 1I4HA 2L3ZA 4JLCA 4NXNM 2INDC 4IUMA 5IT9S 2DOSA 2JRIA 4W9EA 3LVVA 4P7IA 3K9OA 3JR5A 3GLGB 2NCNA 3AE9B 2NTSA 4XUIA 2WXPA 1WXQA 2HL7A 3DBLI 2FT2A 3I3TB 1WE6A 2WWZA 1V80A 2G6DA 3BOWA 1V97A 3VK8A 2MGWA 2DAMA 1ZPSA 2F1GA 2HHNA 3TMPB 2Y0TA 3EC8A 2C9OA 2J42A 5FTKA 4OZCA 4ZRJA 1YX6B 2DWLA 2QEJC 5AEKB 2ZCBA 4LNNA 4CYEA 3HRDD 1IN7A 1HNWM 2D5GA 3B89A 2Q2EB 3HKPA 1WWTA 3A9JB 1PXVA 4YSZB 1PPPA 3DBSA 1VEKA 3LQQA 4AKGA 4EOYA 1AYUA 1ET9A 1T6BX 1GJTA 2QSDA 3WXEA 2E00A 3DBHI 2YLMA 3IAM1 2INNE 4XGIA 1ISNA 2MBHA 4PS3A 2H88B 4FA6A 2RDGA 2R4EA 5GXGB 2KZSA 1YNTE 1DO2A 1G8PA 1J09A 2QSFX 3IG5A 2CV0A 2KMCA 3GLGA 4RM9A 1GL7A 4BBNC 1PJTA 4BKSD 4BKTA 2LHCA 3N1ZC 1R2ZA 3SEBA 2BGFA 2RGFA 3BPFA 2LJ5A 4RNAA 2UUBM 4RGOS 5CX3A 2GHUA 2K6DB 2KX3A 2DAJA 2EELA 4A55A 3MFGA 1IM2A 4AQYM 1YJIA 4BBAA 2LI5A 3HHIA 5JH3A 1E32A 1E94E 2G3QA 3U6SA 2AYOB 1ZV1A 4FJVB 4NAMA 4FCWA 3RULA 1FJGM 4MJSA 1WR1B 1TR8A 3P42A 1NHWC 2Z8LA 1GL6A 3Q8FA 5IN7A 3HGIA 3GRVA 3PLVA 2A5UA 1GCBA 1WX8A 2FO5A 1QUSA 1KH0A 4RGTA 2AS8A 4HROA 3LFYA 4IP3A 1T0RC 1HUCB 4KDIC 3DHIC 4WAAA 2JZZA 4W9LA 1STFE 4R3DA 3AE1B 1G41A 4WW0A 2VH1A 3AE2B 5FR3A 1JROA 1GO5A 4IBBA 2D7GA 2DI0A 4AKHA 3ZDMC 2SAKA 1YALA 2FRQA 3PRMA 4EKUA 3TWLA 3W5UB 4F7ZA 3C58A 2WDRB 2OO9A 3PO0A 5HHDG 3RNGC 3K92A 1L0XB 1V92A 4J6IA 3C3EA 2N9LA 4RY2A 5JZEA 4HWYA 4CDEB 1XO3A 4LFBM 3ZTDA 1IPGA 1ORYB 1TU6A 3EIEA 5DPWA 5KQ8A 1PGXA 3MMPA 1YT7A 3TJPA 3QHTA 3CF6E 1FPYA 4ANVA 3W0LB 4A3PA 3DOAA 1Y56A 2NTTA 2N7DA 2BBCA 1HZ6A 2JT4B 4GMQA 3VKHA 3IV2A 1V1OA 1HZ5A 2V3PA 2JP7A 3HY5A 2GBRA 2EUCA 1HJPA 3MTNA 1IN5A 2NBUA 3DHHC 1TS5A 2H1RA 2KOXA 2YEPF 5LNK1 3CMMB 2LFIA 3W0FA 1E9MA 5PADA 2UU7A 5IKCM 2KO3A 1YN3A 2L7RA 2MH7A 1UWMA 4TV3A 1E10A 2JWZA 2CB5A 3L26A 4HRSA 2D3BA 1CK1A 4L23A 4G4OA 2MBQA 1SXJA 2PJHA 3ZGZA 4DWFA 2CRUA 2JRHA 1N36M 4HK2A 3RVWA 1IXZA 2KDBA 2QHOA 1DOIA 3GLIE 1AIPC 3VRBB 4K7SA 1FMAD 3QQ8B 4D82A 2AL3A 1GOZA 1NYQA 3JSVA 4X65M 4RKUF 3KWZA 2BQQA 1E7UA 1HXYD 3NVYA 2DJGB 3NJTA 2WSEF 1VRAB 4Z8XA 2MJDA 3RNEC 4AWJA 4IBGA 5KPZA 3RI7C 3W2DA 1CPJA 4D8BA 1WJ7A 3I51A 2KK8A 3ZDTA 2KAJA 5EZQA 1K3XA 4FCVA 1Y8RC 2D10A 2LGDA 1EWLA 1U5IA 4DV4M 4B0EA 3V62A 2IO1B 2NPTB 3AV0A 5JI3E 4WA6A 1P7FA 3FUXA 4FLHA 1PJQA 3ENEA 3ZJVA 2KDEB 1PJJA 3GLFB 4N59A 2X8AA 2GQFA 1ZKHA 2BYVE 1GKIA 4FJYA 5IWAM 3FTFA 2O6XA 3IAS1 1PJSA 3I06A 1VDVA 2Y5PA 3V6CB 3N9YC 2L6OA 3BYYB 2MWSB 4AS1A 3T38A 2PTLA 1SXJC 3VH3B 3VR8B 1R4MB 3AKZA 1VDDA 3ZXVA 4B9KA 4MSMB 4HEA1 3L27A 1ATKA 2MP2B 4B0MA 2CU3A 4BOZB 3FILB 2GBKA
chains in the Genus database with same CATH topology
1FNWA 1EWCA 1QILA 2XEPA 4NSOB 2XSZA 4YTMB 3ZYYX 3WHLA 4XZXA 5GKNA 4GRIA 1A70A 2H89B 1GB4A 3J81S 4I81A 4IBFA 1MI0A 1R7RA 4D8IA 3VKGA 4B3TM 3L29A 5KO3A 2AGAA 1N78A 5D3IB 4QOZC 3AE5B 1D2NA 4MB7A 1TDZA 1JMLA 3MP9A 1SF0A 4G6ZA 1FEHA 5E26A 4OU7A 2QCUA 3W1SA 1KF6B 2AQ3B 3ZH9B 4ZRPA 4JWSC 4FWDA 2RDHA 4C56C 1C4AA 2ON8A 2IJ0A 2C5RA 1KFYB 3GRUA 1ENFA 1RFKA 2MEKA 4FVMA 3KW6A 4NRVA 2FBWB 1TGUA 3GPPA 3GLHB 3U7ZA 1Z5CA 4Z6YA 1J5EM 4G4QA 4LJ6A 1HQCA 1QLBB 3T15A 5ITQA 4HLQA 1UUPA 2AHMA 3AOGA 1N62A 4J3OD 2PW9A 4P16A 3T3OA 3PFIA 4TMAB 2BS2B 4XBOA 2XLJA 1TY0A 2IDYA 2MJ3A 3TL4X 4GHLA 1C77A 2UXDM 2FOIC 3PSEA 2CHQA 4WH4A 2YR0A 1ZQ9A 5ITYA 4RGMA 2PVOD 4DUYM 1KRHA 2QENA 1BXTA 1KYIA 2G1EA 3R2TA 1VJKA 4YY3M 1JW9D 1L0YB 3RFZB 1YJJA 2DYMA 3LVWA 5D7GA 3PVSA 1HNXM 1I4PA 2VZKD 3L4PA 2ZAOA 3U61B 2EKIA 3FUTA 1L4DB 4BB9A 5EXPA 4MGHA 1N60A 2K0PA 3MJ5A 2KDMA 2OHFA 2M0AA 3HJQA 4QNRA 5DYGA 1EE8A 2WXLA 4LF9M 4LFAM 4IKGA 5FTNA 1QAMA 5C2TB 5G5GA 2L83A 4KX6B 5JXVA 4US9A 2R62A 4MGIE 4MT5A 2BB5A 2W55A 4D80A 1PGBA 3UZUA 4NZLB 1GPXA 2FUG1 2PKOA 4JI2M 1ZP0B 4AI6A 3J7AS 1SE2A 2XF3A 3V3XA 3PZ7A 4DV7M 4AQ7A 5E6JA 2M56B 1BUIC 3C8YA 2JA2A 1F0ZA 2RKOA 3TEXA 3KLSX 3M6AA 2YNMD 3T1HM 1C1KA 1PJIA 2XH9A 2R45A 5C3JB 3J80S 1QQWA 4EIWA 1XCQL 3RGPA 1Z5AA 1KFVA 1PDXA 1SB3C 1MVKA 5ITRA 1XMOM 1IXSB 4ZTBA 4FD2A 4LF8M 3SATA 4LY6A 4C7ZA 1IBXA 2Y21A 4LRTA 3SFDB 1T3TA 1KLGD 4NXMM 4LF6M 2DWNA 2IGHA 4LLGM 4IBJA 1SJHD 1Z6TA 2D7EA 3NBIA 3TMPA 4PT5A 2HTME 3E9SA 2QBYA 3BK2A 4GHAA 2R4JA 2INPE 4JI6M 3BY4A 2CV1A 1LO5D 2XNAC 1TH2A 2CJNA 3Q8BA 2IGDA 1F2RI 3PHUA 2JZPA 2DLBA 3CWIA 2EA0A 3BZDB 1OJLA 4L78A 3RNVA 3FKEA 2LGIA 2WXNA 4JX1C 1QOFA 5FLXS 3U60B 2XGNA 1FCCC 1W5SA 5DYIA 1FNNA 1QOBA 3DWGC 1IBLM 4LJ9A 1R6BX 3AH7A 3EGRA 1FIQA 4C80A 1KTKA 2DHRA 2X4AA 4Q2JA 1ZDXA 2KA6B 4BOQA 2CHVA 1NENB 2VQFM 4B3RM 4K0KM 5EQTA 2Z3XA 4KGSA 2KMMA 2XSZD 4JI7M 3ILKA 2L52A 2AQ2B 4USAA 3HVDA 3A42A 4IBKA 3VK7A 2CEAA 3IG8A 2PVGC 2JQRB 4GDLB 1PYWD 1NJGA 4ITKA 2Z7JA 1NNUC 4I5SA 4LJ4A 3RE8A 1FXIA 1IN4A 3IXSA 3ETRA 2BTWB 3FYCA 3KVWA 2W54A 4GDKB 1FFUA 4M9SA 1DOYA 4JV5M 3VDPA 1TS2A 1PGAA 1G4AE 2VIIA 1L6VA 4OHJA 2BS4B 4FCTA 3GQ5A 1EM7A 2L09A 2XZFA 3M0EA 1IY2A 4JI8M 3AEEB 4YHHM 1XLOA 3MTVA 2V1CA 2DWMA 3BVGA 2UUAM 5EP3A 3AEAB 1XHBA 3KWVA 1QVRA 3J2PB 3BBAA 1I4RA 4O1NA 1HNZM 5G5HA 1N32M 1J7AA 4B08A 4YSXB 1WYGA 2YFQA 2ZANA 1JWBD 5BMHA 4AZFA 1XC8A 3HJ8A 3FTEA 1AN8A 1IBXB 1QYRA 2QILA 2W82A 2I2YA 3NRZA 1DGFA 4ZHOA 2EO2A 3GP7A 1IN8A 4WURA 3HU2A 3W31A 1TJEA 4ITQA 2I7PA 2BYTA 1SE4A 2G5GX 3CIRB 5ITXE 1F2RC 2WXIA 4M9XA 1S3SA 4X62M 3LYYA 4GKKM 1K51A 1UM8A 3QAUA 3SMSA 3KOXE 4ARIA 3KXEC 1IQPA 1JR3A 2ERCA 4HXDB 1C79A 2CV2A 3U6MA 3R2IA 4BOZA 3SFEB 1H6UA 5BYSA 4ZHPA 5H37D 4JPSA 4L4UA 3HU3A 2FNAA 1HQRD 3PHWA 3GS2A 3E56A 2F5OA 1EWYC 3BYTB 1SIJA 4DR1M 3J27B 4RCOA 1XXGA 5KPTA 5EZSA 4DV3M 1XLPA 1YZBA 2R18A 2WXFA 1IGDA 1JQJC 3B21A 2PIAA 3IT4B 4OVZA 3OWEB 2OQ4A 3WCQA 1V1PA 4KGRA 3U5ZA 2J7NA 5DNYA 3ZC7B 3PXGA 3SFZA 1N77A 2WXOA 4OW0A 4WQMA 3H4MA 4DR3M 2YEPB 5LMUM 1AW7A 1TZOA 1F77A 3U6PA 2LWXA 4XE0A 1TDHA 1NVMA 4PD2A 4JXJA 1L2BA 2WDQB 4NSRA 4X64M 4DV2M 2IPKD 4TQ1A 3ZNHA 3UGJA 1K82A 2QP9X 3JR4A 4OVZB 4A9AA 1N5XA 1MHHE 5BMGA 1B1ZA 1AYFA 4PDIA 4CGYB 4IBIA 4CQNA 5EXTA 2BNKA 3FYDA 1UNSA 3LQRA 1L8QA 4AG5A 1IGCA 4BOUA 3I57A 3P4RB 4GH9A 4LTUA 4RFBA 2J4XA 3FTDA 2WS3B 5EJCA 1SXJD 3SMPA 4LK0M 1XNRM 2FFJA 1D5XC 3O65A 1YSYA 2XZUA 2KRUA 3P4PB 1TS3A 2M19A 3U6DA 5T8IA 1NI3A 2M60A 4JE3B 3L25A 3KP0E 2JXTA 2V0GA 2QZ4A 3RGSA 3HHWA 1FRDA 1TH3A 1OQQA 1VR9A 4A5UA 1GVNA 1Q39A 3SHFA 1HQYE 4H2AA 1QAQA 3J7BA 2KZUA 3FC4A 1I4XA 4KLNA 4JN6A 4BOPA 2E5LM 3H8HA 3I4VA 3GLFA 2DWQA 4YTPB 2F5QA 4AW4A 3BB7A 1CQVA 1EU3A 1NSFA 1HA5A 2KWDA 1QQRA 3U2SC 3EIHA 3QWLA 4DV6M 1Q3CA 3U6OA 4YXDB 2L7IA 5BYRA 1T3QA 4R7GA 1L5PA 4RH6A 1DKIA 2LXEA 4FW9A 2DZNB 4B7GA 2NQ8C 3FILB 5EE0A 4A6QA 2J7QA 2BTEA 2UXCM 1FNVA 4MACA 4L1BA 1D5ZC 3HVZA 3L28A 3R8FA 5HI1A 5D3DA 3T1YM 4TUWA 2RPVA 4D2KA 2ZM6M 3PNYA 3J9CA 3ZJUA 1WGKA 3B2FA 4C7YA 4LZJA 3U6LA 1JCKB 3TWKA 2HHHM 1PUTA 1PFDA 3NVWA 2WU5B 4II7A 4X66M 5IZ7D 5F3WA 4RF1A 3PT2A 3GLHA 1XF5L 3C0RA 3TWMA 2J7QC 4UDUC 1V1PB 3FILA 4LF7M 1N75A 4KKIA 4TQ0A 1ET6A 4DR4M 3SBJA 4LGMA 2VQEM 2Y0QA 3TRKA 3AOEA 1NNJA 1FXAA 2N9KA 3HWSA 1B9RA 1NEKB 3Q69A 5FKAC 4JI0M 2V1UA 3SR6A 3K8ZA 2K47A 4JI3M 3HHYA 3AEBB 1TKGA 1T5XD 4D8EA 1X37A 3P63A 2RMMA 4CISA 1TKYA 3AE8B 4L16A 5MPOA 2WLBA 1K52A 3MHVC 3AE7B 3FUUA 3PRPA 3U52E 2A5YB 3AJIB 4GKJM 3L2AA 3LXFA 1UKFA 1NYRA 1L0VB 2QJLA 4N58A 1TH4A 3B9PA 5HG2A 4LGYA 4S12A 1SJED 2JU6X 3GP1A 2JTCA 3Q8EA 4WIPA 1L4ZB 2R65A 1DGBA 1C78A 3GPYA 4KKJA 2X38A 4B7HA 2N7JA 3KSXA 3GQ3A 3HU1A 5C18A 3KS8A 2O5RA 4L2YA 3TEZA 2KQ4X 2R61A 2HKJA 3AV8A 3ZJTA 1YUBA 4BOSA 4I4LA 1JWSD 3LB8C 4RF0A 1XEEA 4NOOB 3OQCA 5EP1A 3NZ3A 5JI2E 2AX5A 3EA6A 4A8XC 5KQDA 4M0DA 3TEYA 1JR3D 3SYLA 1ZXHA 1XLQA 4YWGG 4MM3B 2LUMA 2L1AA 7CATA 2WQYB 1HT2E 3GLIA 5ITUA 3Q8AA 1C4CA 1SXJB 4DXGA 2K3UA 1XXHB 2DWZB 4MGKE 1IUEA 4HJGE 2I38A 3I9V1 2Z4RA 1MPEA 1Q10A 4XWTA 1QT9A 4LJ5A 3SHGB 1C76A 1P7EA 3KOWE 4FXCA 2J7OA 4XDDA 1SEBD 1IN6A 1M4VA 4FWGA 4IBCA 2AQ1B 1L2CA 2LEKA 4LRSA 3SAUA 2DZOB 5AUKA 2WXHA 2VZKB 4IOIE 5EP4A 1IBKM 4B3MM 4AG6A 1FO4A 1G3IA 5FTLA 1G59A 2X49A 1XXHA 4OX9M 4CHTB 5BPVA 3AEDB 4L8RC 3VLFB 2ZW0A 1E0ZA 5EE1A 2WXGA 1QANA 1YQ4B 8CATA 4A3VB 3BVMA 3DZDA 3GRYA 1FNUA 4RGNA 4I8OA 3AL0C 1NVID 1Z59A 1DGJA 1MU5A 2ZW1A 3K2LA 4NL4H 4RKXA 2LH0A 3KDSE 2JX5A 3M7GA 3NWLA 1CZPA 3OTOM 2WXRA 3VQIA 2BB6A 5FSWA 3AM9A 2K9XA 2JYTA 1LV7A 2KACA 1SBBB 2W3SA 1QOAA 3KOYE 2F5SA 2XFSA 3MHZA 4JI5M 1RYJA 2K5PA 2BJWA 3R8BA 4ZPXA 1D6EC 1ACCA 2WU2B 4DR6M 1N33M 1EU4A 4XWWA 2BS3B 2BJVA 2P5TA 4BLCA 1KSFX 1SXTA 3ABVB 2HCBA 4M0WA 4US8A 1ZXIA 3VFDA 2JWUA 5C1BA 1STEA 1N5WA 1VZ8A 2WXQA 1VZ7A 4DR2M 5EXSA 2J53A 1L6UA 2L32A 4QNMA 1IY0A 4LF5M 4DXFA 2Q5WD 1C9FA 4IBEA 1SXJE 2ONQA 4QHTA 2LHEA 2Y3AA 1I94M 1N34M 4GITA 1DYQA 3GO8A 4DUZM 1CJEA 1KLUD 2KW0A 4IJEA 2JSVX 4NRWA 4MI7A 3GPXA 1Q3BA 1JQ4A 2UUCM 1ZDVA 3W9CB 2I7NA 2QIEB 2WDVB 3KOZE 1Z5BA 3K1JA 5LMNM 2UXBM 3HJSA 1WSPA 2KN4A 1L1ZA 2SEBD 1NJFA 4G4NA 2DBYA 1QOGA 1GAQB 1ESFA 2IGGA 3TUOA 1OFHA 1DGHB 5ITXA 5H92C 2F4VM 1SE3A 4P6VF 3SARA 2E6XA 3THGA 1W5TA 4W5WA 1UGJA 3NVZA 1I4QA 3FAHA 3AE6B 3EUB2 1DGGA 5H8YE 3UK6A 4IBDA 4ZYSA 2W3RA 1XCTL 5HFYA 2C96A 3AEGB 3PNVA 4IJFA 4OZAA 3Q8CA 1IY1A 3LMMA 2QMTA 1ZOYB 3HUIA 4GIPA 3MC0B 3DFZA 3AOEC 5FTMA 1FRRA 4A90A 3P1MA 3FD9A 1HEZE 5FK9C 3AE4B 4GC9A 4LCBA 1AWDA 3ZCBB 3W5VB 1JWUD 1MHXA 2BT6A 5BR8M 1XLNA 1D5MC 1TY2A 1HT1E 1YMHE 3A46A 1ZAEA 3FUVA 2Z84A 3SC3A 5I4DA 3JAMS 5BMIA 3I4YA 3AE3B 1I4WA 2BU3A 4MGZE 2XFTA 3KFUG 4KODA 2KEBA 3FTCA 1J7KA 2MJEA 1R2YA 2DYOA 2G8LA 2OPFA 5A2QS 4YSYB 5IREB 2DXIA 1RWSA 4OZBA 3SAVA 1V8CA 1E6EB 4MH0E 1FM0D 2LJIA 4GLSC 4IIWA 1JWMD 1L1TA 3D8LA 4YTNB 2K22A 2WNMA 1OFFA 3E4RA 4DV1M 3UJNA 3AMZA 3TQSA 2OEDA 5EXXA 1L2DA 3NVVA 1FD6A 2KRKA 1JRPA 2V4IB 3U5ZB 1ZE3D 2Y5CA 1TS4A 4LJAA 1NHGC 3A98B 2F5NA 2ZBKB 5KPRA 2V3NA 1YE9A 3AB5A 2C98A 3DA1A 2GRIA 4HKQA 2JYEA 4QOSA 4REZA 3WHKA 3U61A 1QKZA 2Y20A 4ZRQA 1VLBA 4GUAA 4QHSA 1PM5A 2QPAA 2D7HA 1QZMA 2L7HA 1TYGB 3IT6B 3HHXA 3SASA 1YN5A 3V05A 3W30A 4NJCA 1E9SA 2BW2A 3KSJA 1RM6C 2BTWA 1PVJA 1NY6A 3KS4A 3U6CA 2LMCA 3GLIB 3T3NA 3VRAB 4XDCA 2LNHC 3IFUA 4B7FA 4PCZA 2TSSA 2GB1A 1QAOA 4HKZE 1DOXA 3AN1A 4YT0B 4N6EB 3UI3A 3PHXA 2CHGA 1E9RA 2Z4SA 4LG2A 2WP9B 1GB1A 2XN9C 4G4RA 1VZ6A 1SSNA 2QBYB 3URYA 3D8BA 2N0SB 4LF4M 2G9HD 1K3WA 1J7BA 1N61A 1R7SA 3BWUD 4WWMA 3GRRA 2NMQA 2UZJA 1MX0A 4KO8A 4KHPM 4ZOHC 3U6QA 3BVZA 5ITTA 3VR9B 3TSSA 2B76B 1ROEA 5EE3A 1YQ3B 3O13A 2YQZA 3BK1A 4FWHA 2KXEA 1NY5A 4DV0M 2PMVA 4MGYE 1FCLA 2RGOA 5FTJA 2CUZA 1JALA 2C99A 1TKEA 4DR7M 4LJ8A 3MP2A 2R46A 4DV5M 1QF6A 1BMLC 3CF0A 5TSSA 3CTWB 3KP1E 1C4PA 1I7HA 4L15A 3RPFC 1FFVA 2CE7A 4GC5A 2GI9A 3U60A 2J52A 2WXKA 4NAWB 1XNQM 1GLNA 3SYKA 2PLPA 2E3TA 1N63A 3P4SB 3BOSA 5BYQA 4WAFA 1J7CA 3A45A 3NS1A 3VDUA 1D4BA 4B3SM 3SAWA 3GQ4A 1IXRC 4EE2A 1HR0M 4JI4M 1I4GA 3BIID 1XMQM 1OFIA 1ZUD2 3Q8XA 4PDGA 3PZ8A 3U4EG 1XWIA 3CF2A 4JYAM 3TPZA 2CJOA 1YN4A 2WXJA 1WRIA 1DO0A 3P4QB 3DWMA 5EP2A 2ZAMA 1UWXA 2DVWB 1OQRA 4HL4A 4LFCM 4LZZA 3B2GA 3KQ4A 3HHZA 3TEWA 4KGTA 2F5PA 3MK6A 4DQOC 5EE9A 2C9CA 3U6EA 2ICIA 3RFWA 1JWAD 4TSSA 1E7PB 4MH8A 2CFOA 3ZQ4A 2HWKA 2ACZB 3FUWA 3AECB 4JI1M 3GB1A 3AEFB 3TE6A 2FE8A 4AKIA 1K50A 4DR5M 3KWLA 2WXMA 4D81A 4JWUC 1DGHA 4IDIA 4ARCA 3NUHB 2UU9M 1K53A 3R9XB 4M9ZA 2V6ZM 2RGHA 3AFHA 2M5ZA 3UMMA 1IBMM 3B9JA 4LJ7A 2LHDA 3GPUA 1I4HA 4NXNM 4IUMA 5IT9S 2DOSA 2JRIA 3LVVA 3JR5A 3GLGB 3AE9B 2NTSA 2WXPA 1WXQA 2HL7A 1V97A 3VK8A 1ZPSA 2Y0TA 2C9OA 2J42A 5FTKA 4OZCA 2DWLA 2QEJC 3HRDD 1IN7A 1HNWM 2D5GA 2Q2EB 3HKPA 1WWTA 4YSZB 3LQQA 4AKGA 1ET9A 1T6BX 2QSDA 3IAM1 2INNE 4XGIA 2H88B 2RDGA 2R4EA 5GXGB 2KZSA 1YNTE 1DO2A 1G8PA 1J09A 3IG5A 2CV0A 3GLGA 1GL7A 3SEBA 1R2ZA 4RNAA 2UUBM 4RGOS 2EELA 4A55A 3MFGA 1IM2A 4AQYM 1YJIA 4BBAA 1E32A 1E94E 3U6SA 4NAMA 4FCWA 1FJGM 3P42A 1NHWC 2Z8LA 1GL6A 3Q8FA 3HGIA 3GRVA 4RGTA 1KH0A 4IP3A 4HROA 4R3DA 3AE1B 1G41A 4WW0A 5FR3A 3AE2B 1JROA 4IBBA 2D7GA 4AKHA 2SAKA 3PRMA 3TWLA 3W5UB 3C58A 2WDRB 3PO0A 5HHDG 3K92A 1L0XB 2N9LA 5JZEA 1XO3A 4LFBM 1ORYB 3EIEA 5KQ8A 1PGXA 3CF6E 3W0LB 3DOAA 1Y56A 2NTTA 2BBCA 1HZ6A 4GMQA 3VKHA 1V1OA 1HZ5A 2V3PA 2EUCA 1IN5A 1TS5A 2H1RA 5LNK1 2YEPF 2LFIA 3W0FA 1E9MA 1E10A 1YN3A 2MH7A 1UWMA 3L26A 4HRSA 1CK1A 4L23A 4G4OA 1SXJA 3ZGZA 1N36M 1IXZA 1DOIA 3VRBB 1FMAD 4D82A 1GOZA 1NYQA 4X65M 3NVYA 1HXYD 1VRAB 4Z8XA 2MJDA 4IBGA 5KPZA 3W2DA 4D8BA 3I51A 2KAJA 5EZQA 1K3XA 4FCVA 4DV4M 4B0EA 3AV0A 5JI3E 1P7FA 3FUXA 3ZJVA 1PJJA 3GLFB 4N59A 2X8AA 1GKIA 5IWAM 3FTFA 3IAS1 1VDVA 2Y5PA 3N9YC 2L6OA 3BYYB 4AS1A 3T38A 2PTLA 1SXJC 3VR8B 3AKZA 1VDDA 4HEA1 3L27A 4B0MA 2CU3A 5AUIA 2HDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OW0 A;  4RF1 A;  3MJ5 A;  4RF0 A;  3E9S A;  4P16 A;  4OVZ B;  4R3D A;  4REZ A;  3MP2 A;  5KO3 A;  4M0W A;  4OVZ A;  4RNA A;  5E6J A;  4WUR A;  4PT5 A;  4MM3 B;  2FE8 A; 
#chains in the Genus database with same CATH topology
 4I05 A;  2N9X A;  1FNW A;  1EWC A;  1QIL A;  1UD7 A;  2AL6 A;  2LZ6 A;  2XEP A;  4QH6 A;  2FCM A;  4NSO B;  2IY0 B;  2EKF A;  3T9L A;  1PPN A;  2XSZ A;  4YTM B;  3ZYY X;  3WHL A;  3ZUN A;  4XZX A;  5GKN A;  2EMS A;  4GRI A;  1A70 A;  2H89 B;  1SGH A;  1GB4 A;  2M0X A;  1Q02 A;  3J81 S;  4I81 A;  4IBF A;  4X6J A;  3Q3F A;  1MI0 A;  5AZH A;  1R7R A;  4D8I A;  3VKG A;  4B3T M;  1OGW A;  1WI0 A;  2DKL A;  3L29 A;  2IBI A;  5KO3 A;  2AGA A;  1N78 A;  5D3I B;  4YYR A;  2JY8 A;  1NI2 A;  2I1J A;  3CH2 X;  4QOZ C;  3AE5 B;  1D2N A;  1BVS A;  2K1F A;  4MB7 A;  1QOL A;  1TDZ A;  3PTF C;  1JML A;  4S0R A;  5CVM A;  3RNC C;  2PPH A;  2CP8 A;  1BQI A;  5JZE B;  3OIS A;  1LQB A;  3MP9 A;  2XK5 B;  3UQA A;  3C9E A;  1SF0 A;  2LVN C;  1Q5W B;  4G6Z A;  4FUL A;  2WX0 A;  1C3T A;  1FEH A;  5E26 A;  4OU7 A;  2QCU A;  1NDD A;  3W1S A;  3WXG A;  1KF6 B;  1MFW A;  2IPP B;  3N3G A;  2AQ3 B;  1VD2 A;  1YK7 A;  1OEY J;  2W9N A;  4BFR A;  3ZH9 B;  4ZRP A;  4JWS C;  4HDQ A;  4FWD A;  1E8Y A;  2BWF A;  2RDH A;  4C56 C;  1C4A A;  2ON8 A;  2IJ0 A;  2C5R A;  1KFY B;  3AXC A;  4PYZ A;  3N3K A;  3GRU A;  1ENF A;  2NVU I;  3HIZ A;  1RFK A;  2LVQ A;  2MEK A;  4FVM A;  2P86 A;  3KW6 A;  4DMX A;  2DAG A;  2KNZ A;  4NRV A;  2M1M A;  4GEW A;  2FBW B;  1TGU A;  2KNA A;  1EF5 A;  3GPP A;  3GLH B;  2R2Q A;  2QHO B;  2NS5 A;  3U7Z A;  1Z5C A;  3LCU A;  4Z6Y A;  1J5E M;  4G4Q A;  1V34 A;  3PDF A;  3ZNH B;  1YOV B;  4LJ6 A;  1HQC A;  3U8E A;  3VFK A;  1QLB B;  4MZS A;  3T15 A;  1BGO A;  3QYE A;  2HJ8 A;  2VH2 A;  1Q6K A;  5ITQ A;  4HLQ A;  1UUP A;  4XK8 F;  2FS1 A;  2MW5 A;  4ANX A;  2AHM A;  3AOG A;  1N62 A;  3WAP A;  1MDW A;  4J3O D;  2NPT A;  2PW9 A;  4W9F A;  4P16 A;  3T3O A;  4X6I A;  4NNJ B;  3PFI A;  2G7Y A;  4TMA B;  2KHH A;  2BS2 B;  4XBO A;  2FNJ B;  3ZIM A;  4DBG B;  2XLJ A;  2DX5 B;  3OLM D;  1WGL A;  4WJN A;  1TY0 A;  2KTR B;  3DQV A;  2IDY A;  2OUL A;  2MJ3 A;  4BKS A;  3TL4 X;  4GHL A;  2Y6E A;  1C77 A;  3WIM A;  2UXD M;  3C19 A;  3H89 A;  4W9I A;  4ZDV A;  2FOI C;  2FRA A;  3K9P B;  4GB9 A;  2RPQ A;  3RN9 C;  3PSE A;  3HHA A;  2CHQ A;  4WH4 A;  4YYW A;  1Q0W B;  2RRU A;  2YR0 A;  2KQ7 A;  4LJP B;  1U9Q X;  1A5R A;  2ZEQ A;  1ZQ9 A;  3O1G A;  3IHP C;  5ITY A;  4RGM A;  2PVO D;  4DUY M;  1KRH A;  2QEN A;  2WHI A;  1BXT A;  1KYI A;  2G1E A;  3R2T A;  4LNO A;  3VUX A;  1VJK A;  4YY3 M;  4N8W A;  1JW9 D;  5J18 A;  1L0Y B;  1T0Q C;  3RFZ B;  3E1Z B;  1YJJ A;  2DYM A;  3LVW A;  5D7G A;  2XU1 A;  3PVS A;  1HNX M;  2DJF B;  1I4P A;  3UF8 A;  3VVW B;  2VZK D;  3F92 A;  2DEN B;  3L4P A;  3UIO B;  2ZAO A;  2R9O A;  3U61 B;  2G4D B;  2EKI A;  2K6Q A;  2NBV B;  3FUT A;  1L4D B;  3O0U A;  1T0Y A;  4BS6 A;  3B0A A;  4BB9 A;  4GSW A;  3V76 A;  3S3R A;  5EXP A;  4MGH A;  1N60 A;  1AUA A;  2K0P A;  2DZL A;  3MJ5 A;  2KDM A;  2OHF A;  4GU2 A;  1F4I A;  2KC2 A;  1OQY A;  2M0A A;  3TCA A;  3RT3 B;  3APD A;  4QRX A;  3HJQ A;  4QNR A;  5DYG A;  1EE8 A;  2VRR B;  2WXL A;  2YJ9 A;  3K8U A;  3DF0 A;  4LF9 M;  4LFA M;  3OJ4 B;  2GLS A;  4IKG A;  5FTN A;  1QAM A;  2ACT A;  5G2N A;  5C2T B;  5G5G A;  2L83 A;  3MHS A;  4KX6 B;  3PS6 A;  5JXV A;  1GLO A;  4PAD A;  4US9 A;  2R62 A;  4MGI E;  4MT5 A;  1T6O A;  2BB5 A;  2W55 A;  4D80 A;  1PGB A;  3UZU A;  2LVP C;  3LW5 F;  3QAR A;  4NZL B;  1GPX A;  4YYS A;  2FUG 1;  2PKO A;  4JI2 M;  1ZP0 B;  4AI6 A;  4WP2 A;  2J7Q B;  4W5C A;  3J7A S;  1SE2 A;  2JNH A;  2XF3 A;  3V3X A;  3SHQ A;  3PZ7 A;  1PAD A;  4DV7 M;  4AQ7 A;  5E6J A;  2M56 B;  1BUI C;  2O6V D;  3C8Y A;  2JA2 A;  1F0Z A;  3GZN B;  2RKO A;  3TEX A;  3KLS X;  3M6A A;  2YNM D;  2FAZ A;  3T1H M;  1V9J A;  1C1K A;  1PJI A;  2XH9 A;  4BS5 A;  1ZMW A;  2R45 A;  5C3J B;  3J80 S;  4S17 A;  3DVN V;  1QQW A;  4EIW A;  1XCQ L;  3RGP A;  1Z5A A;  1KFV A;  1PDX A;  1QDR A;  1SB3 C;  1IP9 A;  1MVK A;  5ITR A;  2DCC A;  4PI3 A;  1XMO M;  1R4M I;  1ZMU A;  1IXS B;  4ZTB A;  4FD2 A;  3K9P A;  3IEJ A;  2LGX A;  4LF8 M;  3T6P A;  1WXS A;  4WWN A;  5IO9 A;  3SAT A;  4LY6 A;  1AAR A;  2HE7 A;  2MJ5 B;  2BPS A;  4C7Z A;  1EWO A;  2DZZ A;  5L83 A;  1QMY A;  1IBX A;  2Y21 A;  2CHX A;  2K0B X;  4LRT A;  3SFD B;  1T3T A;  1KLG D;  4NXM M;  4GIV A;  4LF6 M;  2DWN A;  3KUZ A;  2IGH A;  4LLG M;  1F1H A;  4IBJ A;  4WWP A;  1SJH D;  1F52 A;  1Z6T A;  2D7E A;  3NBI A;  3TMP A;  1V86 A;  2I1K A;  4PT5 A;  3L08 A;  2ZJD A;  3OG5 A;  4HEO A;  2HTM E;  3E9S A;  2JVC A;  3GOE A;  4EZL A;  2YVC A;  2QBY A;  3BK2 A;  3FKY A;  1GC6 A;  2GFO A;  4GHA A;  3NOB A;  2R4J A;  3PHW B;  2M8S A;  2INP E;  2KD0 A;  2BKR B;  4JI6 M;  4IWQ A;  3BY4 A;  2CV1 A;  4BSQ A;  2QQ8 A;  1LO5 D;  2XNA C;  4FK5 A;  1TH2 A;  2CJN A;  1NLJ A;  2JWS A;  2K8H A;  3Q8B A;  2IGD A;  1F2R I;  3PHU A;  2JZP A;  1AU4 A;  1SG9 A;  2DLB A;  2IO2 B;  3CWI A;  1PGY A;  4ANU A;  3KWB X;  2EA0 A;  3VXW A;  3BZD B;  1OJL A;  4DBG A;  4L78 A;  3RNV A;  3FKE A;  1OTR A;  1GG3 A;  5DCN A;  3DVN U;  2LGI A;  4DMY A;  2WXN A;  4JX1 C;  4G0N B;  1YX5 B;  2R6N A;  2MQJ A;  1C1Y B;  3A9J A;  4BOS C;  1QOF A;  1TTE A;  5FLX S;  3U60 B;  2ZVN A;  6PAD A;  2XGN A;  1FCC C;  4KIK B;  1IWD A;  1W5S A;  5DYI A;  1FNN A;  4K3B A;  1QOB A;  3DWG C;  4PK1 A;  5E6P A;  1IBL M;  2V4L A;  4LJ9 A;  4X6H A;  1T43 A;  1R6B X;  3AH7 A;  3EGR A;  1FIQ A;  3OF8 A;  1K8R B;  4C80 A;  1KTK A;  2Y5B A;  2RSU A;  2DAI A;  2DHR A;  2X4A A;  4Q2J A;  1ZDX A;  2KA6 B;  3UIP B;  5GMV A;  4BOQ A;  1R4N I;  2DHY A;  2CHV A;  1NB3 A;  1NEN B;  2L76 A;  2VQF M;  4B3R M;  4K0K M;  4DHZ E;  5EQT A;  2Z3X A;  4KGS A;  2KMM A;  3NZS A;  2XSZ D;  1VEG A;  4PYU A;  4JI7 M;  1WR1 A;  1KOT A;  4WJQ A;  3ILK A;  2DCD A;  3NHE A;  2L52 A;  2AQ2 B;  2INC C;  4USA A;  4P1B C;  4HJK A;  3L10 B;  3PRE A;  3HVD A;  3A42 A;  4IBK A;  1MS6 A;  3H6S A;  2VF7 A;  4MSX A;  3VK7 A;  4AJW A;  2CEA A;  3IG8 A;  3ZNZ B;  1WIA A;  3OF9 A;  2PVG C;  2JQR B;  3K24 A;  4GDL B;  1WX7 A;  4K1R B;  1PYW D;  3KH0 A;  1NJG A;  4ITK A;  3W67 A;  7PCK A;  2Z7J A;  3NZU A;  1NNU C;  4I5S A;  4LJ4 A;  4C4V B;  3RE8 A;  1FXI A;  1IN4 A;  2KVZ A;  3ETR A;  3IXS A;  4NPN A;  2BTW B;  1M6D A;  3FYC A;  2B1N A;  3KVW A;  2W54 A;  4GDK B;  1FFU A;  4M9S A;  3H7P A;  3RVX A;  4MM3 A;  1F9J A;  1DOY A;  4JV5 M;  2KX0 A;  2V9H A;  3IG3 A;  3VDP A;  2KFK B;  1TS2 A;  1PGA A;  5A24 A;  4BZA A;  1G4A E;  4LDT D;  2VII A;  3IMA A;  1L6V A;  4OHJ A;  2XEW A;  2BS4 B;  2LD9 A;  3GCB A;  2LRW A;  1PBH A;  2B1M A;  4FCT A;  3GQ5 A;  1EM7 A;  1GEC E;  2NBW B;  1YQB A;  2L09 A;  3ZLZ A;  2XZF A;  3P5V A;  3M0E A;  1IY2 A;  4JI8 M;  3B74 A;  4HDO A;  3AEE B;  3DBH B;  5D94 A;  4YHH M;  1WJ4 A;  3HX3 A;  1MG4 A;  3A4S C;  3EEC A;  2NQA A;  1XLO A;  3PV1 A;  1V33 A;  4HVB A;  3MTV A;  4JQW C;  2K25 A;  4F8C B;  3R7Q A;  2V1C A;  4IWO A;  2KDL A;  2DWM A;  2KC1 A;  5DPS A;  3BVG A;  2UUA M;  5EP3 A;  1V2Y A;  3AEA B;  3H1U A;  4M01 A;  1F2B A;  1XHB A;  2GMI C;  3KWV A;  1QVR A;  3J2P B;  2H7J A;  3BBA A;  1I4R A;  4O1N A;  5AZG A;  3T8M A;  1HNZ M;  2N1V A;  1XT9 B;  5G5H A;  2C0Y A;  3Q2A C;  3WA0 A;  1N32 M;  1J7A A;  4B08 A;  3GE3 C;  1J0G A;  4YSX B;  3I63 C;  4IW0 A;  3HD3 A;  1WYG A;  3DBL B;  2YFQ A;  2ZAN A;  5CHF A;  1JWB D;  2V3S A;  5BMH A;  2QNJ A;  4AZF A;  4WJP A;  4GOC A;  1XC8 A;  3ZUA A;  4M00 A;  3HJ8 A;  1THE A;  4G3O A;  3U8Z A;  3APF A;  2WYQ A;  1D0K A;  3FTE A;  1AN8 A;  1V49 A;  1IBX B;  1QYR A;  3TIX A;  2QIL A;  2W82 A;  2I2Y A;  3NRZ A;  1J19 A;  4C00 A;  1QUT A;  2L8J A;  3H9D A;  4QRV A;  1DGF A;  4ZHO A;  1Z2M A;  2EO2 A;  3GP7 A;  2AUZ A;  2C7M B;  1IN8 A;  1QDT A;  4WUR A;  1KFU L;  2HWJ A;  3QK0 A;  4QBB A;  3HU2 A;  3H6N A;  2VDB B;  3W31 A;  1TJE A;  4ICU A;  4ITQ A;  2I7P A;  1WZ0 A;  4DHJ D;  2BYT A;  1SE4 A;  2G5G X;  3CIR B;  5ITX E;  1F2R C;  3KVF B;  2WXI A;  4IM3 A;  4M9X A;  4GN1 A;  2D11 A;  3LCV B;  4KV2 A;  2PRE A;  1S3S A;  4X62 M;  3LYY A;  4GKK M;  1K51 A;  3D6S A;  2J0J A;  1UM8 A;  3QAU A;  3SMS A;  3KKU A;  3CGW A;  3KOX E;  1V5O A;  4ARI A;  4G50 A;  1IQP A;  3KXE C;  1JR3 A;  1RRB A;  2Z0D B;  3L13 A;  4W9K A;  2ERC A;  4HXD B;  2GBJ A;  1MJD A;  1C79 A;  2CV2 A;  3U6M A;  4I04 A;  3R2I A;  4BOZ A;  3PLU A;  3SFE B;  2ZTC A;  5CHV A;  1H6U A;  5BYS A;  5E6N A;  4AOF A;  1E8X A;  2K8B A;  4EZJ A;  4ZHP A;  5H37 D;  1WMH B;  4JPS A;  2MHJ A;  1QDQ A;  4L4U A;  3HU3 A;  2FNA A;  1HQR D;  3PHW A;  3GS2 A;  1PIP A;  3E56 A;  2DAE A;  2F5O A;  1EWY C;  3MC8 A;  1I42 A;  3BYT B;  1SIJ A;  4BVU C;  4DR1 M;  3A1Q A;  3J27 B;  4RCO A;  1XXG A;  2ZVO A;  3IVF A;  3X0W A;  5KPT A;  3B08 A;  5EZS A;  1OIZ A;  4DV3 M;  2AUX A;  2KLC A;  1XLP A;  1ZMV A;  3SU8 X;  2YJB A;  1KHP A;  1YZB A;  2R18 A;  2LWP A;  2WXF A;  4I6P A;  1IGD A;  1TGZ B;  1JQJ C;  3B21 A;  2PIA A;  2JF5 A;  1TTN A;  3IT4 B;  4OVZ A;  5L8R F;  3OWE B;  2L05 A;  2OQ4 A;  2L0F A;  4XYC A;  3WCQ A;  1V1P A;  4KGR A;  3U5Z A;  3R66 C;  3ZVV A;  2J7N A;  2JZ1 A;  5DNY A;  3ZC7 B;  3PXG A;  3SFZ A;  1N77 A;  1I35 A;  2WXO A;  4OW0 A;  1UH6 A;  5CHT A;  4WQM A;  3H4M A;  4CJ6 A;  2M17 A;  4DR3 M;  3H7P B;  4JL9 A;  4ANR A;  3EHV A;  2PBH A;  2YEP B;  4CDC B;  2ZCC A;  1C7Y A;  5LMU M;  4GMV A;  1AW7 A;  3OVZ A;  1TZO A;  1F77 A;  3U6P A;  2LWX A;  2CHZ A;  4CIZ A;  4XE0 A;  1TDH A;  1BY8 A;  4PP1 A;  4F1S A;  1NVM A;  4PD2 A;  4JXJ A;  2HJ1 A;  3GLF E;  1L2B A;  2WDQ B;  3LXS A;  4NSR A;  4X64 M;  4DV2 M;  2IPK D;  4TQ1 A;  1S4V A;  3U30 A;  3ZNH A;  4DHZ B;  3KW9 A;  3UGJ A;  1K82 A;  2QP9 X;  2ZNV C;  5D6J B;  4AXL A;  1PCI A;  3RNA C;  3JR4 A;  4OVZ B;  4A9A A;  1N5X A;  1DEU A;  2C9W B;  3N32 A;  4F2L A;  1MHH E;  1AYW A;  5BMG A;  1POP A;  1B1Z A;  1AYF A;  4PDI A;  2VHS A;  2CKH B;  1AU2 A;  3AI5 A;  4CGY B;  4IBI A;  1FH0 A;  3P2B A;  4CQN A;  2ZTD A;  2ZPN A;  2ZZP B;  5EXT A;  4QAY A;  3B7Z A;  2BNK A;  4KZC A;  2R0I A;  2MRO B;  3FYD A;  1UNS A;  3A4R A;  3LQR A;  4ZRK A;  2JUO A;  1PPO A;  1L8Q A;  5E6O A;  4AG5 A;  3LJ3 A;  1YK8 A;  2WBF X;  1IGC A;  3WAO A;  4BOU A;  3I57 A;  3P4R B;  4GH9 A;  1P98 A;  3V6E B;  3MOR A;  4LTU A;  2JUJ A;  4RFB A;  2J4X A;  3KW5 B;  1GUA B;  3RMK C;  4Y28 F;  3FTD A;  1XB2 B;  2WSC F;  2WS3 B;  3EFU A;  5EJC A;  1SXJ D;  3SMP A;  4LK0 M;  1XNR M;  2FFJ A;  4FJC A;  1D5X C;  3O65 A;  3UQB A;  4YVA A;  1YSY A;  2XZU A;  2AYO A;  2XU4 A;  2KRU A;  3V61 A;  4MEM A;  3C3D A;  3P4P B;  3WXF A;  2KQS A;  1TS3 A;  1WGH A;  1YVB A;  3L17 A;  2L4F A;  3HHM A;  1RFA A;  2M19 A;  3U6D A;  3MC9 A;  5T8I A;  1NI3 A;  1NL6 A;  2M60 A;  1WRD B;  3V6C A;  4JE3 B;  3L25 A;  3KP0 E;  2JXT A;  5F02 A;  1LFD A;  2V0G A;  2QZ4 A;  3RGS A;  3HHW A;  1FRD A;  1TH3 A;  3AUL A;  1OQQ A;  5CVN B;  3E21 A;  1V5T A;  1VR9 A;  1AEC A;  4A5U A;  1KM7 A;  1GVN A;  2DZJ A;  1NV9 A;  3H8B A;  1Q39 A;  3SHF A;  1HQY E;  1QAQ A;  4H2A A;  3J7B A;  2KZU A;  3FC4 A;  2KDI A;  3LDZ E;  1I4X A;  3RYT A;  4KLN A;  4JN6 A;  4FAD A;  4BOP A;  1OAI A;  2KVR A;  2C7N B;  2E5L M;  2DNA A;  3H8H A;  3I4V A;  2QC8 A;  3GLF A;  2R9M A;  2DWQ A;  4YTP B;  2Z0E B;  1JQP A;  3BC3 A;  2F5Q A;  4CZW A;  1IXS A;  4AW4 A;  3BB7 A;  1CQV A;  2MCN B;  2JY6 A;  1EU3 A;  1NSF A;  1HA5 A;  1VJV A;  2KWD A;  1QQR A;  3U2S C;  3EIH A;  4HCP B;  3QWL A;  4DV6 M;  5KHO A;  1Q3C A;  4JGH B;  2ZPY A;  2APL A;  2FH0 A;  3U6O A;  4NY0 A;  4GDL A;  4YXD B;  2L7I A;  5BYR A;  1T3Q A;  1JB0 F;  3ZW3 A;  4R7G A;  1L5P A;  4RH6 A;  1DKI A;  1SE9 A;  1GJZ A;  4LDT B;  2LXE A;  1WJU A;  1Y08 A;  4FW9 A;  2DZN B;  4B7G A;  1SIF A;  2NQ8 C;  3VTV A;  1U9V A;  3DDC B;  3R3M A;  5EE0 A;  4A6Q A;  2J7Q A;  3FE3 A;  4GDK A;  2BTE A;  2UXC M;  1EWM A;  3MTN B;  1FNV A;  4MAC A;  2YJC A;  4L1B A;  1U9X A;  1D5Z C;  3HVZ A;  1ITO A;  2KFK A;  1CJL A;  3L28 A;  3R8F A;  5IA7 A;  1X1M A;  3I5J C;  5HI1 A;  3K9M A;  1PE6 A;  3DHG C;  3TBL D;  1WJ6 A;  2WGS A;  1TZ1 A;  3BCN A;  5D3D A;  3T1Y M;  4TUW A;  2RPV A;  4D2K A;  2ZM6 M;  3PNY A;  4HPL B;  2MRP A;  3J9C A;  3ZJU A;  1WGK A;  3B2F A;  4C7Y A;  1TIF A;  3ZRF A;  4G11 A;  4LZJ A;  3U6L A;  1JCK B;  2V1Y A;  3K9O B;  2LGS A;  3CH3 X;  3O65 B;  2DZM A;  3TWK A;  2DZK A;  1WXA A;  2HHH M;  1PUT A;  4LNF A;  1PFD A;  3NVW A;  3GLG E;  2WU5 B;  4ZRI A;  3CBK A;  2WX1 A;  3HWN A;  1D0L A;  4II7 A;  4X66 M;  5IZ7 D;  3MHH A;  1GAB A;  5F3W A;  4RF1 A;  1EIJ A;  3F75 A;  3PT2 A;  3N3K B;  2BWE A;  3GLH A;  3CSF A;  1XF5 L;  3C0R A;  3TWM A;  2J7Q C;  4UDU C;  1V1P B;  4N9F 4;  3FIL A;  5LXH A;  1VSN A;  4LF7 M;  4TKN A;  1N75 A;  2LVA A;  1NB5 A;  5JHB A;  4KKI A;  4TQ0 A;  1CV8 A;  1ET6 A;  4IM0 A;  4FIP A;  4DR4 M;  2LVO C;  3SBJ A;  4LGM A;  2VQE M;  2Y0Q A;  1AIM A;  1L2N A;  3TRK A;  3AOE A;  1NNJ A;  2PE6 B;  2AYN A;  1FXA A;  2Y5B B;  2OP3 A;  2N9K A;  4BAX A;  2DC9 A;  3HWS A;  1B9R A;  1NEK B;  3Q69 A;  5FKA C;  4JI0 M;  2V1U A;  1Z5S B;  2KJR A;  3SR6 A;  3Q3M C;  3K8Z A;  2K47 A;  2QDF A;  4JI3 M;  3HHY A;  3AEB B;  1TKG A;  4HPM B;  1ZW7 A;  2F7D A;  1VQ1 A;  4I6L B;  1T5X D;  4X57 B;  4D8E A;  3DOW A;  3TNX A;  1X37 A;  3P63 A;  4AJY B;  1VCB A;  3N20 C;  5JHA A;  2RMM A;  2R2O A;  4CIS A;  3NHE B;  1TKY A;  3AE8 B;  4L16 A;  2K9D A;  5MPO A;  2WZJ A;  2WLB A;  1K52 A;  3MHV C;  2FCQ A;  2MX2 A;  3AE7 B;  1G71 A;  1H4R A;  2DC6 A;  4P1C C;  3FUU A;  1RLF A;  2ZNV B;  3PRP A;  3VH4 B;  3U52 E;  2A5Y B;  3AJI B;  4GKJ M;  3L2A A;  2XU3 A;  5FR6 A;  1F29 A;  3ALB A;  3I04 M;  2JY7 A;  4BQV A;  3LXF A;  1T0S C;  1UKF A;  4K3C A;  1NYR A;  1L0V B;  1ME4 A;  2QJL A;  4N58 A;  1AU0 A;  1TH4 A;  3B9P A;  1ZIV A;  1VEJ A;  2DZI A;  3L54 A;  4LGY A;  5HG2 A;  1EWP A;  1MJG M;  4S12 A;  1SJE D;  2JU6 X;  3GP1 A;  4B6W A;  4XX5 A;  3VTU A;  3B1L X;  2JTC A;  2B3T A;  3Q8E A;  2MLB A;  2NQD B;  5DPT A;  2JRI B;  4WIP A;  4ZYN A;  4OEM A;  2BDL A;  3C9P A;  1L4Z B;  2R65 A;  1DGB A;  1C78 A;  1D3Z A;  5CHV C;  1A5T A;  3GPY A;  4KKJ A;  3PSE B;  2X38 A;  1P0R A;  1PQS A;  1UBI A;  4B7H A;  3UGB B;  2N7J A;  1CUK A;  1HE8 A;  4CDD B;  3Q3J A;  4P6G A;  3KSX A;  3GQ3 A;  4YYV A;  4KT0 F;  1V81 A;  4M8M A;  1R5L A;  4B95 A;  3HU1 A;  5C18 A;  2UYZ B;  3ZTC A;  3KS8 A;  2O5R A;  2KTR A;  4L2Y A;  2AWT A;  2PEA A;  3TEZ A;  2KQ4 X;  2N7E A;  2MBB B;  2R61 A;  2HKJ A;  3AV8 A;  3ZJT A;  5G55 A;  1YUB A;  1MG8 A;  2R9F A;  1YD8 U;  4OEL A;  4BOS A;  4I4L A;  4YV8 A;  1JWS D;  3LB8 C;  4RF0 A;  2N4F A;  1F2C A;  3E46 A;  1XEE A;  4NOO B;  3OQC A;  3Q8G A;  4LNI A;  4YL8 A;  3D32 A;  3H7D A;  3SDL C;  2HDE A;  5EP1 A;  3NZ3 A;  3ONS A;  5JI2 E;  2AX5 A;  3EA6 A;  4A8X C;  5KQD A;  4M0D A;  3TEY A;  1JR3 D;  3SYL A;  1ZXH A;  2NQI A;  1XLQ A;  1WYW B;  3OJ3 A;  4YWG G;  4MM3 B;  2LUM A;  2L1A A;  1GMY A;  7CAT A;  2WQY B;  1HT2 E;  2K39 A;  3JYU A;  4EFO A;  3GLI A;  5ITU A;  3P5X A;  3Q8A A;  1ZCM A;  3PT2 B;  1WGN A;  2OOB A;  2IZV B;  1C4C A;  3DVG Y;  1U9W A;  1SXJ B;  4F1I A;  4DXG A;  3RZW C;  3BWK A;  2K3U A;  1XXH B;  2DWZ B;  4MGK E;  1IUE A;  4HJG E;  3Q14 C;  4GGQ A;  2I38 A;  3I9V 1;  2Z4R A;  1MPE A;  1O0E A;  1Q10 A;  4XWT A;  1QT9 A;  3KUC B;  4LJ5 A;  2A4Z A;  3SHG B;  2EMT A;  1C76 A;  3RCZ A;  3H8C A;  5LXI B;  1P7E A;  2FID A;  3ZXR A;  3KOW E;  4FXC A;  2J7O A;  4KIK A;  3RZF A;  4XDD A;  1SEB D;  1IN6 A;  1M4V A;  1XD3 B;  3QIJ A;  1IFY A;  4FWG A;  2HAK A;  4IBC A;  3KFQ A;  2AQ1 B;  1L2C A;  1OKS A;  2LEK A;  4LRS A;  3SAU A;  2DZO B;  3IFW B;  5AUK A;  2WXH A;  3M63 B;  2L4E A;  4BKG A;  2JQG R;  1P3Q U;  2VZK B;  4IOI E;  5EP4 A;  3C0R B;  4W9C A;  1IBK M;  3B7Q A;  4B3M M;  4AG6 A;  1FO4 A;  2FYE A;  1G3I A;  5FPW A;  5LLI A;  1P1A A;  3MHS D;  5FTL A;  1WXM A;  2L0T A;  1G59 A;  2X49 A;  4G3X B;  2HTH A;  1XXH A;  4OX9 M;  3KUD B;  4CHT B;  2KWC A;  2KYW A;  1NO1 A;  2D07 B;  5BPV A;  2YJ8 A;  3AED B;  3HK0 A;  3APC A;  4L8R C;  3VLF B;  2HD5 B;  3VDZ A;  1JRU A;  1WM3 A;  2ZW0 A;  1E0Z A;  4N4Z A;  4DXA B;  4FBJ B;  4WQO B;  5EE1 A;  3WAN A;  4FJZ A;  2WXG A;  1QAN A;  1YQ4 B;  3PBH A;  3KX1 A;  8CAT A;  5DPR A;  4JIO U;  2BYF A;  1WIV A;  4A3V B;  3BVM A;  2REX A;  1MEM A;  3DZD A;  2RD0 A;  1WX9 A;  1G6J A;  2G4S A;  1E8W A;  3GRY A;  1FNU A;  2KT7 A;  2GOW A;  4RGN A;  2AVW A;  4I8O A;  4K7W A;  3AL0 C;  1OTR B;  1NVI D;  1GNU A;  2VF8 A;  2JZ0 A;  2IO0 B;  1Z59 A;  2KHW B;  2MR9 A;  1DGJ A;  3V60 A;  1MU5 A;  2JY5 A;  3BBZ A;  4XR7 A;  2AIM A;  2ZW1 A;  3K2L A;  4NL4 H;  5J94 A;  2J0K A;  4RKX A;  4Q7J A;  2KWU B;  2LH0 A;  3KDS E;  3VTW A;  2JX5 A;  5J2R A;  3NBX X;  3N1Y C;  3M7G A;  3NWL A;  1CZP A;  3OTO M;  2WXR A;  2ATO A;  3VQI A;  1SNK A;  2BB6 A;  5FSW A;  3AM9 A;  2O01 F;  2K9X A;  2JYT A;  1LV7 A;  2KAC A;  1SBB B;  4IUM B;  4DDI D;  2O2V B;  2KWV B;  2K6B A;  1QOA A;  3KOY E;  2CR5 A;  2W3S A;  3P5W A;  3U7D A;  3BPM A;  1BT0 A;  3DBR I;  2F5S A;  5EGW A;  2KKC A;  2XFS A;  2DHZ A;  5CVO B;  3MHZ A;  4JI5 M;  1RYJ A;  2K5P A;  2Z59 B;  2BJW A;  3R8B A;  3AU4 A;  4W9J A;  4WJO A;  2ASQ A;  4ZPX A;  4WWO A;  1NPZ A;  1D6E C;  1ACC A;  2WU2 B;  4NQK E;  4ASW C;  4DR6 M;  3HM6 X;  1N33 M;  1EU4 A;  4XWW A;  2BS3 B;  2BJV A;  2P5T A;  4BLC A;  1KSF X;  1SXT A;  3ABV B;  3I01 M;  2HCB A;  4DK5 A;  4K7C A;  4M0W A;  4US8 A;  1OAO C;  4I07 A;  1ZXI A;  3VFD A;  5AUI A;  5EF4 A;  2AEH A;  3GE8 C;  3NG0 A;  2JWU A;  2N9P C;  5C1B A;  1STE A;  1N5W A;  1VZ8 A;  1WGR A;  2WXQ A;  3A9K A;  3ECI A;  3QX1 A;  2G8J A;  4UN2 B;  2LXC A;  1VZ7 A;  4CHK A;  2M4N A;  4W5B A;  4DR2 M;  5EXS A;  2J53 A;  3H7S A;  1OIP A;  1L6U A;  2L32 A;  4QNM A;  4FN2 A;  3IEC A;  1IY0 A;  4LF5 M;  4DXF A;  1UFZ A;  2Q5W D;  2D3G A;  3HZJ A;  3L16 A;  1C9F A;  4ACF A;  3RNB C;  4IBE A;  1SXJ E;  2ONQ A;  3ZQJ A;  4QHT A;  2GBM A;  3QCA A;  3W1S C;  1HTQ A;  1LM8 B;  3VUW A;  2LHE A;  1LXD A;  2Y3A A;  1I94 M;  5IOI A;  1WJN A;  3USV A;  3M62 B;  5IP4 D;  4IG7 B;  1N34 M;  3ZRC A;  2BDZ A;  4XC2 A;  3KYD D;  4GIT A;  1DYQ A;  3GO8 A;  4DUZ M;  1CJE A;  1KLU D;  5BO4 B;  2KW0 A;  4FHK A;  4G54 A;  3PGE A;  4IJE A;  4URK A;  2JSV X;  5HKH A;  4NRW A;  3KYC D;  4MI7 A;  1CMX B;  3GPX A;  1Q3B A;  3CST A;  1JQ4 A;  4KVG B;  2UUC M;  1ZDV A;  3W9C B;  3NY5 A;  2I7N A;  3ZKJ C;  5IAA C;  2BKF A;  1PPD A;  2QIE B;  2WDV B;  3KOZ E;  1Z5B A;  3K1J A;  5LMN M;  2UXB M;  2G45 B;  2IYD B;  3HJS A;  1WSP A;  2BYE A;  2LVO A;  2PE9 A;  3KSE A;  2KN4 A;  2LVQ D;  1L1Z A;  1NJF A;  2SEB D;  3V6E A;  4G4N A;  2DBY A;  1QOG A;  1GAQ B;  1NBF C;  1ESF A;  2JZ3 B;  2IGG A;  3FRI A;  3TUO A;  1OFH A;  3SD5 A;  1DGH B;  4II2 B;  2EKK A;  2P7U A;  5ITX A;  2B3A A;  4PS8 A;  2F4V M;  2RR9 A;  5H92 C;  1SE3 A;  4P6V F;  2X8X X;  2FUH B;  1YJ1 A;  1WZ3 A;  3SAR A;  2E6X A;  3THG A;  4LCD E;  2BWE S;  2LAS A;  1W5T A;  3DVG X;  2O6V B;  1E7V A;  5C1Z A;  4W5W A;  1UGJ A;  3NVZ A;  4Q8H A;  1YLA A;  1UBQ A;  4MEL A;  1I4Q A;  3FAH A;  3AE6 B;  3EUB 2;  1DGG A;  5H8Y E;  3UK6 A;  5TR5 A;  3VAW A;  3QYB A;  4IBD A;  2DNF A;  4EEW A;  4A3O A;  4ZYS A;  2D2Q A;  3JVZ X;  4OVV A;  2W3R A;  2MBO A;  3A33 B;  1XCT L;  2LXA A;  5HFY A;  2VHF A;  2L2D A;  2C96 A;  5EDS A;  4P6E A;  2N1W A;  3AEG B;  2DAK A;  3PNV A;  4IJF A;  2LBC A;  3R7R A;  4AXM A;  4OZA A;  4KSL C;  3JSV B;  3AU5 A;  2PAD A;  3ERV A;  1WFY A;  3Q8C A;  1TLO A;  2CIO A;  1EO6 A;  1IY1 A;  1XQQ A;  2O2V A;  3LMM A;  2QMT A;  3OAW A;  4MDK E;  1ZOY B;  3HUI A;  4GIP A;  3MC0 B;  3GLH E;  3N4C A;  3DFZ A;  3AOE C;  2R9C A;  5FTM A;  1FRR A;  4A90 A;  3P1M A;  3PRM B;  4PS7 A;  2C7H A;  3FD9 A;  1HEZ E;  5FK9 C;  2DC8 A;  2P0R A;  4IWP A;  1WY8 A;  3AE4 B;  2J5Y A;  1X9Y A;  4GC9 A;  1CS8 A;  1Y8G A;  2EJS A;  1MIR A;  4LCB A;  1AWD A;  3ZCB B;  2KFJ A;  1ICF A;  4Q8G A;  3ML9 A;  3W5V B;  1JWU D;  1MHX A;  3M99 A;  2BT6 A;  4IC7 B;  3AI8 A;  1S1Q B;  5BR8 M;  1XLN A;  3WAL A;  1D5M C;  1TY2 A;  1YIW A;  1HT1 E;  1L7Y A;  2C60 A;  1YMH E;  3A46 A;  1ZAE A;  4FHJ A;  2G8E A;  3FUV A;  2Z84 A;  3SC3 A;  5I4D A;  3JAM S;  2KLG A;  5BMI A;  1NV8 A;  3I4Y A;  1I4W A;  3AE3 B;  2BU3 A;  3RVV A;  4MGZ E;  2XFT A;  2G3Q B;  3KFU G;  1UEL A;  4KOD A;  5KHQ A;  2KEB A;  3FTC A;  1J7K A;  2MJE A;  1R2Y A;  2DYO A;  1CVZ A;  2G8L A;  1AYV A;  2OPF A;  3PRZ A;  3QT4 A;  5A2Q S;  3ZO5 B;  3Q3O C;  3NS8 A;  3PPA A;  5JH5 C;  1GJS A;  4YSY B;  9PAP A;  3RD2 A;  5IRE B;  2DXI A;  1RWS A;  1A6R A;  4I6N B;  4OZB A;  5J17 A;  3SAV A;  1V8C A;  1DF0 A;  1E6E B;  4MH0 E;  3BXW A;  1EF1 A;  1FM0 D;  2C5L C;  1WMH A;  3QC8 B;  2LJI A;  4GLS C;  4YYU A;  1R4G A;  4IIW A;  1OEY A;  1LTM A;  1MN3 A;  1JWM D;  4MJS B;  1L1T A;  3D8L A;  4YTN B;  1XKG A;  2K22 A;  2WNM A;  2KDF B;  3Q3N C;  1OFF A;  2HD5 A;  1M94 A;  4K81 A;  3E4R A;  3PW3 A;  4DV1 M;  3UJN A;  2K8C A;  2LGY A;  2KNB A;  3QWZ B;  3AMZ A;  3TQS A;  2OED A;  4NQL B;  4XGA B;  2KXJ A;  5EXX A;  1L2D A;  3NVV A;  1FD6 A;  2KRK A;  1JRP A;  2OOA A;  1V6E A;  1R4N B;  2KNV A;  1D0M A;  2V4I B;  4M0W B;  3A9K B;  3U5Z B;  4KLB A;  1ZE3 D;  2KMA A;  5K16 A;  2Y5C A;  5AZF A;  2CU1 A;  1TS4 A;  2MSE D;  2WSF F;  4LJA A;  1NHG C;  3A98 B;  2DYB A;  2F5N A;  1CTE A;  2ZBK B;  5KPR A;  2V3N A;  1YE9 A;  3AB5 A;  4MSQ B;  1KXR A;  2C98 A;  3DA1 A;  2LVP A;  2GRI A;  4HKQ A;  2JYE A;  1SP4 B;  2KTF A;  4QOS A;  4REZ A;  3WHK A;  3U61 A;  1QKZ A;  2Y20 A;  4ZRQ A;  2Z8Y M;  1VLB A;  4GUA A;  4QHS A;  1PM5 A;  1VDL A;  2QPA A;  2JPH A;  2E01 A;  2D7H A;  1QZM A;  2L7H A;  1TYG B;  3QJ3 A;  2MP2 A;  3IT6 B;  2OJW A;  2QCZ A;  3QJZ A;  4KSK C;  2JXX A;  3HHX A;  2AU1 A;  3SAS A;  1YN5 A;  3V05 A;  3IOQ A;  4CDF B;  1QXP A;  2IO3 B;  2JXN A;  4L6V 6;  3BY4 B;  3W30 A;  4W9D A;  4NJC A;  1E9S A;  2BW2 A;  3KSJ A;  2FCS A;  1CSB B;  1Q1O A;  1S3S G;  1K3B B;  1WF9 A;  1RM6 C;  2BTW A;  4YYQ A;  1PVJ A;  1H8C A;  2O6V A;  1E8Z A;  1N6Z A;  4BBN F;  1KLV A;  4EZK A;  1UF0 A;  1NY6 A;  2OOB B;  3KS4 A;  1BP4 A;  2XU5 A;  3ML8 A;  3U6C A;  2EKE C;  2LMC A;  3GLI B;  3T3N A;  4QRG A;  3ZNG C;  2H5X A;  3VRA B;  4XDC A;  2LNH C;  3IBE A;  1P9D U;  1ME3 A;  3IFU A;  1KFX L;  1CB5 A;  4NJ6 A;  4K7U A;  4B7F A;  8PCH A;  4PCZ A;  1MHW A;  1LGR A;  2TSS A;  2GB1 A;  3RNF C;  1U4A A;  1QAO A;  4HKZ E;  1DOX A;  3AN1 A;  4YT0 B;  4KDL B;  4N6E B;  2OZ2 A;  2CS4 A;  3UI3 A;  3PHX A;  2CHG A;  4BPV A;  3PNR A;  1E5W A;  1E9R A;  1WHC A;  1F2A A;  2Z4S A;  4LG2 A;  2DAF A;  1MEG A;  4A20 A;  1J8C A;  2WP9 B;  2J0M A;  1GB1 A;  2XN9 C;  4G4R A;  4W9H A;  1VZ6 A;  1SSN A;  1TT5 B;  2QBY B;  4M02 A;  3URY A;  2GBN A;  2D3A A;  1EFU B;  2XK5 A;  4EUT A;  3D8B A;  1P3Q Q;  2N0S B;  4E3C A;  1WR6 E;  1KHQ A;  2LHG A;  4LF4 M;  4LNK A;  2G9H D;  1K3W A;  1J7B A;  3WAM A;  1N61 A;  1R7S A;  1ZGU B;  3BWU D;  4WWM A;  3W68 A;  4M8N A;  5CTR C;  3GRR A;  2YJ2 A;  2NMQ A;  1EUV B;  2UZJ A;  1MX0 A;  2FQ9 A;  3EFC A;  3QA8 A;  1RU3 A;  1VG5 A;  4KO8 A;  4KHP M;  2FCN A;  4ZOH C;  3U6Q A;  2KZR A;  3BVZ A;  5ITT A;  3VR9 B;  2DCB A;  3OVX A;  3TSS A;  3UIN B;  2R9N A;  4RMA A;  2N35 A;  2B76 B;  1ROE A;  5EE3 A;  1YQ3 B;  3DPD A;  3O13 A;  2YQZ A;  4DHJ B;  3I3T A;  3BK1 A;  1HTO A;  2NQG A;  4FWH A;  3Q6B A;  2LRU A;  3B7N A;  4N79 A;  2R6F A;  1KJT A;  2KXE A;  1NY5 A;  4DV0 M;  1RAX A;  2D3C A;  4DDG D;  2ARY A;  3X23 A;  1PRB A;  4HLE A;  3VUY A;  2PMV A;  4MGY E;  1FCL A;  3BIN A;  2RGO A;  5FTJ A;  2CUZ A;  1JAL A;  1XXH E;  2C99 A;  1TKE A;  1WGG A;  4DR7 M;  4LJ8 A;  3VHT C;  3MP2 A;  2R46 A;  2DC7 A;  4DV5 M;  1QF6 A;  3IUT A;  3QSD A;  1BML C;  4ANW A;  2BF8 B;  3CF0 A;  2GNO A;  5TSS A;  3CTW B;  3KP1 E;  1C4P A;  4OVU A;  4HXD A;  2HH5 A;  3S3Q A;  1I7H A;  3M3J A;  1NQC A;  1WH3 A;  4L15 A;  3DCG A;  4HPP A;  2MBE A;  3RPF C;  4W4U A;  1TL9 A;  1FFV A;  2OJR A;  2CE7 A;  2CWB A;  4GC5 A;  2GI9 A;  3U60 A;  3F5V A;  2J52 A;  2WXK A;  2NR2 A;  4NAW B;  2KAN A;  1XNQ M;  1JR3 E;  1GLN A;  3SYK A;  4XZ4 A;  2PLP A;  2E3T A;  1N63 A;  2JQF R;  4MZO A;  3P4S B;  3BOS A;  2BWB A;  2MA9 B;  5BYQ A;  4RM8 A;  2MH8 A;  4WAF A;  2KN5 A;  4NC6 A;  1DV0 A;  2KJH B;  1J7C A;  3A45 A;  3NS1 A;  3VDU A;  1D4B A;  1Y4H A;  4B3S M;  3TL5 A;  4AP4 C;  2E02 A;  4E74 A;  3SAW A;  3RUI B;  3GQ4 A;  1IXR C;  4EE2 A;  1HR0 M;  2FIF A;  4JI4 M;  1WM2 A;  2WDT B;  4E71 A;  1I4G A;  3BII D;  1XMQ M;  1OFI A;  2RDB C;  4HWI B;  5L95 C;  1ZUD 2;  3Q8X A;  4PDG A;  3PZ8 A;  2IBI B;  3U4E G;  1XWI A;  3CF2 A;  4JYA M;  2N9E B;  4P17 A;  1EF7 A;  3TPZ A;  2JY6 B;  4C4V A;  1TBE A;  1YN4 A;  2CJO A;  2WXJ A;  2UWQ A;  2E03 A;  1WRI A;  1DO0 A;  3N1X C;  3P4Q B;  1FXT B;  3DWM A;  3CBJ A;  3ZNI D;  5EP2 A;  5CHW A;  2ZAM A;  1AU3 A;  1UWX A;  2DCA A;  2DVW B;  3N30 A;  1IYF A;  1OQR A;  4HL4 A;  3S2A A;  4LFC M;  2L00 B;  4R71 A;  4LZZ A;  1WGY A;  1WXV A;  3B2G A;  3KQ4 A;  4KZ0 A;  3HHZ A;  2FUD A;  3TEW A;  3FRH A;  2BVC A;  3L0W B;  4KGT A;  3DBR B;  3PRP B;  2F5P A;  3MK6 A;  1E90 A;  4DQO C;  5JA7 A;  5EE9 A;  2KJ6 A;  2PNS A;  2LTU A;  2C9C A;  4IM2 A;  3U6E A;  2ICI A;  3RFW A;  3PZD A;  1JWA D;  3QAQ A;  4TSS A;  4II3 B;  1E7P B;  3MJW A;  4MH8 A;  2CFO A;  3ZQ4 A;  1UZX B;  3A1Q B;  2HWK A;  1TF0 B;  3PVL A;  2ACZ B;  3FUW A;  1WGD A;  3AEC B;  4JI1 M;  3GB1 A;  4ICV A;  4PP2 E;  3AEF B;  3TE6 A;  3IHP A;  2DEN A;  5C23 A;  2FE8 A;  4NAW A;  2FTD A;  4AKI A;  3M95 A;  3PHX B;  3W1Y A;  4NJ7 A;  2CHW A;  3H4J A;  2R44 A;  1K50 A;  1GC7 A;  4CO7 A;  2DZY A;  4DR5 M;  3KWL A;  2WXM A;  5D2M B;  1QZE A;  4D81 A;  4JWU C;  3JW0 X;  3HM3 A;  3GZN I;  1WE7 A;  1DGH A;  2O25 A;  4GXB A;  4IDI A;  4ZUX U;  1UGM A;  4ARC A;  1CQD A;  2LUE A;  3B79 A;  3P5U A;  3NUH B;  2UU9 M;  1K53 A;  4LJO B;  4HCN B;  4TUU A;  3R9X B;  4M9Z A;  2V6Z M;  5DFL A;  2RGH A;  4W9G A;  3AFH A;  2M5Z A;  3UMM A;  1IBM M;  3B9J A;  4LJ7 A;  2IY1 B;  2XBB C;  4AUQ C;  2LHD A;  2HXZ A;  3GPU A;  1I4H A;  2L3Z A;  4JLC A;  4NXN M;  2IND C;  4IUM A;  5IT9 S;  2DOS A;  2JRI A;  4W9E A;  3LVV A;  4P7I A;  3K9O A;  3JR5 A;  3GLG B;  2NCN A;  3AE9 B;  2NTS A;  4XUI A;  2WXP A;  1WXQ A;  2HL7 A;  3DBL I;  2FT2 A;  3I3T B;  1WE6 A;  2WWZ A;  1V80 A;  2G6D A;  3BOW A;  1V97 A;  3VK8 A;  2MGW A;  2DAM A;  1ZPS A;  2F1G A;  2HHN A;  3TMP B;  2Y0T A;  3EC8 A;  2C9O A;  2J42 A;  5FTK A;  4OZC A;  4ZRJ A;  1YX6 B;  2DWL A;  2QEJ C;  5AEK B;  2ZCB A;  4LNN A;  4CYE A;  3HRD D;  1IN7 A;  1HNW M;  2D5G A;  3B89 A;  2Q2E B;  3HKP A;  1WWT A;  3A9J B;  1PXV A;  4YSZ B;  1PPP A;  3DBS A;  1VEK A;  3LQQ A;  4AKG A;  4EOY A;  1AYU A;  1ET9 A;  1T6B X;  1GJT A;  2QSD A;  3WXE A;  2E00 A;  3DBH I;  2YLM A;  3IAM 1;  2INN E;  4XGI A;  1ISN A;  2MBH A;  4PS3 A;  2H88 B;  4FA6 A;  2RDG A;  2R4E A;  5GXG B;  2KZS A;  1YNT E;  1DO2 A;  1G8P A;  1J09 A;  2QSF X;  3IG5 A;  2CV0 A;  2KMC A;  3GLG A;  4RM9 A;  1GL7 A;  4BBN C;  1PJT A;  4BKS D;  4BKT A;  2LHC A;  3N1Z C;  1R2Z A;  3SEB A;  2BGF A;  2RGF A;  3BPF A;  2LJ5 A;  4RNA A;  2UUB M;  4RGO S;  5CX3 A;  2GHU A;  2K6D B;  2KX3 A;  2DAJ A;  2EEL A;  4A55 A;  3MFG A;  1IM2 A;  4AQY M;  1YJI A;  4BBA A;  2LI5 A;  3HHI A;  5JH3 A;  1E32 A;  1E94 E;  2G3Q A;  3U6S A;  2AYO B;  1ZV1 A;  4FJV B;  4NAM A;  4FCW A;  3RUL A;  1FJG M;  4MJS A;  1WR1 B;  1TR8 A;  3P42 A;  1NHW C;  2Z8L A;  1GL6 A;  3Q8F A;  5IN7 A;  3HGI A;  3GRV A;  3PLV A;  2A5U A;  1GCB A;  1WX8 A;  2FO5 A;  1QUS A;  1KH0 A;  4RGT A;  2AS8 A;  4HRO A;  3LFY A;  4IP3 A;  1T0R C;  1HUC B;  4KDI C;  3DHI C;  4WAA A;  2JZZ A;  4W9L A;  1STF E;  4R3D A;  3AE1 B;  1G41 A;  4WW0 A;  2VH1 A;  3AE2 B;  5FR3 A;  1JRO A;  1GO5 A;  4IBB A;  2D7G A;  2DI0 A;  4AKH A;  3ZDM C;  2SAK A;  1YAL A;  2FRQ A;  3PRM A;  4EKU A;  3TWL A;  3W5U B;  4F7Z A;  3C58 A;  2WDR B;  2OO9 A;  3PO0 A;  5HHD G;  3RNG C;  3K92 A;  1L0X B;  1V92 A;  4J6I A;  3C3E A;  2N9L A;  4RY2 A;  5JZE A;  4HWY A;  4CDE B;  1XO3 A;  4LFB M;  3ZTD A;  1IPG A;  1ORY B;  1TU6 A;  3EIE A;  5DPW A;  5KQ8 A;  1PGX A;  3MMP A;  1YT7 A;  3TJP A;  3QHT A;  3CF6 E;  1FPY A;  4ANV A;  3W0L B;  4A3P A;  3DOA A;  1Y56 A;  2NTT A;  2N7D A;  2BBC A;  1HZ6 A;  2JT4 B;  4GMQ A;  3VKH A;  3IV2 A;  1V1O A;  1HZ5 A;  2V3P A;  2JP7 A;  3HY5 A;  2GBR A;  2EUC A;  1HJP A;  3MTN A;  1IN5 A;  2NBU A;  3DHH C;  1TS5 A;  2H1R A;  2KOX A;  2YEP F;  5LNK 1;  3CMM B;  2LFI A;  3W0F A;  1E9M A;  5PAD A;  2UU7 A;  5IKC M;  2KO3 A;  1YN3 A;  2L7R A;  2MH7 A;  1UWM A;  4TV3 A;  1E10 A;  2JWZ A;  2CB5 A;  3L26 A;  4HRS A;  2D3B A;  1CK1 A;  4L23 A;  4G4O A;  2MBQ A;  1SXJ A;  2PJH A;  3ZGZ A;  4DWF A;  2CRU A;  2JRH A;  1N36 M;  4HK2 A;  3RVW A;  1IXZ A;  2KDB A;  2QHO A;  1DOI A;  3GLI E;  1AIP C;  3VRB B;  4K7S A;  1FMA D;  3QQ8 B;  4D82 A;  2AL3 A;  1GOZ A;  1NYQ A;  3JSV A;  4X65 M;  4RKU F;  3KWZ A;  2BQQ A;  1E7U A;  1HXY D;  3NVY A;  2DJG B;  3NJT A;  2WSE F;  1VRA B;  4Z8X A;  2MJD A;  3RNE C;  4AWJ A;  4IBG A;  5KPZ A;  3RI7 C;  3W2D A;  1CPJ A;  4D8B A;  1WJ7 A;  3I51 A;  2KK8 A;  3ZDT A;  2KAJ A;  5EZQ A;  1K3X A;  4FCV A;  1Y8R C;  2D10 A;  2LGD A;  1EWL A;  1U5I A;  4DV4 M;  4B0E A;  3V62 A;  2IO1 B;  2NPT B;  3AV0 A;  5JI3 E;  4WA6 A;  1P7F A;  3FUX A;  4FLH A;  1PJQ A;  3ENE A;  3ZJV A;  2KDE B;  1PJJ A;  3GLF B;  4N59 A;  2X8A A;  2GQF A;  1ZKH A;  2BYV E;  1GKI A;  4FJY A;  5IWA M;  3FTF A;  2O6X A;  3IAS 1;  1PJS A;  3I06 A;  1VDV A;  2Y5P A;  3V6C B;  3N9Y C;  2L6O A;  3BYY B;  2MWS B;  4AS1 A;  3T38 A;  2PTL A;  1SXJ C;  3VH3 B;  3VR8 B;  1R4M B;  3AKZ A;  1VDD A;  3ZXV A;  4B9K A;  4MSM B;  4HEA 1;  3L27 A;  1ATK A;  2MP2 B;  4B0M A;  2CU3 A;  4BOZ B;  3FIL B;  2GBK A; 
#chains in the Genus database with same CATH homology
 1FNW A;  1EWC A;  1QIL A;  2XEP A;  4NSO B;  2XSZ A;  4YTM B;  3ZYY X;  3WHL A;  4XZX A;  5GKN A;  4GRI A;  1A70 A;  2H89 B;  1GB4 A;  3J81 S;  4I81 A;  4IBF A;  1MI0 A;  1R7R A;  4D8I A;  3VKG A;  4B3T M;  3L29 A;  5KO3 A;  2AGA A;  1N78 A;  5D3I B;  4QOZ C;  3AE5 B;  1D2N A;  4MB7 A;  1TDZ A;  1JML A;  3MP9 A;  1SF0 A;  4G6Z A;  1FEH A;  5E26 A;  4OU7 A;  2QCU A;  3W1S A;  1KF6 B;  2AQ3 B;  3ZH9 B;  4ZRP A;  4JWS C;  4FWD A;  2RDH A;  4C56 C;  1C4A A;  2ON8 A;  2IJ0 A;  2C5R A;  1KFY B;  3GRU A;  1ENF A;  1RFK A;  2MEK A;  4FVM A;  3KW6 A;  4NRV A;  2FBW B;  1TGU A;  3GPP A;  3GLH B;  3U7Z A;  1Z5C A;  4Z6Y A;  1J5E M;  4G4Q A;  4LJ6 A;  1HQC A;  1QLB B;  3T15 A;  5ITQ A;  4HLQ A;  1UUP A;  2AHM A;  3AOG A;  1N62 A;  4J3O D;  2PW9 A;  4P16 A;  3T3O A;  3PFI A;  4TMA B;  2BS2 B;  4XBO A;  2XLJ A;  1TY0 A;  2IDY A;  2MJ3 A;  3TL4 X;  4GHL A;  1C77 A;  2UXD M;  2FOI C;  3PSE A;  2CHQ A;  4WH4 A;  2YR0 A;  1ZQ9 A;  5ITY A;  4RGM A;  2PVO D;  4DUY M;  1KRH A;  2QEN A;  1BXT A;  1KYI A;  2G1E A;  3R2T A;  1VJK A;  4YY3 M;  1JW9 D;  1L0Y B;  3RFZ B;  1YJJ A;  2DYM A;  3LVW A;  5D7G A;  3PVS A;  1HNX M;  1I4P A;  2VZK D;  3L4P A;  2ZAO A;  3U61 B;  2EKI A;  3FUT A;  1L4D B;  4BB9 A;  5EXP A;  4MGH A;  1N60 A;  2K0P A;  3MJ5 A;  2KDM A;  2OHF A;  2M0A A;  3HJQ A;  4QNR A;  5DYG A;  1EE8 A;  2WXL A;  4LF9 M;  4LFA M;  4IKG A;  5FTN A;  1QAM A;  5C2T B;  5G5G A;  2L83 A;  4KX6 B;  5JXV A;  4US9 A;  2R62 A;  4MGI E;  4MT5 A;  2BB5 A;  2W55 A;  4D80 A;  1PGB A;  3UZU A;  4NZL B;  1GPX A;  2FUG 1;  2PKO A;  4JI2 M;  1ZP0 B;  4AI6 A;  3J7A S;  1SE2 A;  2XF3 A;  3V3X A;  3PZ7 A;  4DV7 M;  4AQ7 A;  5E6J A;  2M56 B;  1BUI C;  3C8Y A;  2JA2 A;  1F0Z A;  2RKO A;  3TEX A;  3KLS X;  3M6A A;  2YNM D;  3T1H M;  1C1K A;  1PJI A;  2XH9 A;  2R45 A;  5C3J B;  3J80 S;  1QQW A;  4EIW A;  1XCQ L;  3RGP A;  1Z5A A;  1KFV A;  1PDX A;  1SB3 C;  1MVK A;  5ITR A;  1XMO M;  1IXS B;  4ZTB A;  4FD2 A;  4LF8 M;  3SAT A;  4LY6 A;  4C7Z A;  1IBX A;  2Y21 A;  4LRT A;  3SFD B;  1T3T A;  1KLG D;  4NXM M;  4LF6 M;  2DWN A;  2IGH A;  4LLG M;  4IBJ A;  1SJH D;  1Z6T A;  2D7E A;  3NBI A;  3TMP A;  4PT5 A;  2HTM E;  3E9S A;  2QBY A;  3BK2 A;  4GHA A;  2R4J A;  2INP E;  4JI6 M;  3BY4 A;  2CV1 A;  1LO5 D;  2XNA C;  1TH2 A;  2CJN A;  3Q8B A;  2IGD A;  1F2R I;  3PHU A;  2JZP A;  2DLB A;  3CWI A;  2EA0 A;  3BZD B;  1OJL A;  4L78 A;  3RNV A;  3FKE A;  2LGI A;  2WXN A;  4JX1 C;  1QOF A;  5FLX S;  3U60 B;  2XGN A;  1FCC C;  1W5S A;  5DYI A;  1FNN A;  1QOB A;  3DWG C;  1IBL M;  4LJ9 A;  1R6B X;  3AH7 A;  3EGR A;  1FIQ A;  4C80 A;  1KTK A;  2DHR A;  2X4A A;  4Q2J A;  1ZDX A;  2KA6 B;  4BOQ A;  2CHV A;  1NEN B;  2VQF M;  4B3R M;  4K0K M;  5EQT A;  2Z3X A;  4KGS A;  2KMM A;  2XSZ D;  4JI7 M;  3ILK A;  2L52 A;  2AQ2 B;  4USA A;  3HVD A;  3A42 A;  4IBK A;  3VK7 A;  2CEA A;  3IG8 A;  2PVG C;  2JQR B;  4GDL B;  1PYW D;  1NJG A;  4ITK A;  2Z7J A;  1NNU C;  4I5S A;  4LJ4 A;  3RE8 A;  1FXI A;  1IN4 A;  3IXS A;  3ETR A;  2BTW B;  3FYC A;  3KVW A;  2W54 A;  4GDK B;  1FFU A;  4M9S A;  1DOY A;  4JV5 M;  3VDP A;  1TS2 A;  1PGA A;  1G4A E;  2VII A;  1L6V A;  4OHJ A;  2BS4 B;  4FCT A;  3GQ5 A;  1EM7 A;  2L09 A;  2XZF A;  3M0E A;  1IY2 A;  4JI8 M;  3AEE B;  4YHH M;  1XLO A;  3MTV A;  2V1C A;  2DWM A;  3BVG A;  2UUA M;  5EP3 A;  3AEA B;  1XHB A;  3KWV A;  1QVR A;  3J2P B;  3BBA A;  1I4R A;  4O1N A;  1HNZ M;  5G5H A;  1N32 M;  1J7A A;  4B08 A;  4YSX B;  1WYG A;  2YFQ A;  2ZAN A;  1JWB D;  5BMH A;  4AZF A;  1XC8 A;  3HJ8 A;  3FTE A;  1AN8 A;  1IBX B;  1QYR A;  2QIL A;  2W82 A;  2I2Y A;  3NRZ A;  1DGF A;  4ZHO A;  2EO2 A;  3GP7 A;  1IN8 A;  4WUR A;  3HU2 A;  3W31 A;  1TJE A;  4ITQ A;  2I7P A;  2BYT A;  1SE4 A;  2G5G X;  3CIR B;  5ITX E;  1F2R C;  2WXI A;  4M9X A;  1S3S A;  4X62 M;  3LYY A;  4GKK M;  1K51 A;  1UM8 A;  3QAU A;  3SMS A;  3KOX E;  4ARI A;  3KXE C;  1IQP A;  1JR3 A;  2ERC A;  4HXD B;  1C79 A;  2CV2 A;  3U6M A;  3R2I A;  4BOZ A;  3SFE B;  1H6U A;  5BYS A;  4ZHP A;  5H37 D;  4JPS A;  4L4U A;  3HU3 A;  2FNA A;  1HQR D;  3PHW A;  3GS2 A;  3E56 A;  2F5O A;  1EWY C;  3BYT B;  1SIJ A;  4DR1 M;  3J27 B;  4RCO A;  1XXG A;  5KPT A;  5EZS A;  4DV3 M;  1XLP A;  1YZB A;  2R18 A;  2WXF A;  1IGD A;  1JQJ C;  3B21 A;  2PIA A;  3IT4 B;  4OVZ A;  3OWE B;  2OQ4 A;  3WCQ A;  1V1P A;  4KGR A;  3U5Z A;  2J7N A;  5DNY A;  3ZC7 B;  3PXG A;  3SFZ A;  1N77 A;  2WXO A;  4OW0 A;  4WQM A;  3H4M A;  4DR3 M;  2YEP B;  5LMU M;  1AW7 A;  1TZO A;  1F77 A;  3U6P A;  2LWX A;  4XE0 A;  1TDH A;  1NVM A;  4PD2 A;  4JXJ A;  1L2B A;  2WDQ B;  4NSR A;  4X64 M;  4DV2 M;  2IPK D;  4TQ1 A;  3ZNH A;  3UGJ A;  1K82 A;  2QP9 X;  3JR4 A;  4OVZ B;  4A9A A;  1N5X A;  1MHH E;  5BMG A;  1B1Z A;  1AYF A;  4PDI A;  4CGY B;  4IBI A;  4CQN A;  5EXT A;  2BNK A;  3FYD A;  1UNS A;  3LQR A;  1L8Q A;  4AG5 A;  1IGC A;  4BOU A;  3I57 A;  3P4R B;  4GH9 A;  4LTU A;  4RFB A;  2J4X A;  3FTD A;  2WS3 B;  5EJC A;  1SXJ D;  3SMP A;  4LK0 M;  1XNR M;  2FFJ A;  1D5X C;  3O65 A;  1YSY A;  2XZU A;  2KRU A;  3P4P B;  1TS3 A;  2M19 A;  3U6D A;  5T8I A;  1NI3 A;  2M60 A;  4JE3 B;  3L25 A;  3KP0 E;  2JXT A;  2V0G A;  2QZ4 A;  3RGS A;  3HHW A;  1FRD A;  1TH3 A;  1OQQ A;  1VR9 A;  4A5U A;  1GVN A;  1Q39 A;  3SHF A;  1HQY E;  4H2A A;  1QAQ A;  3J7B A;  2KZU A;  3FC4 A;  1I4X A;  4KLN A;  4JN6 A;  4BOP A;  2E5L M;  3H8H A;  3I4V A;  3GLF A;  2DWQ A;  4YTP B;  2F5Q A;  4AW4 A;  3BB7 A;  1CQV A;  1EU3 A;  1NSF A;  1HA5 A;  2KWD A;  1QQR A;  3U2S C;  3EIH A;  3QWL A;  4DV6 M;  1Q3C A;  3U6O A;  4YXD B;  2L7I A;  5BYR A;  1T3Q A;  4R7G A;  1L5P A;  4RH6 A;  1DKI A;  2LXE A;  4FW9 A;  2DZN B;  4B7G A;  2NQ8 C;  3FIL B;  5EE0 A;  4A6Q A;  2J7Q A;  2BTE A;  2UXC M;  1FNV A;  4MAC A;  4L1B A;  1D5Z C;  3HVZ A;  3L28 A;  3R8F A;  5HI1 A;  5D3D A;  3T1Y M;  4TUW A;  2RPV A;  4D2K A;  2ZM6 M;  3PNY A;  3J9C A;  3ZJU A;  1WGK A;  3B2F A;  4C7Y A;  4LZJ A;  3U6L A;  1JCK B;  3TWK A;  2HHH M;  1PUT A;  1PFD A;  3NVW A;  2WU5 B;  4II7 A;  4X66 M;  5IZ7 D;  5F3W A;  4RF1 A;  3PT2 A;  3GLH A;  1XF5 L;  3C0R A;  3TWM A;  2J7Q C;  4UDU C;  1V1P B;  3FIL A;  4LF7 M;  1N75 A;  4KKI A;  4TQ0 A;  1ET6 A;  4DR4 M;  3SBJ A;  4LGM A;  2VQE M;  2Y0Q A;  3TRK A;  3AOE A;  1NNJ A;  1FXA A;  2N9K A;  3HWS A;  1B9R A;  1NEK B;  3Q69 A;  5FKA C;  4JI0 M;  2V1U A;  3SR6 A;  3K8Z A;  2K47 A;  4JI3 M;  3HHY A;  3AEB B;  1TKG A;  1T5X D;  4D8E A;  1X37 A;  3P63 A;  2RMM A;  4CIS A;  1TKY A;  3AE8 B;  4L16 A;  5MPO A;  2WLB A;  1K52 A;  3MHV C;  3AE7 B;  3FUU A;  3PRP A;  3U52 E;  2A5Y B;  3AJI B;  4GKJ M;  3L2A A;  3LXF A;  1UKF A;  1NYR A;  1L0V B;  2QJL A;  4N58 A;  1TH4 A;  3B9P A;  5HG2 A;  4LGY A;  4S12 A;  1SJE D;  2JU6 X;  3GP1 A;  2JTC A;  3Q8E A;  4WIP A;  1L4Z B;  2R65 A;  1DGB A;  1C78 A;  3GPY A;  4KKJ A;  2X38 A;  4B7H A;  2N7J A;  3KSX A;  3GQ3 A;  3HU1 A;  5C18 A;  3KS8 A;  2O5R A;  4L2Y A;  3TEZ A;  2KQ4 X;  2R61 A;  2HKJ A;  3AV8 A;  3ZJT A;  1YUB A;  4BOS A;  4I4L A;  1JWS D;  3LB8 C;  4RF0 A;  1XEE A;  4NOO B;  3OQC A;  5EP1 A;  3NZ3 A;  5JI2 E;  2AX5 A;  3EA6 A;  4A8X C;  5KQD A;  4M0D A;  3TEY A;  1JR3 D;  3SYL A;  1ZXH A;  1XLQ A;  4YWG G;  4MM3 B;  2LUM A;  2L1A A;  7CAT A;  2WQY B;  1HT2 E;  3GLI A;  5ITU A;  3Q8A A;  1C4C A;  1SXJ B;  4DXG A;  2K3U A;  1XXH B;  2DWZ B;  4MGK E;  1IUE A;  4HJG E;  2I38 A;  3I9V 1;  2Z4R A;  1MPE A;  1Q10 A;  4XWT A;  1QT9 A;  4LJ5 A;  3SHG B;  1C76 A;  1P7E A;  3KOW E;  4FXC A;  2J7O A;  4XDD A;  1SEB D;  1IN6 A;  1M4V A;  4FWG A;  4IBC A;  2AQ1 B;  1L2C A;  2LEK A;  4LRS A;  3SAU A;  2DZO B;  5AUK A;  2WXH A;  2VZK B;  4IOI E;  5EP4 A;  1IBK M;  4B3M M;  4AG6 A;  1FO4 A;  1G3I A;  5FTL A;  1G59 A;  2X49 A;  1XXH A;  4OX9 M;  4CHT B;  5BPV A;  3AED B;  4L8R C;  3VLF B;  2ZW0 A;  1E0Z A;  5EE1 A;  2WXG A;  1QAN A;  1YQ4 B;  8CAT A;  4A3V B;  3BVM A;  3DZD A;  3GRY A;  1FNU A;  4RGN A;  4I8O A;  3AL0 C;  1NVI D;  1Z59 A;  1DGJ A;  1MU5 A;  2ZW1 A;  3K2L A;  4NL4 H;  4RKX A;  2LH0 A;  3KDS E;  2JX5 A;  3M7G A;  3NWL A;  1CZP A;  3OTO M;  2WXR A;  3VQI A;  2BB6 A;  5FSW A;  3AM9 A;  2K9X A;  2JYT A;  1LV7 A;  2KAC A;  1SBB B;  2W3S A;  1QOA A;  3KOY E;  2F5S A;  2XFS A;  3MHZ A;  4JI5 M;  1RYJ A;  2K5P A;  2BJW A;  3R8B A;  4ZPX A;  1D6E C;  1ACC A;  2WU2 B;  4DR6 M;  1N33 M;  1EU4 A;  4XWW A;  2BS3 B;  2BJV A;  2P5T A;  4BLC A;  1KSF X;  1SXT A;  3ABV B;  2HCB A;  4M0W A;  4US8 A;  1ZXI A;  3VFD A;  2JWU A;  5C1B A;  1STE A;  1N5W A;  1VZ8 A;  2WXQ A;  1VZ7 A;  4DR2 M;  5EXS A;  2J53 A;  1L6U A;  2L32 A;  4QNM A;  1IY0 A;  4LF5 M;  4DXF A;  2Q5W D;  1C9F A;  4IBE A;  1SXJ E;  2ONQ A;  4QHT A;  2LHE A;  2Y3A A;  1I94 M;  1N34 M;  4GIT A;  1DYQ A;  3GO8 A;  4DUZ M;  1CJE A;  1KLU D;  2KW0 A;  4IJE A;  2JSV X;  4NRW A;  4MI7 A;  3GPX A;  1Q3B A;  1JQ4 A;  2UUC M;  1ZDV A;  3W9C B;  2I7N A;  2QIE B;  2WDV B;  3KOZ E;  1Z5B A;  3K1J A;  5LMN M;  2UXB M;  3HJS A;  1WSP A;  2KN4 A;  1L1Z A;  2SEB D;  1NJF A;  4G4N A;  2DBY A;  1QOG A;  1GAQ B;  1ESF A;  2IGG A;  3TUO A;  1OFH A;  1DGH B;  5ITX A;  5H92 C;  2F4V M;  1SE3 A;  4P6V F;  3SAR A;  2E6X A;  3THG A;  1W5T A;  4W5W A;  1UGJ A;  3NVZ A;  1I4Q A;  3FAH A;  3AE6 B;  3EUB 2;  1DGG A;  5H8Y E;  3UK6 A;  4IBD A;  4ZYS A;  2W3R A;  1XCT L;  5HFY A;  2C96 A;  3AEG B;  3PNV A;  4IJF A;  4OZA A;  3Q8C A;  1IY1 A;  3LMM A;  2QMT A;  1ZOY B;  3HUI A;  4GIP A;  3MC0 B;  3DFZ A;  3AOE C;  5FTM A;  1FRR A;  4A90 A;  3P1M A;  3FD9 A;  1HEZ E;  5FK9 C;  3AE4 B;  4GC9 A;  4LCB A;  1AWD A;  3ZCB B;  3W5V B;  1JWU D;  1MHX A;  2BT6 A;  5BR8 M;  1XLN A;  1D5M C;  1TY2 A;  1HT1 E;  1YMH E;  3A46 A;  1ZAE A;  3FUV A;  2Z84 A;  3SC3 A;  5I4D A;  3JAM S;  5BMI A;  3I4Y A;  3AE3 B;  1I4W A;  2BU3 A;  4MGZ E;  2XFT A;  3KFU G;  4KOD A;  2KEB A;  3FTC A;  1J7K A;  2MJE A;  1R2Y A;  2DYO A;  2G8L A;  2OPF A;  5A2Q S;  4YSY B;  5IRE B;  2DXI A;  1RWS A;  4OZB A;  3SAV A;  1V8C A;  1E6E B;  4MH0 E;  1FM0 D;  2LJI A;  4GLS C;  4IIW A;  1JWM D;  1L1T A;  3D8L A;  4YTN B;  2K22 A;  2WNM A;  1OFF A;  3E4R A;  4DV1 M;  3UJN A;  3AMZ A;  3TQS A;  2OED A;  5EXX A;  1L2D A;  3NVV A;  1FD6 A;  2KRK A;  1JRP A;  2V4I B;  3U5Z B;  1ZE3 D;  2Y5C A;  1TS4 A;  4LJA A;  1NHG C;  3A98 B;  2F5N A;  2ZBK B;  5KPR A;  2V3N A;  1YE9 A;  3AB5 A;  2C98 A;  3DA1 A;  2GRI A;  4HKQ A;  2JYE A;  4QOS A;  4REZ A;  3WHK A;  3U61 A;  1QKZ A;  2Y20 A;  4ZRQ A;  1VLB A;  4GUA A;  4QHS A;  1PM5 A;  2QPA A;  2D7H A;  1QZM A;  2L7H A;  1TYG B;  3IT6 B;  3HHX A;  3SAS A;  1YN5 A;  3V05 A;  3W30 A;  4NJC A;  1E9S A;  2BW2 A;  3KSJ A;  1RM6 C;  2BTW A;  1PVJ A;  1NY6 A;  3KS4 A;  3U6C A;  2LMC A;  3GLI B;  3T3N A;  3VRA B;  4XDC A;  2LNH C;  3IFU A;  4B7F A;  4PCZ A;  2TSS A;  2GB1 A;  1QAO A;  4HKZ E;  1DOX A;  3AN1 A;  4YT0 B;  4N6E B;  3UI3 A;  3PHX A;  2CHG A;  1E9R A;  2Z4S A;  4LG2 A;  2WP9 B;  1GB1 A;  2XN9 C;  4G4R A;  1VZ6 A;  1SSN A;  2QBY B;  3URY A;  3D8B A;  2N0S B;  4LF4 M;  2G9H D;  1K3W A;  1J7B A;  1N61 A;  1R7S A;  3BWU D;  4WWM A;  3GRR A;  2NMQ A;  2UZJ A;  1MX0 A;  4KO8 A;  4KHP M;  4ZOH C;  3U6Q A;  3BVZ A;  5ITT A;  3VR9 B;  3TSS A;  2B76 B;  1ROE A;  5EE3 A;  1YQ3 B;  3O13 A;  2YQZ A;  3BK1 A;  4FWH A;  2KXE A;  1NY5 A;  4DV0 M;  2PMV A;  4MGY E;  1FCL A;  2RGO A;  5FTJ A;  2CUZ A;  1JAL A;  2C99 A;  1TKE A;  4DR7 M;  4LJ8 A;  3MP2 A;  2R46 A;  4DV5 M;  1QF6 A;  1BML C;  3CF0 A;  5TSS A;  3CTW B;  3KP1 E;  1C4P A;  1I7H A;  4L15 A;  3RPF C;  1FFV A;  2CE7 A;  4GC5 A;  2GI9 A;  3U60 A;  2J52 A;  2WXK A;  4NAW B;  1XNQ M;  1GLN A;  3SYK A;  2PLP A;  2E3T A;  1N63 A;  3P4S B;  3BOS A;  5BYQ A;  4WAF A;  1J7C A;  3A45 A;  3NS1 A;  3VDU A;  1D4B A;  4B3S M;  3SAW A;  3GQ4 A;  1IXR C;  4EE2 A;  1HR0 M;  4JI4 M;  1I4G A;  3BII D;  1XMQ M;  1OFI A;  1ZUD 2;  3Q8X A;  4PDG A;  3PZ8 A;  3U4E G;  1XWI A;  3CF2 A;  4JYA M;  3TPZ A;  2CJO A;  1YN4 A;  2WXJ A;  1WRI A;  1DO0 A;  3P4Q B;  3DWM A;  5EP2 A;  2ZAM A;  1UWX A;  2DVW B;  1OQR A;  4HL4 A;  4LFC M;  4LZZ A;  3B2G A;  3KQ4 A;  3HHZ A;  3TEW A;  4KGT A;  2F5P A;  3MK6 A;  4DQO C;  5EE9 A;  2C9C A;  3U6E A;  2ICI A;  3RFW A;  1JWA D;  4TSS A;  1E7P B;  4MH8 A;  2CFO A;  3ZQ4 A;  2HWK A;  2ACZ B;  3FUW A;  3AEC B;  4JI1 M;  3GB1 A;  3AEF B;  3TE6 A;  2FE8 A;  4AKI A;  1K50 A;  4DR5 M;  3KWL A;  2WXM A;  4D81 A;  4JWU C;  1DGH A;  4IDI A;  4ARC A;  3NUH B;  2UU9 M;  1K53 A;  3R9X B;  4M9Z A;  2V6Z M;  2RGH A;  3AFH A;  2M5Z A;  3UMM A;  1IBM M;  3B9J A;  4LJ7 A;  2LHD A;  3GPU A;  1I4H A;  4NXN M;  4IUM A;  5IT9 S;  2DOS A;  2JRI A;  3LVV A;  3JR5 A;  3GLG B;  3AE9 B;  2NTS A;  2WXP A;  1WXQ A;  2HL7 A;  1V97 A;  3VK8 A;  1ZPS A;  2Y0T A;  2C9O A;  2J42 A;  5FTK A;  4OZC A;  2DWL A;  2QEJ C;  3HRD D;  1IN7 A;  1HNW M;  2D5G A;  2Q2E B;  3HKP A;  1WWT A;  4YSZ B;  3LQQ A;  4AKG A;  1ET9 A;  1T6B X;  2QSD A;  3IAM 1;  2INN E;  4XGI A;  2H88 B;  2RDG A;  2R4E A;  5GXG B;  2KZS A;  1YNT E;  1DO2 A;  1G8P A;  1J09 A;  3IG5 A;  2CV0 A;  3GLG A;  1GL7 A;  3SEB A;  1R2Z A;  4RNA A;  2UUB M;  4RGO S;  2EEL A;  4A55 A;  3MFG A;  1IM2 A;  4AQY M;  1YJI A;  4BBA A;  1E32 A;  1E94 E;  3U6S A;  4NAM A;  4FCW A;  1FJG M;  3P42 A;  1NHW C;  2Z8L A;  1GL6 A;  3Q8F A;  3HGI A;  3GRV A;  4RGT A;  1KH0 A;  4IP3 A;  4HRO A;  4R3D A;  3AE1 B;  1G41 A;  4WW0 A;  5FR3 A;  3AE2 B;  1JRO A;  4IBB A;  2D7G A;  4AKH A;  2SAK A;  3PRM A;  3TWL A;  3W5U B;  3C58 A;  2WDR B;  3PO0 A;  5HHD G;  3K92 A;  1L0X B;  2N9L A;  5JZE A;  1XO3 A;  4LFB M;  1ORY B;  3EIE A;  5KQ8 A;  1PGX A;  3CF6 E;  3W0L B;  3DOA A;  1Y56 A;  2NTT A;  2BBC A;  1HZ6 A;  4GMQ A;  3VKH A;  1V1O A;  1HZ5 A;  2V3P A;  2EUC A;  1IN5 A;  1TS5 A;  2H1R A;  5LNK 1;  2YEP F;  2LFI A;  3W0F A;  1E9M A;  1E10 A;  1YN3 A;  2MH7 A;  1UWM A;  3L26 A;  4HRS A;  1CK1 A;  4L23 A;  4G4O A;  1SXJ A;  3ZGZ A;  1N36 M;  1IXZ A;  1DOI A;  3VRB B;  1FMA D;  4D82 A;  1GOZ A;  1NYQ A;  4X65 M;  3NVY A;  1HXY D;  1VRA B;  4Z8X A;  2MJD A;  4IBG A;  5KPZ A;  3W2D A;  4D8B A;  3I51 A;  2KAJ A;  5EZQ A;  1K3X A;  4FCV A;  4DV4 M;  4B0E A;  3AV0 A;  5JI3 E;  1P7F A;  3FUX A;  3ZJV A;  1PJJ A;  3GLF B;  4N59 A;  2X8A A;  1GKI A;  5IWA M;  3FTF A;  3IAS 1;  1VDV A;  2Y5P A;  3N9Y C;  2L6O A;  3BYY B;  4AS1 A;  3T38 A;  2PTL A;  1SXJ C;  3VR8 B;  3AKZ A;  1VDD A;  4HEA 1;  3L27 A;  4B0M A;  2CU3 A;  5AUI A;  2HDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...