4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
b'TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like protease
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
3MJ5A 3MP2A 4R3DA 4RNAA 4P16A 2FE8A 4WURA 5E6JA 4RF0A 3E9SA 4OVZA 4PT5A 5KO3A 4OW0A 4RF1A 4REZA 4M0WA 4MM3B 4OVZB
chains in the Genus database with same CATH superfamily
2RSUA 3FAHA 1LV7A 5CHFA 4I05A 3EGRA 2WXQA 2ARYA 3AEFB 1H8CA 2JQGR 2KXEA 4L23A 1TH3A 2KDEB 5ITUA 1TR8A 1XLNA 3USVA 2KTRA 4B3RM 1SXJA 2IGGA 3UZUA 1BXTA 5FKAC 3ETRA 3SHGB 4E3CA 4W9GA 1TLOA 4X6HA 2EMTA 2N9XA 3SASA 4NQLB 4CZWA 2AS8A 2E02A 3KDSE 3QQ8B 2KACA 4K81A 3VR9B 3W68A 3ERVA 3DOAA 1TJEA 3VRBB 3I4VA 5C1ZA 4A3OA 2R9OA 4F1IA 3DBLI 3PVLA 4RNAA 4WJQA 4EKUA 3B7QA 2EO2A 4MEMA 3DCGA 4HDQA 2MLBA 3DDCB 3HX3A 2DCCA 3ZGZA 3UINB 4Q8GA 2JY5A 4IBEA 4OEMA 3WXEA 2Z4RA 3W2DA 2AYOB 2HJ8A 3I3TA 5F02A 3UGBB 3RNGC 5JHAA 3PRMA 3IG5A 3PPAA 1L2CA 2GHUA 2UWQA 2DWNA 1WXAA 2L8JA 4W9CA 4WQMA 1XXHA 2X8XX 2PBHA 1DGBA 3ZNID 1L5PA 3KYDD 1HA5A 2L4EA 4PDGA 1TYGB 4RGTA 3W1SA 3HKPA 4MSXA 2OZ2A 1WGNA 3WIMA 2XU3A 4PS7A 2E00A 4IM0A 4YTMB 2KDBA 1GVNA 2UXBM 4G3XB 4QHTA 1IYFA 2C98A 5BYRA 4GIVA 2N35A 1QANA 4B7HA 5DPWA 1N75A 2D10A 3RCZA 5EZSA 4DR5M 2NBUA 4AZFA 4M02A 2WQYB 2J42A 3QARA 4TMAB 4ASWC 3PRPA 4D8EA 5ITRA 1MDWA 2DWLA 5EF4A 2DOSA 1PM5A 1QT9A 1KLVA 2R18A 2KNZA 3V61A 1KLUD 3KW6A 2KOXA 3W5UB 5FSWA 1R5LA 2ZNVC 2V4IB 2BDZA 4GHAA 1JR3A 4D82A 4W9JA 4LJAA 4X64M 2KWVB 4RF1A 2L32A 3K92A 3HWNA 3LXFA 3P5UA 3PLVA 2G8LA 1AARA 1F0ZA 2KC2A 4CISA 1HQRD 4N58A 3RNVA 2C7MB 2LVOC 1DO2A 2AUXA 2WBFX 2KJHB 1KLGD 4TV3A 2O5RA 3U7DA 2G4SA 1Y08A 4I07A 2LJIA 4ITKA 4DR3M 2LNHC 1VRAB 2ATOA 3AI8A 3ZW3A 4IBCA 3VRAB 2LVNC 1DF0A 2F4VM 1FJGM 3GRVA 3VFDA 2X8AA 1SGHA 2HCBA 4ZRQA 5JHBA 3DF0A 1T6BX 2MSED 5C23A 3V76A 4RMAA 1Z5CA 2KEBA 5J2RA 5D3DA 3DVGX 2K8BA 1TGUA 2KXJA 1YVBA 3U6SA 1YIWA 1WMHA 3PT2B 4I81A 4DBGB 1I4GA 4DXAB 1PVJA 4WWOA 4Q2JA 5EXPA 1F4IA 1HQCA 1WJUA 2VQEM 5D2MB 3P4SB 1QOGA 5BMIA 3C9PA 3S3RA 3OVZA 1XWIA 1R4MB 2NBVB 3ZYYX 2C9OA 5G2NA 4K7WA 1O0EA 3W67A 5JH5C 2RDGA 4KHPM 4GN1A 2XSZA 3U61A 2MBHA 1WGLA 1L7YA 4FHKA 1AU0A 1CUKA 3DVNU 3ZTDA 2IDYA 3U6QA 3GLFA 5FTNA 3IMAA 1ET9A 4NJCA 3NHEA 1NY6A 4LF5M 3ZQ4A 2LRWA 2QHOB 2GOWA 3GLGB 1KOTA 5EGWA 1Z5AA 2QQ8A 1YD8U 1JR3E 1SE9A 1P3QQ 2VDBB 4K1RB 2BB6A 3JVZX 4LF9M 1TDZA 1G71A 3GP1A 1F9JA 3FKYA 1TT5B 2H5XA 4G50A 4N9F4 3MHVC 3U4EG 2M0AA 5J18A 2B1MA 3S3QA 3HU2A 2CJOA 3CWIA 5EE0A 2G1EA 3AM9A 2V6ZM 3L17A 1XD3B 4JE3B 3TE6A 2Y5CA 3AV8A 2JU6X 3IFWB 3URYA 3FYDA 1KF6B 3VAWA 4MGYE 5LMUM 1R4NB 4M0WB 2MJ5B 3A9JB 3AOEA 2XEWA 1WYGA 2X38A 1WJ7A 1GL6A 1OIZA 4I8OA 1VJKA 2Z4SA 3J80S 4LF8M 1NLJA 2DI0A 1VCBA 1YE9A 3JR5A 4JV5M 4ZHOA 4K7CA 1LO5D 1SJED 4I6NB 2XNAC 3P5VA 2DZLA 3AE1B 1OEYA 1F52A 5BMHA 1RFKA 1WGRA 2FCNA 3KFUG 1ZV1A 2JP7A 2K0BX 1JMLA 5IZ7D 5C1BA 2HWKA 5KPZA 1XF5L 3APDA 3CIRB 5E6JA 5EDSA 4WAFA 2JZ1A 3SFEB 3FILB 2DAIA 9PAPA 1FXTB 2G9HD 3L29A 1UM8A 2R65A 3OTOM 4LF7M 4JWSC 2ZCCA 3J81S 2CHGA 2OJWA 2HD5B 2HTME 4ZPXA 1A70A 2IO3B 3ZCBB 2BS4B 4W5CA 4MH0E 1NVID 3R8FA 1AU4A 1Z6TA 2J7QA 3GRUA 2Z3XA 1U9QX 2CJNA 3GLFE 3ZTCA 2N1WA 1F29A 1MI0A 3B89A 4PP2E 1OGWA 2CB5A 4LJ7A 3SEBA 1QDQA 3UJNA 4MT5A 3RNAC 4DUZM 2YLMA 2PLPA 4MSMB 4B3TM 5EP1A 3H4MA 2IBIB 5IREB 4RFBA 4HXDB 5FTMA 3RVWA 1OAOC 4YYRA 1GB1A 2RPVA 1PGYA 3JYUA 3BINA 1D2NA 1QXPA 1ZW7A 4JQWC 1FO4A 2LHCA 1Q0WB 5L95C 4AS1A 4DK5A 1I4HA 3APFA 2LVQA 3ML8A 4LFBM 2DNAA 1GLOA 1EO6A 3U6PA 4KLBA 2HTHA 1RU3A 1DOYA 2IO2B 4K0KM 1YT7A 1YOVB 3NOBA 4URKA 2RGHA 5E6NA 2B3TA 4HRSA 2GLSA 2DYBA 2FTDA 3GLHA 3GO8A 1QOAA 3T1HM 1AU2A 3ALBA 3L0WB 1NQCA 2E03A 3N3KA 1ZXHA 4C4VA 4GC5A 2I1JA 3KP0E 4KVGB 2DYMA 2J53A 5A24A 1V80A 2GQFA 3AOGA 2NPTB 2IY1B 3RYTA 3V6CB 4NXMM 2N1VA 4USAA 2RRUA 1XHBA 3T38A 1HNWM 3GRRA 2CHZA 4JPSA 2LJ5A 1GB4A 1U5IA 3H7PA 3V05A 3B08A 4JN6A 2LGIA 2UU9M 3BYTB 4BPVA 2UXDM 4EZJA 2L7RA 1PCIA 4REZA 4HKZE 1R2YA 1GC6A 5EP4A 2K8HA 2WNMA 5D3IB 4LCDE 1KHPA 3DVGY 4IDIA 4LGYA 1K53A 5HKHA 2WSFF 3MJWA 1G4AE 2BYEA 3SYKA 2KMCA 2QJLA 2ZNVB 2JRIA 2WDVB 1PGXA 2L4FA 2NVUI 1D5MC 3IHPC 3KLSX 2L0TA 3UF8A 4CDEB 4DV7M 3KW9A 4B9KA 3HHYA 2DXIA 2KNVA 4P6EA 2Y0QA 1WX8A 2JYEA 1JRUA 3QX1A 3QA8A 4XZXA 4WP2A 3PLUA 1GG3A 2Z8LA 4AG6A 1DOXA 2BF8B 2AHMA 2KANA 5D6JB 4X65M 1SXTA 2J52A 1L0XB 1UBQA 1I4WA 2C96A 1P0RA 2CKHB 1N5WA 2H88B 4EOYA 5BPVA 1K3WA 2P86A 1FIQA 4AQ7A 1F2RI 1XO3A 4GDLB 2AEHA 2XLJA 1WI0A 3ZNHB 3TPZA 4I04A 2KZUA 2RDHA 5L83A 2DJFB 4FVMA 3RD2A 4MGIE 2PE6B 3IFUA 2H89B 3EECA 1CS8A 1QQWA 1EIJA 2BTWB 2M4NA 5AZGA 4FLHA 1CZPA 4D8BA 3SU8X 3VKHA 1J0GA 4MACA 1MIRA 3R66C 3U2SC 1NV8A 2LXAA 3AMZA 2PIAA 4LNOA 3VXWA 1E7PB 3U5ZB 2ZZPB 4DV0M 1D4BA 1QDRA 4JLCA 3PHUA 3V62A 1HXYD 1PDXA 3A9KA 5IO9A 3FUUA 4R71A 1JB0F 2J0MA 1VDDA 2L1AA 5EXSA 3NZ3A 4XC2A 3RGSA 3C0RB 1IN5A 1ZXIA 1C1KA 4G4OA 1XLPA 1WXSA 1K51A 4LJPB 2CHWA 3O65B 3VTUA 4QAYA 4BOSC 3SD5A 1WGHA 3DZDA 1NI2A 1JQPA 2WU2B 3AH7A 5FTKA 4BKGA 1YZBA 1T3TA 2D11A 3QIJA 2QCUA 1I35A 1WIVA 1IM2A 3Q2AC 1Y8GA 4MGKE 1HE8A 2DCDA 3PBHA 3OF9A 4TQ0A 3VDUA 1WXVA 2JUOA 5FPWA 2FCSA 3PT2A 1J5EM 1V1PA 1WJNA 3ZC7B 3UQBA 7CATA 2EKKA 1N78A 1V81A 1WFYA 1EWPA 2LGYA 3DBHI 1D0MA 3EIEA 2KHHA 2ACZB 1ITOA 1HNXM 3NWLA 1I4RA 1I4XA 4IBKA 3N9YC 1PJJA 3J7AS 3K9MA 5FTLA 2DX5B 2HE7A 1YK7A 3IXSA 3VTWA 1ESFA 3T8MA 2LXEA 4ZYSA 3SAWA 3VQIA 1NHGC 4JGHB 3V60A 2YJBA 3OAWA 3DHIC 2RR9A 1WIAA 2BWBA 1CQVA 1MG8A 3PHWB 4RCOA 2MQJA 5A2QS 2AUZA 1XEEA 4DV6M 5AEKB 5LXHA 1WXMA 4IBFA 1OQRA 4DUYM 1I4PA 2QBYB 3M99A 2INCC 4BLCA 4YL8A 1PJQA 2FS1A 1POPA 1STEA 4ZHPA 1IP9A 1BUIC 2ZW0A 2ZPNA 2AIMA 3U6EA 3B9JA 4J6IA 1IXZA 4II3B 1DO0A 1BP4A 4B7GA 1WJ6A 3A98B 3IOQA 2E01A 1BVSA 3ZJVA 2INDC 4NY0A 1GCBA 3LYYA 3RPFC 2UYZB 2NS5A 1YX5B 2JRHA 2OPFA 3DQVA 2D3CA 3P5WA 1E8YA 4KKIA 4YSXB 3SAVA 4M0WA 3MC8A 4IWOA 2BKFA 1NEKB 3AEEB 4A3VB 1KYIA 1FXIA 2YJ2A 1OQYA 1OFFA 4R3DA 2CU1A 4JL9A 3K9PA 1CV8A 1ZCMA 3TWLA 3M6AA 2OOBB 3MTNA 4YYWA 1R6BX 1C77A 2ZJDA 3FUTA 4IBDA 2PREA 2MGWA 1NENB 3T3NA 3N3GA 1VJVA 4G4QA 1UWMA 1YN4A 4HJKA 1D5XC 3KWLA 4MJSB 2ACTA 1ZUD2 3N32A 4BBAA 2JF5A 4EIWA 4G3OA 3PZ7A 3RZFA 2CHXA 4LFAM 3PSEB 2QMTA 2BS3B 2MBQA 3OISA 3H89A 4PADA 3H6NA 1FFUA 3LVWA 1PYWD 2N9LA 4K7SA 1HEZE 1WRDB 1U4AA 2GBJA 2ONQA 3TBLD 3VR8B 1NL6A 2QIEB 4OU7A 5EZQA 4EZLA 5FLXS 2N4FA 1Q3CA 1V86A 1Z2MA 2Z59B 1STFE 1PUTA 2BWFA 4XX5A 3FUXA 3AE2B 1WJ4A 2QCZA 3NUHB 4M9ZA 2QEJC 2NCNA 2R46A 2BKRB 2Y5BB 4MM3B 1M6DA 2G5GX 2KZSA 1D0LA 4KX6B 2Y0TA 2IBIA 3KXEC 3KKUA 2D7HA 4DWFA 2MP2B 1V2YA 3PREA 1ME3A 1DEUA 4QOSA 2WXFA 2WS3B 2KKCA 3J7BA 2CRUA 3KFQA 1UZXB 2KX0A 1D0KA 5CHVA 3LMMA 5EP2A 1WRIA 3P4RB 3AB5A 1JWAD 2VF7A 2HHNA 1GNUA 1SE2A 3FE3A 4GDKB 3NBIA 1RFAA 2X49A 1IXSA 1KFVA 2QC8A 3HY5A 4GGQA 4II2B 1WGYA 2INPE 1G41A 2UU7A 1VDLA 2D3AA 3IT6B 2R6NA 3BC3A 3BY4B 1V1OA 4IWQA 1DGJA 2K6DB 3L27A 4A3PA 2SEBD 1YNTE 2FFJA 4K3CA 1WM3A 2WX1A 3A1QB 3SAUA 2LEKA 3MP9A 1IFYA 3KOZE 3QCAA 2MH8A 3CGWA 4W5BA 1WR1B 3Q8EA 4KO8A 2D3GA 1Y4HA 2L6OA 4HEA1 5IOIA 3VDPA 2WZJA 4WH4A 4N8WA 3MHSD 2OOAA 1EWMA 3TIXA 4FHJA 3BWKA 2KX3A 3K8ZA 3ZKJC 1AIPC 4C7YA 3A42A 3B79A 4C7ZA 1MX0A 1TZ1A 2KMMA 5ITXA 1ROEA 3FTCA 2ZVNA 3Q8AA 1CJEA 3CH2X 2J0KA 4FK5A 3BK2A 3AFHA 2L3ZA 3PZ8A 4CO7A 4HCPB 2JA2A 2LMCA 2WXRA 1HT2E 2FUDA 1Y56A 2B1NA 4GH9A 2O2VB 3AL0C 2JY6B 2ZBKB 3KVFB 4HK2A 5LMNM 2DAMA 4BSQA 1VEKA 2VHFA 4ZRIA 1EU3A 1JROA 2DVWB 3BYYB 4BVUC 1DGHB 1QAOA 3M3JA 4S17A 4DV5M 4PS8A 4RKUF 1IBXB 1HT1E 4CHTB 1C4PA 4GMQA 4AW4A 2W54A 3WAOA 1XMOM 1YSYA 4DR7M 1IPGA 3ZDMC 2R44A 2FH0A 1VZ6A 1NNUC 3ZNHA 3LQQA 1WGGA 3NZUA 4GEWA 2WDTB 2N7EA 3TQSA 4Z8XA 1WGKA 3X23A 1H6UA 3I9V1 2XK5B 2RGOA 3L13A 2MRPA 3F92A 3QK0A 1TU6A 2KW0A 3DBRB 1GAQB 3K2LA 4BOPA 2V3SA 2L83A 3T3OA 5DNYA 1L1ZA 2I7NA 2WXHA 3A33B 4YV8A 3QWLA 1SXJC 1SXJE 2M17A 2KZRA 4HLQA 4QHSA 3GPXA 5DPRA 1Z5SB 3JAMS 2IGDA 2KLGA 2XU1A 4QH6A 1K3XA 1AYWA 2LRUA 1LM8B 3U30A 1J8CA 4DHZB 4W5WA 3H7DA 3U6MA 4DR6M 3GS2A 3SATA 1KSFX 3KW5B 5CHTA 1J7AA 1PJTA 3C58A 1R4MI 3SBJA 2LHEA 2V3PA 4NAWA 3U52E 2D5GA 1V92A 4Q8HA 2B3AA 3PZDA 2P7UA 4IUMB 2FYEA 4AI6A 2F7DA 1FPYA 1IWDA 4BOUA 3MC0B 1IN4A 3HHWA 2DCBA 2YNMD 1EM7A 7PCKA 3T15A 3UGJA 3JSVB 2IGHA 5KHQA 3FUVA 1PQSA 1QILA 2YQZA 1YK8A 2LGSA 2GMIC 3AV0A 1J7BA 1QZMA 1L2NA 2Y6EA 1MU5A 2WXMA 1XXHE 2JXXA 2VQFM 3VK8A 1SBBB 4BOZA 2KFKB 2UUAM 3JW0X 3SYLA 3LDZE 1WHCA 3DHGC 2PADA 1F2BA 2DZOB 3W1SC 1FNWA 1PPDA 1V8CA 3MORA 1AN8A 3HU3A 3GP7A 1TS2A 3AEGB 2LWPA 1SIJA 2NQGA 4PK1A 2WXKA 3CF6E 1QUTA 5EE1A 1U9VA 1YJIA 2KC1A 1R4NI 3SARA 1ET6A 3GZNB 3HJQA 2KDLA 3U7ZA 4CDFB 1C7YA 4PP1A 2DWZB 3O13A 4FWHA 3QAQA 4MGZE 1IBMM 2I1KA 2Z84A 3R9XB 4HEOA 3E21A 4GHLA 4AJWA 3K1JA 5E26A 1OJLA 2BBCA 3BVZA 1NI3A 3N4CA 2KJ6A 4WAAA 5JZEB 4LY6A 1NY5A 3MFGA 2QENA 4GXBA 1D6EC 3TL5A 2M1MA 4XK8F 5CVOB 4WW0A 1VLBA 1F77A 3OG5A 2XFTA 2WYQA 3DWMA 4PYZA 1BQIA 1MEGA 2G8EA 2APLA 5DPTA 1HZ5A 3PXGA 4OVZB 1HNZM 4G54A 1QF6A 5ITTA 2EKIA 1C9FA 2AWTA 3U60A 1AYVA 4JI7M 4M01A 8PCHA 2O6VA 2LI5A 2EUCA 1JWBD 5H92C 2LUMA 3IUTA 1C79A 3V6EA 1OEYJ 1VDVA 2DLBA 2PVGC 2QILA 4W9EA 4ZRJA 2YJCA 1IBLM 1QQRA 5J94A 2N9EB 1X37A 2C7HA 4JI6M 4A55A 4D8IA 1C4CA 1YJJA 2K5PA 1JWSD 5C18A 3KOWE 1LXDA 2E6XA 4L15A 4IIWA 1ZDVA 4AKGA 1BGOA 2Y21A 3WA0A 2O6XA 2QPAA 1XB2B 4NXNM 3K9OB 4QRVA 5JA7A 3GLIA 1WZ3A 1VEGA 1OFIA 2P5TA 3WAMA 1QDTA 2BW2A 1S1QB 5FR3A 1L8QA 4QRXA 2J4XA 3WXFA 3HD3A 4B3SM 4A8XC 1EE8A 2DAFA 4BKTA 2DHYA 3TWKA 2OULA 4JWUC 1QOFA 2QP9X 2XZUA 4LJOB 3EFUA 1V34A 3T9LA 5DCNA 3AU5A 3Q8XA 5KPRA 4RGNA 3IT4B 4W9FA 1JQ4A 2WWZA 4MSQB 2V1CA 2HH5A 1XC8A 1EF7A 5BR8M 4S12A 4N59A 3D8LA 5G55A 4JXJA 1YQ3B 1PFDA 3RULA 2MR9A 4OELA 2KRUA 3CSTA 1TTNA 4EEWA 3AE5B 3R7RA 1SP4B 3H7SA 1ME4A 3CH3X 4JI1M 4XGAB 4MM3A 3B21A 1THEA 4BKSD 1P3QU 4CDDB 2UXCM 3FD9A 2BGFA 2LVAA 4CGYB 1GECE 3Q8GA 3B1LX 5KO3A 2LBCA 4AQYM 1J7KA 2PNSA 3RVXA 4M8MA 1QZEA 2FBWB 3KH0A 4EUTA 3PHXB 2PKOA 2ZTCA 2LWXA 3SFZA 3CSFA 1OTRA 4TUUA 3SMPA 1E7UA 3B7ZA 1SXJD 4GDKA 4K7UA 1ZGUB 2FCQA 3AOEC 1ISNA 2FUG1 2CE7A 5FTJA 1XLQA 1XXGA 3IG8A 3BBZA 2VF8A 4GRIA 4X62M 5TR5A 1TDHA 4AUQC 4C56C 2DNFA 5C3JB 2CIOA 4P7IA 1HTQA 3GQ3A 3TUOA 2DBYA 4CIZA 1UNSA 1L6UA 3B2FA 2L7IA 3BOSA 3Q3OC 3FTEA 4QOZC 3I06A 2DENB 3GLIE 1WGDA 2BT6A 3WANA 1IY2A 1T43A 4DV3M 4KDIC 4KSLC 4J3OD 3NS1A 1S4VA 2I38A 4F1SA 3LB8C 4NSRA 1P7EA 1WE6A 3RI7C 2BNKA 3QYEA 1PADA 3N1YC 1RM6C 2CV2A 1PXVA 3IEJA 3NVVA 1Q5WB 4OHJA 1F2CA 4I5SA 2LVPA 1ORYB 4HLEA 4N6EB 3WAPA 4IM2A 2J7QC 1ZMUA 2JZ0A 3Q3JA 5LLIA 1TY0A 3I51A 2L2DA 5CX3A 3ZJUA 1ZKHA 1SF0A 2RKOA 3PW3A 1AU3A 2KTRB 4JX1C 1SXJB 2WGSA 2DAGA 5EXXA 2EMSA 4DR2M 4ZRKA 3W9CB 5H37D 4DXFA 3TEXA 1CPJA 1WX7A 3ZJTA 2AYOA 1YQBA 4AOFA 2XZFA 1N34M 4LNIA 4XBOA 1NB3A 2E5LM 1R4GA 2RPQA 3EA6A 1PGAA 2JY8A 3ZLZA 3I01M 3UQAA 4YY3M 3TJPA 2I7PA 1IQPA 3GB1A 3NG0A 3MTVA 4X6IA 3U6OA 4PCZA 4NNJB 1AECA 1Z59A 2F5SA 2G4DB 3RNCC 4IBJA 2M0XA 4MGHA 3RNBC 4L78A 4IG7B 1RWSA 2QSFX 1P98A 4IM3A 5TSSA 1U9WA 3AXCA 2G6DA 1JR3D 3PRMB 4DMYA 4G11A 4W9HA 1NPZA 3UI3A 2DAEA 1T0SC 1FRDA 3MHHA 1XXHB 4I4LA 4LRSA 1WWTA 2XK5A 5HFYA 2O25A 2DWQA 3GLHE 2Y5PA 3DA1A 3HHIA 2BPSA 4LJ5A 3PRZA 4L16A 2KNAA 2R9CA 1YJ1A 3D32A 4UN2B 3Q69A 5CVNB 5EXTA 1NHWC 1KJTA 3ZIMA 3B7NA 1MS6A 3VUWA 3R2IA 3ZUNA 3A45A 1L1TA 4IP3A 1FXAA 4P1BC 1EWOA 3HJ8A 3GPUA 3T1YM 4LDTD 1CJLA 4AKHA 5E6PA 3GQ4A 4B95A 1SJHD 4FJYA 2UUBM 1T6OA 2PMVA 2WXOA 1CSBB 1NJGA 2D07B 5JI2E 1EF1A 2KA6B 2WHIA 1IGCA 1Q3BA 1T0YA 3PRPB 3C3EA 1B9RA 4ZYNA 3VHTC 4P6GA 4WJOA 4CYEA 3OJ4B 2NBWB 3HJSA 2JZZA 3NRZA 4RH6A 2ICIA 3R3MA 4EZKA 4P1CC 4JI5M 1FMAD 3JSVA 4B0EA 1Y8RC 2KWDA 3W0FA 4FN2A 4KZ0A 2D2QA 2L05A 2FOIC 4FXCA 3Q14C 2AVWA 1B1ZA 2BB5A 2NQIA 1TS5A 2JSVX 1MJDA 1WZ0A 4ANVA 1IY1A 1VD2A 1HUCB 4F8CB 4LJ9A 1OKSA 3SHQA 2WU5B 1MN3A 1AYFA 5PADA 2AQ2B 4DBGA 2XSZD 2JT4B 5IA7A 1XMQM 3VH3B 2KN4A 3KSEA 2G3QB 4L1BA 4XYCA 5EP3A 4HJGE 3LXSA 3ZUAA 1GLNA 1LQBA 1WM2A 3NBXX 3ZVVA 3CTWB 4B7FA 3ABVB 4Z6YA 4I6PA 4WA6A 1QVRA 4LDTB 1GKIA 3LCUA 2BS2B 3HRDD 2A4ZA 3HM3A 1ICFA 2F5OA 1OFHA 1L2BA 1TF0B 4HPMB 1IUEA 1TKEA 2L0FA 3UMMA 2K3UA 2KTFA 1MHXA 4KIKB 3HZJA 8CATA 3KWZA 1WF9A 3BCNA 3E4RA 2MBOA 2DZYA 1C3TA 1PJIA 1UD7A 1WMHB 2ZTDA 4A9AA 4AP4C 2QSDA 2ZM6M 1MPEA 1FH0A 1NBFC 2R9MA 3RVVA 2C5RA 3Q8CA 2M19A 3IG3A 2J0JA 4G0NB 4FCWA 2QHOA 5ITYA 3GLGA 4XDDA 4EE2A 2GBNA 2HXZA 1ZMWA 4L6V6 4ZDVA 3H9DA 2OHFA 4B08A 1WH3A 1MEMA 1VG5A 2AX5A 1PIPA 5IAAC 1K52A 5DYIA 1WXQA 1GJZA 4X6JA 3PFIA 3KP1E 1QLBB 3GLFB 2LHGA 3MMPA 2ZANA 5KQDA 3EUB2 2ZVOA 4M9XA 3NHEB 1SG9A 4P6VF 4US9A 3TNXA 4E74A 3THGA 2X4AA 2NR2A 2L76A 1V9JA 3A9JA 3AE3B 5E6OA 3NY5A 1QMYA 1JWUD 2FUHB 3MJ5A 3J2PB 5AUKA 1XCQL 4HPLB 3GPPA 2DKLA 3KYCD 4C80A 4LJ4A 3L26A 2J5YA 5DPSA 1KXRA 2C7NB 3I57A 1EWLA 3K9OA 1LGRA 3W1YA 3M7GA 1UGJA 2BYVE 3I63C 2E3TA 1MHWA 4PDIA 2MJ3A 3ENEA 2YJ8A 2HDEA 3SC3A 3P2BA 2GRIA 1L4ZB 1M4VA 2WXIA 1XT9B 3DWGC 2WXGA 2VZKD 3FILA 1BY8A 2AYNA 4LJ6A 1XQQA 2JWZA 2KDIA 2LH0A 1P9DU 3A46A 2KO3A 4I6LB 3MP2A 2HD5A 3J27B 2IYDB 4IKGA 3CMMB 1JRPA 1VQ1A 3PDFA 1EFUB 2QNJA 2WLBA 3SHFA 5C2TB 1FRRA 2NTTA 4C00A 3P5XA 1PRBA 4LJ8A 1RAXA 1VR9A 2CFOA 2UZJA 3U8ZA 2LVQD 1HZ6A 3Q8FA 4WJNA 5IKCM 1IN7A 1DGGA 3I4YA 2VHSA 3PNYA 3GE3C 4HXDA 4N4ZA 1CTEA 2RD0A 1E90A 2YR0A 3P42A 4S0RA 2BDLA 3O1GA 4A6QA 2KMAA 2J7QB 3W5VB 3E9SA 1NV9A 3PHXA 1KRHA 1NVMA 1FM0D 1ZMVA 2KRKA 4Q7JA 4JI3M 1G3IA 1NSFA 3Q8BA 2JX5A 1E9MA 4FWGA 4DR1M 1E8WA 1T0QC 5JH3A 2VZKB 1WY8A 4RKXA 4P17A 4NRVA 2OEDA 3A4SC 3HHZA 5IN7A 2AU1A 1IY0A 2V3NA 2FNAA 3VKGA 1E7VA 2V4LA 1WR6E 3QHTA 3APCA 3TCAA 2N7JA 1V5OA 3M62B 4FBJB 1PGBA 2CEAA 1XLOA 3Q3MC 3TMPB 4AKIA 1DYQA 3ONSA 1L4DB 4RM8A 1MG4A 3RFZB 1YALA 3LFYA 3NZSA 2D3BA 3ILKA 1FNVA 4IBGA 2DZNB 3BIID 4LZZA 3V3XA 2GBRA 4YYQA 2NMQA 3ZH9B 3H8CA 3V6CA 1FNUA 2NPTA 1KM7A 2MA9B 4XGIA 1J7CA 4R7GA 5IWAM 4OVUA 1P7FA 1K8RB 2BVCA 4BZAA 2DC6A 1FNNA 2SAKA 2JQFR 3IVFA 4K3BA 3GLHB 4GB9A 4FW9A 2KWCA 1HR0M 2W3SA 2EKEC 2KVRA 4HWYA 2KJRA 1XCTL 3N3KB 3RN9C 3DBRI 4C4VB 2WSCF 4WJPA 2R2OA 3QT4A 1TZOA 2J7NA 4PT5A 4IOIE 1ENFA 4B3MM 3RMKC 4KKJA 3D6SA 4NRWA 2OO9A 4XDCA 3DBSA 5KPTA 2BYFA 2KFJA 3RT3B 3DFZA 4KZCA 3H7PB 2AL6A 5GKNA 3PTFC 1N61A 2K25A 2CV0A 2LVOA 2JXNA 2DZMA 2P0RA 1N62A 1VZ8A 1ACCA 1Q1OA 4NAMA 2V0GA 4W4UA 5CHVC 3GPYA 3QSDA 1NO1A 3KWBX 2FO5A 1SNKA 2V9HA 4HPPA 3I04M 2JRIB 2WXLA 3FTDA 2D7GA 1V49A 4XR7A 2MROB 4XWWA 4GDLA 4MH8A 1AUAA 1FCLA 3TEZA 5IT9S 3EC8A 1UH6A 2XN9C 1YUBA 3QJ3A 1AWDA 2C60A 1SB3C 5G5HA 2WXNA 1D3ZA 3HHMA 1IXRC 4WIPA 4B0MA 2XF3A 2F5QA 2YJ9A 2BTWA 3KSXA 1QUSA 5JXVA 4IBIA 4DDID 5KQ8A 3X0WA 4GKKM 4KODA 5EQTA 4HVBA 1UFZA 1N6ZA 3BWUD 1HJPA 3U5ZA 1CK1A 1F2AA 4HROA 2HJ1A 4TQ1A 1UUPA 5HHDG 1K82A 2EKFA 3HU1A 1ZP0B 3DBLB 2DHRA 3AJIB 3RZWC 3N1ZC 1SIFA 3RNEC 2LGXA 3C3DA 1L2DA 3ZRCA 3IECA 3GZNI 2ZW1A 3L08A 3C0RA 1N33M 2XBBC 2IJ0A 2JYTA 1QAMA 1TY2A 3O65A 1TKGA 5ITXE 1AYUA 3QC8B 1E5WA 2N0SB 2JTCA 3AE4B 1C4AA 5BO4B 2R9NA 4AJYB 1C76A 4FIPA 5GMVA 3NJTA 2H1RA 4IW0A 4GSWA 4IJFA 1ZOYB 2RGFA 2BWES 5L8RF 3A9KB 4M9SA 4D80A 2A5UA 1EF5A 2L52A 2RMMA 1TKYA 2MWSB 3DHHC 3KUZA 1A6RA 4PYUA 1N77A 2OP3A 1S3SG 4BOQA 2G3QA 1ZQ9A 2KNBA 3HHAA 1MFWA 4JI8M 2VH1A 2PEAA 4UDUC 2JWSA 5I4DA 4LRTA 2IPPB 4RF0A 1CB5A 4FD2A 3NS8A 2HAKA 2JNHA 2QDFA 1UF0A 3MC9A 2FAZA 3IAS1 1Z5BA 4GITA 3UIOB 2K9XA 3HWSA 1I94M 5F3WA 2R6FA 2MJEA 3AN1A 2ZEQA 2IY0B 3VH4B 4KIKA 4QNMA 4HKQA 4ITQA 2MX2A 1V1PB 3PHWA 1BMLC 4LNNA 6PADA 4FCVA 2LGDA 2M5ZA 1N32M 4MB7A 1JCKB 1GL7A 2FQ9A 1GUAB 3M95A 2G45B 2CHVA 2FCMA 2FE8A 4OZCA 3VUXA 2F1GA 1Q39A 3ZRFA 4LF6M 1OIPA 2QBYA 1TIFA 4GLSC 1GOZA 3SFDB 4G4NA 2DC8A 5ITQA 4FCTA 4YVAA 3LCVB 1GO5A 1QOLA 2MHJA 5BMGA 4WQOB 2ZAOA 1OQQA 1T3QA 3KS8A 4LNKA 2DZKA 1TS3A 1TTEA 4Y28F 3AECB 1IN6A 1G8PA 3KOXE 4IJEA 3MK6A 4TUWA 3PVSA 3KUDB 3OQCA 1YMHE 3WXGA 1UWXA 4YT0B 3L2AA 1Q6KA 2R45A 3LVVA 1RLFA 2CUZA 4D81A 1F2RC 1VSNA 1SE3A 2Y20A 4JI2M 1R7RA 1E8ZA 3L4PA 1QOBA 4HCNB 1PJSA 1KFYB 4E71A 3AU4A 3Q6BA 4NZLB 3W31A 4GC9A 4CDCB 1GPXA 3ZQJA 3KSJA 2OOBA 1HQYE 2LXCA 2HKJA 3AE8B 3H1UA 3VK7A 1UGMA 4OX9M 3P4QB 4HWIB 4DDGD 2M8SA 4ZRPA 5AZFA 2OQ4A 2ASQA 2DAJA 4A90A 3B9PA 1IBKM 4AG5A 4LF4M 4BFRA 2JUJA 4IC7B 4GMVA 5K16A 2W55A 4QBBA 4MJSA 3CF0A 3SDLC 5D7GA 3PSEA 3NVZA 4DHJD 4II7A 3QJZA 3ZNGC 2CR5A 3P63A 5H8YE 3PO0A 3WCQA 3K9PB 4AXLA 2GBKA 2K0PA 2PTLA 2Z0EB 3U6LA 2KAJA 3MTNB 5CHWA 3QAUA 3IAM1 1QYRA 1V33A 4YHHM 2FNJB 3HVDA 2KN5A 3HGIA 2VRRB 2YEPF 4LTUA 3AEDB 3SMSA 3QYBA 3AULA 4PS3A 1EU4A 3E56A 3M63B 3PV1A 3N20C 1D5ZC 2Y5BA 2LFIA 4KT0F 4ZOHC 3U8EA 1QKZA 2A5YB 4ANWA 1FD6A 1A5TA 2KQ4X 2REXA 4RGMA 5EE9A 1E9SA 2XGNA 1EWYC 1TGZB 1DKIA 2CU3A 1WE7A 2MP2A 2W9NA 1L6VA 4DV2M 2JPHA 5G5GA 2LZ6A 1E10A 3B2GA 3UK6A 2N9KA 4LFCM 3E1ZB 3FRIA 1PPOA 5JI3E 2LHDA 2MEKA 3WHLA 1NB5A 2ZPYA 2O01F 1ZAEA 2MBBB 4N79A 2EJSA 3HIZA 4KGSA 5HG2A 3ZO5B 4L8RC 4DHJB 2PW9A 3KX1A 2PE9A 3VLFB 5HI1A 3IHPA 1L0VB 4ACFA 2XEPA 3UIPB 2K9DA 1EUVB 1XKGA 4XUIA 1M94A 3ECIA 4KGTA 4X57B 3VFKA 4ARCA 3BY4A 3AE7B 1F1HA 3OLMD 5CVMA 1A5RA 3F5VA 1GABA 2LD9A 3TMPA 2Y3AA 3HHXA 2FRAA 2FIDA 3A1QA 1T0RC 2Z0DB 3R7QA 2KYWA 4A20A 2YFQA 2C99A 1Q02A 1KFXL 1JQJC 1MHHE 1RRBA 1WR1A 2WP9B 3TRKA 3MHZA 3GRYA 4KGRA 2DZJA 3M0EA 1JALA 3ZDTA 4MI7A 1YN5A 4YSZB 2YEPB 1IXSB 2JZ3B 3H8HA 2G8JA 4HL4A 2GI9A 1YX6B 2V1YA 2JXTA 3NVWA 3KWVA 2KT7A 4NOOB 1DGFA 3BPMA 2L00B 2KWUB 2ERCA 4DQOC 4ANRA 2FT2A 2WDQB 4W9DA 2K22A 3HM6X 2MCNB 2R4JA 1WSPA 3J9CA 3B74A 3L25A 4LK0M 1E9RA 1C78A 1E32A 2KLCA 2ON8A 2DC9A 4O1NA 3GCBA 1N5XA 4NL4H 2EELA 4LG2A 2C0YA 1WYWB 1NYRA 3ML9A 2XFSA 4MZOA 4WWPA 3S2AA 2PVOD 3TEYA 4GOCA 1V6EA 1Q10A 2JWUA 2O2VA 3N1XC 4DR4M 2C9WB 2JY6A 4FJCA 4FWDA 2TSSA 4ANXA 1V5TA 3BVGA 2L7HA 1DV0A 2KVZA 4A5UA 3KOYE 1DGHA 4DMXA 1MJGM 3VDZA 2DHZA 3P4PB 5MPOA 1OAIA 3AE9B 5LNK1 1E8XA 4ICUA 4BOSA 4W9LA 2W3RA 1IBXA 3FRHA 3R8BA 1LTMA 3BZDB 4HDOA 4BBNC 3AEAB 3N30A 4X66M 3I3TB 4FULA 1UBIA 2ZCBA 3MHSA 1RYJA 3OVXA 4YYVA 1TS4A 4WWNA 1S3SA 2C9CA 3A4RA 4PD2A 3DVNV 3D8BA 1FFVA 3L16A 4W9IA 2KDMA 2YVCA 3FKEA 5T8IA 2FIFA 2KQSA 2QZ4A 2WSEF 3FC4A 3HUIA 2DC7A 2LTUA 4EFOA 2GBMA 4M00A 1NJFA 4JIOU 3OF8A 1EWCA 3RUIB 2KQ7A 2N7DA 4PI3A 2BJVA 3FTFA 1E6EB 1ZDXA 4ICVA 1TL9A 1CVZA 1PPPA 2NQAA 2LVPC 1ATKA 2MH7A 4AWJA 1R7SA 4LCBA 4TKNA 1H4RA 1N36M 4IUMA 2DZIA 4IBBA 5AUIA 4QNRA 3F75A 2HL7A 4DV1M 3AKZA 3TWMA 4FADA 2JQRB 4US8A 4BAXA 2WX0A 3BBAA 2JY7A 2Z8YM 3T6PA 1IN8A 2K8CA 3BK1A 4L2YA 1GJTA 3ZNZB 1E0ZA 3C9EA 3I5JC 4BS5A 4LZJA 4XE0A 3PS6A 4KDLB 1BT0A 2BU3A 2NQ8C 3QWZB 4MZSA 4WURA 3BXWA 3ZXVA 1HTOA 3B0AA 4YTPB 4RGOS 4GUAA 4CJ6A 2DAKA 3HVZA 2KFKA 3RGPA 2GNOA 4F2LA 2KDFB 2R61A 1FEHA 4NAWB 1K3BB 3K8UA 4L4UA 1WX9A 1E94E 2B76B 3BB7A 2XU4A 1LFDA 1P1AA 1SEBD 1X1MA 2DJGB 3SR6A 3U6CA 4LGMA 4G6ZA 2NQDB 2CP8A 3W30A 4NJ6A 3KUCB 3H4JA 3E46A 1W5TA 2MBEA 2F5PA 3FYCA 4ARIA 4MDKE 4BOZB 2AGAA 3H6SA 1YN3A 3TEWA 4DV4M 5DFLA 1NDDA 4LLGM 2PPHA 4ZTBA 4MELA 2AL3A 2EA0A 4FA6A 1PBHA 1T5XD 1V97A 3DOWA 1PE6A 4BQVA 5JZEA 2O6VD 2K1FA 3CF2A 3L10B 1N60A 4KSKC 3DPDA 1MVKA 2FRQA 3VVWB 4OVVA 3RNFC 2D7EA 4DHZE 4P16A 4LNFA 3Q3NC 3AEBB 1I42A 3U6DA 2INNE 3KS4A 4IWPA 2BQQA 1R2ZA 2IPKD 4OVZA 4BB9A 3U61B 2XU5A 2VH2A 3L54A 2K39A 1G59A 2CS4A 2WXPA 2JVCA 1X9YA 4ANUA 4G4RA 3P1MA 1YLAA 4W9KA 4F7ZA 1JW9D 1SSNA 4B6WA 3PGEA 1C1YB 4GKJM 2AQ3B 2L09A 1UKFA 3VTVA 3BPFA 3R2TA 4YXDB 4QRGA 2R0IA 1XNRM 1JWMD 2OJRA 1VZ7A 1KH0A 4BS6A 3GOEA 2Q2EB 2WXJA 4D2KA 4AXMA 2R9FA 1K50A 3DBHB 1U9XA 2IZVB 3ZXRA 4KLNA 2BWEA 5BYQA 4TSSA 3LQRA 3U60B 1J19A 3RFWA 1KTKA 1TH2A 2O6VB 3JR4A 2LUEA 4OW0A 3OJ3A 4YYUA 1CQDA 2CHQA 4CQNA 3RE8A 5KHOA 3V6EB 5LXIB 3L28A 2I2YA 3AI5A 3AE6B 1I7HA 1IGDA 4XWTA 2BTEA 2Z7JA 3TSSA 3K24A 4NQKE 5IP4D 2GFOA 3VUYA 1QAQA 2IO0B 2LASA 1GC7A 3IV2A 5BYSA 1UELA 3KQ4A 5FR6A 4KV2A 3WHKA 1N63A 4NJ7A 1GMYA 4BBNF 1W5SA 2GB1A 2K6QA 3GLIB 2M56B 2BJWA 3FUWA 4FJVB 2DZZA 1CMXB 3NVYA 5EE3A 3CBKA 3BOWA 2R4EA 1J09A 4NSOB 3GLGE 4GU2A 1FCCC 2MJDA 2KHWB 2H7JA 4ZUXU 4RM9A 1AW7A 3W0LB 2NTSA 2DCAA 4JYAM 1NYQA 4JI4M 2IO1B 2KK8A 2BYTA 2ZAMA 1XNQM 1YQ4B 2WDRB 2CV1A 4YSYB 5FK9C 2VIIA 5J17A 3OWEB 1G6JA 2PJHA 3EFCA 3H8BA 4YWGG 5CTRC 1ZIVA 2K6BA 4YTNB 2J7OA 4H2AA 4M0DA 3O0UA 1PPNA 1I4QA 5AZHA 2C5LC 1VEJA 5DYGA 4FJZA 2G7YA 4DXGA 2RDBC 3CBJA 3LW5F 2V1UA 5GXGB 3KVWA 2UUCM 2W82A 3PNVA 4JI0M 2XH9A 1KFUL 5EJCA 4NC6A 2CWBA 4GIPA 2KD0A 1ZE3D 5D94A 2Q5WD 2M60A 2R2QA 2R62A 3GQ5A 2HHHM 3BVMA 2MW5A 1NNJA 1GJSA 1SE4A 3LJ3A 2DYOA 1TH4A 1TBEA 3IBEA 4WWMA 3HK0A 3Q3FA 4YYSA 2DWMA 2F5NA 1KHQA 2K47A 2DENA 1L0YB 2HWJA 3TL4X 3EIHA 4RY2A 1OTRB 2JZPA 4CHKA 1AIMA 3C19A 4BKSA 1DOIA 2AQ1B 1ZPSA 2N9PC 4XZ4A 3C8YA 3PNRA 3WALA 4M8NA 4OZBA 4OZAA 4NPNA 3EHVA 3GE8C
chains in the Genus database with same CATH topology
3FAHA 1LV7A 3EGRA 2WXQA 3AEFB 2KXEA 4L23A 1TH3A 5ITUA 1XLNA 4B3RM 1SXJA 2IGGA 3UZUA 1BXTA 5FKAC 3ETRA 3SHGB 3SASA 3KDSE 3VR9B 2KACA 3DOAA 1TJEA 3VRBB 3I4VA 4RNAA 2EO2A 3ZGZA 4IBEA 2Z4RA 3W2DA 3PRMA 3IG5A 1L2CA 2DWNA 4WQMA 1XXHA 1DGBA 1L5PA 1HA5A 4PDGA 1TYGB 4RGTA 3W1SA 3HKPA 4YTMB 1GVNA 2UXBM 4QHTA 2C98A 5BYRA 1QANA 4B7HA 1N75A 5EZSA 4DR5M 4AZFA 2WQYB 2J42A 4TMAB 3PRPA 4D8EA 5ITRA 2DWLA 2DOSA 1PM5A 1QT9A 2R18A 1KLUD 3KW6A 3W5UB 5FSWA 2V4IB 4GHAA 1JR3A 4D82A 4LJAA 4X64M 2L32A 4RF1A 3K92A 3LXFA 2G8LA 1F0ZA 4CISA 1HQRD 4N58A 3RNVA 1DO2A 1KLGD 2O5RA 2LJIA 4ITKA 4DR3M 2LNHC 1VRAB 4IBCA 3VRAB 2F4VM 1FJGM 3GRVA 3VFDA 2X8AA 2HCBA 4ZRQA 1T6BX 1Z5CA 2KEBA 5D3DA 1TGUA 3U6SA 4I81A 1I4GA 1PVJA 4Q2JA 5EXPA 1HQCA 2VQEM 3P4SB 1QOGA 5BMIA 1XWIA 3ZYYX 2C9OA 2RDGA 4KHPM 2XSZA 3U61A 2IDYA 3U6QA 3GLFA 5FTNA 1ET9A 4NJCA 1NY6A 4LF5M 3ZQ4A 3GLGB 1Z5AA 2BB6A 4LF9M 1TDZA 3GP1A 3MHVC 3U4EG 2M0AA 3HU2A 2CJOA 3CWIA 5EE0A 2G1EA 3AM9A 2V6ZM 4JE3B 3TE6A 2Y5CA 3AV8A 2JU6X 3URYA 3FYDA 1KF6B 4MGYE 5LMUM 3AOEA 1WYGA 2X38A 1GL6A 4I8OA 1VJKA 2Z4SA 3J80S 4LF8M 1YE9A 3JR5A 4JV5M 4ZHOA 1LO5D 1SJED 2XNAC 3AE1B 5BMHA 1RFKA 3KFUG 1JMLA 5IZ7D 5C1BA 2HWKA 5KPZA 1XF5L 3CIRB 5E6JA 4WAFA 3SFEB 3FILB 2G9HD 3L29A 1UM8A 2R65A 3OTOM 4LF7M 4JWSC 3J81S 2CHGA 2HTME 4ZPXA 1A70A 3ZCBB 2BS4B 4MH0E 1NVID 3R8FA 1Z6TA 2J7QA 3GRUA 2Z3XA 2CJNA 1MI0A 4LJ7A 3SEBA 3UJNA 4MT5A 4DUZM 2PLPA 5EP1A 3H4MA 4B3TM 5IREB 4RFBA 4HXDB 5FTMA 1GB1A 2RPVA 1D2NA 1FO4A 4AS1A 1I4HA 4LFBM 3U6PA 1DOYA 4K0KM 2RGHA 4HRSA 3GLHA 3GO8A 1QOAA 3T1HM 1ZXHA 4GC5A 3KP0E 2DYMA 2J53A 3AOGA 4NXMM 4USAA 1XHBA 3T38A 1HNWM 3GRRA 4JPSA 1GB4A 3V05A 4JN6A 2LGIA 2UU9M 3BYTB 2UXDM 4REZA 4HKZE 1R2YA 5D3IB 5EP4A 2WNMA 4IDIA 4LGYA 1K53A 1G4AE 3SYKA 2QJLA 2JRIA 2WDVB 1PGXA 1D5MC 3KLSX 4DV7M 3HHYA 2DXIA 2Y0QA 2JYEA 4XZXA 2Z8LA 4AG6A 1DOXA 2AHMA 4X65M 1SXTA 2J52A 1L0XB 1I4WA 2C96A 1N5WA 2H88B 5BPVA 1K3WA 1FIQA 4AQ7A 1F2RI 1XO3A 4GDLB 2XLJA 3TPZA 2KZUA 2RDHA 4FVMA 4MGIE 3IFUA 2H89B 1QQWA 2BTWB 1CZPA 4D8BA 3VKHA 4MACA 3U2SC 3AMZA 2PIAA 1E7PB 3U5ZB 4DV0M 1D4BA 3PHUA 1HXYD 1PDXA 3FUUA 1VDDA 2L1AA 5EXSA 3NZ3A 3RGSA 1IN5A 1ZXIA 1C1KA 4G4OA 1XLPA 1K51A 3DZDA 2WU2B 3AH7A 5FTKA 1YZBA 1T3TA 2QCUA 1IM2A 4MGKE 4TQ0A 3VDUA 3PT2A 1J5EM 1V1PA 3ZC7B 7CATA 1N78A 3EIEA 2ACZB 1HNXM 3NWLA 1I4RA 1I4XA 4IBKA 3N9YC 1PJJA 3J7AS 5FTLA 3IXSA 1ESFA 2LXEA 4ZYSA 3SAWA 3VQIA 1NHGC 1CQVA 4RCOA 5A2QS 1XEEA 4DV6M 4IBFA 1OQRA 4DUYM 1I4PA 2QBYB 4BLCA 1STEA 4ZHPA 1BUIC 2ZW0A 3U6EA 3B9JA 1IXZA 1DO0A 4B7GA 3A98B 3ZJVA 3LYYA 3RPFC 2OPFA 4KKIA 4YSXB 3SAVA 4M0WA 1NEKB 3AEEB 4A3VB 1KYIA 1FXIA 1OFFA 4R3DA 3TWLA 3M6AA 1R6BX 1C77A 3FUTA 4IBDA 1NENB 3T3NA 4G4QA 1UWMA 1YN4A 1D5XC 3KWLA 1ZUD2 4BBAA 4EIWA 3PZ7A 4LFAM 2QMTA 2BS3B 1FFUA 3LVWA 1PYWD 2N9LA 1HEZE 2ONQA 3VR8B 2QIEB 4OU7A 5EZQA 5FLXS 1Q3CA 1PUTA 3FUXA 3AE2B 3NUHB 4M9ZA 2QEJC 2R46A 4MM3B 2G5GX 2KZSA 4KX6B 2Y0TA 3KXEC 2D7HA 4QOSA 2WXFA 2WS3B 3J7BA 3LMMA 5EP2A 1WRIA 3P4RB 3AB5A 1JWAD 1SE2A 4GDKB 3NBIA 2X49A 1KFVA 2INPE 1G41A 3IT6B 1V1OA 1DGJA 3L27A 2SEBD 1YNTE 2FFJA 3SAUA 2LEKA 3MP9A 3KOZE 3Q8EA 4KO8A 2L6OA 4HEA1 3VDPA 4WH4A 3K8ZA 4C7YA 3A42A 4C7ZA 1MX0A 2KMMA 5ITXA 3FTCA 1ROEA 3Q8AA 1CJEA 3BK2A 3AFHA 3PZ8A 2JA2A 2LMCA 2WXRA 1HT2E 1Y56A 4GH9A 3AL0C 2ZBKB 5LMNM 1EU3A 1JROA 2DVWB 3BYYB 1DGHB 1QAOA 4DV5M 1IBXB 1HT1E 4CHTB 1C4PA 4GMQA 4AW4A 2W54A 1XMOM 1YSYA 4DR7M 3ZNHA 1VZ6A 1NNUC 3LQQA 3TQSA 4Z8XA 1WGKA 1H6UA 3I9V1 2RGOA 2KW0A 1GAQB 3K2LA 4BOPA 2L83A 3T3OA 5DNYA 1L1ZA 2I7NA 2WXHA 3QWLA 1SXJC 1SXJE 4HLQA 4QHSA 3GPXA 3JAMS 2IGDA 1K3XA 4W5WA 3GS2A 3U6MA 4DR6M 3SATA 1KSFX 1J7AA 3C58A 3SBJA 2LHEA 2V3PA 3U52E 2D5GA 4AI6A 4BOUA 3MC0B 1IN4A 3HHWA 2YNMD 1EM7A 3T15A 3UGJA 2IGHA 3FUVA 1QILA 2YQZA 3AV0A 1J7BA 1QZMA 1MU5A 2WXMA 2VQFM 3VK8A 1SBBB 4BOZA 2UUAM 3SYLA 2DZOB 1FNWA 1V8CA 1AN8A 3HU3A 3GP7A 1TS2A 3AEGB 1SIJA 2WXKA 3CF6E 5EE1A 1YJIA 3SARA 1ET6A 3HJQA 3U7ZA 2DWZB 3O13A 4FWHA 4MGZE 1IBMM 2Z84A 3R9XB 4GHLA 3K1JA 5E26A 1OJLA 2BBCA 3BVZA 1NI3A 4LY6A 1NY5A 3MFGA 2QENA 1D6EC 4WW0A 1VLBA 1F77A 2XFTA 3DWMA 1HZ5A 3PXGA 4OVZB 1HNZM 1QF6A 5ITTA 2EKIA 1C9FA 3U60A 4JI7M 2EUCA 1JWBD 5H92C 2LUMA 1C79A 1VDVA 2DLBA 2PVGC 2QILA 1IBLM 1QQRA 1X37A 4JI6M 4A55A 4D8IA 1C4CA 1YJJA 2K5PA 1JWSD 5C18A 3KOWE 2E6XA 4L15A 4IIWA 1ZDVA 4AKGA 2Y21A 2QPAA 4NXNM 3GLIA 2P5TA 1OFIA 2BW2A 5FR3A 1L8QA 2J4XA 4B3SM 4A8XC 1EE8A 3TWKA 4JWUC 1QOFA 2QP9X 2XZUA 3Q8XA 5KPRA 4RGNA 3IT4B 1JQ4A 2V1CA 1XC8A 5BR8M 4S12A 4N59A 3D8LA 4JXJA 1YQ3B 1PFDA 2KRUA 3AE5B 4JI1M 3B21A 2UXCM 3FD9A 4CGYB 5KO3A 4AQYM 1J7KA 2FBWB 2PKOA 2LWXA 3SFZA 3SMPA 1SXJD 3AOEC 2FUG1 2CE7A 5FTJA 1XLQA 1XXGA 3IG8A 4GRIA 4X62M 5C3JB 1TDHA 4C56C 3GQ3A 3TUOA 2DBYA 1UNSA 1L6UA 3B2FA 2L7IA 3BOSA 3FTEA 4QOZC 2BT6A 1IY2A 4DV3M 4J3OD 3NS1A 2I38A 3LB8C 4NSRA 1P7EA 2BNKA 1RM6C 2CV2A 3NVVA 4OHJA 4I5SA 1ORYB 4N6EB 2J7QC 1TY0A 3I51A 3ZJUA 1SF0A 2RKOA 4JX1C 1SXJB 5EXXA 4DR2M 3W9CB 5H37D 4DXFA 3TEXA 3ZJTA 2XZFA 1N34M 4XBOA 2E5LM 3EA6A 1PGAA 4YY3M 2I7PA 1IQPA 3GB1A 3MTVA 3U6OA 4PCZA 1Z59A 2F5SA 4IBJA 4MGHA 4L78A 1RWSA 5TSSA 1JR3D 3UI3A 1FRDA 1XXHB 4I4LA 4LRSA 1WWTA 5HFYA 2DWQA 2Y5PA 3DA1A 4LJ5A 4L16A 3Q69A 5EXTA 1NHWC 3R2IA 4IP3A 3A45A 1L1TA 1FXAA 3HJ8A 3GPUA 3T1YM 4AKHA 3GQ4A 1SJHD 2UUBM 2PMVA 2WXOA 1NJGA 5JI2E 2KA6B 1IGCA 1Q3BA 1B9RA 3HJSA 3NRZA 4RH6A 2ICIA 4JI5M 1FMAD 4B0EA 2KWDA 3W0FA 2FOIC 4FXCA 1B1ZA 2BB5A 1TS5A 2JSVX 1IY1A 4LJ9A 2WU5B 1AYFA 2AQ2B 2XSZD 1XMQM 2KN4A 4L1BA 5EP3A 4HJGE 1GLNA 3CTWB 4B7FA 3ABVB 4Z6YA 1QVRA 1GKIA 2BS2B 3HRDD 2F5OA 1OFHA 1L2BA 1IUEA 1TKEA 3UMMA 2K3UA 1MHXA 8CATA 3E4RA 1PJIA 4A9AA 2QSDA 2ZM6M 1MPEA 2C5RA 3Q8CA 2M19A 4FCWA 4XDDA 5ITYA 3GLGA 4EE2A 2OHFA 4B08A 2AX5A 1K52A 5DYIA 1WXQA 3PFIA 3KP1E 1QLBB 3GLFB 2ZANA 5KQDA 3EUB2 4M9XA 4P6VF 4US9A 3THGA 2X4AA 3AE3B 1JWUD 3MJ5A 3J2PB 5AUKA 1XCQL 3GPPA 4C80A 4LJ4A 3L26A 3I57A 3M7GA 1UGJA 2E3TA 4PDIA 2MJ3A 2HDEA 3SC3A 2GRIA 1L4ZB 1M4VA 2WXIA 3DWGC 2WXGA 2VZKD 3FILA 4LJ6A 2LH0A 3A46A 3MP2A 3J27B 4IKGA 1JRPA 2WLBA 3SHFA 5C2TB 1FRRA 2NTTA 4LJ8A 1VR9A 2CFOA 2UZJA 1HZ6A 3Q8FA 1IN7A 1DGGA 3I4YA 3PNYA 2YR0A 3P42A 4A6QA 3W5VB 3E9SA 3PHXA 1KRHA 1NVMA 1FM0D 4JI3M 2KRKA 1G3IA 1NSFA 3Q8BA 2JX5A 1E9MA 4FWGA 4DR1M 2VZKB 4RKXA 4NRVA 2OEDA 3HHZA 1IY0A 2V3NA 2FNAA 3VKGA 2N7JA 1PGBA 2CEAA 1XLOA 4AKIA 1DYQA 1L4DB 3RFZB 3ILKA 1FNVA 4IBGA 2DZNB 3BIID 4LZZA 3V3XA 2NMQA 3ZH9B 1FNUA 4XGIA 1J7CA 4R7GA 5IWAM 1P7FA 1FNNA 2SAKA 3GLHB 4FW9A 1HR0M 2W3SA 1XCTL 1TZOA 2J7NA 4PT5A 4IOIE 1ENFA 4B3MM 4KKJA 4NRWA 4XDCA 5KPTA 3DFZA 5GKNA 1N61A 2CV0A 1N62A 1VZ8A 1ACCA 4NAMA 2V0GA 3GPYA 2WXLA 3FTDA 2D7GA 4XWWA 4MH8A 1FCLA 3TEZA 5IT9S 2XN9C 1YUBA 1AWDA 1SB3C 5G5HA 2WXNA 1IXRC 4WIPA 4B0MA 2XF3A 2F5QA 2BTWA 3KSXA 5JXVA 4IBIA 5KQ8A 4GKKM 4KODA 5EQTA 3BWUD 3U5ZA 1CK1A 4HROA 4TQ1A 1UUPA 5HHDG 1K82A 1ZP0B 3HU1A 2DHRA 3AJIB 1L2DA 2ZW1A 3C0RA 1N33M 2IJ0A 2JYTA 1QAMA 1TY2A 3O65A 1TKGA 5ITXE 2N0SB 2JTCA 3AE4B 1C4AA 1C76A 2H1RA 4IJFA 1ZOYB 4M9SA 4D80A 2L52A 2RMMA 1TKYA 1N77A 4BOQA 1ZQ9A 4JI8M 4UDUC 5I4DA 4LRTA 4RF0A 4FD2A 3IAS1 1Z5BA 4GITA 2K9XA 3HWSA 1I94M 5F3WA 2MJEA 3AN1A 4QNMA 4HKQA 4ITQA 1V1PB 3PHWA 1BMLC 4FCVA 2M5ZA 1N32M 4MB7A 1JCKB 1GL7A 2CHVA 2FE8A 4OZCA 1Q39A 4LF6M 2QBYA 4GLSC 1GOZA 3SFDB 4G4NA 5ITQA 4FCTA 5BMGA 2ZAOA 1OQQA 1T3QA 3KS8A 1TS3A 3AECB 1IN6A 1G8PA 3KOXE 4IJEA 3MK6A 4TUWA 3PVSA 3OQCA 1YMHE 1UWXA 4YT0B 3L2AA 2R45A 3LVVA 2CUZA 4D81A 1F2RC 1SE3A 2Y20A 4JI2M 1R7RA 3L4PA 1QOBA 1KFYB 4NZLB 3W31A 4GC9A 1GPXA 3KSJA 1HQYE 2HKJA 3AE8B 3P4QB 3VK7A 4OX9M 4ZRPA 2OQ4A 4A90A 3B9PA 1IBKM 4AG5A 4LF4M 2W55A 3CF0A 5D7GA 3PSEA 3NVZA 4II7A 3P63A 5H8YE 3PO0A 3WCQA 2K0PA 2PTLA 3U6LA 2KAJA 3QAUA 3IAM1 1QYRA 4YHHM 3HVDA 3HGIA 2YEPF 4LTUA 3AEDB 3SMSA 1EU4A 3E56A 1D5ZC 2LFIA 4ZOHC 1QKZA 2A5YB 1FD6A 2KQ4X 4RGMA 5EE9A 1E9SA 2XGNA 1EWYC 1DKIA 2CU3A 1L6VA 4DV2M 5G5GA 1E10A 3B2GA 3UK6A 2N9KA 4LFCM 5JI3E 2LHDA 2MEKA 3WHLA 1ZAEA 4KGSA 5HG2A 4L8RC 2PW9A 5HI1A 3VLFB 1L0VB 2XEPA 4KGTA 3BY4A 4ARCA 3AE7B 3TMPA 2Y3AA 3HHXA 2YFQA 2C99A 1JQJC 1MHHE 2WP9B 3TRKA 3MHZA 3GRYA 4KGRA 3M0EA 1JALA 4MI7A 1YN5A 4YSZB 2YEPB 1IXSB 3H8HA 4HL4A 2GI9A 3NVWA 2JXTA 3KWVA 4NOOB 1DGFA 2ERCA 4DQOC 2WDQB 2K22A 2R4JA 1WSPA 3J9CA 3L25A 4LK0M 1E9RA 1C78A 1E32A 2ON8A 4O1NA 1N5XA 4NL4H 2EELA 4LG2A 1NYRA 2XFSA 2PVOD 3TEYA 1Q10A 2JWUA 4DR4M 4FWDA 2TSSA 3BVGA 2L7HA 4A5UA 3KOYE 1DGHA 3P4PB 5MPOA 3AE9B 5LNK1 4BOSA 2W3RA 1IBXA 3R8BA 3BZDB 3AEAB 4X66M 1RYJA 1TS4A 1S3SA 2C9CA 4PD2A 3D8BA 1FFVA 2KDMA 5T8IA 3FKEA 2QZ4A 3FC4A 3HUIA 1NJFA 1EWCA 2BJVA 3FTFA 1E6EB 1ZDXA 2MH7A 1R7SA 4LCBA 1N36M 4IUMA 4IBBA 5AUIA 4QNRA 2HL7A 4DV1M 3AKZA 3TWMA 2JQRB 4US8A 3BBAA 1IN8A 3BK1A 4L2YA 1E0ZA 4LZJA 4XE0A 2BU3A 2NQ8C 4WURA 4YTPB 4RGOS 4GUAA 3HVZA 4NAWB 3RGPA 2R61A 1FEHA 4L4UA 1E94E 2B76B 3BB7A 1SEBD 3SR6A 3U6CA 4LGMA 4G6ZA 3W30A 1W5TA 2F5PA 3FYCA 4ARIA 2AGAA 1YN3A 3TEWA 4DV4M 4LLGM 4ZTBA 2EA0A 1T5XD 1V97A 5JZEA 3CF2A 1N60A 1MVKA 2D7EA 4P16A 3AEBB 3U6DA 2INNE 3KS4A 1R2ZA 2IPKD 4OVZA 4BB9A 3U61B 1G59A 2WXPA 4G4RA 3P1MA 1JW9D 1SSNA 4GKJM 2AQ3B 2L09A 1UKFA 3R2TA 4YXDB 1XNRM 1JWMD 1VZ7A 1KH0A 2Q2EB 2WXJA 4D2KA 1K50A 4KLNA 5BYQA 4TSSA 3LQRA 3U60B 3RFWA 1KTKA 1TH2A 3JR4A 4OW0A 2CHQA 4CQNA 3RE8A 3L28A 2I2YA 3AE6B 1I7HA 1IGDA 4XWTA 2BTEA 2Z7JA 3TSSA 1QAQA 5BYSA 3KQ4A 3WHKA 1N63A 1W5SA 2GB1A 3GLIB 2M56B 2BJWA 3FUWA 3NVYA 5EE3A 2R4EA 1J09A 4NSOB 1FCCC 2MJDA 1AW7A 3W0LB 2NTSA 4JYAM 1NYQA 4JI4M 2BYTA 2ZAMA 1XNQM 1YQ4B 2WDRB 2CV1A 4YSYB 5FK9C 2VIIA 3OWEB 4YWGG 4YTNB 2J7OA 4H2AA 4M0DA 1I4QA 5DYGA 4DXGA 2V1UA 5GXGB 3KVWA 2UUCM 2W82A 3PNVA 4JI0M 2XH9A 5EJCA 4GIPA 1ZE3D 2Q5WD 2M60A 2R62A 3GQ5A 2HHHM 3BVMA 1NNJA 1SE4A 2DYOA 1TH4A 4WWMA 2DWMA 2F5NA 2K47A 1L0YB 3TL4X 3EIHA 2JZPA 1DOIA 2AQ1B 1ZPSA 3C8YA 4OZBA 4OZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  3MP2 A;  4R3D A;  4RNA A;  4P16 A;  2FE8 A;  4WUR A;  5E6J A;  4RF0 A;  3E9S A;  4OVZ A;  4PT5 A;  5KO3 A;  4OW0 A;  4RF1 A;  4REZ A;  4M0W A;  4MM3 B;  4OVZ B; 
#chains in the Genus database with same CATH topology
 2RSU A;  3FAH A;  1LV7 A;  5CHF A;  4I05 A;  3EGR A;  2WXQ A;  2ARY A;  3AEF B;  1H8C A;  2JQG R;  2KXE A;  4L23 A;  1TH3 A;  2KDE B;  5ITU A;  1TR8 A;  1XLN A;  3USV A;  2KTR A;  4B3R M;  1SXJ A;  2IGG A;  3UZU A;  1BXT A;  5FKA C;  3ETR A;  3SHG B;  4E3C A;  4W9G A;  1TLO A;  4X6H A;  2EMT A;  2N9X A;  3SAS A;  4NQL B;  4CZW A;  2AS8 A;  2E02 A;  3KDS E;  3QQ8 B;  2KAC A;  4K81 A;  3VR9 B;  3W68 A;  3ERV A;  3DOA A;  1TJE A;  3VRB B;  3I4V A;  5C1Z A;  4A3O A;  2R9O A;  4F1I A;  3DBL I;  3PVL A;  4RNA A;  4WJQ A;  4EKU A;  3B7Q A;  2EO2 A;  4MEM A;  3DCG A;  4HDQ A;  2MLB A;  3DDC B;  3HX3 A;  2DCC A;  3ZGZ A;  3UIN B;  4Q8G A;  2JY5 A;  4IBE A;  4OEM A;  3WXE A;  2Z4R A;  3W2D A;  2AYO B;  2HJ8 A;  3I3T A;  5F02 A;  3UGB B;  3RNG C;  5JHA A;  3PRM A;  3IG5 A;  3PPA A;  1L2C A;  2GHU A;  2UWQ A;  2DWN A;  1WXA A;  2L8J A;  4W9C A;  4WQM A;  1XXH A;  2X8X X;  2PBH A;  1DGB A;  3ZNI D;  1L5P A;  3KYD D;  1HA5 A;  2L4E A;  4PDG A;  1TYG B;  4RGT A;  3W1S A;  3HKP A;  4MSX A;  2OZ2 A;  1WGN A;  3WIM A;  2XU3 A;  4PS7 A;  2E00 A;  4IM0 A;  4YTM B;  2KDB A;  1GVN A;  2UXB M;  4G3X B;  4QHT A;  1IYF A;  2C98 A;  5BYR A;  4GIV A;  2N35 A;  1QAN A;  4B7H A;  5DPW A;  1N75 A;  2D10 A;  3RCZ A;  5EZS A;  4DR5 M;  2NBU A;  4AZF A;  4M02 A;  2WQY B;  2J42 A;  3QAR A;  4TMA B;  4ASW C;  3PRP A;  4D8E A;  5ITR A;  1MDW A;  2DWL A;  5EF4 A;  2DOS A;  1PM5 A;  1QT9 A;  1KLV A;  2R18 A;  2KNZ A;  3V61 A;  1KLU D;  3KW6 A;  2KOX A;  3W5U B;  5FSW A;  1R5L A;  2ZNV C;  2V4I B;  2BDZ A;  4GHA A;  1JR3 A;  4D82 A;  4W9J A;  4LJA A;  4X64 M;  2KWV B;  4RF1 A;  2L32 A;  3K92 A;  3HWN A;  3LXF A;  3P5U A;  3PLV A;  2G8L A;  1AAR A;  1F0Z A;  2KC2 A;  4CIS A;  1HQR D;  4N58 A;  3RNV A;  2C7M B;  2LVO C;  1DO2 A;  2AUX A;  2WBF X;  2KJH B;  1KLG D;  4TV3 A;  2O5R A;  3U7D A;  2G4S A;  1Y08 A;  4I07 A;  2LJI A;  4ITK A;  4DR3 M;  2LNH C;  1VRA B;  2ATO A;  3AI8 A;  3ZW3 A;  4IBC A;  3VRA B;  2LVN C;  1DF0 A;  2F4V M;  1FJG M;  3GRV A;  3VFD A;  2X8A A;  1SGH A;  2HCB A;  4ZRQ A;  5JHB A;  3DF0 A;  1T6B X;  2MSE D;  5C23 A;  3V76 A;  4RMA A;  1Z5C A;  2KEB A;  5J2R A;  5D3D A;  3DVG X;  2K8B A;  1TGU A;  2KXJ A;  1YVB A;  3U6S A;  1YIW A;  1WMH A;  3PT2 B;  4I81 A;  4DBG B;  1I4G A;  4DXA B;  1PVJ A;  4WWO A;  4Q2J A;  5EXP A;  1F4I A;  1HQC A;  1WJU A;  2VQE M;  5D2M B;  3P4S B;  1QOG A;  5BMI A;  3C9P A;  3S3R A;  3OVZ A;  1XWI A;  1R4M B;  2NBV B;  3ZYY X;  2C9O A;  5G2N A;  4K7W A;  1O0E A;  3W67 A;  5JH5 C;  2RDG A;  4KHP M;  4GN1 A;  2XSZ A;  3U61 A;  2MBH A;  1WGL A;  1L7Y A;  4FHK A;  1AU0 A;  1CUK A;  3DVN U;  3ZTD A;  2IDY A;  3U6Q A;  3GLF A;  5FTN A;  3IMA A;  1ET9 A;  4NJC A;  3NHE A;  1NY6 A;  4LF5 M;  3ZQ4 A;  2LRW A;  2QHO B;  2GOW A;  3GLG B;  1KOT A;  5EGW A;  1Z5A A;  2QQ8 A;  1YD8 U;  1JR3 E;  1SE9 A;  1P3Q Q;  2VDB B;  4K1R B;  2BB6 A;  3JVZ X;  4LF9 M;  1TDZ A;  1G71 A;  3GP1 A;  1F9J A;  3FKY A;  1TT5 B;  2H5X A;  4G50 A;  4N9F 4;  3MHV C;  3U4E G;  2M0A A;  5J18 A;  2B1M A;  3S3Q A;  3HU2 A;  2CJO A;  3CWI A;  5EE0 A;  2G1E A;  3AM9 A;  2V6Z M;  3L17 A;  1XD3 B;  4JE3 B;  3TE6 A;  2Y5C A;  3AV8 A;  2JU6 X;  3IFW B;  3URY A;  3FYD A;  1KF6 B;  3VAW A;  4MGY E;  5LMU M;  1R4N B;  4M0W B;  2MJ5 B;  3A9J B;  3AOE A;  2XEW A;  1WYG A;  2X38 A;  1WJ7 A;  1GL6 A;  1OIZ A;  4I8O A;  1VJK A;  2Z4S A;  3J80 S;  4LF8 M;  1NLJ A;  2DI0 A;  1VCB A;  1YE9 A;  3JR5 A;  4JV5 M;  4ZHO A;  4K7C A;  1LO5 D;  1SJE D;  4I6N B;  2XNA C;  3P5V A;  2DZL A;  3AE1 B;  1OEY A;  1F52 A;  5BMH A;  1RFK A;  1WGR A;  2FCN A;  3KFU G;  1ZV1 A;  2JP7 A;  2K0B X;  1JML A;  5IZ7 D;  5C1B A;  2HWK A;  5KPZ A;  1XF5 L;  3APD A;  3CIR B;  5E6J A;  5EDS A;  4WAF A;  2JZ1 A;  3SFE B;  3FIL B;  2DAI A;  9PAP A;  1FXT B;  2G9H D;  3L29 A;  1UM8 A;  2R65 A;  3OTO M;  4LF7 M;  4JWS C;  2ZCC A;  3J81 S;  2CHG A;  2OJW A;  2HD5 B;  2HTM E;  4ZPX A;  1A70 A;  2IO3 B;  3ZCB B;  2BS4 B;  4W5C A;  4MH0 E;  1NVI D;  3R8F A;  1AU4 A;  1Z6T A;  2J7Q A;  3GRU A;  2Z3X A;  1U9Q X;  2CJN A;  3GLF E;  3ZTC A;  2N1W A;  1F29 A;  1MI0 A;  3B89 A;  4PP2 E;  1OGW A;  2CB5 A;  4LJ7 A;  3SEB A;  1QDQ A;  3UJN A;  4MT5 A;  3RNA C;  4DUZ M;  2YLM A;  2PLP A;  4MSM B;  4B3T M;  5EP1 A;  3H4M A;  2IBI B;  5IRE B;  4RFB A;  4HXD B;  5FTM A;  3RVW A;  1OAO C;  4YYR A;  1GB1 A;  2RPV A;  1PGY A;  3JYU A;  3BIN A;  1D2N A;  1QXP A;  1ZW7 A;  4JQW C;  1FO4 A;  2LHC A;  1Q0W B;  5L95 C;  4AS1 A;  4DK5 A;  1I4H A;  3APF A;  2LVQ A;  3ML8 A;  4LFB M;  2DNA A;  1GLO A;  1EO6 A;  3U6P A;  4KLB A;  2HTH A;  1RU3 A;  1DOY A;  2IO2 B;  4K0K M;  1YT7 A;  1YOV B;  3NOB A;  4URK A;  2RGH A;  5E6N A;  2B3T A;  4HRS A;  2GLS A;  2DYB A;  2FTD A;  3GLH A;  3GO8 A;  1QOA A;  3T1H M;  1AU2 A;  3ALB A;  3L0W B;  1NQC A;  2E03 A;  3N3K A;  1ZXH A;  4C4V A;  4GC5 A;  2I1J A;  3KP0 E;  4KVG B;  2DYM A;  2J53 A;  5A24 A;  1V80 A;  2GQF A;  3AOG A;  2NPT B;  2IY1 B;  3RYT A;  3V6C B;  4NXM M;  2N1V A;  4USA A;  2RRU A;  1XHB A;  3T38 A;  1HNW M;  3GRR A;  2CHZ A;  4JPS A;  2LJ5 A;  1GB4 A;  1U5I A;  3H7P A;  3V05 A;  3B08 A;  4JN6 A;  2LGI A;  2UU9 M;  3BYT B;  4BPV A;  2UXD M;  4EZJ A;  2L7R A;  1PCI A;  4REZ A;  4HKZ E;  1R2Y A;  1GC6 A;  5EP4 A;  2K8H A;  2WNM A;  5D3I B;  4LCD E;  1KHP A;  3DVG Y;  4IDI A;  4LGY A;  1K53 A;  5HKH A;  2WSF F;  3MJW A;  1G4A E;  2BYE A;  3SYK A;  2KMC A;  2QJL A;  2ZNV B;  2JRI A;  2WDV B;  1PGX A;  2L4F A;  2NVU I;  1D5M C;  3IHP C;  3KLS X;  2L0T A;  3UF8 A;  4CDE B;  4DV7 M;  3KW9 A;  4B9K A;  3HHY A;  2DXI A;  2KNV A;  4P6E A;  2Y0Q A;  1WX8 A;  2JYE A;  1JRU A;  3QX1 A;  3QA8 A;  4XZX A;  4WP2 A;  3PLU A;  1GG3 A;  2Z8L A;  4AG6 A;  1DOX A;  2BF8 B;  2AHM A;  2KAN A;  5D6J B;  4X65 M;  1SXT A;  2J52 A;  1L0X B;  1UBQ A;  1I4W A;  2C96 A;  1P0R A;  2CKH B;  1N5W A;  2H88 B;  4EOY A;  5BPV A;  1K3W A;  2P86 A;  1FIQ A;  4AQ7 A;  1F2R I;  1XO3 A;  4GDL B;  2AEH A;  2XLJ A;  1WI0 A;  3ZNH B;  3TPZ A;  4I04 A;  2KZU A;  2RDH A;  5L83 A;  2DJF B;  4FVM A;  3RD2 A;  4MGI E;  2PE6 B;  3IFU A;  2H89 B;  3EEC A;  1CS8 A;  1QQW A;  1EIJ A;  2BTW B;  2M4N A;  5AZG A;  4FLH A;  1CZP A;  4D8B A;  3SU8 X;  3VKH A;  1J0G A;  4MAC A;  1MIR A;  3R66 C;  3U2S C;  1NV8 A;  2LXA A;  3AMZ A;  2PIA A;  4LNO A;  3VXW A;  1E7P B;  3U5Z B;  2ZZP B;  4DV0 M;  1D4B A;  1QDR A;  4JLC A;  3PHU A;  3V62 A;  1HXY D;  1PDX A;  3A9K A;  5IO9 A;  3FUU A;  4R71 A;  1JB0 F;  2J0M A;  1VDD A;  2L1A A;  5EXS A;  3NZ3 A;  4XC2 A;  3RGS A;  3C0R B;  1IN5 A;  1ZXI A;  1C1K A;  4G4O A;  1XLP A;  1WXS A;  1K51 A;  4LJP B;  2CHW A;  3O65 B;  3VTU A;  4QAY A;  4BOS C;  3SD5 A;  1WGH A;  3DZD A;  1NI2 A;  1JQP A;  2WU2 B;  3AH7 A;  5FTK A;  4BKG A;  1YZB A;  1T3T A;  2D11 A;  3QIJ A;  2QCU A;  1I35 A;  1WIV A;  1IM2 A;  3Q2A C;  1Y8G A;  4MGK E;  1HE8 A;  2DCD A;  3PBH A;  3OF9 A;  4TQ0 A;  3VDU A;  1WXV A;  2JUO A;  5FPW A;  2FCS A;  3PT2 A;  1J5E M;  1V1P A;  1WJN A;  3ZC7 B;  3UQB A;  7CAT A;  2EKK A;  1N78 A;  1V81 A;  1WFY A;  1EWP A;  2LGY A;  3DBH I;  1D0M A;  3EIE A;  2KHH A;  2ACZ B;  1ITO A;  1HNX M;  3NWL A;  1I4R A;  1I4X A;  4IBK A;  3N9Y C;  1PJJ A;  3J7A S;  3K9M A;  5FTL A;  2DX5 B;  2HE7 A;  1YK7 A;  3IXS A;  3VTW A;  1ESF A;  3T8M A;  2LXE A;  4ZYS A;  3SAW A;  3VQI A;  1NHG C;  4JGH B;  3V60 A;  2YJB A;  3OAW A;  3DHI C;  2RR9 A;  1WIA A;  2BWB A;  1CQV A;  1MG8 A;  3PHW B;  4RCO A;  2MQJ A;  5A2Q S;  2AUZ A;  1XEE A;  4DV6 M;  5AEK B;  5LXH A;  1WXM A;  4IBF A;  1OQR A;  4DUY M;  1I4P A;  2QBY B;  3M99 A;  2INC C;  4BLC A;  4YL8 A;  1PJQ A;  2FS1 A;  1POP A;  1STE A;  4ZHP A;  1IP9 A;  1BUI C;  2ZW0 A;  2ZPN A;  2AIM A;  3U6E A;  3B9J A;  4J6I A;  1IXZ A;  4II3 B;  1DO0 A;  1BP4 A;  4B7G A;  1WJ6 A;  3A98 B;  3IOQ A;  2E01 A;  1BVS A;  3ZJV A;  2IND C;  4NY0 A;  1GCB A;  3LYY A;  3RPF C;  2UYZ B;  2NS5 A;  1YX5 B;  2JRH A;  2OPF A;  3DQV A;  2D3C A;  3P5W A;  1E8Y A;  4KKI A;  4YSX B;  3SAV A;  4M0W A;  3MC8 A;  4IWO A;  2BKF A;  1NEK B;  3AEE B;  4A3V B;  1KYI A;  1FXI A;  2YJ2 A;  1OQY A;  1OFF A;  4R3D A;  2CU1 A;  4JL9 A;  3K9P A;  1CV8 A;  1ZCM A;  3TWL A;  3M6A A;  2OOB B;  3MTN A;  4YYW A;  1R6B X;  1C77 A;  2ZJD A;  3FUT A;  4IBD A;  2PRE A;  2MGW A;  1NEN B;  3T3N A;  3N3G A;  1VJV A;  4G4Q A;  1UWM A;  1YN4 A;  4HJK A;  1D5X C;  3KWL A;  4MJS B;  2ACT A;  1ZUD 2;  3N32 A;  4BBA A;  2JF5 A;  4EIW A;  4G3O A;  3PZ7 A;  3RZF A;  2CHX A;  4LFA M;  3PSE B;  2QMT A;  2BS3 B;  2MBQ A;  3OIS A;  3H89 A;  4PAD A;  3H6N A;  1FFU A;  3LVW A;  1PYW D;  2N9L A;  4K7S A;  1HEZ E;  1WRD B;  1U4A A;  2GBJ A;  2ONQ A;  3TBL D;  3VR8 B;  1NL6 A;  2QIE B;  4OU7 A;  5EZQ A;  4EZL A;  5FLX S;  2N4F A;  1Q3C A;  1V86 A;  1Z2M A;  2Z59 B;  1STF E;  1PUT A;  2BWF A;  4XX5 A;  3FUX A;  3AE2 B;  1WJ4 A;  2QCZ A;  3NUH B;  4M9Z A;  2QEJ C;  2NCN A;  2R46 A;  2BKR B;  2Y5B B;  4MM3 B;  1M6D A;  2G5G X;  2KZS A;  1D0L A;  4KX6 B;  2Y0T A;  2IBI A;  3KXE C;  3KKU A;  2D7H A;  4DWF A;  2MP2 B;  1V2Y A;  3PRE A;  1ME3 A;  1DEU A;  4QOS A;  2WXF A;  2WS3 B;  2KKC A;  3J7B A;  2CRU A;  3KFQ A;  1UZX B;  2KX0 A;  1D0K A;  5CHV A;  3LMM A;  5EP2 A;  1WRI A;  3P4R B;  3AB5 A;  1JWA D;  2VF7 A;  2HHN A;  1GNU A;  1SE2 A;  3FE3 A;  4GDK B;  3NBI A;  1RFA A;  2X49 A;  1IXS A;  1KFV A;  2QC8 A;  3HY5 A;  4GGQ A;  4II2 B;  1WGY A;  2INP E;  1G41 A;  2UU7 A;  1VDL A;  2D3A A;  3IT6 B;  2R6N A;  3BC3 A;  3BY4 B;  1V1O A;  4IWQ A;  1DGJ A;  2K6D B;  3L27 A;  4A3P A;  2SEB D;  1YNT E;  2FFJ A;  4K3C A;  1WM3 A;  2WX1 A;  3A1Q B;  3SAU A;  2LEK A;  3MP9 A;  1IFY A;  3KOZ E;  3QCA A;  2MH8 A;  3CGW A;  4W5B A;  1WR1 B;  3Q8E A;  4KO8 A;  2D3G A;  1Y4H A;  2L6O A;  4HEA 1;  5IOI A;  3VDP A;  2WZJ A;  4WH4 A;  4N8W A;  3MHS D;  2OOA A;  1EWM A;  3TIX A;  4FHJ A;  3BWK A;  2KX3 A;  3K8Z A;  3ZKJ C;  1AIP C;  4C7Y A;  3A42 A;  3B79 A;  4C7Z A;  1MX0 A;  1TZ1 A;  2KMM A;  5ITX A;  1ROE A;  3FTC A;  2ZVN A;  3Q8A A;  1CJE A;  3CH2 X;  2J0K A;  4FK5 A;  3BK2 A;  3AFH A;  2L3Z A;  3PZ8 A;  4CO7 A;  4HCP B;  2JA2 A;  2LMC A;  2WXR A;  1HT2 E;  2FUD A;  1Y56 A;  2B1N A;  4GH9 A;  2O2V B;  3AL0 C;  2JY6 B;  2ZBK B;  3KVF B;  4HK2 A;  5LMN M;  2DAM A;  4BSQ A;  1VEK A;  2VHF A;  4ZRI A;  1EU3 A;  1JRO A;  2DVW B;  3BYY B;  4BVU C;  1DGH B;  1QAO A;  3M3J A;  4S17 A;  4DV5 M;  4PS8 A;  4RKU F;  1IBX B;  1HT1 E;  4CHT B;  1C4P A;  4GMQ A;  4AW4 A;  2W54 A;  3WAO A;  1XMO M;  1YSY A;  4DR7 M;  1IPG A;  3ZDM C;  2R44 A;  2FH0 A;  1VZ6 A;  1NNU C;  3ZNH A;  3LQQ A;  1WGG A;  3NZU A;  4GEW A;  2WDT B;  2N7E A;  3TQS A;  4Z8X A;  1WGK A;  3X23 A;  1H6U A;  3I9V 1;  2XK5 B;  2RGO A;  3L13 A;  2MRP A;  3F92 A;  3QK0 A;  1TU6 A;  2KW0 A;  3DBR B;  1GAQ B;  3K2L A;  4BOP A;  2V3S A;  2L83 A;  3T3O A;  5DNY A;  1L1Z A;  2I7N A;  2WXH A;  3A33 B;  4YV8 A;  3QWL A;  1SXJ C;  1SXJ E;  2M17 A;  2KZR A;  4HLQ A;  4QHS A;  3GPX A;  5DPR A;  1Z5S B;  3JAM S;  2IGD A;  2KLG A;  2XU1 A;  4QH6 A;  1K3X A;  1AYW A;  2LRU A;  1LM8 B;  3U30 A;  1J8C A;  4DHZ B;  4W5W A;  3H7D A;  3U6M A;  4DR6 M;  3GS2 A;  3SAT A;  1KSF X;  3KW5 B;  5CHT A;  1J7A A;  1PJT A;  3C58 A;  1R4M I;  3SBJ A;  2LHE A;  2V3P A;  4NAW A;  3U52 E;  2D5G A;  1V92 A;  4Q8H A;  2B3A A;  3PZD A;  2P7U A;  4IUM B;  2FYE A;  4AI6 A;  2F7D A;  1FPY A;  1IWD A;  4BOU A;  3MC0 B;  1IN4 A;  3HHW A;  2DCB A;  2YNM D;  1EM7 A;  7PCK A;  3T15 A;  3UGJ A;  3JSV B;  2IGH A;  5KHQ A;  3FUV A;  1PQS A;  1QIL A;  2YQZ A;  1YK8 A;  2LGS A;  2GMI C;  3AV0 A;  1J7B A;  1QZM A;  1L2N A;  2Y6E A;  1MU5 A;  2WXM A;  1XXH E;  2JXX A;  2VQF M;  3VK8 A;  1SBB B;  4BOZ A;  2KFK B;  2UUA M;  3JW0 X;  3SYL A;  3LDZ E;  1WHC A;  3DHG C;  2PAD A;  1F2B A;  2DZO B;  3W1S C;  1FNW A;  1PPD A;  1V8C A;  3MOR A;  1AN8 A;  3HU3 A;  3GP7 A;  1TS2 A;  3AEG B;  2LWP A;  1SIJ A;  2NQG A;  4PK1 A;  2WXK A;  3CF6 E;  1QUT A;  5EE1 A;  1U9V A;  1YJI A;  2KC1 A;  1R4N I;  3SAR A;  1ET6 A;  3GZN B;  3HJQ A;  2KDL A;  3U7Z A;  4CDF B;  1C7Y A;  4PP1 A;  2DWZ B;  3O13 A;  4FWH A;  3QAQ A;  4MGZ E;  1IBM M;  2I1K A;  2Z84 A;  3R9X B;  4HEO A;  3E21 A;  4GHL A;  4AJW A;  3K1J A;  5E26 A;  1OJL A;  2BBC A;  3BVZ A;  1NI3 A;  3N4C A;  2KJ6 A;  4WAA A;  5JZE B;  4LY6 A;  1NY5 A;  3MFG A;  2QEN A;  4GXB A;  1D6E C;  3TL5 A;  2M1M A;  4XK8 F;  5CVO B;  4WW0 A;  1VLB A;  1F77 A;  3OG5 A;  2XFT A;  2WYQ A;  3DWM A;  4PYZ A;  1BQI A;  1MEG A;  2G8E A;  2APL A;  5DPT A;  1HZ5 A;  3PXG A;  4OVZ B;  1HNZ M;  4G54 A;  1QF6 A;  5ITT A;  2EKI A;  1C9F A;  2AWT A;  3U60 A;  1AYV A;  4JI7 M;  4M01 A;  8PCH A;  2O6V A;  2LI5 A;  2EUC A;  1JWB D;  5H92 C;  2LUM A;  3IUT A;  1C79 A;  3V6E A;  1OEY J;  1VDV A;  2DLB A;  2PVG C;  2QIL A;  4W9E A;  4ZRJ A;  2YJC A;  1IBL M;  1QQR A;  5J94 A;  2N9E B;  1X37 A;  2C7H A;  4JI6 M;  4A55 A;  4D8I A;  1C4C A;  1YJJ A;  2K5P A;  1JWS D;  5C18 A;  3KOW E;  1LXD A;  2E6X A;  4L15 A;  4IIW A;  1ZDV A;  4AKG A;  1BGO A;  2Y21 A;  3WA0 A;  2O6X A;  2QPA A;  1XB2 B;  4NXN M;  3K9O B;  4QRV A;  5JA7 A;  3GLI A;  1WZ3 A;  1VEG A;  1OFI A;  2P5T A;  3WAM A;  1QDT A;  2BW2 A;  1S1Q B;  5FR3 A;  1L8Q A;  4QRX A;  2J4X A;  3WXF A;  3HD3 A;  4B3S M;  4A8X C;  1EE8 A;  2DAF A;  4BKT A;  2DHY A;  3TWK A;  2OUL A;  4JWU C;  1QOF A;  2QP9 X;  2XZU A;  4LJO B;  3EFU A;  1V34 A;  3T9L A;  5DCN A;  3AU5 A;  3Q8X A;  5KPR A;  4RGN A;  3IT4 B;  4W9F A;  1JQ4 A;  2WWZ A;  4MSQ B;  2V1C A;  2HH5 A;  1XC8 A;  1EF7 A;  5BR8 M;  4S12 A;  4N59 A;  3D8L A;  5G55 A;  4JXJ A;  1YQ3 B;  1PFD A;  3RUL A;  2MR9 A;  4OEL A;  2KRU A;  3CST A;  1TTN A;  4EEW A;  3AE5 B;  3R7R A;  1SP4 B;  3H7S A;  1ME4 A;  3CH3 X;  4JI1 M;  4XGA B;  4MM3 A;  3B21 A;  1THE A;  4BKS D;  1P3Q U;  4CDD B;  2UXC M;  3FD9 A;  2BGF A;  2LVA A;  4CGY B;  1GEC E;  3Q8G A;  3B1L X;  5KO3 A;  2LBC A;  4AQY M;  1J7K A;  2PNS A;  3RVX A;  4M8M A;  1QZE A;  2FBW B;  3KH0 A;  4EUT A;  3PHX B;  2PKO A;  2ZTC A;  2LWX A;  3SFZ A;  3CSF A;  1OTR A;  4TUU A;  3SMP A;  1E7U A;  3B7Z A;  1SXJ D;  4GDK A;  4K7U A;  1ZGU B;  2FCQ A;  3AOE C;  1ISN A;  2FUG 1;  2CE7 A;  5FTJ A;  1XLQ A;  1XXG A;  3IG8 A;  3BBZ A;  2VF8 A;  4GRI A;  4X62 M;  5TR5 A;  1TDH A;  4AUQ C;  4C56 C;  2DNF A;  5C3J B;  2CIO A;  4P7I A;  1HTQ A;  3GQ3 A;  3TUO A;  2DBY A;  4CIZ A;  1UNS A;  1L6U A;  3B2F A;  2L7I A;  3BOS A;  3Q3O C;  3FTE A;  4QOZ C;  3I06 A;  2DEN B;  3GLI E;  1WGD A;  2BT6 A;  3WAN A;  1IY2 A;  1T43 A;  4DV3 M;  4KDI C;  4KSL C;  4J3O D;  3NS1 A;  1S4V A;  2I38 A;  4F1S A;  3LB8 C;  4NSR A;  1P7E A;  1WE6 A;  3RI7 C;  2BNK A;  3QYE A;  1PAD A;  3N1Y C;  1RM6 C;  2CV2 A;  1PXV A;  3IEJ A;  3NVV A;  1Q5W B;  4OHJ A;  1F2C A;  4I5S A;  2LVP A;  1ORY B;  4HLE A;  4N6E B;  3WAP A;  4IM2 A;  2J7Q C;  1ZMU A;  2JZ0 A;  3Q3J A;  5LLI A;  1TY0 A;  3I51 A;  2L2D A;  5CX3 A;  3ZJU A;  1ZKH A;  1SF0 A;  2RKO A;  3PW3 A;  1AU3 A;  2KTR B;  4JX1 C;  1SXJ B;  2WGS A;  2DAG A;  5EXX A;  2EMS A;  4DR2 M;  4ZRK A;  3W9C B;  5H37 D;  4DXF A;  3TEX A;  1CPJ A;  1WX7 A;  3ZJT A;  2AYO A;  1YQB A;  4AOF A;  2XZF A;  1N34 M;  4LNI A;  4XBO A;  1NB3 A;  2E5L M;  1R4G A;  2RPQ A;  3EA6 A;  1PGA A;  2JY8 A;  3ZLZ A;  3I01 M;  3UQA A;  4YY3 M;  3TJP A;  2I7P A;  1IQP A;  3GB1 A;  3NG0 A;  3MTV A;  4X6I A;  3U6O A;  4PCZ A;  4NNJ B;  1AEC A;  1Z59 A;  2F5S A;  2G4D B;  3RNC C;  4IBJ A;  2M0X A;  4MGH A;  3RNB C;  4L78 A;  4IG7 B;  1RWS A;  2QSF X;  1P98 A;  4IM3 A;  5TSS A;  1U9W A;  3AXC A;  2G6D A;  1JR3 D;  3PRM B;  4DMY A;  4G11 A;  4W9H A;  1NPZ A;  3UI3 A;  2DAE A;  1T0S C;  1FRD A;  3MHH A;  1XXH B;  4I4L A;  4LRS A;  1WWT A;  2XK5 A;  5HFY A;  2O25 A;  2DWQ A;  3GLH E;  2Y5P A;  3DA1 A;  3HHI A;  2BPS A;  4LJ5 A;  3PRZ A;  4L16 A;  2KNA A;  2R9C A;  1YJ1 A;  3D32 A;  4UN2 B;  3Q69 A;  5CVN B;  5EXT A;  1NHW C;  1KJT A;  3ZIM A;  3B7N A;  1MS6 A;  3VUW A;  3R2I A;  3ZUN A;  3A45 A;  1L1T A;  4IP3 A;  1FXA A;  4P1B C;  1EWO A;  3HJ8 A;  3GPU A;  3T1Y M;  4LDT D;  1CJL A;  4AKH A;  5E6P A;  3GQ4 A;  4B95 A;  1SJH D;  4FJY A;  2UUB M;  1T6O A;  2PMV A;  2WXO A;  1CSB B;  1NJG A;  2D07 B;  5JI2 E;  1EF1 A;  2KA6 B;  2WHI A;  1IGC A;  1Q3B A;  1T0Y A;  3PRP B;  3C3E A;  1B9R A;  4ZYN A;  3VHT C;  4P6G A;  4WJO A;  4CYE A;  3OJ4 B;  2NBW B;  3HJS A;  2JZZ A;  3NRZ A;  4RH6 A;  2ICI A;  3R3M A;  4EZK A;  4P1C C;  4JI5 M;  1FMA D;  3JSV A;  4B0E A;  1Y8R C;  2KWD A;  3W0F A;  4FN2 A;  4KZ0 A;  2D2Q A;  2L05 A;  2FOI C;  4FXC A;  3Q14 C;  2AVW A;  1B1Z A;  2BB5 A;  2NQI A;  1TS5 A;  2JSV X;  1MJD A;  1WZ0 A;  4ANV A;  1IY1 A;  1VD2 A;  1HUC B;  4F8C B;  4LJ9 A;  1OKS A;  3SHQ A;  2WU5 B;  1MN3 A;  1AYF A;  5PAD A;  2AQ2 B;  4DBG A;  2XSZ D;  2JT4 B;  5IA7 A;  1XMQ M;  3VH3 B;  2KN4 A;  3KSE A;  2G3Q B;  4L1B A;  4XYC A;  5EP3 A;  4HJG E;  3LXS A;  3ZUA A;  1GLN A;  1LQB A;  1WM2 A;  3NBX X;  3ZVV A;  3CTW B;  4B7F A;  3ABV B;  4Z6Y A;  4I6P A;  4WA6 A;  1QVR A;  4LDT B;  1GKI A;  3LCU A;  2BS2 B;  3HRD D;  2A4Z A;  3HM3 A;  1ICF A;  2F5O A;  1OFH A;  1L2B A;  1TF0 B;  4HPM B;  1IUE A;  1TKE A;  2L0F A;  3UMM A;  2K3U A;  2KTF A;  1MHX A;  4KIK B;  3HZJ A;  8CAT A;  3KWZ A;  1WF9 A;  3BCN A;  3E4R A;  2MBO A;  2DZY A;  1C3T A;  1PJI A;  1UD7 A;  1WMH B;  2ZTD A;  4A9A A;  4AP4 C;  2QSD A;  2ZM6 M;  1MPE A;  1FH0 A;  1NBF C;  2R9M A;  3RVV A;  2C5R A;  3Q8C A;  2M19 A;  3IG3 A;  2J0J A;  4G0N B;  4FCW A;  2QHO A;  5ITY A;  3GLG A;  4XDD A;  4EE2 A;  2GBN A;  2HXZ A;  1ZMW A;  4L6V 6;  4ZDV A;  3H9D A;  2OHF A;  4B08 A;  1WH3 A;  1MEM A;  1VG5 A;  2AX5 A;  1PIP A;  5IAA C;  1K52 A;  5DYI A;  1WXQ A;  1GJZ A;  4X6J A;  3PFI A;  3KP1 E;  1QLB B;  3GLF B;  2LHG A;  3MMP A;  2ZAN A;  5KQD A;  3EUB 2;  2ZVO A;  4M9X A;  3NHE B;  1SG9 A;  4P6V F;  4US9 A;  3TNX A;  4E74 A;  3THG A;  2X4A A;  2NR2 A;  2L76 A;  1V9J A;  3A9J A;  3AE3 B;  5E6O A;  3NY5 A;  1QMY A;  1JWU D;  2FUH B;  3MJ5 A;  3J2P B;  5AUK A;  1XCQ L;  4HPL B;  3GPP A;  2DKL A;  3KYC D;  4C80 A;  4LJ4 A;  3L26 A;  2J5Y A;  5DPS A;  1KXR A;  2C7N B;  3I57 A;  1EWL A;  3K9O A;  1LGR A;  3W1Y A;  3M7G A;  1UGJ A;  2BYV E;  3I63 C;  2E3T A;  1MHW A;  4PDI A;  2MJ3 A;  3ENE A;  2YJ8 A;  2HDE A;  3SC3 A;  3P2B A;  2GRI A;  1L4Z B;  1M4V A;  2WXI A;  1XT9 B;  3DWG C;  2WXG A;  2VZK D;  3FIL A;  1BY8 A;  2AYN A;  4LJ6 A;  1XQQ A;  2JWZ A;  2KDI A;  2LH0 A;  1P9D U;  3A46 A;  2KO3 A;  4I6L B;  3MP2 A;  2HD5 A;  3J27 B;  2IYD B;  4IKG A;  3CMM B;  1JRP A;  1VQ1 A;  3PDF A;  1EFU B;  2QNJ A;  2WLB A;  3SHF A;  5C2T B;  1FRR A;  2NTT A;  4C00 A;  3P5X A;  1PRB A;  4LJ8 A;  1RAX A;  1VR9 A;  2CFO A;  2UZJ A;  3U8Z A;  2LVQ D;  1HZ6 A;  3Q8F A;  4WJN A;  5IKC M;  1IN7 A;  1DGG A;  3I4Y A;  2VHS A;  3PNY A;  3GE3 C;  4HXD A;  4N4Z A;  1CTE A;  2RD0 A;  1E90 A;  2YR0 A;  3P42 A;  4S0R A;  2BDL A;  3O1G A;  4A6Q A;  2KMA A;  2J7Q B;  3W5V B;  3E9S A;  1NV9 A;  3PHX A;  1KRH A;  1NVM A;  1FM0 D;  1ZMV A;  2KRK A;  4Q7J A;  4JI3 M;  1G3I A;  1NSF A;  3Q8B A;  2JX5 A;  1E9M A;  4FWG A;  4DR1 M;  1E8W A;  1T0Q C;  5JH3 A;  2VZK B;  1WY8 A;  4RKX A;  4P17 A;  4NRV A;  2OED A;  3A4S C;  3HHZ A;  5IN7 A;  2AU1 A;  1IY0 A;  2V3N A;  2FNA A;  3VKG A;  1E7V A;  2V4L A;  1WR6 E;  3QHT A;  3APC A;  3TCA A;  2N7J A;  1V5O A;  3M62 B;  4FBJ B;  1PGB A;  2CEA A;  1XLO A;  3Q3M C;  3TMP B;  4AKI A;  1DYQ A;  3ONS A;  1L4D B;  4RM8 A;  1MG4 A;  3RFZ B;  1YAL A;  3LFY A;  3NZS A;  2D3B A;  3ILK A;  1FNV A;  4IBG A;  2DZN B;  3BII D;  4LZZ A;  3V3X A;  2GBR A;  4YYQ A;  2NMQ A;  3ZH9 B;  3H8C A;  3V6C A;  1FNU A;  2NPT A;  1KM7 A;  2MA9 B;  4XGI A;  1J7C A;  4R7G A;  5IWA M;  4OVU A;  1P7F A;  1K8R B;  2BVC A;  4BZA A;  2DC6 A;  1FNN A;  2SAK A;  2JQF R;  3IVF A;  4K3B A;  3GLH B;  4GB9 A;  4FW9 A;  2KWC A;  1HR0 M;  2W3S A;  2EKE C;  2KVR A;  4HWY A;  2KJR A;  1XCT L;  3N3K B;  3RN9 C;  3DBR I;  4C4V B;  2WSC F;  4WJP A;  2R2O A;  3QT4 A;  1TZO A;  2J7N A;  4PT5 A;  4IOI E;  1ENF A;  4B3M M;  3RMK C;  4KKJ A;  3D6S A;  4NRW A;  2OO9 A;  4XDC A;  3DBS A;  5KPT A;  2BYF A;  2KFJ A;  3RT3 B;  3DFZ A;  4KZC A;  3H7P B;  2AL6 A;  5GKN A;  3PTF C;  1N61 A;  2K25 A;  2CV0 A;  2LVO A;  2JXN A;  2DZM A;  2P0R A;  1N62 A;  1VZ8 A;  1ACC A;  1Q1O A;  4NAM A;  2V0G A;  4W4U A;  5CHV C;  3GPY A;  3QSD A;  1NO1 A;  3KWB X;  2FO5 A;  1SNK A;  2V9H A;  4HPP A;  3I04 M;  2JRI B;  2WXL A;  3FTD A;  2D7G A;  1V49 A;  4XR7 A;  2MRO B;  4XWW A;  4GDL A;  4MH8 A;  1AUA A;  1FCL A;  3TEZ A;  5IT9 S;  3EC8 A;  1UH6 A;  2XN9 C;  1YUB A;  3QJ3 A;  1AWD A;  2C60 A;  1SB3 C;  5G5H A;  2WXN A;  1D3Z A;  3HHM A;  1IXR C;  4WIP A;  4B0M A;  2XF3 A;  2F5Q A;  2YJ9 A;  2BTW A;  3KSX A;  1QUS A;  5JXV A;  4IBI A;  4DDI D;  5KQ8 A;  3X0W A;  4GKK M;  4KOD A;  5EQT A;  4HVB A;  1UFZ A;  1N6Z A;  3BWU D;  1HJP A;  3U5Z A;  1CK1 A;  1F2A A;  4HRO A;  2HJ1 A;  4TQ1 A;  1UUP A;  5HHD G;  1K82 A;  2EKF A;  3HU1 A;  1ZP0 B;  3DBL B;  2DHR A;  3AJI B;  3RZW C;  3N1Z C;  1SIF A;  3RNE C;  2LGX A;  3C3D A;  1L2D A;  3ZRC A;  3IEC A;  3GZN I;  2ZW1 A;  3L08 A;  3C0R A;  1N33 M;  2XBB C;  2IJ0 A;  2JYT A;  1QAM A;  1TY2 A;  3O65 A;  1TKG A;  5ITX E;  1AYU A;  3QC8 B;  1E5W A;  2N0S B;  2JTC A;  3AE4 B;  1C4A A;  5BO4 B;  2R9N A;  4AJY B;  1C76 A;  4FIP A;  5GMV A;  3NJT A;  2H1R A;  4IW0 A;  4GSW A;  4IJF A;  1ZOY B;  2RGF A;  2BWE S;  5L8R F;  3A9K B;  4M9S A;  4D80 A;  2A5U A;  1EF5 A;  2L52 A;  2RMM A;  1TKY A;  2MWS B;  3DHH C;  3KUZ A;  1A6R A;  4PYU A;  1N77 A;  2OP3 A;  1S3S G;  4BOQ A;  2G3Q A;  1ZQ9 A;  2KNB A;  3HHA A;  1MFW A;  4JI8 M;  2VH1 A;  2PEA A;  4UDU C;  2JWS A;  5I4D A;  4LRT A;  2IPP B;  4RF0 A;  1CB5 A;  4FD2 A;  3NS8 A;  2HAK A;  2JNH A;  2QDF A;  1UF0 A;  3MC9 A;  2FAZ A;  3IAS 1;  1Z5B A;  4GIT A;  3UIO B;  2K9X A;  3HWS A;  1I94 M;  5F3W A;  2R6F A;  2MJE A;  3AN1 A;  2ZEQ A;  2IY0 B;  3VH4 B;  4KIK A;  4QNM A;  4HKQ A;  4ITQ A;  2MX2 A;  1V1P B;  3PHW A;  1BML C;  4LNN A;  6PAD A;  4FCV A;  2LGD A;  2M5Z A;  1N32 M;  4MB7 A;  1JCK B;  1GL7 A;  2FQ9 A;  1GUA B;  3M95 A;  2G45 B;  2CHV A;  2FCM A;  2FE8 A;  4OZC A;  3VUX A;  2F1G A;  1Q39 A;  3ZRF A;  4LF6 M;  1OIP A;  2QBY A;  1TIF A;  4GLS C;  1GOZ A;  3SFD B;  4G4N A;  2DC8 A;  5ITQ A;  4FCT A;  4YVA A;  3LCV B;  1GO5 A;  1QOL A;  2MHJ A;  5BMG A;  4WQO B;  2ZAO A;  1OQQ A;  1T3Q A;  3KS8 A;  4LNK A;  2DZK A;  1TS3 A;  1TTE A;  4Y28 F;  3AEC B;  1IN6 A;  1G8P A;  3KOX E;  4IJE A;  3MK6 A;  4TUW A;  3PVS A;  3KUD B;  3OQC A;  1YMH E;  3WXG A;  1UWX A;  4YT0 B;  3L2A A;  1Q6K A;  2R45 A;  3LVV A;  1RLF A;  2CUZ A;  4D81 A;  1F2R C;  1VSN A;  1SE3 A;  2Y20 A;  4JI2 M;  1R7R A;  1E8Z A;  3L4P A;  1QOB A;  4HCN B;  1PJS A;  1KFY B;  4E71 A;  3AU4 A;  3Q6B A;  4NZL B;  3W31 A;  4GC9 A;  4CDC B;  1GPX A;  3ZQJ A;  3KSJ A;  2OOB A;  1HQY E;  2LXC A;  2HKJ A;  3AE8 B;  3H1U A;  3VK7 A;  1UGM A;  4OX9 M;  3P4Q B;  4HWI B;  4DDG D;  2M8S A;  4ZRP A;  5AZF A;  2OQ4 A;  2ASQ A;  2DAJ A;  4A90 A;  3B9P A;  1IBK M;  4AG5 A;  4LF4 M;  4BFR A;  2JUJ A;  4IC7 B;  4GMV A;  5K16 A;  2W55 A;  4QBB A;  4MJS A;  3CF0 A;  3SDL C;  5D7G A;  3PSE A;  3NVZ A;  4DHJ D;  4II7 A;  3QJZ A;  3ZNG C;  2CR5 A;  3P63 A;  5H8Y E;  3PO0 A;  3WCQ A;  3K9P B;  4AXL A;  2GBK A;  2K0P A;  2PTL A;  2Z0E B;  3U6L A;  2KAJ A;  3MTN B;  5CHW A;  3QAU A;  3IAM 1;  1QYR A;  1V33 A;  4YHH M;  2FNJ B;  3HVD A;  2KN5 A;  3HGI A;  2VRR B;  2YEP F;  4LTU A;  3AED B;  3SMS A;  3QYB A;  3AUL A;  4PS3 A;  1EU4 A;  3E56 A;  3M63 B;  3PV1 A;  3N20 C;  1D5Z C;  2Y5B A;  2LFI A;  4KT0 F;  4ZOH C;  3U8E A;  1QKZ A;  2A5Y B;  4ANW A;  1FD6 A;  1A5T A;  2KQ4 X;  2REX A;  4RGM A;  5EE9 A;  1E9S A;  2XGN A;  1EWY C;  1TGZ B;  1DKI A;  2CU3 A;  1WE7 A;  2MP2 A;  2W9N A;  1L6V A;  4DV2 M;  2JPH A;  5G5G A;  2LZ6 A;  1E10 A;  3B2G A;  3UK6 A;  2N9K A;  4LFC M;  3E1Z B;  3FRI A;  1PPO A;  5JI3 E;  2LHD A;  2MEK A;  3WHL A;  1NB5 A;  2ZPY A;  2O01 F;  1ZAE A;  2MBB B;  4N79 A;  2EJS A;  3HIZ A;  4KGS A;  5HG2 A;  3ZO5 B;  4L8R C;  4DHJ B;  2PW9 A;  3KX1 A;  2PE9 A;  3VLF B;  5HI1 A;  3IHP A;  1L0V B;  4ACF A;  2XEP A;  3UIP B;  2K9D A;  1EUV B;  1XKG A;  4XUI A;  1M94 A;  3ECI A;  4KGT A;  4X57 B;  3VFK A;  4ARC A;  3BY4 A;  3AE7 B;  1F1H A;  3OLM D;  5CVM A;  1A5R A;  3F5V A;  1GAB A;  2LD9 A;  3TMP A;  2Y3A A;  3HHX A;  2FRA A;  2FID A;  3A1Q A;  1T0R C;  2Z0D B;  3R7Q A;  2KYW A;  4A20 A;  2YFQ A;  2C99 A;  1Q02 A;  1KFX L;  1JQJ C;  1MHH E;  1RRB A;  1WR1 A;  2WP9 B;  3TRK A;  3MHZ A;  3GRY A;  4KGR A;  2DZJ A;  3M0E A;  1JAL A;  3ZDT A;  4MI7 A;  1YN5 A;  4YSZ B;  2YEP B;  1IXS B;  2JZ3 B;  3H8H A;  2G8J A;  4HL4 A;  2GI9 A;  1YX6 B;  2V1Y A;  2JXT A;  3NVW A;  3KWV A;  2KT7 A;  4NOO B;  1DGF A;  3BPM A;  2L00 B;  2KWU B;  2ERC A;  4DQO C;  4ANR A;  2FT2 A;  2WDQ B;  4W9D A;  2K22 A;  3HM6 X;  2MCN B;  2R4J A;  1WSP A;  3J9C A;  3B74 A;  3L25 A;  4LK0 M;  1E9R A;  1C78 A;  1E32 A;  2KLC A;  2ON8 A;  2DC9 A;  4O1N A;  3GCB A;  1N5X A;  4NL4 H;  2EEL A;  4LG2 A;  2C0Y A;  1WYW B;  1NYR A;  3ML9 A;  2XFS A;  4MZO A;  4WWP A;  3S2A A;  2PVO D;  3TEY A;  4GOC A;  1V6E A;  1Q10 A;  2JWU A;  2O2V A;  3N1X C;  4DR4 M;  2C9W B;  2JY6 A;  4FJC A;  4FWD A;  2TSS A;  4ANX A;  1V5T A;  3BVG A;  2L7H A;  1DV0 A;  2KVZ A;  4A5U A;  3KOY E;  1DGH A;  4DMX A;  1MJG M;  3VDZ A;  2DHZ A;  3P4P B;  5MPO A;  1OAI A;  3AE9 B;  5LNK 1;  1E8X A;  4ICU A;  4BOS A;  4W9L A;  2W3R A;  1IBX A;  3FRH A;  3R8B A;  1LTM A;  3BZD B;  4HDO A;  4BBN C;  3AEA B;  3N30 A;  4X66 M;  3I3T B;  4FUL A;  1UBI A;  2ZCB A;  3MHS A;  1RYJ A;  3OVX A;  4YYV A;  1TS4 A;  4WWN A;  1S3S A;  2C9C A;  3A4R A;  4PD2 A;  3DVN V;  3D8B A;  1FFV A;  3L16 A;  4W9I A;  2KDM A;  2YVC A;  3FKE A;  5T8I A;  2FIF A;  2KQS A;  2QZ4 A;  2WSE F;  3FC4 A;  3HUI A;  2DC7 A;  2LTU A;  4EFO A;  2GBM A;  4M00 A;  1NJF A;  4JIO U;  3OF8 A;  1EWC A;  3RUI B;  2KQ7 A;  2N7D A;  4PI3 A;  2BJV A;  3FTF A;  1E6E B;  1ZDX A;  4ICV A;  1TL9 A;  1CVZ A;  1PPP A;  2NQA A;  2LVP C;  1ATK A;  2MH7 A;  4AWJ A;  1R7S A;  4LCB A;  4TKN A;  1H4R A;  1N36 M;  4IUM A;  2DZI A;  4IBB A;  5AUI A;  4QNR A;  3F75 A;  2HL7 A;  4DV1 M;  3AKZ A;  3TWM A;  4FAD A;  2JQR B;  4US8 A;  4BAX A;  2WX0 A;  3BBA A;  2JY7 A;  2Z8Y M;  3T6P A;  1IN8 A;  2K8C A;  3BK1 A;  4L2Y A;  1GJT A;  3ZNZ B;  1E0Z A;  3C9E A;  3I5J C;  4BS5 A;  4LZJ A;  4XE0 A;  3PS6 A;  4KDL B;  1BT0 A;  2BU3 A;  2NQ8 C;  3QWZ B;  4MZS A;  4WUR A;  3BXW A;  3ZXV A;  1HTO A;  3B0A A;  4YTP B;  4RGO S;  4GUA A;  4CJ6 A;  2DAK A;  3HVZ A;  2KFK A;  3RGP A;  2GNO A;  4F2L A;  2KDF B;  2R61 A;  1FEH A;  4NAW B;  1K3B B;  3K8U A;  4L4U A;  1WX9 A;  1E94 E;  2B76 B;  3BB7 A;  2XU4 A;  1LFD A;  1P1A A;  1SEB D;  1X1M A;  2DJG B;  3SR6 A;  3U6C A;  4LGM A;  4G6Z A;  2NQD B;  2CP8 A;  3W30 A;  4NJ6 A;  3KUC B;  3H4J A;  3E46 A;  1W5T A;  2MBE A;  2F5P A;  3FYC A;  4ARI A;  4MDK E;  4BOZ B;  2AGA A;  3H6S A;  1YN3 A;  3TEW A;  4DV4 M;  5DFL A;  1NDD A;  4LLG M;  2PPH A;  4ZTB A;  4MEL A;  2AL3 A;  2EA0 A;  4FA6 A;  1PBH A;  1T5X D;  1V97 A;  3DOW A;  1PE6 A;  4BQV A;  5JZE A;  2O6V D;  2K1F A;  3CF2 A;  3L10 B;  1N60 A;  4KSK C;  3DPD A;  1MVK A;  2FRQ A;  3VVW B;  4OVV A;  3RNF C;  2D7E A;  4DHZ E;  4P16 A;  4LNF A;  3Q3N C;  3AEB B;  1I42 A;  3U6D A;  2INN E;  3KS4 A;  4IWP A;  2BQQ A;  1R2Z A;  2IPK D;  4OVZ A;  4BB9 A;  3U61 B;  2XU5 A;  2VH2 A;  3L54 A;  2K39 A;  1G59 A;  2CS4 A;  2WXP A;  2JVC A;  1X9Y A;  4ANU A;  4G4R A;  3P1M A;  1YLA A;  4W9K A;  4F7Z A;  1JW9 D;  1SSN A;  4B6W A;  3PGE A;  1C1Y B;  4GKJ M;  2AQ3 B;  2L09 A;  1UKF A;  3VTV A;  3BPF A;  3R2T A;  4YXD B;  4QRG A;  2R0I A;  1XNR M;  1JWM D;  2OJR A;  1VZ7 A;  1KH0 A;  4BS6 A;  3GOE A;  2Q2E B;  2WXJ A;  4D2K A;  4AXM A;  2R9F A;  1K50 A;  3DBH B;  1U9X A;  2IZV B;  3ZXR A;  4KLN A;  2BWE A;  5BYQ A;  4TSS A;  3LQR A;  3U60 B;  1J19 A;  3RFW A;  1KTK A;  1TH2 A;  2O6V B;  3JR4 A;  2LUE A;  4OW0 A;  3OJ3 A;  4YYU A;  1CQD A;  2CHQ A;  4CQN A;  3RE8 A;  5KHO A;  3V6E B;  5LXI B;  3L28 A;  2I2Y A;  3AI5 A;  3AE6 B;  1I7H A;  1IGD A;  4XWT A;  2BTE A;  2Z7J A;  3TSS A;  3K24 A;  4NQK E;  5IP4 D;  2GFO A;  3VUY A;  1QAQ A;  2IO0 B;  2LAS A;  1GC7 A;  3IV2 A;  5BYS A;  1UEL A;  3KQ4 A;  5FR6 A;  4KV2 A;  3WHK A;  1N63 A;  4NJ7 A;  1GMY A;  4BBN F;  1W5S A;  2GB1 A;  2K6Q A;  3GLI B;  2M56 B;  2BJW A;  3FUW A;  4FJV B;  2DZZ A;  1CMX B;  3NVY A;  5EE3 A;  3CBK A;  3BOW A;  2R4E A;  1J09 A;  4NSO B;  3GLG E;  4GU2 A;  1FCC C;  2MJD A;  2KHW B;  2H7J A;  4ZUX U;  4RM9 A;  1AW7 A;  3W0L B;  2NTS A;  2DCA A;  4JYA M;  1NYQ A;  4JI4 M;  2IO1 B;  2KK8 A;  2BYT A;  2ZAM A;  1XNQ M;  1YQ4 B;  2WDR B;  2CV1 A;  4YSY B;  5FK9 C;  2VII A;  5J17 A;  3OWE B;  1G6J A;  2PJH A;  3EFC A;  3H8B A;  4YWG G;  5CTR C;  1ZIV A;  2K6B A;  4YTN B;  2J7O A;  4H2A A;  4M0D A;  3O0U A;  1PPN A;  1I4Q A;  5AZH A;  2C5L C;  1VEJ A;  5DYG A;  4FJZ A;  2G7Y A;  4DXG A;  2RDB C;  3CBJ A;  3LW5 F;  2V1U A;  5GXG B;  3KVW A;  2UUC M;  2W82 A;  3PNV A;  4JI0 M;  2XH9 A;  1KFU L;  5EJC A;  4NC6 A;  2CWB A;  4GIP A;  2KD0 A;  1ZE3 D;  5D94 A;  2Q5W D;  2M60 A;  2R2Q A;  2R62 A;  3GQ5 A;  2HHH M;  3BVM A;  2MW5 A;  1NNJ A;  1GJS A;  1SE4 A;  3LJ3 A;  2DYO A;  1TH4 A;  1TBE A;  3IBE A;  4WWM A;  3HK0 A;  3Q3F A;  4YYS A;  2DWM A;  2F5N A;  1KHQ A;  2K47 A;  2DEN A;  1L0Y B;  2HWJ A;  3TL4 X;  3EIH A;  4RY2 A;  1OTR B;  2JZP A;  4CHK A;  1AIM A;  3C19 A;  4BKS A;  1DOI A;  2AQ1 B;  1ZPS A;  2N9P C;  4XZ4 A;  3C8Y A;  3PNR A;  3WAL A;  4M8N A;  4OZB A;  4OZA A;  4NPN A;  3EHV A;  3GE8 C; 
#chains in the Genus database with same CATH homology
 3FAH A;  1LV7 A;  3EGR A;  2WXQ A;  3AEF B;  2KXE A;  4L23 A;  1TH3 A;  5ITU A;  1XLN A;  4B3R M;  1SXJ A;  2IGG A;  3UZU A;  1BXT A;  5FKA C;  3ETR A;  3SHG B;  3SAS A;  3KDS E;  3VR9 B;  2KAC A;  3DOA A;  1TJE A;  3VRB B;  3I4V A;  4RNA A;  2EO2 A;  3ZGZ A;  4IBE A;  2Z4R A;  3W2D A;  3PRM A;  3IG5 A;  1L2C A;  2DWN A;  4WQM A;  1XXH A;  1DGB A;  1L5P A;  1HA5 A;  4PDG A;  1TYG B;  4RGT A;  3W1S A;  3HKP A;  4YTM B;  1GVN A;  2UXB M;  4QHT A;  2C98 A;  5BYR A;  1QAN A;  4B7H A;  1N75 A;  5EZS A;  4DR5 M;  4AZF A;  2WQY B;  2J42 A;  4TMA B;  3PRP A;  4D8E A;  5ITR A;  2DWL A;  2DOS A;  1PM5 A;  1QT9 A;  2R18 A;  1KLU D;  3KW6 A;  3W5U B;  5FSW A;  2V4I B;  4GHA A;  1JR3 A;  4D82 A;  4LJA A;  4X64 M;  2L32 A;  4RF1 A;  3K92 A;  3LXF A;  2G8L A;  1F0Z A;  4CIS A;  1HQR D;  4N58 A;  3RNV A;  1DO2 A;  1KLG D;  2O5R A;  2LJI A;  4ITK A;  4DR3 M;  2LNH C;  1VRA B;  4IBC A;  3VRA B;  2F4V M;  1FJG M;  3GRV A;  3VFD A;  2X8A A;  2HCB A;  4ZRQ A;  1T6B X;  1Z5C A;  2KEB A;  5D3D A;  1TGU A;  3U6S A;  4I81 A;  1I4G A;  1PVJ A;  4Q2J A;  5EXP A;  1HQC A;  2VQE M;  3P4S B;  1QOG A;  5BMI A;  1XWI A;  3ZYY X;  2C9O A;  2RDG A;  4KHP M;  2XSZ A;  3U61 A;  2IDY A;  3U6Q A;  3GLF A;  5FTN A;  1ET9 A;  4NJC A;  1NY6 A;  4LF5 M;  3ZQ4 A;  3GLG B;  1Z5A A;  2BB6 A;  4LF9 M;  1TDZ A;  3GP1 A;  3MHV C;  3U4E G;  2M0A A;  3HU2 A;  2CJO A;  3CWI A;  5EE0 A;  2G1E A;  3AM9 A;  2V6Z M;  4JE3 B;  3TE6 A;  2Y5C A;  3AV8 A;  2JU6 X;  3URY A;  3FYD A;  1KF6 B;  4MGY E;  5LMU M;  3AOE A;  1WYG A;  2X38 A;  1GL6 A;  4I8O A;  1VJK A;  2Z4S A;  3J80 S;  4LF8 M;  1YE9 A;  3JR5 A;  4JV5 M;  4ZHO A;  1LO5 D;  1SJE D;  2XNA C;  3AE1 B;  5BMH A;  1RFK A;  3KFU G;  1JML A;  5IZ7 D;  5C1B A;  2HWK A;  5KPZ A;  1XF5 L;  3CIR B;  5E6J A;  4WAF A;  3SFE B;  3FIL B;  2G9H D;  3L29 A;  1UM8 A;  2R65 A;  3OTO M;  4LF7 M;  4JWS C;  3J81 S;  2CHG A;  2HTM E;  4ZPX A;  1A70 A;  3ZCB B;  2BS4 B;  4MH0 E;  1NVI D;  3R8F A;  1Z6T A;  2J7Q A;  3GRU A;  2Z3X A;  2CJN A;  1MI0 A;  4LJ7 A;  3SEB A;  3UJN A;  4MT5 A;  4DUZ M;  2PLP A;  5EP1 A;  3H4M A;  4B3T M;  5IRE B;  4RFB A;  4HXD B;  5FTM A;  1GB1 A;  2RPV A;  1D2N A;  1FO4 A;  4AS1 A;  1I4H A;  4LFB M;  3U6P A;  1DOY A;  4K0K M;  2RGH A;  4HRS A;  3GLH A;  3GO8 A;  1QOA A;  3T1H M;  1ZXH A;  4GC5 A;  3KP0 E;  2DYM A;  2J53 A;  3AOG A;  4NXM M;  4USA A;  1XHB A;  3T38 A;  1HNW M;  3GRR A;  4JPS A;  1GB4 A;  3V05 A;  4JN6 A;  2LGI A;  2UU9 M;  3BYT B;  2UXD M;  4REZ A;  4HKZ E;  1R2Y A;  5D3I B;  5EP4 A;  2WNM A;  4IDI A;  4LGY A;  1K53 A;  1G4A E;  3SYK A;  2QJL A;  2JRI A;  2WDV B;  1PGX A;  1D5M C;  3KLS X;  4DV7 M;  3HHY A;  2DXI A;  2Y0Q A;  2JYE A;  4XZX A;  2Z8L A;  4AG6 A;  1DOX A;  2AHM A;  4X65 M;  1SXT A;  2J52 A;  1L0X B;  1I4W A;  2C96 A;  1N5W A;  2H88 B;  5BPV A;  1K3W A;  1FIQ A;  4AQ7 A;  1F2R I;  1XO3 A;  4GDL B;  2XLJ A;  3TPZ A;  2KZU A;  2RDH A;  4FVM A;  4MGI E;  3IFU A;  2H89 B;  1QQW A;  2BTW B;  1CZP A;  4D8B A;  3VKH A;  4MAC A;  3U2S C;  3AMZ A;  2PIA A;  1E7P B;  3U5Z B;  4DV0 M;  1D4B A;  3PHU A;  1HXY D;  1PDX A;  3FUU A;  1VDD A;  2L1A A;  5EXS A;  3NZ3 A;  3RGS A;  1IN5 A;  1ZXI A;  1C1K A;  4G4O A;  1XLP A;  1K51 A;  3DZD A;  2WU2 B;  3AH7 A;  5FTK A;  1YZB A;  1T3T A;  2QCU A;  1IM2 A;  4MGK E;  4TQ0 A;  3VDU A;  3PT2 A;  1J5E M;  1V1P A;  3ZC7 B;  7CAT A;  1N78 A;  3EIE A;  2ACZ B;  1HNX M;  3NWL A;  1I4R A;  1I4X A;  4IBK A;  3N9Y C;  1PJJ A;  3J7A S;  5FTL A;  3IXS A;  1ESF A;  2LXE A;  4ZYS A;  3SAW A;  3VQI A;  1NHG C;  1CQV A;  4RCO A;  5A2Q S;  1XEE A;  4DV6 M;  4IBF A;  1OQR A;  4DUY M;  1I4P A;  2QBY B;  4BLC A;  1STE A;  4ZHP A;  1BUI C;  2ZW0 A;  3U6E A;  3B9J A;  1IXZ A;  1DO0 A;  4B7G A;  3A98 B;  3ZJV A;  3LYY A;  3RPF C;  2OPF A;  4KKI A;  4YSX B;  3SAV A;  4M0W A;  1NEK B;  3AEE B;  4A3V B;  1KYI A;  1FXI A;  1OFF A;  4R3D A;  3TWL A;  3M6A A;  1R6B X;  1C77 A;  3FUT A;  4IBD A;  1NEN B;  3T3N A;  4G4Q A;  1UWM A;  1YN4 A;  1D5X C;  3KWL A;  1ZUD 2;  4BBA A;  4EIW A;  3PZ7 A;  4LFA M;  2QMT A;  2BS3 B;  1FFU A;  3LVW A;  1PYW D;  2N9L A;  1HEZ E;  2ONQ A;  3VR8 B;  2QIE B;  4OU7 A;  5EZQ A;  5FLX S;  1Q3C A;  1PUT A;  3FUX A;  3AE2 B;  3NUH B;  4M9Z A;  2QEJ C;  2R46 A;  4MM3 B;  2G5G X;  2KZS A;  4KX6 B;  2Y0T A;  3KXE C;  2D7H A;  4QOS A;  2WXF A;  2WS3 B;  3J7B A;  3LMM A;  5EP2 A;  1WRI A;  3P4R B;  3AB5 A;  1JWA D;  1SE2 A;  4GDK B;  3NBI A;  2X49 A;  1KFV A;  2INP E;  1G41 A;  3IT6 B;  1V1O A;  1DGJ A;  3L27 A;  2SEB D;  1YNT E;  2FFJ A;  3SAU A;  2LEK A;  3MP9 A;  3KOZ E;  3Q8E A;  4KO8 A;  2L6O A;  4HEA 1;  3VDP A;  4WH4 A;  3K8Z A;  4C7Y A;  3A42 A;  4C7Z A;  1MX0 A;  2KMM A;  5ITX A;  3FTC A;  1ROE A;  3Q8A A;  1CJE A;  3BK2 A;  3AFH A;  3PZ8 A;  2JA2 A;  2LMC A;  2WXR A;  1HT2 E;  1Y56 A;  4GH9 A;  3AL0 C;  2ZBK B;  5LMN M;  1EU3 A;  1JRO A;  2DVW B;  3BYY B;  1DGH B;  1QAO A;  4DV5 M;  1IBX B;  1HT1 E;  4CHT B;  1C4P A;  4GMQ A;  4AW4 A;  2W54 A;  1XMO M;  1YSY A;  4DR7 M;  3ZNH A;  1VZ6 A;  1NNU C;  3LQQ A;  3TQS A;  4Z8X A;  1WGK A;  1H6U A;  3I9V 1;  2RGO A;  2KW0 A;  1GAQ B;  3K2L A;  4BOP A;  2L83 A;  3T3O A;  5DNY A;  1L1Z A;  2I7N A;  2WXH A;  3QWL A;  1SXJ C;  1SXJ E;  4HLQ A;  4QHS A;  3GPX A;  3JAM S;  2IGD A;  1K3X A;  4W5W A;  3GS2 A;  3U6M A;  4DR6 M;  3SAT A;  1KSF X;  1J7A A;  3C58 A;  3SBJ A;  2LHE A;  2V3P A;  3U52 E;  2D5G A;  4AI6 A;  4BOU A;  3MC0 B;  1IN4 A;  3HHW A;  2YNM D;  1EM7 A;  3T15 A;  3UGJ A;  2IGH A;  3FUV A;  1QIL A;  2YQZ A;  3AV0 A;  1J7B A;  1QZM A;  1MU5 A;  2WXM A;  2VQF M;  3VK8 A;  1SBB B;  4BOZ A;  2UUA M;  3SYL A;  2DZO B;  1FNW A;  1V8C A;  1AN8 A;  3HU3 A;  3GP7 A;  1TS2 A;  3AEG B;  1SIJ A;  2WXK A;  3CF6 E;  5EE1 A;  1YJI A;  3SAR A;  1ET6 A;  3HJQ A;  3U7Z A;  2DWZ B;  3O13 A;  4FWH A;  4MGZ E;  1IBM M;  2Z84 A;  3R9X B;  4GHL A;  3K1J A;  5E26 A;  1OJL A;  2BBC A;  3BVZ A;  1NI3 A;  4LY6 A;  1NY5 A;  3MFG A;  2QEN A;  1D6E C;  4WW0 A;  1VLB A;  1F77 A;  2XFT A;  3DWM A;  1HZ5 A;  3PXG A;  4OVZ B;  1HNZ M;  1QF6 A;  5ITT A;  2EKI A;  1C9F A;  3U60 A;  4JI7 M;  2EUC A;  1JWB D;  5H92 C;  2LUM A;  1C79 A;  1VDV A;  2DLB A;  2PVG C;  2QIL A;  1IBL M;  1QQR A;  1X37 A;  4JI6 M;  4A55 A;  4D8I A;  1C4C A;  1YJJ A;  2K5P A;  1JWS D;  5C18 A;  3KOW E;  2E6X A;  4L15 A;  4IIW A;  1ZDV A;  4AKG A;  2Y21 A;  2QPA A;  4NXN M;  3GLI A;  2P5T A;  1OFI A;  2BW2 A;  5FR3 A;  1L8Q A;  2J4X A;  4B3S M;  4A8X C;  1EE8 A;  3TWK A;  4JWU C;  1QOF A;  2QP9 X;  2XZU A;  3Q8X A;  5KPR A;  4RGN A;  3IT4 B;  1JQ4 A;  2V1C A;  1XC8 A;  5BR8 M;  4S12 A;  4N59 A;  3D8L A;  4JXJ A;  1YQ3 B;  1PFD A;  2KRU A;  3AE5 B;  4JI1 M;  3B21 A;  2UXC M;  3FD9 A;  4CGY B;  5KO3 A;  4AQY M;  1J7K A;  2FBW B;  2PKO A;  2LWX A;  3SFZ A;  3SMP A;  1SXJ D;  3AOE C;  2FUG 1;  2CE7 A;  5FTJ A;  1XLQ A;  1XXG A;  3IG8 A;  4GRI A;  4X62 M;  5C3J B;  1TDH A;  4C56 C;  3GQ3 A;  3TUO A;  2DBY A;  1UNS A;  1L6U A;  3B2F A;  2L7I A;  3BOS A;  3FTE A;  4QOZ C;  2BT6 A;  1IY2 A;  4DV3 M;  4J3O D;  3NS1 A;  2I38 A;  3LB8 C;  4NSR A;  1P7E A;  2BNK A;  1RM6 C;  2CV2 A;  3NVV A;  4OHJ A;  4I5S A;  1ORY B;  4N6E B;  2J7Q C;  1TY0 A;  3I51 A;  3ZJU A;  1SF0 A;  2RKO A;  4JX1 C;  1SXJ B;  5EXX A;  4DR2 M;  3W9C B;  5H37 D;  4DXF A;  3TEX A;  3ZJT A;  2XZF A;  1N34 M;  4XBO A;  2E5L M;  3EA6 A;  1PGA A;  4YY3 M;  2I7P A;  1IQP A;  3GB1 A;  3MTV A;  3U6O A;  4PCZ A;  1Z59 A;  2F5S A;  4IBJ A;  4MGH A;  4L78 A;  1RWS A;  5TSS A;  1JR3 D;  3UI3 A;  1FRD A;  1XXH B;  4I4L A;  4LRS A;  1WWT A;  5HFY A;  2DWQ A;  2Y5P A;  3DA1 A;  4LJ5 A;  4L16 A;  3Q69 A;  5EXT A;  1NHW C;  3R2I A;  4IP3 A;  3A45 A;  1L1T A;  1FXA A;  3HJ8 A;  3GPU A;  3T1Y M;  4AKH A;  3GQ4 A;  1SJH D;  2UUB M;  2PMV A;  2WXO A;  1NJG A;  5JI2 E;  2KA6 B;  1IGC A;  1Q3B A;  1B9R A;  3HJS A;  3NRZ A;  4RH6 A;  2ICI A;  4JI5 M;  1FMA D;  4B0E A;  2KWD A;  3W0F A;  2FOI C;  4FXC A;  1B1Z A;  2BB5 A;  1TS5 A;  2JSV X;  1IY1 A;  4LJ9 A;  2WU5 B;  1AYF A;  2AQ2 B;  2XSZ D;  1XMQ M;  2KN4 A;  4L1B A;  5EP3 A;  4HJG E;  1GLN A;  3CTW B;  4B7F A;  3ABV B;  4Z6Y A;  1QVR A;  1GKI A;  2BS2 B;  3HRD D;  2F5O A;  1OFH A;  1L2B A;  1IUE A;  1TKE A;  3UMM A;  2K3U A;  1MHX A;  8CAT A;  3E4R A;  1PJI A;  4A9A A;  2QSD A;  2ZM6 M;  1MPE A;  2C5R A;  3Q8C A;  2M19 A;  4FCW A;  4XDD A;  5ITY A;  3GLG A;  4EE2 A;  2OHF A;  4B08 A;  2AX5 A;  1K52 A;  5DYI A;  1WXQ A;  3PFI A;  3KP1 E;  1QLB B;  3GLF B;  2ZAN A;  5KQD A;  3EUB 2;  4M9X A;  4P6V F;  4US9 A;  3THG A;  2X4A A;  3AE3 B;  1JWU D;  3MJ5 A;  3J2P B;  5AUK A;  1XCQ L;  3GPP A;  4C80 A;  4LJ4 A;  3L26 A;  3I57 A;  3M7G A;  1UGJ A;  2E3T A;  4PDI A;  2MJ3 A;  2HDE A;  3SC3 A;  2GRI A;  1L4Z B;  1M4V A;  2WXI A;  3DWG C;  2WXG A;  2VZK D;  3FIL A;  4LJ6 A;  2LH0 A;  3A46 A;  3MP2 A;  3J27 B;  4IKG A;  1JRP A;  2WLB A;  3SHF A;  5C2T B;  1FRR A;  2NTT A;  4LJ8 A;  1VR9 A;  2CFO A;  2UZJ A;  1HZ6 A;  3Q8F A;  1IN7 A;  1DGG A;  3I4Y A;  3PNY A;  2YR0 A;  3P42 A;  4A6Q A;  3W5V B;  3E9S A;  3PHX A;  1KRH A;  1NVM A;  1FM0 D;  4JI3 M;  2KRK A;  1G3I A;  1NSF A;  3Q8B A;  2JX5 A;  1E9M A;  4FWG A;  4DR1 M;  2VZK B;  4RKX A;  4NRV A;  2OED A;  3HHZ A;  1IY0 A;  2V3N A;  2FNA A;  3VKG A;  2N7J A;  1PGB A;  2CEA A;  1XLO A;  4AKI A;  1DYQ A;  1L4D B;  3RFZ B;  3ILK A;  1FNV A;  4IBG A;  2DZN B;  3BII D;  4LZZ A;  3V3X A;  2NMQ A;  3ZH9 B;  1FNU A;  4XGI A;  1J7C A;  4R7G A;  5IWA M;  1P7F A;  1FNN A;  2SAK A;  3GLH B;  4FW9 A;  1HR0 M;  2W3S A;  1XCT L;  1TZO A;  2J7N A;  4PT5 A;  4IOI E;  1ENF A;  4B3M M;  4KKJ A;  4NRW A;  4XDC A;  5KPT A;  3DFZ A;  5GKN A;  1N61 A;  2CV0 A;  1N62 A;  1VZ8 A;  1ACC A;  4NAM A;  2V0G A;  3GPY A;  2WXL A;  3FTD A;  2D7G A;  4XWW A;  4MH8 A;  1FCL A;  3TEZ A;  5IT9 S;  2XN9 C;  1YUB A;  1AWD A;  1SB3 C;  5G5H A;  2WXN A;  1IXR C;  4WIP A;  4B0M A;  2XF3 A;  2F5Q A;  2BTW A;  3KSX A;  5JXV A;  4IBI A;  5KQ8 A;  4GKK M;  4KOD A;  5EQT A;  3BWU D;  3U5Z A;  1CK1 A;  4HRO A;  4TQ1 A;  1UUP A;  5HHD G;  1K82 A;  1ZP0 B;  3HU1 A;  2DHR A;  3AJI B;  1L2D A;  2ZW1 A;  3C0R A;  1N33 M;  2IJ0 A;  2JYT A;  1QAM A;  1TY2 A;  3O65 A;  1TKG A;  5ITX E;  2N0S B;  2JTC A;  3AE4 B;  1C4A A;  1C76 A;  2H1R A;  4IJF A;  1ZOY B;  4M9S A;  4D80 A;  2L52 A;  2RMM A;  1TKY A;  1N77 A;  4BOQ A;  1ZQ9 A;  4JI8 M;  4UDU C;  5I4D A;  4LRT A;  4RF0 A;  4FD2 A;  3IAS 1;  1Z5B A;  4GIT A;  2K9X A;  3HWS A;  1I94 M;  5F3W A;  2MJE A;  3AN1 A;  4QNM A;  4HKQ A;  4ITQ A;  1V1P B;  3PHW A;  1BML C;  4FCV A;  2M5Z A;  1N32 M;  4MB7 A;  1JCK B;  1GL7 A;  2CHV A;  2FE8 A;  4OZC A;  1Q39 A;  4LF6 M;  2QBY A;  4GLS C;  1GOZ A;  3SFD B;  4G4N A;  5ITQ A;  4FCT A;  5BMG A;  2ZAO A;  1OQQ A;  1T3Q A;  3KS8 A;  1TS3 A;  3AEC B;  1IN6 A;  1G8P A;  3KOX E;  4IJE A;  3MK6 A;  4TUW A;  3PVS A;  3OQC A;  1YMH E;  1UWX A;  4YT0 B;  3L2A A;  2R45 A;  3LVV A;  2CUZ A;  4D81 A;  1F2R C;  1SE3 A;  2Y20 A;  4JI2 M;  1R7R A;  3L4P A;  1QOB A;  1KFY B;  4NZL B;  3W31 A;  4GC9 A;  1GPX A;  3KSJ A;  1HQY E;  2HKJ A;  3AE8 B;  3P4Q B;  3VK7 A;  4OX9 M;  4ZRP A;  2OQ4 A;  4A90 A;  3B9P A;  1IBK M;  4AG5 A;  4LF4 M;  2W55 A;  3CF0 A;  5D7G A;  3PSE A;  3NVZ A;  4II7 A;  3P63 A;  5H8Y E;  3PO0 A;  3WCQ A;  2K0P A;  2PTL A;  3U6L A;  2KAJ A;  3QAU A;  3IAM 1;  1QYR A;  4YHH M;  3HVD A;  3HGI A;  2YEP F;  4LTU A;  3AED B;  3SMS A;  1EU4 A;  3E56 A;  1D5Z C;  2LFI A;  4ZOH C;  1QKZ A;  2A5Y B;  1FD6 A;  2KQ4 X;  4RGM A;  5EE9 A;  1E9S A;  2XGN A;  1EWY C;  1DKI A;  2CU3 A;  1L6V A;  4DV2 M;  5G5G A;  1E10 A;  3B2G A;  3UK6 A;  2N9K A;  4LFC M;  5JI3 E;  2LHD A;  2MEK A;  3WHL A;  1ZAE A;  4KGS A;  5HG2 A;  4L8R C;  2PW9 A;  5HI1 A;  3VLF B;  1L0V B;  2XEP A;  4KGT A;  3BY4 A;  4ARC A;  3AE7 B;  3TMP A;  2Y3A A;  3HHX A;  2YFQ A;  2C99 A;  1JQJ C;  1MHH E;  2WP9 B;  3TRK A;  3MHZ A;  3GRY A;  4KGR A;  3M0E A;  1JAL A;  4MI7 A;  1YN5 A;  4YSZ B;  2YEP B;  1IXS B;  3H8H A;  4HL4 A;  2GI9 A;  3NVW A;  2JXT A;  3KWV A;  4NOO B;  1DGF A;  2ERC A;  4DQO C;  2WDQ B;  2K22 A;  2R4J A;  1WSP A;  3J9C A;  3L25 A;  4LK0 M;  1E9R A;  1C78 A;  1E32 A;  2ON8 A;  4O1N A;  1N5X A;  4NL4 H;  2EEL A;  4LG2 A;  1NYR A;  2XFS A;  2PVO D;  3TEY A;  1Q10 A;  2JWU A;  4DR4 M;  4FWD A;  2TSS A;  3BVG A;  2L7H A;  4A5U A;  3KOY E;  1DGH A;  3P4P B;  5MPO A;  3AE9 B;  5LNK 1;  4BOS A;  2W3R A;  1IBX A;  3R8B A;  3BZD B;  3AEA B;  4X66 M;  1RYJ A;  1TS4 A;  1S3S A;  2C9C A;  4PD2 A;  3D8B A;  1FFV A;  2KDM A;  5T8I A;  3FKE A;  2QZ4 A;  3FC4 A;  3HUI A;  1NJF A;  1EWC A;  2BJV A;  3FTF A;  1E6E B;  1ZDX A;  2MH7 A;  1R7S A;  4LCB A;  1N36 M;  4IUM A;  4IBB A;  5AUI A;  4QNR A;  2HL7 A;  4DV1 M;  3AKZ A;  3TWM A;  2JQR B;  4US8 A;  3BBA A;  1IN8 A;  3BK1 A;  4L2Y A;  1E0Z A;  4LZJ A;  4XE0 A;  2BU3 A;  2NQ8 C;  4WUR A;  4YTP B;  4RGO S;  4GUA A;  3HVZ A;  4NAW B;  3RGP A;  2R61 A;  1FEH A;  4L4U A;  1E94 E;  2B76 B;  3BB7 A;  1SEB D;  3SR6 A;  3U6C A;  4LGM A;  4G6Z A;  3W30 A;  1W5T A;  2F5P A;  3FYC A;  4ARI A;  2AGA A;  1YN3 A;  3TEW A;  4DV4 M;  4LLG M;  4ZTB A;  2EA0 A;  1T5X D;  1V97 A;  5JZE A;  3CF2 A;  1N60 A;  1MVK A;  2D7E A;  4P16 A;  3AEB B;  3U6D A;  2INN E;  3KS4 A;  1R2Z A;  2IPK D;  4OVZ A;  4BB9 A;  3U61 B;  1G59 A;  2WXP A;  4G4R A;  3P1M A;  1JW9 D;  1SSN A;  4GKJ M;  2AQ3 B;  2L09 A;  1UKF A;  3R2T A;  4YXD B;  1XNR M;  1JWM D;  1VZ7 A;  1KH0 A;  2Q2E B;  2WXJ A;  4D2K A;  1K50 A;  4KLN A;  5BYQ A;  4TSS A;  3LQR A;  3U60 B;  3RFW A;  1KTK A;  1TH2 A;  3JR4 A;  4OW0 A;  2CHQ A;  4CQN A;  3RE8 A;  3L28 A;  2I2Y A;  3AE6 B;  1I7H A;  1IGD A;  4XWT A;  2BTE A;  2Z7J A;  3TSS A;  1QAQ A;  5BYS A;  3KQ4 A;  3WHK A;  1N63 A;  1W5S A;  2GB1 A;  3GLI B;  2M56 B;  2BJW A;  3FUW A;  3NVY A;  5EE3 A;  2R4E A;  1J09 A;  4NSO B;  1FCC C;  2MJD A;  1AW7 A;  3W0L B;  2NTS A;  4JYA M;  1NYQ A;  4JI4 M;  2BYT A;  2ZAM A;  1XNQ M;  1YQ4 B;  2WDR B;  2CV1 A;  4YSY B;  5FK9 C;  2VII A;  3OWE B;  4YWG G;  4YTN B;  2J7O A;  4H2A A;  4M0D A;  1I4Q A;  5DYG A;  4DXG A;  2V1U A;  5GXG B;  3KVW A;  2UUC M;  2W82 A;  3PNV A;  4JI0 M;  2XH9 A;  5EJC A;  4GIP A;  1ZE3 D;  2Q5W D;  2M60 A;  2R62 A;  3GQ5 A;  2HHH M;  3BVM A;  1NNJ A;  1SE4 A;  2DYO A;  1TH4 A;  4WWM A;  2DWM A;  2F5N A;  2K47 A;  1L0Y B;  3TL4 X;  3EIH A;  2JZP A;  1DOI A;  2AQ1 B;  1ZPS A;  3C8Y A;  4OZB A;  4OZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...