4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
molecule keywords Papain-like protease
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
4RF1A 4RNAA 3MP2A 4REZA 4M0WA 4OVZB 3MJ5A 4OVZA 4MM3B 5E6JA 2FE8A 3E9SA 4PT5A 4RF0A 4WURA 4OW0A 4R3DA 5KO3A 4P16A
chains in the Genus database with same CATH superfamily
3C8YA 2DCAA 1J8CA 4BAXA 2I7PA 3GLHB 2ZVOA 4RM9A 1DF0A 3JR4A 4IG7B 1YX5B 4B0EA 3U61A 3P1MA 3FTDA 1I4RA 4NSOB 2CHZA 1PJJA 2KJRA 3M63B 3MTNA 4NRWA 1UZXB 1WJ6A 5EZQA 2KRUA 1JR3E 1HXYD 4IJEA 2ZZPB 2LGSA 5FSWA 4LNFA 3GRYA 2VHFA 2ACTA 1ET6A 4EUTA 3T3NA 5J94A 4FWDA 1I35A 4P6EA 1E8YA 4KX6B 4II2B 1YT7A 3SASA 4PI3A 3K24A 3VVWB 1NNJA 3LVWA 4AWJA 2K6QA 3H89A 4B3TM 5D94A 2LRUA 3NS8A 1UUPA 4A3OA 2DHRA 1EF5A 1WRIA 1F2AA 2KTRB 1C77A 2H7JA 3WALA 1PXVA 3OLMD 2EKKA 2MBHA 2MWSB 4HCPB 2KWUB 1N60A 1HNZM 4OVUA 5MPOA 1L2DA 3C58A 3USVA 4CHTB 1V81A 2KQ4X 4GIVA 2DZKA 3D32A 2G3QB 1XXHE 2GBKA 5FTJA 3O65A 4FHJA 3T1YM 4M0DA 4KHPM 2GRIA 3EHVA 2LGDA 2JUJA 1E7PB 2DJGB 2W54A 3THGA 1DO2A 4LZZA 1CMXB 1Q39A 2L4FA 5AUKA 3WAPA 2KJ6A 3KP0E 1TDZA 1JWSD 2AS8A 4FULA 2DZZA 1ZW7A 5CVOB 1GJTA 4NAWB 1ATKA 4RY2A 2BVCA 3I3TA 3P2BA 1IY0A 1N77A 4BOSC 4JI2M 4I6NB 3NG0A 1AU3A 1Y08A 3A46A 3IAM1 5EP1A 1F77A 1N78A 1JR3A 4MH8A 5LXHA 1F52A 2D11A 1CZPA 3AFHA 2RDBC 2VHSA 4DMXA 4B3MM 2P86A 4LGYA 1MIRA 4BS5A 4BBAA 2VZKD 1K52A 2CWBA 2E6XA 4M9XA 2JTCA 3K8ZA 4EE2A 1MI0A 2JZPA 3VKGA 5LXIB 3KOWE 1Q5WB 2C0YA 1PBHA 2QNJA 3GB1A 2HDEA 5FKAC 1I4WA 4I6LB 3P5XA 4JV5M 3K9PB 2PPHA 2DAMA 4ANWA 1L2NA 2Y3AA 3N1YC 1TTNA 3ZRCA 2Q5WD 2A5YB 2FNAA 3UK6A 1Q02A 1Z2MA 4NZLB 2BGFA 1RLFA 2DOSA 2WXMA 4CZWA 2ZW0A 1NY5A 2CHWA 3TE6A 4KZ0A 3BXWA 2KRKA 2DZYA 3W1SC 3K9OB 3MTNB 3B2FA 3H6NA 2CEAA 2JXXA 5A24A 4IW0A 4GKKM 1YZBA 3KS4A 2DHYA 2WXLA 3T9LA 1V1PA 5JI3E 3NOBA 4AZFA 4ZRKA 4QOZC 3QC8B 4RM8A 1BXTA 5DYIA 1IWDA 1K8RB 3PFIA 2VH1A 2JQGR 3U4EG 1ZE3D 2L7RA 3QHTA 4GMQA 1YJ1A 2KZUA 1RU3A 4AXLA 4KSLC 3V62A 3GPYA 2Y20A 3KWBX 1Z5SB 1VDDA 3B08A 4CIZA 5ITUA 2KC1A 4FJZA 3GZNB 5C23A 3PRMB 2FAZA 2WXFA 2M0XA 3IVFA 2R6NA 1NYRA 2TSSA 3W5VB 4BKSD 2CU1A 1PRBA 5BR8M 2XSZD 2O6VD 1K50A 4AUQC 1E9RA 4MSXA 1M94A 3H7PB 1JMLA 1VD2A 4YL8A 3V6EB 2XU4A 4UDUC 1P0RA 2WGSA 3O65B 5GMVA 4ZRIA 4RNAA 2RDGA 4OHJA 2QC8A 3ZNHB 3X23A 4ZHOA 2ZPYA 1WIAA 2KX3A 1ZXIA 4QAYA 4JPSA 2IBIA 1FEHA 4YYQA 4Q8HA 2GBNA 1QOGA 4JWSC 2MBQA 5EE1A 5KHOA 4N8WA 2JYTA 2G5GX 3OJ4B 2NTTA 4IUMA 1L1TA 4XWTA 3TJPA 2KFKB 2L83A 5JH5C 2WHIA 3KDSE 4JN6A 2JX5A 2BB5A 1IBMM 3I01M 4W9LA 4LNKA 1KXRA 4YYVA 4X6HA 3RYTA 1J7KA 1TR8A 3AE1B 5AZFA 3KFUG 4QRGA 4M8NA 4EOYA 2FCQA 4GDLA 4LJ6A 4XDCA 1ZPSA 3QWLA 4B08A 1ACCA 1PJTA 4Q8GA 3PZ7A 5C3JB 4YWGG 3HWSA 3WXEA 3GQ4A 1L0VB 3ZUNA 1S4VA 1EO6A 4BKTA 3S3QA 4WA6A 5FTLA 2LZ6A 1T0SC 3U61B 4A3PA 1LO5D 3B7NA 1G41A 3TSSA 2HJ8A 4P6VF 4X57B 3V61A 3SHGB 1DYQA 4B3SM 2WZJA 2GBMA 2KX0A 3DWMA 4BZAA 3OTOM 1IQPA 1WR1B 2RR9A 2DWQA 4NJCA 2AIMA 2KDEB 2YFQA 4D80A 2V1YA 4FADA 3RD2A 1WYGA 1WX8A 3Q3FA 1NI3A 2J42A 4KIKB 4Q7JA 4HKQA 4CO7A 2CV2A 1WZ3A 3VTWA 3E56A 1ESFA 4JXJA 2NQ8C 2RKOA 4IBCA 4D8BA 2G8JA 2RPVA 3QQ8B 3PHUA 4W9GA 1XWIA 3WANA 3W5UB 4P7IA 2N4FA 5T8IA 3QYBA 1FNUA 1WGLA 2OOBB 2L7IA 1PDXA 3L26A 1DOYA 3AU5A 1VSNA 3W31A 4YYSA 1D4BA 3GPPA 5IO9A 2ZM6M 3H4MA 3I04M 3V6CA 3PHXB 4P6GA 1SIFA 1DGHA 3TIXA 2RD0A 3U5ZB 3HUIA 4HLEA 3FUXA 4W9CA 3VQIA 2XK5A 2HKJA 3B89A 1IUEA 4F2LA 2M1MA 3M6AA 2JQRB 3W67A 1ZDVA 5ITXA 3FTCA 3UGJA 3AMZA 3O1GA 2V3NA 3UQAA 2HXZA 2KVZA 2D7EA 4AW4A 1KTKA 1C9FA 2Z0EB 2ZCCA 2LUEA 2DC7A 2YJBA 2DAFA 2WXRA 3I4YA 2WDQB 1OQQA 1FNWA 2V1CA 4LGMA 2YEPF 4MH0E 3RNGC 1XNQM 3FUWA 1MVKA 4GDKB 2BWFA 5G5GA 2EMSA 1NBFC 3AE7B 4EZLA 3Q3MC 2KN4A 2DENB 4JWUC 3ZYYX 4LF6M 2XN9C 2DXIA 3GLGA 1YD8U 1OTRB 2FUG1 1AYUA 4UN2B 4MELA 2B3AA 1IGDA 1S3SG 1G71A 2XBBC 1LXDA 4KDLB 1GB1A 3SHQA 2N0SB 1JQPA 2SEBD 1SXJE 2J0MA 2INDC 4RFBA 3IG3A 4BSQA 3DCGA 2DC8A 2PADA 2RPQA 5HKHA 2AVWA 1R4NB 4B3RM 4LK0M 2Y0TA 3DF0A 2KWVB 4GOCA 3AOEA 2BB6A 2YJCA 3OJ3A 2KDMA 5AZHA 4GB9A 3HGIA 1N61A 1QKZA 5KO3A 4F1SA 3IECA 5C2TB 1P3QQ 4US9A 3BK2A 4PK1A 4PT5A 1AWDA 4IWQA 4GC9A 4DMYA 3TEZA 3ZJTA 4IOIE 4Z6YA 2CHXA 1KFVA 4FWGA 2F5OA 3BY4B 2HD5A 1RM6C 4C7YA 1TLOA 3CIRB 1IGCA 3GS2A 1WGKA 2ZTCA 1JCKB 3ZNZB 1TS3A 1KFYB 5G5HA 2YJ9A 3DOWA 4PADA 3NVYA 3BYYB 1XNRM 5CHVA 4MZSA 2AYOA 3AV0A 5CX3A 9PAPA 4C00A 1H6UA 4G6ZA 2D7HA 5FTMA 3ZJUA 1NLJA 5JZEA 1R4MI 1Q10A 1YQ3B 4ZOHC 1O0EA 4PS7A 2E01A 4IWPA 1PPPA 1JWAD 2BTWB 2OHFA 4FVMA 2DX5B 4FN2A 4JI6M 3HZJA 1K3WA 4AS1A 4LF4M 1WXAA 4MB7A 3TQSA 4YYWA 3K1JA 1T43A 1FIQA 3DVGY 1RWSA 2G4DB 5L8RF 4W9KA 1QF6A 2Z3XA 3AEAB 2EUCA 5BYSA 1QVRA 1XT9B 4G0NB 3QIJA 3FILB 1XB2B 3L16A 1I7HA 3DA1A 2WDRB 4TMAB 4LJAA 4IJFA 1R2YA 3NWLA 2LI5A 2YNMD 3KWVA 4LDTB 1QAQA 1L6UA 3SMSA 2G8EA 4IBGA 1STFE 4P16A 4JI0M 3H8CA 4I81A 4FCTA 3DBHI 2MR9A 1JROA 2AQ1B 2D3BA 1A6RA 2ZTDA 3FUVA 4K3CA 5FK9C 3H8HA 4A9AA 4EKUA 1FFVA 1R2ZA 1SE3A 4TUUA 3HK0A 4LCBA 4OU7A 4TSSA 3W9CB 3KFQA 2ZNVC 3TUOA 4LRTA 4YTNB 2YVCA 3W1SA 1SBBB 1LTMA 3BIID 1TKYA 3ML9A 5I4DA 2R4JA 1V49A 3Q8CA 2DZMA 3MHSA 3L2AA 3IFWB 3KYCD 3MJWA 2RGOA 3LYYA 5HG2A 2JY6A 1YMHE 4QBBA 2OULA 4JI5M 1ZGUB 4KKJA 1UNSA 4RCOA 2OO9A 2KO3A 3ZJVA 1V33A 3PSEB 1JRUA 3AEGB 2IY0B 4WJNA 1NB3A 3BCNA 1XO3A 1ZV1A 1RFAA 2HHHM 1TZ1A 4MEMA 1J19A 4RH6A 5AUIA 2MHJA 2R6FA 4L2YA 2PE6B 1YIWA 3DWGC 1HE8A 3VXWA 3CWIA 3GRRA 2C5RA 4FW9A 3U6PA 2KFJA 2WXIA 3GRVA 2FCNA 1PPDA 3IEJA 2ATOA 4A6QA 3A1QA 3LDZE 3AE2B 1YE9A 4IBJA 4HEA1 4KT0F 2AU1A 2XZUA 3KP1E 1NI2A 1SE4A 2B3TA 3W1YA 1YN4A 4W9IA 1ZUD2 3B21A 5H8YE 1X37A 3KSJA 2KLGA 1C1YB 1FNVA 1QMYA 2MROB 5F02A 4J3OD 1ZCMA 4HROA 4WW0A 4W5WA 1BQIA 2FIDA 2L76A 3DPDA 3KXEC 1DOIA 1BGOA 2NQAA 3AECB 4CYEA 2L0FA 4W9FA 3GLGE 4RMAA 3PRZA 1P9DU 4W9JA 1Y4HA 1TS2A 2PNSA 2JU6X 2K8HA 2C60A 1GLNA 4AI6A 2KMAA 2AUZA 3ZKJC 3PVLA 3SR6A 1QANA 2FCMA 2E00A 2I1KA 3I9V1 2Z59B 2ASQA 3MFGA 1J7AA 5DPWA 1JQJC 4ACFA 1VG5A 3KVWA 2OQ4A 1FM0D 2K3UA 2N9PC 2LGXA 5E6PA 5KQ8A 5IWAM 4WAFA 2YR0A 1ENFA 4I05A 1WI0A 3NY5A 4GN1A 2CV0A 4QHTA 4CDDB 1VCBA 3J2PB 3Q69A 4K3BA 1BT0A 4BKGA 2RGFA 2IO3B 3S2AA 1FMAD 4RKXA 1WYWB 3WAOA 1F1HA 1EF1A 1VZ6A 4HWYA 3OG5A 3VH4B 4EEWA 2H88B 5LMNM 3QX1A 2AX5A 3KW5B 2HH5A 2WYQA 5TR5A 1XLPA 4M9ZA 2KFKA 4NAMA 4KGSA 3GPUA 3WAMA 4FK5A 1BVSA 2O25A 2K6BA 3LB8C 3APDA 2G7YA 2AL3A 1OTRA 3AE5B 3KVFB 4HCNB 3R7RA 2NBVB 2Z84A 5L95C 3CH3X 1G8PA 2IJ0A 2UU9M 1TKEA 2WXKA 3L10B 3NVVA 4GMVA 4ZYSA 2XSZA 4IBKA 4BQVA 2BKRB 2PBHA 3PZDA 1THEA 1WY8A 2K9DA 2R46A 1T5XD 4BOQA 3TWMA 4XK8F 3U30A 1CPJA 3HU3A 4YY3M 2N7EA 2G3QA 2W82A 1KRHA 4E74A 3T38A 2FE8A 2L09A 3I5JC 2H89B 1WGHA 1XF5L 4IM2A 2IPKD 3LQRA 3OF8A 2FNJB 5DFLA 2XZFA 1XMQM 1CTEA 2IY1B 1QOAA 3J7BA 2GNOA 1WE7A 2PVOD 1SP4B 1V6EA 2B1MA 2I38A 2L7HA 4KIKA 4AJWA 4I07A 4LJ7A 4YHHM 4WIPA 3FAHA 3BBAA 4OZCA 5BMGA 3CSFA 1MX0A 3HU2A 2K39A 3LCVB 4JI1M 2M17A 4BBNC 2M5ZA 4FLHA 1SG9A 4OX9M 4LRSA 1EWCA 5G2NA 2MH8A 1OIPA 1HZ6A 5IOIA 3QT4A 3ZDMC 2BT6A 3ABVB 4B9KA 1GO5A 4K0KM 1U9WA 3K9OA 3HHWA 4BOZA 4HLQA 4LLGM 3RCZA 4IP3A 1F2CA 3PRPA 5KQDA 4GDLB 1UBQA 1QZMA 2C9OA 2C99A 1L0XB 3P4QB 1UH6A 1YOVB 1HZ5A 2GBRA 1YN3A 3RMKC 1HEZE 2BKFA 2JY7A 1FRDA 2DKLA 2LWXA 3P4PB 4EFOA 1P3QU 5EF4A 4LJ4A 3E1ZB 1IN4A 1CJEA 1GOZA 3ENEA 2ZCBA 3M3JA 2PKOA 2MSED 3ZVVA 4PDGA 2ERCA 3L25A 5FLXS 1E9MA 1JR3D 3JAMS 2DZLA 2C98A 3FKEA 3WHKA 2IO2B 4XWWA 3UIPB 1ZQ9A 2WDVB 1M6DA 1U9QX 4W9HA 3B74A 2J7OA 3ZXVA 4BFRA 3M62B 1OQRA 2BNKA 4AJYB 1MU5A 3K2LA 3Q2AC 5JI2E 5EXTA 2JXNA 3DVNU 1FCCC 1SGHA 2LVPC 1H4RA 1AU2A 2K47A 4NPNA 2IBIB 1AARA 4RF0A 1V86A 5TSSA 1QT9A 2KNAA 2PVGC 2WX1A 3KOYE 2MBOA 1L2BA 3DHIC 3B9JA 4O1NA 1FNNA 3BVGA 1YNTE 2AQ2B 2KLCA 3CF2A 2WBFX 5DNYA 1VZ8A 3SBJA 3E4RA 4NXNM 3DVGX 3UINB 1PADA 1Y56A 1Y8GA 2J53A 2MP2A 1Q0WB 1WH3A 3FRIA 2UUAM 4ZRQA 3M99A 3RE8A 2JZ0A 4MGZE 3SAVA 4LJ8A 4RGNA 1NHWC 4GLSC 1XXHB 3QAUA 3HD3A 5BMHA 4NC6A 2KTRA 1R4MB 2LJ5A 1SJHD 2UUBM 3UIOB 1VLBA 1IY2A 4MGKE 4JGHB 4KGTA 3AEFB 3U8EA 2K9XA 4WJPA 1E9SA 2R45A 4HRSA 3UZUA 2FUHB 1OEYA 3EIHA 3PTFC 4C7ZA 2EKFA 2R65A 1KOTA 4BBNF 1AECA 3IFUA 2UXCM 1BUIC 4LF8M 3U60A 1UWXA 4DR4M 1CSBB 2ZVNA 2L05A 3EIEA 5PADA 2M8SA 3TL4X 8CATA 2M4NA 3GOEA 4M01A 4L8RC 3IT4B 2M0AA 2F5QA 2H1RA 1IYFA 5DPSA 1WJNA 2FS1A 4GC5A 2V3SA 3JSVA 1GB4A 4DHZB 1IBXA 4XBOA 2KWDA 3AU4A 4G50A 4IBFA 2DLBA 3AEDB 3SYKA 1KHQA 4KSKC 2CR5A 2HJ1A 2KXEA 2GMIC 2E02A 3FRHA 1PJIA 3B9PA 3U6QA 3AOEC 2GB1A 3AI5A 4R3DA 1FJGM 3B7QA 4LZJA 1VR9A 3K8UA 3APCA 1RFKA 1WX7A 2F5NA 2MX2A 1NL6A 1PJSA 4LFAM 4DHZE 3S3RA 2MP2B 2KDFB 1LGRA 3KW9A 5JA7A 4JYAM 1V9JA 1GVNA 3VHTC 3PVSA 1HQCA 2AEHA 2C9WB 1KM7A 4DBGA 3ERVA 3BB7A 2KC2A 2D3CA 3B1LX 2EKIA 4HVBA 4HXDA 5ITTA 2D07B 2BTEA 3RVWA 5EP4A 1C4AA 2GI9A 4NAWA 5G55A 1JWMD 3NJTA 5EP3A 2OP3A 3X0WA 1POPA 2JY6B 5H37D 3Q3OC 1YALA 1GC6A 3Q6BA 4URKA 1VZ7A 1L5PA 3KSXA 1NQCA 2N9XA 5EQTA 4F7ZA 2IO1B 1OEYJ 1P7EA 4US8A 1Q3BA 1TGUA 3GP1A 4BOSA 3LXFA 3ZIMA 4RF1A 2QBYA 3ZTDA 3GQ5A 4MJSA 1GCBA 1EM7A 5D3DA 4I6PA 2BYVE 4KO8A 4W9DA 1VRAB 1Z59A 1C1KA 1SXJB 5KPTA 4EIWA 1FO4A 2CP8A 1N33M 1UGMA 2ZAMA 1C3TA 3DBSA 1T0QC 3GLIB 2P0RA 2I2YA 2LXAA 4PS8A 4XGIA 4REZA 3AL0C 3ONSA 4AQ7A 3VH3B 2INPE 2JWSA 4AKIA 2DZOB 2P5TA 1F9JA 4QNRA 4B7FA 3AKZA 3GLFE 1I94M 2EKEC 4A5UA 2N9KA 3TMPA 1VJKA 3PO0A 1MDWA 3JSVB 2MBBB 3URYA 3U6CA 2X38A 3FC4A 1Y8RC 3QAQA 1NVMA 2V3PA 2JRHA 5AEKB 1HR0M 2KHWB 4I8OA 3UMMA 1HNXM 1N32M 3R9XB 5LMUM 4M8MA 2C96A 3VUXA 3ZQJA 2JF5A 2K6DB 4P1BC 2V4LA 1C76A 3Q8FA 5CVMA 3K92A 1R4NI 4ASWC 2FBWB 3ZW3A 4I5SA 1XCQL 1DOXA 3CBKA 1EIJA 4MGIE 3HJSA 3UJNA 1MHHE 1QQRA 4AP4C 2JT4B 2JY8A 3P4RB 3U6EA 4FIPA 2KNVA 4DV1M 1OJLA 2LRWA 4BOUA 3ZNID 5BO4B 3LW5F 2N9EB 1F2RI 1CUKA 1N5XA 1WMHB 2JNHA 1W5SA 3PXGA 1TGZB 2AYOB 5EE0A 4FBJB 3KWLA 2G6DA 4HXDB 1DGBA 4JI7M 1GMYA 1WR6E 2WP9B 4JLCA 1I4QA 4G4QA 4NQLB 4LJOB 1YJJA 5EE3A 2KK8A 4DDID 4ZUXU 5C1BA 3R8BA 3NZUA 4LJPB 1E32A 1PM5A 2O6VB 2BYEA 3I3TB 4M02A 2JYEA 2JZ3B 3VFKA 5J2RA 2VDBB 3P5WA 1JALA 3AI8A 4LCDE 3HHZA 2WWZA 3A9JA 3RFZB 5FR3A 1GC7A 2NPTB 3PT2B 4E71A 1VEKA 2CS4A 2Z4RA 1XHBA 1K53A 3KOZE 3FILA 3RVXA 4PDIA 3L08A 2CE7A 1Q6KA 3I06A 4DR7M 4NY0A 4WWPA 3TEWA 4CDFB 2QPAA 2XFTA 5KPZA 2YEPB 3JW0X 5D7GA 3ZDTA 2EELA 3BPMA 2HWKA 2WXQA 3KYDD 2N1VA 1IP9A 1QOFA 2W55A 3DVNV 1WMHA 3NBIA 1NY6A 4LFBM 2LWPA 3J81S 4II7A 4PYZA 1GJZA 2YJ2A 4FWHA 3C9EA 3Q8BA 4FJCA 1JWUD 1T6OA 5IT9S 2MJ3A 1E7VA 2M56B 4DQOC 2L2DA 2WXNA 2O01F 1WF9A 2L8JA 3V6CB 3IMAA 1NB5A 1TKGA 2XFSA 1SF0A 1R5LA 1UM8A 3OVXA 3U52E 2IO0B 5H92C 3GZNI 3LXSA 4WQMA 2LVAA 2ZPNA 3PBHA 2WSEF 3NS1A 1FCLA 1FRRA 2LJIA 2DNAA 4Q2JA 4FXCA 2E3TA 1R7SA 3SYLA 4GRIA 3RI7C 2VF8A 2CUZA 1G3IA 2XGNA 2X8XX 1KLGD 3EFUA 1YK7A 1K3BB 4CGYB 2XLJA 1TH4A 4MACA 4ZPXA 1BMLC 2WXPA 4CDCB 1GUAB 1WHCA 5E26A 3U6MA 4GXBA 4QOSA 3PV1A 4WH4A 2F1GA 2MA9B 2N7DA 2CHVA 2JWZA 2Y5BA 1D2NA 4J6IA 2KWCA 3B79A 2Y0QA 2IDYA 3SAUA 4C4VA 3U7ZA 3RGPA 1T3QA 2IPPB 5KHQA 2OOAA 4HJGE 4S17A 5JXVA 3BINA 3IOQA 1GG3A 3VTUA 3NZSA 4L78A 2IGDA 2L6OA 2JVCA 2N35A 1V80A 3EGRA 2FT2A 4PP2E 1GABA 3M7GA 3EUB2 4MI7A 5E6OA 3L4PA 3H8BA 2MJEA 3GO8A 1GNUA 2UXBM 1SSNA 2KZRA 4DDGD 3LCUA 3W0FA 5C18A 3W0LB 2LVPA 3SDLC 4DHJD 1EWPA 3BWKA 2KMCA 3MP2A 3GLHE 3LQQA 3KUZA 3H6SA 4TKNA 1L1ZA 4YYRA 2UUCM 2ARYA 2WXOA 1E7UA 2GFOA 1R4GA 2R9FA 2QJLA 1NEKB 1ZKHA 4A3VB 1J5EM 3RNCC 3TEXA 2XEPA 3NHEA 3T8MA 1M4VA 1TZOA 3NVWA 4OELA 4DV4M 1WE6A 1G6JA 2XU1A 3SD5A 4LDTD 2QCUA 1XLOA 3BVZA 3VUYA 3PW3A 2ZEQA 2LVQA 4LY6A 5DPTA 3PNVA 4DK5A 1EWMA 4ZRJA 4DR2M 3APFA 4ANVA 3WIMA 1QZEA 2KN5A 3WCQA 4NJ7A 2WU5B 5IZ7D 3H7SA 5EXPA 4S0RA 2K1FA 3GQ3A 3HM6X 2QP9X 3NUHB 4MM3A 3SATA 3PHXA 3R8FA 1F2BA 2BDZA 2PMVA 4W4UA 1V5TA 2RGHA 3D8BA 3GLFA 1N5WA 2INCC 2LXEA 1OAIA 4M00A 2YJ8A 2WXJA 3SAWA 4HK2A 1MEMA 1AYVA 1Z5AA 3K9PA 2V9HA 3BPFA 3U7DA 3OISA 3RVVA 1FXTB 3TWLA 2DWLA 3DZDA 4FHKA 5J18A 2PIAA 4YSYB 2OJWA 2KAJA 4NQKE 1SE2A 1ZDXA 1IN5A 3PS6A 3B2GA 4BB9A 4NNJB 5FTKA 1YK8A 4QRVA 4XZXA 1MG8A 5JH3A 3ZGZA 3WXGA 2FQ9A 4XGAB 5HFYA 1E0ZA 1IBKM 1ME4A 1TT5B 4I4LA 2QCZA 1L7YA 2RSUA 5ITXE 1PPOA 5IKCM 3PDFA 2FCSA 1D5MC 4DR1M 4FA6A 3KSEA 1AUAA 3W68A 1CQVA 4IDIA 1PYWD 3A1QB 1XXHA 4ITQA 3GPXA 4RGOS 2DWNA 1WGRA 4X6IA 3HHIA 2KHHA 1WX9A 1A5RA 5HHDG 2ICIA 2KTFA 5DCNA 3KOXE 3ZNHA 1IPGA 1YSYA 4MT5A 2D3GA 1D5ZC 3ZTCA 4IKGA 3I51A 3CH2X 3GLFB 3V6EA 3CF0A 4ANUA 2KYWA 2G1EA 1UBIA 1NHGC 4DR3M 3TNXA 3AOGA 1KLUD 4IUMB 4MM3B 4II3B 2J7QC 3U8ZA 3R2TA 3ZQ4A 3N9YC 1J0GA 4YTPB 1BP4A 2NQGA 2QENA 2R44A 1UWMA 3VAWA 1EWYC 1V5OA 3A98B 2A4ZA 2AWTA 4GIPA 4YTMB 5E6JA 1OFFA 1TU6A 2KACA 3U6DA 1TL9A 2BWEA 3BK1A 1OFIA 1J09A 1CS8A 1TTEA 2KQ7A 1UKFA 2GOWA 2G45B 2ZANA 1QOBA 2R61A 4YSZB 1NV9A 2UWQA 4I04A 2G4SA 1SE9A 4AKHA 2C7HA 2KDLA 4R71A 1T0YA 2L4EA 2KVRA 1XEEA 4BKSA 3IV2A 2VH2A 3CMMB 3WHLA 3DBLB 3VR8B 3LMMA 1WXSA 2GHUA 2MH7A 3SHFA 7PCKA 1J7CA 2HWJA 3HVZA 1DKIA 2R4EA 3DDCB 3ZC7B 2JA2A 2BF8B 4F8CB 2VIIA 4ZYNA 1AU0A 4K7WA 3DHHC 2W3RA 2FOIC 3HJQA 2DZNB 3VFDA 5BYQA 5FR6A 3RT3B 5ITYA 1C4CA 1GPXA 2EJSA 4G4OA 4YYUA 3I57A 4X64M 2BTWA 1E8XA 1WRDB 1LFDA 1NSFA 1AYWA 2IYDB 3A33B 1VQ1A 2Z8YM 3BYTB 3N32A 2YQZA 3ZO5B 2WS3B 1WJ7A 1WM3A 3N4CA 2LHDA 3IHPC 3GLHA 2L32A 4IBEA 4JE3B 4TUWA 3GLIE 5C1ZA 1CB5A 4ARCA 4QH6A 1SEBD 2Y5BB 4D8EA 3RUIB 1XD3B 1L8QA 3C0RA 3OVZA 3Q14C 4C80A 2FFJA 2HTHA 3RULA 3IXSA 3NVZA 3JYUA 3M0EA 3KUDB 3P42A 5EDSA 4AOFA 4XUIA 3F75A 2DCCA 2JZZA 1MHWA 1B1ZA 4K81A 3GLIA 4LFCM 4XDDA 3MMPA 4LF7M 1QDTA 4K1RB 2WQYB 2CFOA 4DHJB 2KD0A 4HPMB 1Q1OA 3OWEB 2CIOA 1C4PA 2QMTA 3RNFC 5CHTA 5EP2A 3N30A 3KW6A 1RRBA 2X4AA 3H1UA 1PUTA 3DFZA 2MGWA 3AV8A 3L27A 4DXAB 2CU3A 1MHXA 1WXVA 2O2VA 2BQQA 3MP9A 4GH9A 2RRUA 1ORYB 3AE8B 4HJKA 4W9EA 2BW2A 2V6ZM 1QUTA 2V1UA 2FUDA 2XEWA 1PVJA 2R9NA 1HT2E 1PFDA 5BMIA 4DUZM 1TY2A 1WGDA 3W2DA 5CHFA 2GBJA 3QCAA 1NYQA 1ISNA 1JRPA 2JZ1A 4DBGB 3J27B 4DUYM 2V0GA 2DCDA 1KF6B 5E6NA 3T6PA 3NRZA 2K8BA 4GSWA 3PHWA 4DV7M 1TY0A 3P63A 2D10A 3AE6B 1HNWM 3IBEA 4A90A 1D3ZA 2L00B 3VTVA 1I42A 2KANA 2E5LM 1WXQA 1ZAEA 3RGSA 1WGGA 2UXDM 5K16A 4JL9A 5J17A 3IG5A 2DWZB 1KSFX 3UF8A 3HHXA 3ZUAA 3BWUD 2CHQA 1WIVA 1FXIA 4XZ4A 2Z7JA 2HE7A 4KV2A 1YVBA 2X8AA 1S1QB 2JXTA 1LM8B 3PPAA 3V3XA 5CHWA 2BU3A 4IIWA 4OVZA 4W5BA 1XC8A 4CISA 2LFIA 1V92A 3V05A 2J5YA 1F0ZA 5AZGA 4G4RA 2QSDA 1UELA 4MZOA 3GP7A 1U9XA 4AKGA 2E03A 1D0MA 3MC0B 2IZVB 5EGWA 1YJIA 3GE3C 4K7CA 3E9SA 4HPPA 1EFUB 2MJ5B 3BVMA 3VUWA 2F5SA 3TWKA 3AULA 1TIFA 1GL6A 2M60A 1J7BA 3TL5A 4L6V6 3A9KA 4DWFA 4ARIA 3TEYA 1AU4A 3KX1A 1IN6A 2LASA 4P1CC 1E90A 3KH0A 3C19A 2MCNB 1D0KA 4LNOA 3HRDD 1EF7A 4WWOA 2BJVA 2LMCA 3D6SA 1KYIA 1DO0A 2AHMA 2XF3A 3TMPB 4M9SA 2PJHA 3PHWB 3L13A 1SXJA 3FTFA 2LVOA 3HHYA 3GCBA 3VDUA 3LJ3A 1GKIA 4IC7B 2N1WA 3SEBA 2R62A 4AG5A 3MHHA 3AB5A 2REXA 4BVUC 1PGYA 3AM9A 2D3AA 1WM2A 3P5VA 1TF0B 2LBCA 4JI8M 3N3KA 5CTRC 2UZJA 5BYRA 3PNYA 2PW9A 3U5ZA 1C7YA 1IXSB 1NENB 4NSRA 2KQSA 2WSCF 3D8LA 4FCWA 2MRPA 4DR6M 3ZNGC 5EZSA 2K0PA 2LHCA 2KZSA 1NDDA 4DV5M 1HJPA 4G11A 5EJCA 3SFDB 1WSPA 2Q2EB 3LVVA 2QIEB 4N59A 3R3MA 1W5TA 2LHGA 2C5LC 1CV8A 4RGMA 1C78A 2L52A 2LUMA 3N3KB 4YXDB 5DPRA 3KLSX 1G4AE 3A4RA 2XU5A 3L29A 1S3SA 4LTUA 3KQ4A 3QWZB 2NTSA 1AN8A 2GLSA 3Q3JA 1CK1A 3SFZA 2IGHA 2BYTA 4KKIA 2FH0A 3AEEB 1V2YA 2CV1A 1NNUC 1XCTL 1UD7A 1QAOA 3TCAA 1DGJA 2H5XA 3TPZA 3W30A 2L1AA 1WWTA 8PCHA 3RN9C 3U2SC 3AE9B 3U6OA 1C79A 3T3OA 1WXMA 4H2AA 1YQBA 3RZFA 3PRPB 1V34A 1E5WA 3UI3A 1CQDA 1JB0F 4IBDA 5KPRA 1HQRD 3I63C 1QLBB 3SU8X 2MW5A 2DCBA 1QXPA 1LQBA 2JSVX 4BLCA 4AXMA 1L4ZB 1YUBA 3QJZA 2LH0A 1YLAA 2CHGA 1R6BX 5GKNA 1QILA 2N9LA 3FYDA 2PREA 4ICVA 4M0WB 1WR1A 5CHVC 2GQFA 2KMMA 2WDTB 1DGGA 3FD9A 2QBYB 3RNAC 2FO5A 1Z5CA 1E6EB 2K5PA 3ZLZA 2QQ8A 1E94E 2NBUA 3MC8A 4IM0A 2WX0A 4CHKA 1VEGA 5IP4D 2BPSA 4CJ6A 4QHSA 3DOAA 4ZTBA 2AYNA 1B9RA 1K82A 1IXZA 2ZAOA 4DV6M 1OAOC 5D2MB 1KFUL 4RGTA 3HHMA 2AGAA 3BC3A 4NOOB 4USAA 3KS8A 4B95A 3U60B 4WP2A 2NR2A 2KJHB 4NJ6A 2C7MB 2DI0A 1U9VA 3ECIA 4PD2A 4BS6A 3QSDA 1FD6A 2IGGA 3IUTA 1Z5BA 2VRRB 2Y6EA 4QNMA 4FCVA 3VDZA 4DV0M 2WXHA 4IWOA 4ZDVA 3CGWA 2XU3A 5JHAA 1JW9D 1IY1A 2D2QA 3F92A 4N6EB 1KHPA 1NJGA 5FTNA 2DC9A 2NS5A 3PNRA 2OPFA 1UGJA 2J4XA 3HVDA 2CRUA 2WXGA 2DENA 3RNBC 3MK6A 2J7QA 3IT6B 2DWMA 4GUAA 3C3DA 1P98A 4N9F4 1V8CA 3RNVA 1AW7A 2ACZB 4E3CA 4QRXA 1DGHB 1STEA 2OEDA 2JY5A 3DBLI 4GDKA 4L23A 3WXFA 3SFEB 4XC2A 1IM2A 3PGEA 5JHBA 3MC9A 1T3TA 1WGNA 1MFWA 2R2OA 4YVAA 1ET9A 2DZIA 3ALBA 4B0MA 1QOLA 2DC6A 3JVZX 2OOBA 1GAQB 3QA8A 1YN5A 1NJFA 1ROEA 1SXJD 4DXFA 1QUSA 1IBLM 2LGIA 1V97A 4HDQA 5IA7A 3ZCBB 3U6SA 2K8CA 3TBLD 1IXRC 4GHLA 4YV8A 4WJQA 1TBEA 3L54A 4NXMM 3DBHB 2JQFR 4D2KA 1OKSA 2R9OA 3Q8GA 3PLUA 3IG8A 2QHOB 2X49A 2R9MA 1OIZA 1X1MA 3C9PA 3PRMA 4YT0B 5LNK1 4JQWC 1MG4A 1L4DB 4GU2A 1A5TA 4OVZB 4D82A 2LVNC 4ANXA 1YX6B 4BOZB 2DJFB 1VEJA 4Z8XA 3V76A 1A70A 4ICUA 1ZIVA 3HKPA 3OQCA 4X6JA 5IAAC 2LHEA 2OZ2A 2DNFA 3AJIB 3HY5A 4L16A 1K3XA 1E8WA 1DV0A 1PE6A 1QDQA 3AH7A 1MJDA 4AG6A 1IFYA 2JRIA 1KH0A 2BS4B 4AQYM 2DYMA 2D7GA 2ONQA 4YSXB 1XKGA 2V4IB 1Q3CA 2QZ4A 2NCNA 4GEWA 4G4NA 3M95A 1TS4A 3VR9B 1HUCB 3ZRFA 1IBXB 3L0WB 4KLBA 3L17A 4TQ1A 4XYCA 2RMMA 3HIZA 3N1XC 1T6BX 4LF5M 1BY8A 3PZ8A 1XLQA 2J7QB 2PE9A 2KT7A 6PADA 3OF9A 3VRAB 4A8XC 4RKUF 4PYUA 1MJGM 1WZ0A 2BBCA 5ITQA 1XLNA 1QDRA 2DAGA 4EZKA 1MN3A 1TS5A 1VDVA 4N79A 3Q8AA 2HTME 4W5CA 3AXCA 4OZAA 3QARA 4A55A 1FH0A 1MEGA 1D5XC 2VQEM 2LXCA 1PGXA 4L1BA 2APLA 2Z4SA 3RPFC 3CBJA 1AIPC 2Y5PA 3BOSA 4FJVB 1TYGB 5IREB 2BWES 4GGQA 1VDLA 2O2VB 1L6VA 2L3ZA 4DXGA 5L83A 4DV3M 4DR5M 2B1NA 3J9CA 2QSFX 1T0RC 2QEJC 4CQNA 1P7FA 2FRAA 2PTLA 4MSQB 1H8CA 2LEKA 3KUCB 3FYCA 2R18A 4D81A 3N20C 5BPVA 4KDIC 1EU3A 3A4SC 3SMPA 3R66C 3FE3A 3FUUA 1N6ZA 2J0JA 4TV3A 1NPZA 4FJYA 1PCIA 4GHAA 1SIJA 2DAKA 2JUOA 2SAKA 2XK5B 2MEKA 2NQDB 4G54A 4X66M 2ZNVB 1SJED 3CTWB 2MLBA 3L28A 3MHSD 3QYEA 2F5PA 3RZWC 3H7DA 2PLPA 2QILA 2J52A 2QHOA 2HL7A 3H7PA 1TJEA 4ITKA 4WJOA 3K9MA 2MBEA 1ZP0B 1I4HA 2CKHB 5IN7A 1QYRA 2K0BX 4HDOA 2Z0DB 3KKUA 3V60A 5D6JB 3NZ3A 1OQYA 1G59A 1EU4A 3E21A 5EXSA 2Y21A 3EECA 4OVVA 3GE8C 3RFWA 5DYGA 4KGRA 2VZKB 2BS3B 4OW0A 4PS3A 2LNHC 3J80S 2HAKA 2DAJA 2W9NA 4ZRPA 3HJ8A 3HHAA 4NL4H 3P4SB 2EO2A 4WURA 3MTVA 2O5RA 4M0WA 4D8IA 1ZXHA 2RDHA 1WJUA 2ON8A 4MGYE 3Q8EA 4NRVA 4LG2A 3FKYA 3EA6A 2MQJA 2WSFF 1EUVB 1PGBA 2UYZB 1HTQA 2G8LA 3T1HM 3IAS1 5A2QS 3O13A 4KZCA 4KLNA 3PREA 4N58A 2PEAA 2J7NA 1FPYA 2DBYA 3O0UA 4OEMA 3H4JA 1N62A 2A5UA 2JPHA 1YQ4B 2DAEA 5GXGB 1PIPA 3BBZA 5CVNB 4KVGB 4B7GA 4WQOB 1N63A 3VDPA 4MJSB 1EE8A 1PPNA 2Y5CA 2KKCA 2LD9A 3Q8XA 1N34M 1NV8A 2AUXA 2I1JA 4B7HA 1IN7A 4Y28F 1IXSA 1P1AA 4G3XB 3HM3A 4A20A 3E46A 1F4IA 4ZHPA 4K7SA 2NVUI 3NHEB 2NQIA 1QQWA 1JQ4A 2DAIA 1JWBD 3FUTA 3GLGB 2BDLA 4BPVA 1UF0A 2LGYA 3HWNA 1OGWA 4GKJM 3MJ5A 3VK7A 4GITA 2INNE 2CJNA 3A9KB 1MS6A 1WGYA 1SB3C 2FYEA 3VKHA 1Z6TA 2L0TA 1DEUA 3H9DA 2JWUA 4L4UA 3DHGC 4EZJA 2EMTA 2R2QA 1HA5A 1EWOA 2DVWB 4DV2M 4MSMB 4XX5A 1L2CA 2J0KA 4B6WA 4WAAA 1XMOM 3SARA 1I4PA 3U6LA 1GECE 3B7ZA 2DYBA 4HEOA 3VLFB 1ZMWA 3RNEC 2FIFA 3J7AS 3ZXRA 3UQBA 4IBBA 3A45A 1LV7A 4C4VB 4HKZE 4LF9M 4LJ5A 1X9YA 1RYJA 3FTEA 2AL6A 2JRIB 1AIMA 3N3GA 4R7GA 1NVID 4MGHA 3QK0A 2N7JA 1WJ4A 4IBIA 1V1PB 2HHNA 1I4GA 1AYFA 4X65M 1GLOA 1N75A 1PJQA 3DBRB 1KLVA 2BS2B 1ZMUA 2KDIA 2M19A 1UFZA 2BJWA 4WWMA 3LFYA 2KA6B 1SXJC 1TH2A 2LVOC 2ZW1A 3KWZA 5JZEB 4HL4A 5HI1A 4K7UA 3HX3A 4ANRA 1F29A 1CVZA 3EC8A 1ICFA 2KW0A 2G9HD 2F4VM 3P5UA 1I4XA 4HWIB 2KNZA 2CJOA 1FFUA 3AE4B 1GL7A 4MDKE 3N1ZC 2UU7A 5ITRA 3BOWA 3MORA 4N4ZA 1L0YB 2AQ3B 3PSEA 3BZDB 1IN8A 3R2IA 4IM3A 2MJDA 2F7DA 2VF7A 1V1OA 2JP7A 2NBWB 3MHZA 3AE3B 2R0IA 3Q3NC 3QJ3A 3JR5A 2NMQA 2CB5A 1HT1E 4OZBA 1FXAA 3SC3A 2DZJA 3AN1A 3GRUA 5EE9A 3T15A 1MPEA 1DGFA 2EA0A 4X62M 1R7RA 3MHVC 4JI3M 1D6EC 1N36M 3UGBB 4FD2A 1RAXA 3CF6E 1U5IA 2KDBA 1VJVA 3TRKA 1WFYA 3B0AA 4PCZA 4LJ9A 2O6VA 1SNKA 1K51A 4HPLB 3R7QA 2C7NB 4XR7A 3C3EA 1XXGA 2C9CA 4BOPA 2Z8LA 1KJTA 2R9CA 1E8ZA 2D5GA 2ZBKB 2VQFM 2HD5B 3BY4A 4TQ0A 4JIOU 2K25A 4CDEB 3VRBB 2NPTA 3PT2A 2BWBA 4JX1C 1ITOA 3A42A 3DQVA 3WA0A 2WNMA 2QDFA 4P17A 1E10A 4KODA 2O6XA 4LNIA 1KFXL 5LLIA 2FRQA 4PP1A 4F1IA 3CSTA 4WWNA 1CJLA 1PGAA 4LNNA 1TH3A 5EXXA 5FPWA 2WLBA 5F3WA 2KEBA 3VK8A 3HU1A 1HQYE 1PQSA 3F5VA 1ZMVA 2KNBA 1ZOYB 3ML8A 3C0RB 4JI4M 1TDHA 7CATA 1GJSA 2DHZA 2B76B 1QAMA 3IHPA 4C56C 4XE0A 2KXJA 1F2RC 2BYFA 2K22A 3OAWA 1ME3A 2LVQD 3ILKA 1XQQA 2OJRA 3I4VA 1NO1A 2W3SA 2DYOA 3PLVA 3A9JB 2FTDA 1U4AA 2HCBA 2ZJDA 5D3IB 1OFHA 3ETRA 2XH9A 2LTUA 2I7NA 4G3OA 3DBRI 1HTOA 4S12A 1D0LA 1EWLA 3AEBB 1SXTA 3ZH9B 2YLMA 4L15A 2KOXA 2P7UA 3EFCA 2XNAC 3NBXX 2WU2B
chains in the Genus database with same CATH topology
3C8YA 2I7PA 3GLHB 3JR4A 4B0EA 3U61A 3P1MA 3FTDA 1I4RA 4NSOB 1PJJA 4NRWA 5EZQA 2KRUA 1HXYD 4IJEA 5FSWA 3GRYA 1ET6A 3T3NA 4FWDA 4KX6B 3SASA 1NNJA 3LVWA 4B3TM 1UUPA 2DHRA 1WRIA 1C77A 1N60A 1HNZM 5MPOA 1L2DA 3C58A 4CHTB 2KQ4X 5FTJA 3O65A 3T1YM 4M0DA 4KHPM 2GRIA 1E7PB 2W54A 3THGA 1DO2A 4LZZA 1Q39A 5AUKA 3KP0E 1TDZA 1JWSD 4NAWB 1IY0A 1N77A 4JI2M 3A46A 3IAM1 5EP1A 1F77A 1N78A 1JR3A 4MH8A 1CZPA 3AFHA 4B3MM 4LGYA 4BBAA 2VZKD 1K52A 2E6XA 4M9XA 2JTCA 3K8ZA 4EE2A 1MI0A 2JZPA 3VKGA 3KOWE 3GB1A 2HDEA 5FKAC 1I4WA 4JV5M 2Y3AA 2Q5WD 2A5YB 2FNAA 3UK6A 4NZLB 2DOSA 2WXMA 2ZW0A 1NY5A 3TE6A 2KRKA 3B2FA 2CEAA 4GKKM 1YZBA 3KS4A 2WXLA 1V1PA 5JI3E 4AZFA 4QOZC 1BXTA 5DYIA 3PFIA 3U4EG 1ZE3D 4GMQA 2KZUA 3GPYA 2Y20A 1VDDA 5ITUA 2WXFA 1NYRA 2TSSA 3W5VB 5BR8M 2XSZD 1K50A 1E9RA 1JMLA 4UDUC 4RNAA 2RDGA 4OHJA 4ZHOA 1ZXIA 4JPSA 1FEHA 1QOGA 4JWSC 5EE1A 2JYTA 2G5GX 2NTTA 4IUMA 1L1TA 4XWTA 2L83A 3KDSE 4JN6A 2JX5A 2BB5A 1IBMM 1J7KA 3AE1B 3KFUG 4LJ6A 4XDCA 1ZPSA 3QWLA 4B08A 1ACCA 3PZ7A 5C3JB 4YWGG 3HWSA 3GQ4A 1L0VB 5FTLA 3U61B 1LO5D 3TSSA 1G41A 4P6VF 3SHGB 1DYQA 4B3SM 3DWMA 3OTOM 1IQPA 2DWQA 4NJCA 2YFQA 4D80A 1WYGA 1NI3A 2J42A 4HKQA 2CV2A 3E56A 1ESFA 4JXJA 2NQ8C 2RKOA 4IBCA 4D8BA 2RPVA 3PHUA 1XWIA 3W5UB 5T8IA 1FNUA 2L7IA 1PDXA 3L26A 1DOYA 3W31A 1D4BA 3GPPA 2ZM6M 3H4MA 1DGHA 3U5ZB 3HUIA 3FUXA 3VQIA 2HKJA 1IUEA 3M6AA 2JQRB 1ZDVA 5ITXA 3FTCA 3UGJA 3AMZA 2V3NA 2D7EA 4AW4A 1KTKA 1C9FA 2WXRA 3I4YA 2WDQB 1OQQA 1FNWA 2V1CA 4LGMA 2YEPF 4MH0E 1XNQM 3FUWA 1MVKA 4GDKB 5G5GA 3AE7B 2KN4A 4JWUC 3ZYYX 4LF6M 2XN9C 2DXIA 3GLGA 2FUG1 1IGDA 1GB1A 2N0SB 2SEBD 1SXJE 4RFBA 4B3RM 4LK0M 2Y0TA 3AOEA 2BB6A 2KDMA 3HGIA 1N61A 1QKZA 5KO3A 5C2TB 4US9A 3BK2A 4PT5A 1AWDA 4GC9A 3TEZA 3ZJTA 4IOIE 4Z6YA 1KFVA 4FWGA 2F5OA 1RM6C 4C7YA 3CIRB 1IGCA 3GS2A 1WGKA 1JCKB 1TS3A 1KFYB 5G5HA 3NVYA 3BYYB 1XNRM 3AV0A 1H6UA 4G6ZA 2D7HA 5FTMA 3ZJUA 5JZEA 1Q10A 1YQ3B 4ZOHC 2BTWB 1JWAD 2OHFA 4FVMA 4JI6M 1K3WA 4AS1A 4LF4M 4MB7A 3TQSA 3K1JA 1FIQA 1RWSA 1QF6A 2Z3XA 3AEAB 2EUCA 5BYSA 1QVRA 3FILB 1I7HA 3DA1A 2WDRB 4TMAB 4LJAA 4IJFA 1R2YA 3NWLA 3KWVA 2YNMD 1QAQA 1L6UA 3SMSA 4IBGA 4P16A 4JI0M 4I81A 4FCTA 1JROA 2AQ1B 3FUVA 5FK9C 3H8HA 4A9AA 1FFVA 1R2ZA 1SE3A 4LCBA 4OU7A 4TSSA 3W9CB 3TUOA 4LRTA 4YTNB 3W1SA 1SBBB 5I4DA 3BIID 1TKYA 2R4JA 3Q8CA 3L2AA 2RGOA 3LYYA 5HG2A 1YMHE 4JI5M 4KKJA 1UNSA 4RCOA 3ZJVA 3AEGB 1XO3A 2HHHM 4RH6A 5AUIA 4L2YA 3DWGC 3CWIA 3GRRA 2C5RA 4FW9A 3U6PA 2WXIA 3GRVA 4A6QA 3AE2B 1YE9A 4IBJA 4HEA1 2XZUA 3KP1E 1SE4A 3B21A 1YN4A 1ZUD2 5H8YE 1X37A 3KSJA 1FNVA 4J3OD 4HROA 4WW0A 4W5WA 3KXEC 1DOIA 3AECB 1TS2A 2JU6X 1GLNA 4AI6A 3SR6A 1QANA 3I9V1 3MFGA 1J7AA 1JQJC 3KVWA 2OQ4A 1FM0D 2K3UA 5KQ8A 5IWAM 4WAFA 2YR0A 1ENFA 2CV0A 4QHTA 3J2PB 3Q69A 1FMAD 4RKXA 1VZ6A 2H88B 5LMNM 2AX5A 1XLPA 4M9ZA 4NAMA 4KGSA 3GPUA 3LB8C 3AE5B 2Z84A 1G8PA 2IJ0A 2UU9M 1TKEA 2WXKA 3NVVA 4ZYSA 2XSZA 4IBKA 2R46A 1T5XD 4BOQA 3TWMA 3HU3A 4YY3M 2W82A 1KRHA 3T38A 2FE8A 2L09A 2H89B 1XF5L 2IPKD 3LQRA 2XZFA 1XMQM 1QOAA 3J7BA 2PVOD 2I38A 2L7HA 4LJ7A 4YHHM 4WIPA 3FAHA 3BBAA 4OZCA 5BMGA 1MX0A 3HU2A 4JI1M 2M5ZA 4OX9M 4LRSA 1EWCA 1HZ6A 2BT6A 3ABVB 4K0KM 3HHWA 4BOZA 4HLQA 4LLGM 4IP3A 3PRPA 5KQDA 4GDLB 1QZMA 2C9OA 2C99A 1L0XB 3P4QB 1HZ5A 1YN3A 1HEZE 1FRDA 2LWXA 3P4PB 4LJ4A 1IN4A 1CJEA 1GOZA 2PKOA 4PDGA 2ERCA 3L25A 5FLXS 1E9MA 1JR3D 3JAMS 3FKEA 2C98A 3WHKA 4XWWA 1ZQ9A 2WDVB 2J7OA 1OQRA 2BNKA 1MU5A 3K2LA 5JI2E 5EXTA 1FCCC 2K47A 4RF0A 5TSSA 1QT9A 2PVGC 3KOYE 1L2BA 3B9JA 4O1NA 1FNNA 3BVGA 1YNTE 2AQ2B 3CF2A 5DNYA 1VZ8A 3SBJA 3E4RA 4NXNM 1Y56A 2J53A 2UUAM 4ZRQA 3RE8A 4MGZE 3SAVA 4LJ8A 4RGNA 1NHWC 4GLSC 1XXHB 3QAUA 5BMHA 1SJHD 2UUBM 1VLBA 1IY2A 4MGKE 4KGTA 3AEFB 2K9XA 1E9SA 2R45A 4HRSA 3UZUA 3EIHA 4C7ZA 2R65A 3IFUA 2UXCM 1BUIC 4LF8M 3U60A 1UWXA 4DR4M 3EIEA 3TL4X 8CATA 4L8RC 3IT4B 2M0AA 2F5QA 2H1RA 4GC5A 1GB4A 1IBXA 4XBOA 2KWDA 4IBFA 2DLBA 3AEDB 3SYKA 2KXEA 1PJIA 3B9PA 3U6QA 3AOEC 2GB1A 4R3DA 1FJGM 4LZJA 1VR9A 1RFKA 2F5NA 4LFAM 4JYAM 1GVNA 3PVSA 1HQCA 3BB7A 2EKIA 5ITTA 2BTEA 5EP4A 1C4AA 2GI9A 1JWMD 5EP3A 5H37D 1VZ7A 1L5PA 3KSXA 5EQTA 1P7EA 4US8A 1Q3BA 1TGUA 3GP1A 4BOSA 3LXFA 4RF1A 2QBYA 3GQ5A 1EM7A 5D3DA 4KO8A 1VRAB 1Z59A 1C1KA 1SXJB 5KPTA 4EIWA 1FO4A 1N33M 2ZAMA 3GLIB 2I2YA 4XGIA 4REZA 3AL0C 4AQ7A 2INPE 4AKIA 2DZOB 2P5TA 4QNRA 4B7FA 3AKZA 1I94M 4A5UA 2N9KA 3TMPA 1VJKA 3PO0A 3URYA 3U6CA 2X38A 3FC4A 1NVMA 2V3PA 1HR0M 4I8OA 3UMMA 1HNXM 1N32M 3R9XB 5LMUM 2C96A 1C76A 3Q8FA 3K92A 2FBWB 4I5SA 1XCQL 1DOXA 4MGIE 3HJSA 3UJNA 1MHHE 1QQRA 3P4RB 3U6EA 4DV1M 1OJLA 4BOUA 1F2RI 1N5XA 1W5SA 3PXGA 4HXDB 5EE0A 3KWLA 1DGBA 4JI7M 2WP9B 1I4QA 4G4QA 1YJJA 5EE3A 5C1BA 3R8BA 1E32A 1PM5A 2JYEA 1JALA 3HHZA 3RFZB 5FR3A 2Z4RA 1XHBA 1K53A 3KOZE 3FILA 4PDIA 2CE7A 4DR7M 3TEWA 2QPAA 2XFTA 5KPZA 5D7GA 2YEPB 2EELA 2HWKA 2WXQA 1QOFA 2W55A 3NBIA 1NY6A 4LFBM 3J81S 4II7A 4FWHA 3Q8BA 1JWUD 5IT9S 2MJ3A 2M56B 4DQOC 2WXNA 1TKGA 2XFSA 1SF0A 1UM8A 3U52E 5H92C 4WQMA 3NS1A 1FCLA 1FRRA 2LJIA 4Q2JA 4FXCA 2E3TA 1R7SA 3SYLA 4GRIA 2CUZA 1G3IA 2XGNA 1KLGD 4CGYB 2XLJA 1TH4A 4MACA 4ZPXA 1BMLC 2WXPA 5E26A 3U6MA 4QOSA 4WH4A 2CHVA 1D2NA 2Y0QA 2IDYA 3SAUA 3U7ZA 3RGPA 1T3QA 4HJGE 5JXVA 4L78A 2IGDA 2L6OA 3EGRA 3M7GA 3EUB2 4MI7A 3L4PA 2MJEA 3GO8A 2UXBM 1SSNA 3W0FA 5C18A 3W0LB 3MP2A 3LQQA 1L1ZA 2UUCM 2WXOA 2QJLA 1NEKB 3TEXA 4A3VB 1J5EM 2XEPA 1M4VA 1TZOA 3NVWA 4DV4M 2QCUA 1XLOA 3BVZA 4LY6A 3PNVA 4DR2M 3WCQA 2WU5B 5IZ7D 5EXPA 3GQ3A 2QP9X 3NUHB 3SATA 3PHXA 3R8FA 2PMVA 2RGHA 3D8BA 3GLFA 1N5WA 2LXEA 2WXJA 3SAWA 1Z5AA 3TWLA 2DWLA 3DZDA 2PIAA 4YSYB 2KAJA 1SE2A 1ZDXA 1IN5A 3B2GA 4BB9A 5FTKA 4XZXA 3ZGZA 5HFYA 1E0ZA 1IBKM 4I4LA 5ITXE 1D5MC 4DR1M 1CQVA 4IDIA 1PYWD 1XXHA 4ITQA 3GPXA 4RGOS 2DWNA 5HHDG 2ICIA 3KOXE 3ZNHA 1YSYA 4MT5A 1D5ZC 4IKGA 3I51A 3GLFB 3CF0A 2G1EA 1NHGC 4DR3M 3AOGA 1KLUD 4MM3B 2J7QC 3R2TA 3ZQ4A 3N9YC 4YTPB 2QENA 1UWMA 1EWYC 3A98B 4GIPA 4YTMB 5E6JA 1OFFA 2KACA 3U6DA 3BK1A 1OFIA 1J09A 1UKFA 2ZANA 1QOBA 2R61A 4YSZB 4AKHA 1XEEA 3WHLA 3VR8B 3LMMA 2MH7A 3SHFA 1J7CA 3HVZA 1DKIA 2R4EA 3ZC7B 2JA2A 2VIIA 2W3RA 2FOIC 3HJQA 2DZNB 3VFDA 5BYQA 5ITYA 1C4CA 1GPXA 4G4OA 3I57A 4X64M 2BTWA 1NSFA 3BYTB 2YQZA 2WS3B 2LHDA 3GLHA 2L32A 4IBEA 4JE3B 4TUWA 4ARCA 1SEBD 4D8EA 1L8QA 3C0RA 4C80A 2FFJA 3IXSA 3NVZA 3M0EA 3P42A 1B1ZA 3GLIA 4LFCM 4XDDA 4LF7M 2WQYB 2CFOA 3OWEB 1C4PA 2QMTA 5EP2A 3KW6A 2X4AA 1PUTA 3DFZA 3AV8A 3L27A 2CU3A 1MHXA 3MP9A 4GH9A 1ORYB 3AE8B 2BW2A 2V6ZM 2V1UA 1PVJA 1HT2E 1PFDA 5BMIA 4DUZM 1TY2A 3W2DA 1NYQA 1JRPA 4DUYM 3J27B 2V0GA 1KF6B 3NRZA 3PHWA 4DV7M 1TY0A 3P63A 3AE6B 1HNWM 4A90A 2E5LM 1WXQA 1ZAEA 3RGSA 2UXDM 3IG5A 2DWZB 1KSFX 3HHXA 3BWUD 2CHQA 1FXIA 2Z7JA 2X8AA 2JXTA 3V3XA 2BU3A 4IIWA 4OVZA 1XC8A 4CISA 2LFIA 3V05A 1F0ZA 4G4RA 2QSDA 3GP7A 4AKGA 3MC0B 1YJIA 3E9SA 3BVMA 2F5SA 3TWKA 1GL6A 2M60A 1J7BA 4ARIA 3TEYA 1IN6A 3HRDD 2BJVA 2LMCA 1KYIA 1DO0A 2AHMA 2XF3A 4M9SA 1SXJA 3FTFA 3HHYA 3VDUA 1GKIA 3SEBA 2R62A 4AG5A 3AB5A 3AM9A 4JI8M 2UZJA 5BYRA 3PNYA 2PW9A 3U5ZA 1IXSB 1NENB 4NSRA 3D8LA 4FCWA 4DR6M 5EZSA 2K0PA 2KZSA 4DV5M 5EJCA 3SFDB 1WSPA 2Q2EB 3LVVA 2QIEB 4N59A 1W5TA 4RGMA 1C78A 2L52A 2LUMA 4YXDB 3KLSX 1G4AE 3L29A 1S3SA 4LTUA 3KQ4A 2NTSA 1AN8A 1CK1A 3SFZA 2IGHA 2BYTA 4KKIA 3AEEB 1XCTL 2CV1A 1NNUC 1QAOA 1DGJA 3TPZA 3W30A 2L1AA 1WWTA 3U2SC 3AE9B 3U6OA 1C79A 3T3OA 4H2AA 3UI3A 4IBDA 5KPRA 1HQRD 1QLBB 2JSVX 4BLCA 1L4ZB 1YUBA 2LH0A 2CHGA 1R6BX 5GKNA 1QILA 2N9LA 3FYDA 2KMMA 1DGGA 3FD9A 2QBYB 1Z5CA 1E6EB 2K5PA 1E94E 4QHSA 3DOAA 4ZTBA 1B9RA 1K82A 1IXZA 2ZAOA 4DV6M 4RGTA 2AGAA 4NOOB 4USAA 3KS8A 3U60B 4PD2A 1FD6A 2IGGA 1Z5BA 4QNMA 4FCVA 4DV0M 2WXHA 1JW9D 1IY1A 4N6EB 1NJGA 5FTNA 2OPFA 1UGJA 2J4XA 3HVDA 2WXGA 2J7QA 3MK6A 3IT6B 2DWMA 4GUAA 3RNVA 1V8CA 1AW7A 2ACZB 1DGHB 1STEA 2OEDA 4L23A 3SFEB 1IM2A 1T3TA 1ET9A 4B0MA 1GAQB 1YN5A 1NJFA 1ROEA 1SXJD 4DXFA 1IBLM 2LGIA 1V97A 3ZCBB 3U6SA 1IXRC 4GHLA 4NXMM 4D2KA 3IG8A 2X49A 3PRMA 4YT0B 5LNK1 1L4DB 4D82A 4OVZB 4Z8XA 1A70A 3OQCA 3HKPA 2LHEA 3AJIB 4L16A 1K3XA 3AH7A 4AG6A 2JRIA 1KH0A 2BS4B 4AQYM 2DYMA 2D7GA 2ONQA 4YSXB 2V4IB 1Q3CA 2QZ4A 3VR9B 4G4NA 1TS4A 1IBXB 4TQ1A 2RMMA 1T6BX 4LF5M 3PZ8A 1XLQA 3VRAB 4A8XC 2BBCA 5ITQA 1XLNA 1TS5A 1VDVA 3Q8AA 2HTME 4OZAA 4A55A 1D5XC 2VQEM 1PGXA 4L1BA 2Z4SA 3RPFC 2Y5PA 3BOSA 1TYGB 5IREB 4DXGA 1L6VA 4DV3M 4DR5M 3J9CA 2QEJC 4CQNA 1P7FA 2PTLA 2LEKA 3FYCA 2R18A 4D81A 5BPVA 1EU3A 3SMPA 3FUUA 4GHAA 1SIJA 2SAKA 2MEKA 4X66M 1SJED 3CTWB 3L28A 2F5PA 2PLPA 2QILA 2J52A 2HL7A 1TJEA 4ITKA 1ZP0B 1I4HA 1QYRA 3NZ3A 1G59A 1EU4A 5EXSA 2Y21A 3RFWA 5DYGA 4KGRA 2VZKB 2BS3B 4OW0A 2LNHC 3J80S 4ZRPA 3HJ8A 4NL4H 3P4SB 2EO2A 4WURA 3MTVA 2O5RA 4M0WA 4D8IA 1ZXHA 2RDHA 2ON8A 4MGYE 3Q8EA 4NRVA 4LG2A 3EA6A 1PGBA 2G8LA 3T1HM 3IAS1 5A2QS 3O13A 4KLNA 4N58A 2J7NA 2DBYA 1N62A 1YQ4B 5GXGB 4B7GA 1N63A 3VDPA 1EE8A 2Y5CA 3Q8XA 1N34M 4B7HA 1IN7A 4ZHPA 1QQWA 1JQ4A 1JWBD 3FUTA 3GLGB 4GKJM 3MJ5A 3VK7A 4GITA 2INNE 2CJNA 1SB3C 3VKHA 1Z6TA 2JWUA 4L4UA 1HA5A 2DVWB 4DV2M 1L2CA 1XMOM 3SARA 1I4PA 3U6LA 3VLFB 3J7AS 4IBBA 3A45A 1LV7A 4HKZE 4LF9M 4LJ5A 1RYJA 3FTEA 4R7GA 1NVID 4MGHA 2N7JA 4IBIA 1V1PB 1I4GA 1AYFA 4X65M 1N75A 2BS2B 2M19A 2BJWA 4WWMA 2KA6B 1SXJC 1TH2A 2ZW1A 4HL4A 5HI1A 2KW0A 2G9HD 2F4VM 1I4XA 2CJOA 1FFUA 3AE4B 1GL7A 5ITRA 1L0YB 2AQ3B 3PSEA 3BZDB 3R2IA 1IN8A 2MJDA 1V1OA 3MHZA 3AE3B 3JR5A 2NMQA 1HT1E 4OZBA 1FXAA 3SC3A 3AN1A 3GRUA 5EE9A 3T15A 1MPEA 1DGFA 2EA0A 4X62M 1R7RA 3MHVC 4JI3M 1D6EC 1N36M 4FD2A 3CF6E 3TRKA 4PCZA 4LJ9A 1K51A 1XXGA 2C9CA 4BOPA 2Z8LA 2D5GA 2ZBKB 2VQFM 3BY4A 4TQ0A 3VRBB 3PT2A 4JX1C 3A42A 2WNMA 1E10A 4KODA 1PGAA 1TH3A 5EXXA 2WLBA 5F3WA 2KEBA 3VK8A 3HU1A 1HQYE 1ZOYB 4JI4M 1TDHA 7CATA 2B76B 1QAMA 4C56C 4XE0A 1F2RC 2K22A 3ILKA 3I4VA 2W3SA 2DYOA 2HCBA 5D3IB 1OFHA 3ETRA 2XH9A 2I7NA 4S12A 3AEBB 1SXTA 3ZH9B 4L15A 2XNAC 2WU2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF1 A;  4RNA A;  3MP2 A;  4REZ A;  4M0W A;  4OVZ B;  3MJ5 A;  4OVZ A;  4MM3 B;  5E6J A;  2FE8 A;  3E9S A;  4PT5 A;  4RF0 A;  4WUR A;  4OW0 A;  4R3D A;  5KO3 A;  4P16 A; 
#chains in the Genus database with same CATH topology
 3C8Y A;  2DCA A;  1J8C A;  4BAX A;  2I7P A;  3GLH B;  2ZVO A;  4RM9 A;  1DF0 A;  3JR4 A;  4IG7 B;  1YX5 B;  4B0E A;  3U61 A;  3P1M A;  3FTD A;  1I4R A;  4NSO B;  2CHZ A;  1PJJ A;  2KJR A;  3M63 B;  3MTN A;  4NRW A;  1UZX B;  1WJ6 A;  5EZQ A;  2KRU A;  1JR3 E;  1HXY D;  4IJE A;  2ZZP B;  2LGS A;  5FSW A;  4LNF A;  3GRY A;  2VHF A;  2ACT A;  1ET6 A;  4EUT A;  3T3N A;  5J94 A;  4FWD A;  1I35 A;  4P6E A;  1E8Y A;  4KX6 B;  4II2 B;  1YT7 A;  3SAS A;  4PI3 A;  3K24 A;  3VVW B;  1NNJ A;  3LVW A;  4AWJ A;  2K6Q A;  3H89 A;  4B3T M;  5D94 A;  2LRU A;  3NS8 A;  1UUP A;  4A3O A;  2DHR A;  1EF5 A;  1WRI A;  1F2A A;  2KTR B;  1C77 A;  2H7J A;  3WAL A;  1PXV A;  3OLM D;  2EKK A;  2MBH A;  2MWS B;  4HCP B;  2KWU B;  1N60 A;  1HNZ M;  4OVU A;  5MPO A;  1L2D A;  3C58 A;  3USV A;  4CHT B;  1V81 A;  2KQ4 X;  4GIV A;  2DZK A;  3D32 A;  2G3Q B;  1XXH E;  2GBK A;  5FTJ A;  3O65 A;  4FHJ A;  3T1Y M;  4M0D A;  4KHP M;  2GRI A;  3EHV A;  2LGD A;  2JUJ A;  1E7P B;  2DJG B;  2W54 A;  3THG A;  1DO2 A;  4LZZ A;  1CMX B;  1Q39 A;  2L4F A;  5AUK A;  3WAP A;  2KJ6 A;  3KP0 E;  1TDZ A;  1JWS D;  2AS8 A;  4FUL A;  2DZZ A;  1ZW7 A;  5CVO B;  1GJT A;  4NAW B;  1ATK A;  4RY2 A;  2BVC A;  3I3T A;  3P2B A;  1IY0 A;  1N77 A;  4BOS C;  4JI2 M;  4I6N B;  3NG0 A;  1AU3 A;  1Y08 A;  3A46 A;  3IAM 1;  5EP1 A;  1F77 A;  1N78 A;  1JR3 A;  4MH8 A;  5LXH A;  1F52 A;  2D11 A;  1CZP A;  3AFH A;  2RDB C;  2VHS A;  4DMX A;  4B3M M;  2P86 A;  4LGY A;  1MIR A;  4BS5 A;  4BBA A;  2VZK D;  1K52 A;  2CWB A;  2E6X A;  4M9X A;  2JTC A;  3K8Z A;  4EE2 A;  1MI0 A;  2JZP A;  3VKG A;  5LXI B;  3KOW E;  1Q5W B;  2C0Y A;  1PBH A;  2QNJ A;  3GB1 A;  2HDE A;  5FKA C;  1I4W A;  4I6L B;  3P5X A;  4JV5 M;  3K9P B;  2PPH A;  2DAM A;  4ANW A;  1L2N A;  2Y3A A;  3N1Y C;  1TTN A;  3ZRC A;  2Q5W D;  2A5Y B;  2FNA A;  3UK6 A;  1Q02 A;  1Z2M A;  4NZL B;  2BGF A;  1RLF A;  2DOS A;  2WXM A;  4CZW A;  2ZW0 A;  1NY5 A;  2CHW A;  3TE6 A;  4KZ0 A;  3BXW A;  2KRK A;  2DZY A;  3W1S C;  3K9O B;  3MTN B;  3B2F A;  3H6N A;  2CEA A;  2JXX A;  5A24 A;  4IW0 A;  4GKK M;  1YZB A;  3KS4 A;  2DHY A;  2WXL A;  3T9L A;  1V1P A;  5JI3 E;  3NOB A;  4AZF A;  4ZRK A;  4QOZ C;  3QC8 B;  4RM8 A;  1BXT A;  5DYI A;  1IWD A;  1K8R B;  3PFI A;  2VH1 A;  2JQG R;  3U4E G;  1ZE3 D;  2L7R A;  3QHT A;  4GMQ A;  1YJ1 A;  2KZU A;  1RU3 A;  4AXL A;  4KSL C;  3V62 A;  3GPY A;  2Y20 A;  3KWB X;  1Z5S B;  1VDD A;  3B08 A;  4CIZ A;  5ITU A;  2KC1 A;  4FJZ A;  3GZN B;  5C23 A;  3PRM B;  2FAZ A;  2WXF A;  2M0X A;  3IVF A;  2R6N A;  1NYR A;  2TSS A;  3W5V B;  4BKS D;  2CU1 A;  1PRB A;  5BR8 M;  2XSZ D;  2O6V D;  1K50 A;  4AUQ C;  1E9R A;  4MSX A;  1M94 A;  3H7P B;  1JML A;  1VD2 A;  4YL8 A;  3V6E B;  2XU4 A;  4UDU C;  1P0R A;  2WGS A;  3O65 B;  5GMV A;  4ZRI A;  4RNA A;  2RDG A;  4OHJ A;  2QC8 A;  3ZNH B;  3X23 A;  4ZHO A;  2ZPY A;  1WIA A;  2KX3 A;  1ZXI A;  4QAY A;  4JPS A;  2IBI A;  1FEH A;  4YYQ A;  4Q8H A;  2GBN A;  1QOG A;  4JWS C;  2MBQ A;  5EE1 A;  5KHO A;  4N8W A;  2JYT A;  2G5G X;  3OJ4 B;  2NTT A;  4IUM A;  1L1T A;  4XWT A;  3TJP A;  2KFK B;  2L83 A;  5JH5 C;  2WHI A;  3KDS E;  4JN6 A;  2JX5 A;  2BB5 A;  1IBM M;  3I01 M;  4W9L A;  4LNK A;  1KXR A;  4YYV A;  4X6H A;  3RYT A;  1J7K A;  1TR8 A;  3AE1 B;  5AZF A;  3KFU G;  4QRG A;  4M8N A;  4EOY A;  2FCQ A;  4GDL A;  4LJ6 A;  4XDC A;  1ZPS A;  3QWL A;  4B08 A;  1ACC A;  1PJT A;  4Q8G A;  3PZ7 A;  5C3J B;  4YWG G;  3HWS A;  3WXE A;  3GQ4 A;  1L0V B;  3ZUN A;  1S4V A;  1EO6 A;  4BKT A;  3S3Q A;  4WA6 A;  5FTL A;  2LZ6 A;  1T0S C;  3U61 B;  4A3P A;  1LO5 D;  3B7N A;  1G41 A;  3TSS A;  2HJ8 A;  4P6V F;  4X57 B;  3V61 A;  3SHG B;  1DYQ A;  4B3S M;  2WZJ A;  2GBM A;  2KX0 A;  3DWM A;  4BZA A;  3OTO M;  1IQP A;  1WR1 B;  2RR9 A;  2DWQ A;  4NJC A;  2AIM A;  2KDE B;  2YFQ A;  4D80 A;  2V1Y A;  4FAD A;  3RD2 A;  1WYG A;  1WX8 A;  3Q3F A;  1NI3 A;  2J42 A;  4KIK B;  4Q7J A;  4HKQ A;  4CO7 A;  2CV2 A;  1WZ3 A;  3VTW A;  3E56 A;  1ESF A;  4JXJ A;  2NQ8 C;  2RKO A;  4IBC A;  4D8B A;  2G8J A;  2RPV A;  3QQ8 B;  3PHU A;  4W9G A;  1XWI A;  3WAN A;  3W5U B;  4P7I A;  2N4F A;  5T8I A;  3QYB A;  1FNU A;  1WGL A;  2OOB B;  2L7I A;  1PDX A;  3L26 A;  1DOY A;  3AU5 A;  1VSN A;  3W31 A;  4YYS A;  1D4B A;  3GPP A;  5IO9 A;  2ZM6 M;  3H4M A;  3I04 M;  3V6C A;  3PHX B;  4P6G A;  1SIF A;  1DGH A;  3TIX A;  2RD0 A;  3U5Z B;  3HUI A;  4HLE A;  3FUX A;  4W9C A;  3VQI A;  2XK5 A;  2HKJ A;  3B89 A;  1IUE A;  4F2L A;  2M1M A;  3M6A A;  2JQR B;  3W67 A;  1ZDV A;  5ITX A;  3FTC A;  3UGJ A;  3AMZ A;  3O1G A;  2V3N A;  3UQA A;  2HXZ A;  2KVZ A;  2D7E A;  4AW4 A;  1KTK A;  1C9F A;  2Z0E B;  2ZCC A;  2LUE A;  2DC7 A;  2YJB A;  2DAF A;  2WXR A;  3I4Y A;  2WDQ B;  1OQQ A;  1FNW A;  2V1C A;  4LGM A;  2YEP F;  4MH0 E;  3RNG C;  1XNQ M;  3FUW A;  1MVK A;  4GDK B;  2BWF A;  5G5G A;  2EMS A;  1NBF C;  3AE7 B;  4EZL A;  3Q3M C;  2KN4 A;  2DEN B;  4JWU C;  3ZYY X;  4LF6 M;  2XN9 C;  2DXI A;  3GLG A;  1YD8 U;  1OTR B;  2FUG 1;  1AYU A;  4UN2 B;  4MEL A;  2B3A A;  1IGD A;  1S3S G;  1G71 A;  2XBB C;  1LXD A;  4KDL B;  1GB1 A;  3SHQ A;  2N0S B;  1JQP A;  2SEB D;  1SXJ E;  2J0M A;  2IND C;  4RFB A;  3IG3 A;  4BSQ A;  3DCG A;  2DC8 A;  2PAD A;  2RPQ A;  5HKH A;  2AVW A;  1R4N B;  4B3R M;  4LK0 M;  2Y0T A;  3DF0 A;  2KWV B;  4GOC A;  3AOE A;  2BB6 A;  2YJC A;  3OJ3 A;  2KDM A;  5AZH A;  4GB9 A;  3HGI A;  1N61 A;  1QKZ A;  5KO3 A;  4F1S A;  3IEC A;  5C2T B;  1P3Q Q;  4US9 A;  3BK2 A;  4PK1 A;  4PT5 A;  1AWD A;  4IWQ A;  4GC9 A;  4DMY A;  3TEZ A;  3ZJT A;  4IOI E;  4Z6Y A;  2CHX A;  1KFV A;  4FWG A;  2F5O A;  3BY4 B;  2HD5 A;  1RM6 C;  4C7Y A;  1TLO A;  3CIR B;  1IGC A;  3GS2 A;  1WGK A;  2ZTC A;  1JCK B;  3ZNZ B;  1TS3 A;  1KFY B;  5G5H A;  2YJ9 A;  3DOW A;  4PAD A;  3NVY A;  3BYY B;  1XNR M;  5CHV A;  4MZS A;  2AYO A;  3AV0 A;  5CX3 A;  9PAP A;  4C00 A;  1H6U A;  4G6Z A;  2D7H A;  5FTM A;  3ZJU A;  1NLJ A;  5JZE A;  1R4M I;  1Q10 A;  1YQ3 B;  4ZOH C;  1O0E A;  4PS7 A;  2E01 A;  4IWP A;  1PPP A;  1JWA D;  2BTW B;  2OHF A;  4FVM A;  2DX5 B;  4FN2 A;  4JI6 M;  3HZJ A;  1K3W A;  4AS1 A;  4LF4 M;  1WXA A;  4MB7 A;  3TQS A;  4YYW A;  3K1J A;  1T43 A;  1FIQ A;  3DVG Y;  1RWS A;  2G4D B;  5L8R F;  4W9K A;  1QF6 A;  2Z3X A;  3AEA B;  2EUC A;  5BYS A;  1QVR A;  1XT9 B;  4G0N B;  3QIJ A;  3FIL B;  1XB2 B;  3L16 A;  1I7H A;  3DA1 A;  2WDR B;  4TMA B;  4LJA A;  4IJF A;  1R2Y A;  3NWL A;  2LI5 A;  2YNM D;  3KWV A;  4LDT B;  1QAQ A;  1L6U A;  3SMS A;  2G8E A;  4IBG A;  1STF E;  4P16 A;  4JI0 M;  3H8C A;  4I81 A;  4FCT A;  3DBH I;  2MR9 A;  1JRO A;  2AQ1 B;  2D3B A;  1A6R A;  2ZTD A;  3FUV A;  4K3C A;  5FK9 C;  3H8H A;  4A9A A;  4EKU A;  1FFV A;  1R2Z A;  1SE3 A;  4TUU A;  3HK0 A;  4LCB A;  4OU7 A;  4TSS A;  3W9C B;  3KFQ A;  2ZNV C;  3TUO A;  4LRT A;  4YTN B;  2YVC A;  3W1S A;  1SBB B;  1LTM A;  3BII D;  1TKY A;  3ML9 A;  5I4D A;  2R4J A;  1V49 A;  3Q8C A;  2DZM A;  3MHS A;  3L2A A;  3IFW B;  3KYC D;  3MJW A;  2RGO A;  3LYY A;  5HG2 A;  2JY6 A;  1YMH E;  4QBB A;  2OUL A;  4JI5 M;  1ZGU B;  4KKJ A;  1UNS A;  4RCO A;  2OO9 A;  2KO3 A;  3ZJV A;  1V33 A;  3PSE B;  1JRU A;  3AEG B;  2IY0 B;  4WJN A;  1NB3 A;  3BCN A;  1XO3 A;  1ZV1 A;  1RFA A;  2HHH M;  1TZ1 A;  4MEM A;  1J19 A;  4RH6 A;  5AUI A;  2MHJ A;  2R6F A;  4L2Y A;  2PE6 B;  1YIW A;  3DWG C;  1HE8 A;  3VXW A;  3CWI A;  3GRR A;  2C5R A;  4FW9 A;  3U6P A;  2KFJ A;  2WXI A;  3GRV A;  2FCN A;  1PPD A;  3IEJ A;  2ATO A;  4A6Q A;  3A1Q A;  3LDZ E;  3AE2 B;  1YE9 A;  4IBJ A;  4HEA 1;  4KT0 F;  2AU1 A;  2XZU A;  3KP1 E;  1NI2 A;  1SE4 A;  2B3T A;  3W1Y A;  1YN4 A;  4W9I A;  1ZUD 2;  3B21 A;  5H8Y E;  1X37 A;  3KSJ A;  2KLG A;  1C1Y B;  1FNV A;  1QMY A;  2MRO B;  5F02 A;  4J3O D;  1ZCM A;  4HRO A;  4WW0 A;  4W5W A;  1BQI A;  2FID A;  2L76 A;  3DPD A;  3KXE C;  1DOI A;  1BGO A;  2NQA A;  3AEC B;  4CYE A;  2L0F A;  4W9F A;  3GLG E;  4RMA A;  3PRZ A;  1P9D U;  4W9J A;  1Y4H A;  1TS2 A;  2PNS A;  2JU6 X;  2K8H A;  2C60 A;  1GLN A;  4AI6 A;  2KMA A;  2AUZ A;  3ZKJ C;  3PVL A;  3SR6 A;  1QAN A;  2FCM A;  2E00 A;  2I1K A;  3I9V 1;  2Z59 B;  2ASQ A;  3MFG A;  1J7A A;  5DPW A;  1JQJ C;  4ACF A;  1VG5 A;  3KVW A;  2OQ4 A;  1FM0 D;  2K3U A;  2N9P C;  2LGX A;  5E6P A;  5KQ8 A;  5IWA M;  4WAF A;  2YR0 A;  1ENF A;  4I05 A;  1WI0 A;  3NY5 A;  4GN1 A;  2CV0 A;  4QHT A;  4CDD B;  1VCB A;  3J2P B;  3Q69 A;  4K3B A;  1BT0 A;  4BKG A;  2RGF A;  2IO3 B;  3S2A A;  1FMA D;  4RKX A;  1WYW B;  3WAO A;  1F1H A;  1EF1 A;  1VZ6 A;  4HWY A;  3OG5 A;  3VH4 B;  4EEW A;  2H88 B;  5LMN M;  3QX1 A;  2AX5 A;  3KW5 B;  2HH5 A;  2WYQ A;  5TR5 A;  1XLP A;  4M9Z A;  2KFK A;  4NAM A;  4KGS A;  3GPU A;  3WAM A;  4FK5 A;  1BVS A;  2O25 A;  2K6B A;  3LB8 C;  3APD A;  2G7Y A;  2AL3 A;  1OTR A;  3AE5 B;  3KVF B;  4HCN B;  3R7R A;  2NBV B;  2Z84 A;  5L95 C;  3CH3 X;  1G8P A;  2IJ0 A;  2UU9 M;  1TKE A;  2WXK A;  3L10 B;  3NVV A;  4GMV A;  4ZYS A;  2XSZ A;  4IBK A;  4BQV A;  2BKR B;  2PBH A;  3PZD A;  1THE A;  1WY8 A;  2K9D A;  2R46 A;  1T5X D;  4BOQ A;  3TWM A;  4XK8 F;  3U30 A;  1CPJ A;  3HU3 A;  4YY3 M;  2N7E A;  2G3Q A;  2W82 A;  1KRH A;  4E74 A;  3T38 A;  2FE8 A;  2L09 A;  3I5J C;  2H89 B;  1WGH A;  1XF5 L;  4IM2 A;  2IPK D;  3LQR A;  3OF8 A;  2FNJ B;  5DFL A;  2XZF A;  1XMQ M;  1CTE A;  2IY1 B;  1QOA A;  3J7B A;  2GNO A;  1WE7 A;  2PVO D;  1SP4 B;  1V6E A;  2B1M A;  2I38 A;  2L7H A;  4KIK A;  4AJW A;  4I07 A;  4LJ7 A;  4YHH M;  4WIP A;  3FAH A;  3BBA A;  4OZC A;  5BMG A;  3CSF A;  1MX0 A;  3HU2 A;  2K39 A;  3LCV B;  4JI1 M;  2M17 A;  4BBN C;  2M5Z A;  4FLH A;  1SG9 A;  4OX9 M;  4LRS A;  1EWC A;  5G2N A;  2MH8 A;  1OIP A;  1HZ6 A;  5IOI A;  3QT4 A;  3ZDM C;  2BT6 A;  3ABV B;  4B9K A;  1GO5 A;  4K0K M;  1U9W A;  3K9O A;  3HHW A;  4BOZ A;  4HLQ A;  4LLG M;  3RCZ A;  4IP3 A;  1F2C A;  3PRP A;  5KQD A;  4GDL B;  1UBQ A;  1QZM A;  2C9O A;  2C99 A;  1L0X B;  3P4Q B;  1UH6 A;  1YOV B;  1HZ5 A;  2GBR A;  1YN3 A;  3RMK C;  1HEZ E;  2BKF A;  2JY7 A;  1FRD A;  2DKL A;  2LWX A;  3P4P B;  4EFO A;  1P3Q U;  5EF4 A;  4LJ4 A;  3E1Z B;  1IN4 A;  1CJE A;  1GOZ A;  3ENE A;  2ZCB A;  3M3J A;  2PKO A;  2MSE D;  3ZVV A;  4PDG A;  2ERC A;  3L25 A;  5FLX S;  1E9M A;  1JR3 D;  3JAM S;  2DZL A;  2C98 A;  3FKE A;  3WHK A;  2IO2 B;  4XWW A;  3UIP B;  1ZQ9 A;  2WDV B;  1M6D A;  1U9Q X;  4W9H A;  3B74 A;  2J7O A;  3ZXV A;  4BFR A;  3M62 B;  1OQR A;  2BNK A;  4AJY B;  1MU5 A;  3K2L A;  3Q2A C;  5JI2 E;  5EXT A;  2JXN A;  3DVN U;  1FCC C;  1SGH A;  2LVP C;  1H4R A;  1AU2 A;  2K47 A;  4NPN A;  2IBI B;  1AAR A;  4RF0 A;  1V86 A;  5TSS A;  1QT9 A;  2KNA A;  2PVG C;  2WX1 A;  3KOY E;  2MBO A;  1L2B A;  3DHI C;  3B9J A;  4O1N A;  1FNN A;  3BVG A;  1YNT E;  2AQ2 B;  2KLC A;  3CF2 A;  2WBF X;  5DNY A;  1VZ8 A;  3SBJ A;  3E4R A;  4NXN M;  3DVG X;  3UIN B;  1PAD A;  1Y56 A;  1Y8G A;  2J53 A;  2MP2 A;  1Q0W B;  1WH3 A;  3FRI A;  2UUA M;  4ZRQ A;  3M99 A;  3RE8 A;  2JZ0 A;  4MGZ E;  3SAV A;  4LJ8 A;  4RGN A;  1NHW C;  4GLS C;  1XXH B;  3QAU A;  3HD3 A;  5BMH A;  4NC6 A;  2KTR A;  1R4M B;  2LJ5 A;  1SJH D;  2UUB M;  3UIO B;  1VLB A;  1IY2 A;  4MGK E;  4JGH B;  4KGT A;  3AEF B;  3U8E A;  2K9X A;  4WJP A;  1E9S A;  2R45 A;  4HRS A;  3UZU A;  2FUH B;  1OEY A;  3EIH A;  3PTF C;  4C7Z A;  2EKF A;  2R65 A;  1KOT A;  4BBN F;  1AEC A;  3IFU A;  2UXC M;  1BUI C;  4LF8 M;  3U60 A;  1UWX A;  4DR4 M;  1CSB B;  2ZVN A;  2L05 A;  3EIE A;  5PAD A;  2M8S A;  3TL4 X;  8CAT A;  2M4N A;  3GOE A;  4M01 A;  4L8R C;  3IT4 B;  2M0A A;  2F5Q A;  2H1R A;  1IYF A;  5DPS A;  1WJN A;  2FS1 A;  4GC5 A;  2V3S A;  3JSV A;  1GB4 A;  4DHZ B;  1IBX A;  4XBO A;  2KWD A;  3AU4 A;  4G50 A;  4IBF A;  2DLB A;  3AED B;  3SYK A;  1KHQ A;  4KSK C;  2CR5 A;  2HJ1 A;  2KXE A;  2GMI C;  2E02 A;  3FRH A;  1PJI A;  3B9P A;  3U6Q A;  3AOE C;  2GB1 A;  3AI5 A;  4R3D A;  1FJG M;  3B7Q A;  4LZJ A;  1VR9 A;  3K8U A;  3APC A;  1RFK A;  1WX7 A;  2F5N A;  2MX2 A;  1NL6 A;  1PJS A;  4LFA M;  4DHZ E;  3S3R A;  2MP2 B;  2KDF B;  1LGR A;  3KW9 A;  5JA7 A;  4JYA M;  1V9J A;  1GVN A;  3VHT C;  3PVS A;  1HQC A;  2AEH A;  2C9W B;  1KM7 A;  4DBG A;  3ERV A;  3BB7 A;  2KC2 A;  2D3C A;  3B1L X;  2EKI A;  4HVB A;  4HXD A;  5ITT A;  2D07 B;  2BTE A;  3RVW A;  5EP4 A;  1C4A A;  2GI9 A;  4NAW A;  5G55 A;  1JWM D;  3NJT A;  5EP3 A;  2OP3 A;  3X0W A;  1POP A;  2JY6 B;  5H37 D;  3Q3O C;  1YAL A;  1GC6 A;  3Q6B A;  4URK A;  1VZ7 A;  1L5P A;  3KSX A;  1NQC A;  2N9X A;  5EQT A;  4F7Z A;  2IO1 B;  1OEY J;  1P7E A;  4US8 A;  1Q3B A;  1TGU A;  3GP1 A;  4BOS A;  3LXF A;  3ZIM A;  4RF1 A;  2QBY A;  3ZTD A;  3GQ5 A;  4MJS A;  1GCB A;  1EM7 A;  5D3D A;  4I6P A;  2BYV E;  4KO8 A;  4W9D A;  1VRA B;  1Z59 A;  1C1K A;  1SXJ B;  5KPT A;  4EIW A;  1FO4 A;  2CP8 A;  1N33 M;  1UGM A;  2ZAM A;  1C3T A;  3DBS A;  1T0Q C;  3GLI B;  2P0R A;  2I2Y A;  2LXA A;  4PS8 A;  4XGI A;  4REZ A;  3AL0 C;  3ONS A;  4AQ7 A;  3VH3 B;  2INP E;  2JWS A;  4AKI A;  2DZO B;  2P5T A;  1F9J A;  4QNR A;  4B7F A;  3AKZ A;  3GLF E;  1I94 M;  2EKE C;  4A5U A;  2N9K A;  3TMP A;  1VJK A;  3PO0 A;  1MDW A;  3JSV B;  2MBB B;  3URY A;  3U6C A;  2X38 A;  3FC4 A;  1Y8R C;  3QAQ A;  1NVM A;  2V3P A;  2JRH A;  5AEK B;  1HR0 M;  2KHW B;  4I8O A;  3UMM A;  1HNX M;  1N32 M;  3R9X B;  5LMU M;  4M8M A;  2C96 A;  3VUX A;  3ZQJ A;  2JF5 A;  2K6D B;  4P1B C;  2V4L A;  1C76 A;  3Q8F A;  5CVM A;  3K92 A;  1R4N I;  4ASW C;  2FBW B;  3ZW3 A;  4I5S A;  1XCQ L;  1DOX A;  3CBK A;  1EIJ A;  4MGI E;  3HJS A;  3UJN A;  1MHH E;  1QQR A;  4AP4 C;  2JT4 B;  2JY8 A;  3P4R B;  3U6E A;  4FIP A;  2KNV A;  4DV1 M;  1OJL A;  2LRW A;  4BOU A;  3ZNI D;  5BO4 B;  3LW5 F;  2N9E B;  1F2R I;  1CUK A;  1N5X A;  1WMH B;  2JNH A;  1W5S A;  3PXG A;  1TGZ B;  2AYO B;  5EE0 A;  4FBJ B;  3KWL A;  2G6D A;  4HXD B;  1DGB A;  4JI7 M;  1GMY A;  1WR6 E;  2WP9 B;  4JLC A;  1I4Q A;  4G4Q A;  4NQL B;  4LJO B;  1YJJ A;  5EE3 A;  2KK8 A;  4DDI D;  4ZUX U;  5C1B A;  3R8B A;  3NZU A;  4LJP B;  1E32 A;  1PM5 A;  2O6V B;  2BYE A;  3I3T B;  4M02 A;  2JYE A;  2JZ3 B;  3VFK A;  5J2R A;  2VDB B;  3P5W A;  1JAL A;  3AI8 A;  4LCD E;  3HHZ A;  2WWZ A;  3A9J A;  3RFZ B;  5FR3 A;  1GC7 A;  2NPT B;  3PT2 B;  4E71 A;  1VEK A;  2CS4 A;  2Z4R A;  1XHB A;  1K53 A;  3KOZ E;  3FIL A;  3RVX A;  4PDI A;  3L08 A;  2CE7 A;  1Q6K A;  3I06 A;  4DR7 M;  4NY0 A;  4WWP A;  3TEW A;  4CDF B;  2QPA A;  2XFT A;  5KPZ A;  2YEP B;  3JW0 X;  5D7G A;  3ZDT A;  2EEL A;  3BPM A;  2HWK A;  2WXQ A;  3KYD D;  2N1V A;  1IP9 A;  1QOF A;  2W55 A;  3DVN V;  1WMH A;  3NBI A;  1NY6 A;  4LFB M;  2LWP A;  3J81 S;  4II7 A;  4PYZ A;  1GJZ A;  2YJ2 A;  4FWH A;  3C9E A;  3Q8B A;  4FJC A;  1JWU D;  1T6O A;  5IT9 S;  2MJ3 A;  1E7V A;  2M56 B;  4DQO C;  2L2D A;  2WXN A;  2O01 F;  1WF9 A;  2L8J A;  3V6C B;  3IMA A;  1NB5 A;  1TKG A;  2XFS A;  1SF0 A;  1R5L A;  1UM8 A;  3OVX A;  3U52 E;  2IO0 B;  5H92 C;  3GZN I;  3LXS A;  4WQM A;  2LVA A;  2ZPN A;  3PBH A;  2WSE F;  3NS1 A;  1FCL A;  1FRR A;  2LJI A;  2DNA A;  4Q2J A;  4FXC A;  2E3T A;  1R7S A;  3SYL A;  4GRI A;  3RI7 C;  2VF8 A;  2CUZ A;  1G3I A;  2XGN A;  2X8X X;  1KLG D;  3EFU A;  1YK7 A;  1K3B B;  4CGY B;  2XLJ A;  1TH4 A;  4MAC A;  4ZPX A;  1BML C;  2WXP A;  4CDC B;  1GUA B;  1WHC A;  5E26 A;  3U6M A;  4GXB A;  4QOS A;  3PV1 A;  4WH4 A;  2F1G A;  2MA9 B;  2N7D A;  2CHV A;  2JWZ A;  2Y5B A;  1D2N A;  4J6I A;  2KWC A;  3B79 A;  2Y0Q A;  2IDY A;  3SAU A;  4C4V A;  3U7Z A;  3RGP A;  1T3Q A;  2IPP B;  5KHQ A;  2OOA A;  4HJG E;  4S17 A;  5JXV A;  3BIN A;  3IOQ A;  1GG3 A;  3VTU A;  3NZS A;  4L78 A;  2IGD A;  2L6O A;  2JVC A;  2N35 A;  1V80 A;  3EGR A;  2FT2 A;  4PP2 E;  1GAB A;  3M7G A;  3EUB 2;  4MI7 A;  5E6O A;  3L4P A;  3H8B A;  2MJE A;  3GO8 A;  1GNU A;  2UXB M;  1SSN A;  2KZR A;  4DDG D;  3LCU A;  3W0F A;  5C18 A;  3W0L B;  2LVP A;  3SDL C;  4DHJ D;  1EWP A;  3BWK A;  2KMC A;  3MP2 A;  3GLH E;  3LQQ A;  3KUZ A;  3H6S A;  4TKN A;  1L1Z A;  4YYR A;  2UUC M;  2ARY A;  2WXO A;  1E7U A;  2GFO A;  1R4G A;  2R9F A;  2QJL A;  1NEK B;  1ZKH A;  4A3V B;  1J5E M;  3RNC C;  3TEX A;  2XEP A;  3NHE A;  3T8M A;  1M4V A;  1TZO A;  3NVW A;  4OEL A;  4DV4 M;  1WE6 A;  1G6J A;  2XU1 A;  3SD5 A;  4LDT D;  2QCU A;  1XLO A;  3BVZ A;  3VUY A;  3PW3 A;  2ZEQ A;  2LVQ A;  4LY6 A;  5DPT A;  3PNV A;  4DK5 A;  1EWM A;  4ZRJ A;  4DR2 M;  3APF A;  4ANV A;  3WIM A;  1QZE A;  2KN5 A;  3WCQ A;  4NJ7 A;  2WU5 B;  5IZ7 D;  3H7S A;  5EXP A;  4S0R A;  2K1F A;  3GQ3 A;  3HM6 X;  2QP9 X;  3NUH B;  4MM3 A;  3SAT A;  3PHX A;  3R8F A;  1F2B A;  2BDZ A;  2PMV A;  4W4U A;  1V5T A;  2RGH A;  3D8B A;  3GLF A;  1N5W A;  2INC C;  2LXE A;  1OAI A;  4M00 A;  2YJ8 A;  2WXJ A;  3SAW A;  4HK2 A;  1MEM A;  1AYV A;  1Z5A A;  3K9P A;  2V9H A;  3BPF A;  3U7D A;  3OIS A;  3RVV A;  1FXT B;  3TWL A;  2DWL A;  3DZD A;  4FHK A;  5J18 A;  2PIA A;  4YSY B;  2OJW A;  2KAJ A;  4NQK E;  1SE2 A;  1ZDX A;  1IN5 A;  3PS6 A;  3B2G A;  4BB9 A;  4NNJ B;  5FTK A;  1YK8 A;  4QRV A;  4XZX A;  1MG8 A;  5JH3 A;  3ZGZ A;  3WXG A;  2FQ9 A;  4XGA B;  5HFY A;  1E0Z A;  1IBK M;  1ME4 A;  1TT5 B;  4I4L A;  2QCZ A;  1L7Y A;  2RSU A;  5ITX E;  1PPO A;  5IKC M;  3PDF A;  2FCS A;  1D5M C;  4DR1 M;  4FA6 A;  3KSE A;  1AUA A;  3W68 A;  1CQV A;  4IDI A;  1PYW D;  3A1Q B;  1XXH A;  4ITQ A;  3GPX A;  4RGO S;  2DWN A;  1WGR A;  4X6I A;  3HHI A;  2KHH A;  1WX9 A;  1A5R A;  5HHD G;  2ICI A;  2KTF A;  5DCN A;  3KOX E;  3ZNH A;  1IPG A;  1YSY A;  4MT5 A;  2D3G A;  1D5Z C;  3ZTC A;  4IKG A;  3I51 A;  3CH2 X;  3GLF B;  3V6E A;  3CF0 A;  4ANU A;  2KYW A;  2G1E A;  1UBI A;  1NHG C;  4DR3 M;  3TNX A;  3AOG A;  1KLU D;  4IUM B;  4MM3 B;  4II3 B;  2J7Q C;  3U8Z A;  3R2T A;  3ZQ4 A;  3N9Y C;  1J0G A;  4YTP B;  1BP4 A;  2NQG A;  2QEN A;  2R44 A;  1UWM A;  3VAW A;  1EWY C;  1V5O A;  3A98 B;  2A4Z A;  2AWT A;  4GIP A;  4YTM B;  5E6J A;  1OFF A;  1TU6 A;  2KAC A;  3U6D A;  1TL9 A;  2BWE A;  3BK1 A;  1OFI A;  1J09 A;  1CS8 A;  1TTE A;  2KQ7 A;  1UKF A;  2GOW A;  2G45 B;  2ZAN A;  1QOB A;  2R61 A;  4YSZ B;  1NV9 A;  2UWQ A;  4I04 A;  2G4S A;  1SE9 A;  4AKH A;  2C7H A;  2KDL A;  4R71 A;  1T0Y A;  2L4E A;  2KVR A;  1XEE A;  4BKS A;  3IV2 A;  2VH2 A;  3CMM B;  3WHL A;  3DBL B;  3VR8 B;  3LMM A;  1WXS A;  2GHU A;  2MH7 A;  3SHF A;  7PCK A;  1J7C A;  2HWJ A;  3HVZ A;  1DKI A;  2R4E A;  3DDC B;  3ZC7 B;  2JA2 A;  2BF8 B;  4F8C B;  2VII A;  4ZYN A;  1AU0 A;  4K7W A;  3DHH C;  2W3R A;  2FOI C;  3HJQ A;  2DZN B;  3VFD A;  5BYQ A;  5FR6 A;  3RT3 B;  5ITY A;  1C4C A;  1GPX A;  2EJS A;  4G4O A;  4YYU A;  3I57 A;  4X64 M;  2BTW A;  1E8X A;  1WRD B;  1LFD A;  1NSF A;  1AYW A;  2IYD B;  3A33 B;  1VQ1 A;  2Z8Y M;  3BYT B;  3N32 A;  2YQZ A;  3ZO5 B;  2WS3 B;  1WJ7 A;  1WM3 A;  3N4C A;  2LHD A;  3IHP C;  3GLH A;  2L32 A;  4IBE A;  4JE3 B;  4TUW A;  3GLI E;  5C1Z A;  1CB5 A;  4ARC A;  4QH6 A;  1SEB D;  2Y5B B;  4D8E A;  3RUI B;  1XD3 B;  1L8Q A;  3C0R A;  3OVZ A;  3Q14 C;  4C80 A;  2FFJ A;  2HTH A;  3RUL A;  3IXS A;  3NVZ A;  3JYU A;  3M0E A;  3KUD B;  3P42 A;  5EDS A;  4AOF A;  4XUI A;  3F75 A;  2DCC A;  2JZZ A;  1MHW A;  1B1Z A;  4K81 A;  3GLI A;  4LFC M;  4XDD A;  3MMP A;  4LF7 M;  1QDT A;  4K1R B;  2WQY B;  2CFO A;  4DHJ B;  2KD0 A;  4HPM B;  1Q1O A;  3OWE B;  2CIO A;  1C4P A;  2QMT A;  3RNF C;  5CHT A;  5EP2 A;  3N30 A;  3KW6 A;  1RRB A;  2X4A A;  3H1U A;  1PUT A;  3DFZ A;  2MGW A;  3AV8 A;  3L27 A;  4DXA B;  2CU3 A;  1MHX A;  1WXV A;  2O2V A;  2BQQ A;  3MP9 A;  4GH9 A;  2RRU A;  1ORY B;  3AE8 B;  4HJK A;  4W9E A;  2BW2 A;  2V6Z M;  1QUT A;  2V1U A;  2FUD A;  2XEW A;  1PVJ A;  2R9N A;  1HT2 E;  1PFD A;  5BMI A;  4DUZ M;  1TY2 A;  1WGD A;  3W2D A;  5CHF A;  2GBJ A;  3QCA A;  1NYQ A;  1ISN A;  1JRP A;  2JZ1 A;  4DBG B;  3J27 B;  4DUY M;  2V0G A;  2DCD A;  1KF6 B;  5E6N A;  3T6P A;  3NRZ A;  2K8B A;  4GSW A;  3PHW A;  4DV7 M;  1TY0 A;  3P63 A;  2D10 A;  3AE6 B;  1HNW M;  3IBE A;  4A90 A;  1D3Z A;  2L00 B;  3VTV A;  1I42 A;  2KAN A;  2E5L M;  1WXQ A;  1ZAE A;  3RGS A;  1WGG A;  2UXD M;  5K16 A;  4JL9 A;  5J17 A;  3IG5 A;  2DWZ B;  1KSF X;  3UF8 A;  3HHX A;  3ZUA A;  3BWU D;  2CHQ A;  1WIV A;  1FXI A;  4XZ4 A;  2Z7J A;  2HE7 A;  4KV2 A;  1YVB A;  2X8A A;  1S1Q B;  2JXT A;  1LM8 B;  3PPA A;  3V3X A;  5CHW A;  2BU3 A;  4IIW A;  4OVZ A;  4W5B A;  1XC8 A;  4CIS A;  2LFI A;  1V92 A;  3V05 A;  2J5Y A;  1F0Z A;  5AZG A;  4G4R A;  2QSD A;  1UEL A;  4MZO A;  3GP7 A;  1U9X A;  4AKG A;  2E03 A;  1D0M A;  3MC0 B;  2IZV B;  5EGW A;  1YJI A;  3GE3 C;  4K7C A;  3E9S A;  4HPP A;  1EFU B;  2MJ5 B;  3BVM A;  3VUW A;  2F5S A;  3TWK A;  3AUL A;  1TIF A;  1GL6 A;  2M60 A;  1J7B A;  3TL5 A;  4L6V 6;  3A9K A;  4DWF A;  4ARI A;  3TEY A;  1AU4 A;  3KX1 A;  1IN6 A;  2LAS A;  4P1C C;  1E90 A;  3KH0 A;  3C19 A;  2MCN B;  1D0K A;  4LNO A;  3HRD D;  1EF7 A;  4WWO A;  2BJV A;  2LMC A;  3D6S A;  1KYI A;  1DO0 A;  2AHM A;  2XF3 A;  3TMP B;  4M9S A;  2PJH A;  3PHW B;  3L13 A;  1SXJ A;  3FTF A;  2LVO A;  3HHY A;  3GCB A;  3VDU A;  3LJ3 A;  1GKI A;  4IC7 B;  2N1W A;  3SEB A;  2R62 A;  4AG5 A;  3MHH A;  3AB5 A;  2REX A;  4BVU C;  1PGY A;  3AM9 A;  2D3A A;  1WM2 A;  3P5V A;  1TF0 B;  2LBC A;  4JI8 M;  3N3K A;  5CTR C;  2UZJ A;  5BYR A;  3PNY A;  2PW9 A;  3U5Z A;  1C7Y A;  1IXS B;  1NEN B;  4NSR A;  2KQS A;  2WSC F;  3D8L A;  4FCW A;  2MRP A;  4DR6 M;  3ZNG C;  5EZS A;  2K0P A;  2LHC A;  2KZS A;  1NDD A;  4DV5 M;  1HJP A;  4G11 A;  5EJC A;  3SFD B;  1WSP A;  2Q2E B;  3LVV A;  2QIE B;  4N59 A;  3R3M A;  1W5T A;  2LHG A;  2C5L C;  1CV8 A;  4RGM A;  1C78 A;  2L52 A;  2LUM A;  3N3K B;  4YXD B;  5DPR A;  3KLS X;  1G4A E;  3A4R A;  2XU5 A;  3L29 A;  1S3S A;  4LTU A;  3KQ4 A;  3QWZ B;  2NTS A;  1AN8 A;  2GLS A;  3Q3J A;  1CK1 A;  3SFZ A;  2IGH A;  2BYT A;  4KKI A;  2FH0 A;  3AEE B;  1V2Y A;  2CV1 A;  1NNU C;  1XCT L;  1UD7 A;  1QAO A;  3TCA A;  1DGJ A;  2H5X A;  3TPZ A;  3W30 A;  2L1A A;  1WWT A;  8PCH A;  3RN9 C;  3U2S C;  3AE9 B;  3U6O A;  1C79 A;  3T3O A;  1WXM A;  4H2A A;  1YQB A;  3RZF A;  3PRP B;  1V34 A;  1E5W A;  3UI3 A;  1CQD A;  1JB0 F;  4IBD A;  5KPR A;  1HQR D;  3I63 C;  1QLB B;  3SU8 X;  2MW5 A;  2DCB A;  1QXP A;  1LQB A;  2JSV X;  4BLC A;  4AXM A;  1L4Z B;  1YUB A;  3QJZ A;  2LH0 A;  1YLA A;  2CHG A;  1R6B X;  5GKN A;  1QIL A;  2N9L A;  3FYD A;  2PRE A;  4ICV A;  4M0W B;  1WR1 A;  5CHV C;  2GQF A;  2KMM A;  2WDT B;  1DGG A;  3FD9 A;  2QBY B;  3RNA C;  2FO5 A;  1Z5C A;  1E6E B;  2K5P A;  3ZLZ A;  2QQ8 A;  1E94 E;  2NBU A;  3MC8 A;  4IM0 A;  2WX0 A;  4CHK A;  1VEG A;  5IP4 D;  2BPS A;  4CJ6 A;  4QHS A;  3DOA A;  4ZTB A;  2AYN A;  1B9R A;  1K82 A;  1IXZ A;  2ZAO A;  4DV6 M;  1OAO C;  5D2M B;  1KFU L;  4RGT A;  3HHM A;  2AGA A;  3BC3 A;  4NOO B;  4USA A;  3KS8 A;  4B95 A;  3U60 B;  4WP2 A;  2NR2 A;  2KJH B;  4NJ6 A;  2C7M B;  2DI0 A;  1U9V A;  3ECI A;  4PD2 A;  4BS6 A;  3QSD A;  1FD6 A;  2IGG A;  3IUT A;  1Z5B A;  2VRR B;  2Y6E A;  4QNM A;  4FCV A;  3VDZ A;  4DV0 M;  2WXH A;  4IWO A;  4ZDV A;  3CGW A;  2XU3 A;  5JHA A;  1JW9 D;  1IY1 A;  2D2Q A;  3F92 A;  4N6E B;  1KHP A;  1NJG A;  5FTN A;  2DC9 A;  2NS5 A;  3PNR A;  2OPF A;  1UGJ A;  2J4X A;  3HVD A;  2CRU A;  2WXG A;  2DEN A;  3RNB C;  3MK6 A;  2J7Q A;  3IT6 B;  2DWM A;  4GUA A;  3C3D A;  1P98 A;  4N9F 4;  1V8C A;  3RNV A;  1AW7 A;  2ACZ B;  4E3C A;  4QRX A;  1DGH B;  1STE A;  2OED A;  2JY5 A;  3DBL I;  4GDK A;  4L23 A;  3WXF A;  3SFE B;  4XC2 A;  1IM2 A;  3PGE A;  5JHB A;  3MC9 A;  1T3T A;  1WGN A;  1MFW A;  2R2O A;  4YVA A;  1ET9 A;  2DZI A;  3ALB A;  4B0M A;  1QOL A;  2DC6 A;  3JVZ X;  2OOB A;  1GAQ B;  3QA8 A;  1YN5 A;  1NJF A;  1ROE A;  1SXJ D;  4DXF A;  1QUS A;  1IBL M;  2LGI A;  1V97 A;  4HDQ A;  5IA7 A;  3ZCB B;  3U6S A;  2K8C A;  3TBL D;  1IXR C;  4GHL A;  4YV8 A;  4WJQ A;  1TBE A;  3L54 A;  4NXM M;  3DBH B;  2JQF R;  4D2K A;  1OKS A;  2R9O A;  3Q8G A;  3PLU A;  3IG8 A;  2QHO B;  2X49 A;  2R9M A;  1OIZ A;  1X1M A;  3C9P A;  3PRM A;  4YT0 B;  5LNK 1;  4JQW C;  1MG4 A;  1L4D B;  4GU2 A;  1A5T A;  4OVZ B;  4D82 A;  2LVN C;  4ANX A;  1YX6 B;  4BOZ B;  2DJF B;  1VEJ A;  4Z8X A;  3V76 A;  1A70 A;  4ICU A;  1ZIV A;  3HKP A;  3OQC A;  4X6J A;  5IAA C;  2LHE A;  2OZ2 A;  2DNF A;  3AJI B;  3HY5 A;  4L16 A;  1K3X A;  1E8W A;  1DV0 A;  1PE6 A;  1QDQ A;  3AH7 A;  1MJD A;  4AG6 A;  1IFY A;  2JRI A;  1KH0 A;  2BS4 B;  4AQY M;  2DYM A;  2D7G A;  2ONQ A;  4YSX B;  1XKG A;  2V4I B;  1Q3C A;  2QZ4 A;  2NCN A;  4GEW A;  4G4N A;  3M95 A;  1TS4 A;  3VR9 B;  1HUC B;  3ZRF A;  1IBX B;  3L0W B;  4KLB A;  3L17 A;  4TQ1 A;  4XYC A;  2RMM A;  3HIZ A;  3N1X C;  1T6B X;  4LF5 M;  1BY8 A;  3PZ8 A;  1XLQ A;  2J7Q B;  2PE9 A;  2KT7 A;  6PAD A;  3OF9 A;  3VRA B;  4A8X C;  4RKU F;  4PYU A;  1MJG M;  1WZ0 A;  2BBC A;  5ITQ A;  1XLN A;  1QDR A;  2DAG A;  4EZK A;  1MN3 A;  1TS5 A;  1VDV A;  4N79 A;  3Q8A A;  2HTM E;  4W5C A;  3AXC A;  4OZA A;  3QAR A;  4A55 A;  1FH0 A;  1MEG A;  1D5X C;  2VQE M;  2LXC A;  1PGX A;  4L1B A;  2APL A;  2Z4S A;  3RPF C;  3CBJ A;  1AIP C;  2Y5P A;  3BOS A;  4FJV B;  1TYG B;  5IRE B;  2BWE S;  4GGQ A;  1VDL A;  2O2V B;  1L6V A;  2L3Z A;  4DXG A;  5L83 A;  4DV3 M;  4DR5 M;  2B1N A;  3J9C A;  2QSF X;  1T0R C;  2QEJ C;  4CQN A;  1P7F A;  2FRA A;  2PTL A;  4MSQ B;  1H8C A;  2LEK A;  3KUC B;  3FYC A;  2R18 A;  4D81 A;  3N20 C;  5BPV A;  4KDI C;  1EU3 A;  3A4S C;  3SMP A;  3R66 C;  3FE3 A;  3FUU A;  1N6Z A;  2J0J A;  4TV3 A;  1NPZ A;  4FJY A;  1PCI A;  4GHA A;  1SIJ A;  2DAK A;  2JUO A;  2SAK A;  2XK5 B;  2MEK A;  2NQD B;  4G54 A;  4X66 M;  2ZNV B;  1SJE D;  3CTW B;  2MLB A;  3L28 A;  3MHS D;  3QYE A;  2F5P A;  3RZW C;  3H7D A;  2PLP A;  2QIL A;  2J52 A;  2QHO A;  2HL7 A;  3H7P A;  1TJE A;  4ITK A;  4WJO A;  3K9M A;  2MBE A;  1ZP0 B;  1I4H A;  2CKH B;  5IN7 A;  1QYR A;  2K0B X;  4HDO A;  2Z0D B;  3KKU A;  3V60 A;  5D6J B;  3NZ3 A;  1OQY A;  1G59 A;  1EU4 A;  3E21 A;  5EXS A;  2Y21 A;  3EEC A;  4OVV A;  3GE8 C;  3RFW A;  5DYG A;  4KGR A;  2VZK B;  2BS3 B;  4OW0 A;  4PS3 A;  2LNH C;  3J80 S;  2HAK A;  2DAJ A;  2W9N A;  4ZRP A;  3HJ8 A;  3HHA A;  4NL4 H;  3P4S B;  2EO2 A;  4WUR A;  3MTV A;  2O5R A;  4M0W A;  4D8I A;  1ZXH A;  2RDH A;  1WJU A;  2ON8 A;  4MGY E;  3Q8E A;  4NRV A;  4LG2 A;  3FKY A;  3EA6 A;  2MQJ A;  2WSF F;  1EUV B;  1PGB A;  2UYZ B;  1HTQ A;  2G8L A;  3T1H M;  3IAS 1;  5A2Q S;  3O13 A;  4KZC A;  4KLN A;  3PRE A;  4N58 A;  2PEA A;  2J7N A;  1FPY A;  2DBY A;  3O0U A;  4OEM A;  3H4J A;  1N62 A;  2A5U A;  2JPH A;  1YQ4 B;  2DAE A;  5GXG B;  1PIP A;  3BBZ A;  5CVN B;  4KVG B;  4B7G A;  4WQO B;  1N63 A;  3VDP A;  4MJS B;  1EE8 A;  1PPN A;  2Y5C A;  2KKC A;  2LD9 A;  3Q8X A;  1N34 M;  1NV8 A;  2AUX A;  2I1J A;  4B7H A;  1IN7 A;  4Y28 F;  1IXS A;  1P1A A;  4G3X B;  3HM3 A;  4A20 A;  3E46 A;  1F4I A;  4ZHP A;  4K7S A;  2NVU I;  3NHE B;  2NQI A;  1QQW A;  1JQ4 A;  2DAI A;  1JWB D;  3FUT A;  3GLG B;  2BDL A;  4BPV A;  1UF0 A;  2LGY A;  3HWN A;  1OGW A;  4GKJ M;  3MJ5 A;  3VK7 A;  4GIT A;  2INN E;  2CJN A;  3A9K B;  1MS6 A;  1WGY A;  1SB3 C;  2FYE A;  3VKH A;  1Z6T A;  2L0T A;  1DEU A;  3H9D A;  2JWU A;  4L4U A;  3DHG C;  4EZJ A;  2EMT A;  2R2Q A;  1HA5 A;  1EWO A;  2DVW B;  4DV2 M;  4MSM B;  4XX5 A;  1L2C A;  2J0K A;  4B6W A;  4WAA A;  1XMO M;  3SAR A;  1I4P A;  3U6L A;  1GEC E;  3B7Z A;  2DYB A;  4HEO A;  3VLF B;  1ZMW A;  3RNE C;  2FIF A;  3J7A S;  3ZXR A;  3UQB A;  4IBB A;  3A45 A;  1LV7 A;  4C4V B;  4HKZ E;  4LF9 M;  4LJ5 A;  1X9Y A;  1RYJ A;  3FTE A;  2AL6 A;  2JRI B;  1AIM A;  3N3G A;  4R7G A;  1NVI D;  4MGH A;  3QK0 A;  2N7J A;  1WJ4 A;  4IBI A;  1V1P B;  2HHN A;  1I4G A;  1AYF A;  4X65 M;  1GLO A;  1N75 A;  1PJQ A;  3DBR B;  1KLV A;  2BS2 B;  1ZMU A;  2KDI A;  2M19 A;  1UFZ A;  2BJW A;  4WWM A;  3LFY A;  2KA6 B;  1SXJ C;  1TH2 A;  2LVO C;  2ZW1 A;  3KWZ A;  5JZE B;  4HL4 A;  5HI1 A;  4K7U A;  3HX3 A;  4ANR A;  1F29 A;  1CVZ A;  3EC8 A;  1ICF A;  2KW0 A;  2G9H D;  2F4V M;  3P5U A;  1I4X A;  4HWI B;  2KNZ A;  2CJO A;  1FFU A;  3AE4 B;  1GL7 A;  4MDK E;  3N1Z C;  2UU7 A;  5ITR A;  3BOW A;  3MOR A;  4N4Z A;  1L0Y B;  2AQ3 B;  3PSE A;  3BZD B;  1IN8 A;  3R2I A;  4IM3 A;  2MJD A;  2F7D A;  2VF7 A;  1V1O A;  2JP7 A;  2NBW B;  3MHZ A;  3AE3 B;  2R0I A;  3Q3N C;  3QJ3 A;  3JR5 A;  2NMQ A;  2CB5 A;  1HT1 E;  4OZB A;  1FXA A;  3SC3 A;  2DZJ A;  3AN1 A;  3GRU A;  5EE9 A;  3T15 A;  1MPE A;  1DGF A;  2EA0 A;  4X62 M;  1R7R A;  3MHV C;  4JI3 M;  1D6E C;  1N36 M;  3UGB B;  4FD2 A;  1RAX A;  3CF6 E;  1U5I A;  2KDB A;  1VJV A;  3TRK A;  1WFY A;  3B0A A;  4PCZ A;  4LJ9 A;  2O6V A;  1SNK A;  1K51 A;  4HPL B;  3R7Q A;  2C7N B;  4XR7 A;  3C3E A;  1XXG A;  2C9C A;  4BOP A;  2Z8L A;  1KJT A;  2R9C A;  1E8Z A;  2D5G A;  2ZBK B;  2VQF M;  2HD5 B;  3BY4 A;  4TQ0 A;  4JIO U;  2K25 A;  4CDE B;  3VRB B;  2NPT A;  3PT2 A;  2BWB A;  4JX1 C;  1ITO A;  3A42 A;  3DQV A;  3WA0 A;  2WNM A;  2QDF A;  4P17 A;  1E10 A;  4KOD A;  2O6X A;  4LNI A;  1KFX L;  5LLI A;  2FRQ A;  4PP1 A;  4F1I A;  3CST A;  4WWN A;  1CJL A;  1PGA A;  4LNN A;  1TH3 A;  5EXX A;  5FPW A;  2WLB A;  5F3W A;  2KEB A;  3VK8 A;  3HU1 A;  1HQY E;  1PQS A;  3F5V A;  1ZMV A;  2KNB A;  1ZOY B;  3ML8 A;  3C0R B;  4JI4 M;  1TDH A;  7CAT A;  1GJS A;  2DHZ A;  2B76 B;  1QAM A;  3IHP A;  4C56 C;  4XE0 A;  2KXJ A;  1F2R C;  2BYF A;  2K22 A;  3OAW A;  1ME3 A;  2LVQ D;  3ILK A;  1XQQ A;  2OJR A;  3I4V A;  1NO1 A;  2W3S A;  2DYO A;  3PLV A;  3A9J B;  2FTD A;  1U4A A;  2HCB A;  2ZJD A;  5D3I B;  1OFH A;  3ETR A;  2XH9 A;  2LTU A;  2I7N A;  4G3O A;  3DBR I;  1HTO A;  4S12 A;  1D0L A;  1EWL A;  3AEB B;  1SXT A;  3ZH9 B;  2YLM A;  4L15 A;  2KOX A;  2P7U A;  3EFC A;  2XNA C;  3NBX X;  2WU2 B; 
#chains in the Genus database with same CATH homology
 3C8Y A;  2I7P A;  3GLH B;  3JR4 A;  4B0E A;  3U61 A;  3P1M A;  3FTD A;  1I4R A;  4NSO B;  1PJJ A;  4NRW A;  5EZQ A;  2KRU A;  1HXY D;  4IJE A;  5FSW A;  3GRY A;  1ET6 A;  3T3N A;  4FWD A;  4KX6 B;  3SAS A;  1NNJ A;  3LVW A;  4B3T M;  1UUP A;  2DHR A;  1WRI A;  1C77 A;  1N60 A;  1HNZ M;  5MPO A;  1L2D A;  3C58 A;  4CHT B;  2KQ4 X;  5FTJ A;  3O65 A;  3T1Y M;  4M0D A;  4KHP M;  2GRI A;  1E7P B;  2W54 A;  3THG A;  1DO2 A;  4LZZ A;  1Q39 A;  5AUK A;  3KP0 E;  1TDZ A;  1JWS D;  4NAW B;  1IY0 A;  1N77 A;  4JI2 M;  3A46 A;  3IAM 1;  5EP1 A;  1F77 A;  1N78 A;  1JR3 A;  4MH8 A;  1CZP A;  3AFH A;  4B3M M;  4LGY A;  4BBA A;  2VZK D;  1K52 A;  2E6X A;  4M9X A;  2JTC A;  3K8Z A;  4EE2 A;  1MI0 A;  2JZP A;  3VKG A;  3KOW E;  3GB1 A;  2HDE A;  5FKA C;  1I4W A;  4JV5 M;  2Y3A A;  2Q5W D;  2A5Y B;  2FNA A;  3UK6 A;  4NZL B;  2DOS A;  2WXM A;  2ZW0 A;  1NY5 A;  3TE6 A;  2KRK A;  3B2F A;  2CEA A;  4GKK M;  1YZB A;  3KS4 A;  2WXL A;  1V1P A;  5JI3 E;  4AZF A;  4QOZ C;  1BXT A;  5DYI A;  3PFI A;  3U4E G;  1ZE3 D;  4GMQ A;  2KZU A;  3GPY A;  2Y20 A;  1VDD A;  5ITU A;  2WXF A;  1NYR A;  2TSS A;  3W5V B;  5BR8 M;  2XSZ D;  1K50 A;  1E9R A;  1JML A;  4UDU C;  4RNA A;  2RDG A;  4OHJ A;  4ZHO A;  1ZXI A;  4JPS A;  1FEH A;  1QOG A;  4JWS C;  5EE1 A;  2JYT A;  2G5G X;  2NTT A;  4IUM A;  1L1T A;  4XWT A;  2L83 A;  3KDS E;  4JN6 A;  2JX5 A;  2BB5 A;  1IBM M;  1J7K A;  3AE1 B;  3KFU G;  4LJ6 A;  4XDC A;  1ZPS A;  3QWL A;  4B08 A;  1ACC A;  3PZ7 A;  5C3J B;  4YWG G;  3HWS A;  3GQ4 A;  1L0V B;  5FTL A;  3U61 B;  1LO5 D;  3TSS A;  1G41 A;  4P6V F;  3SHG B;  1DYQ A;  4B3S M;  3DWM A;  3OTO M;  1IQP A;  2DWQ A;  4NJC A;  2YFQ A;  4D80 A;  1WYG A;  1NI3 A;  2J42 A;  4HKQ A;  2CV2 A;  3E56 A;  1ESF A;  4JXJ A;  2NQ8 C;  2RKO A;  4IBC A;  4D8B A;  2RPV A;  3PHU A;  1XWI A;  3W5U B;  5T8I A;  1FNU A;  2L7I A;  1PDX A;  3L26 A;  1DOY A;  3W31 A;  1D4B A;  3GPP A;  2ZM6 M;  3H4M A;  1DGH A;  3U5Z B;  3HUI A;  3FUX A;  3VQI A;  2HKJ A;  1IUE A;  3M6A A;  2JQR B;  1ZDV A;  5ITX A;  3FTC A;  3UGJ A;  3AMZ A;  2V3N A;  2D7E A;  4AW4 A;  1KTK A;  1C9F A;  2WXR A;  3I4Y A;  2WDQ B;  1OQQ A;  1FNW A;  2V1C A;  4LGM A;  2YEP F;  4MH0 E;  1XNQ M;  3FUW A;  1MVK A;  4GDK B;  5G5G A;  3AE7 B;  2KN4 A;  4JWU C;  3ZYY X;  4LF6 M;  2XN9 C;  2DXI A;  3GLG A;  2FUG 1;  1IGD A;  1GB1 A;  2N0S B;  2SEB D;  1SXJ E;  4RFB A;  4B3R M;  4LK0 M;  2Y0T A;  3AOE A;  2BB6 A;  2KDM A;  3HGI A;  1N61 A;  1QKZ A;  5KO3 A;  5C2T B;  4US9 A;  3BK2 A;  4PT5 A;  1AWD A;  4GC9 A;  3TEZ A;  3ZJT A;  4IOI E;  4Z6Y A;  1KFV A;  4FWG A;  2F5O A;  1RM6 C;  4C7Y A;  3CIR B;  1IGC A;  3GS2 A;  1WGK A;  1JCK B;  1TS3 A;  1KFY B;  5G5H A;  3NVY A;  3BYY B;  1XNR M;  3AV0 A;  1H6U A;  4G6Z A;  2D7H A;  5FTM A;  3ZJU A;  5JZE A;  1Q10 A;  1YQ3 B;  4ZOH C;  2BTW B;  1JWA D;  2OHF A;  4FVM A;  4JI6 M;  1K3W A;  4AS1 A;  4LF4 M;  4MB7 A;  3TQS A;  3K1J A;  1FIQ A;  1RWS A;  1QF6 A;  2Z3X A;  3AEA B;  2EUC A;  5BYS A;  1QVR A;  3FIL B;  1I7H A;  3DA1 A;  2WDR B;  4TMA B;  4LJA A;  4IJF A;  1R2Y A;  3NWL A;  3KWV A;  2YNM D;  1QAQ A;  1L6U A;  3SMS A;  4IBG A;  4P16 A;  4JI0 M;  4I81 A;  4FCT A;  1JRO A;  2AQ1 B;  3FUV A;  5FK9 C;  3H8H A;  4A9A A;  1FFV A;  1R2Z A;  1SE3 A;  4LCB A;  4OU7 A;  4TSS A;  3W9C B;  3TUO A;  4LRT A;  4YTN B;  3W1S A;  1SBB B;  5I4D A;  3BII D;  1TKY A;  2R4J A;  3Q8C A;  3L2A A;  2RGO A;  3LYY A;  5HG2 A;  1YMH E;  4JI5 M;  4KKJ A;  1UNS A;  4RCO A;  3ZJV A;  3AEG B;  1XO3 A;  2HHH M;  4RH6 A;  5AUI A;  4L2Y A;  3DWG C;  3CWI A;  3GRR A;  2C5R A;  4FW9 A;  3U6P A;  2WXI A;  3GRV A;  4A6Q A;  3AE2 B;  1YE9 A;  4IBJ A;  4HEA 1;  2XZU A;  3KP1 E;  1SE4 A;  3B21 A;  1YN4 A;  1ZUD 2;  5H8Y E;  1X37 A;  3KSJ A;  1FNV A;  4J3O D;  4HRO A;  4WW0 A;  4W5W A;  3KXE C;  1DOI A;  3AEC B;  1TS2 A;  2JU6 X;  1GLN A;  4AI6 A;  3SR6 A;  1QAN A;  3I9V 1;  3MFG A;  1J7A A;  1JQJ C;  3KVW A;  2OQ4 A;  1FM0 D;  2K3U A;  5KQ8 A;  5IWA M;  4WAF A;  2YR0 A;  1ENF A;  2CV0 A;  4QHT A;  3J2P B;  3Q69 A;  1FMA D;  4RKX A;  1VZ6 A;  2H88 B;  5LMN M;  2AX5 A;  1XLP A;  4M9Z A;  4NAM A;  4KGS A;  3GPU A;  3LB8 C;  3AE5 B;  2Z84 A;  1G8P A;  2IJ0 A;  2UU9 M;  1TKE A;  2WXK A;  3NVV A;  4ZYS A;  2XSZ A;  4IBK A;  2R46 A;  1T5X D;  4BOQ A;  3TWM A;  3HU3 A;  4YY3 M;  2W82 A;  1KRH A;  3T38 A;  2FE8 A;  2L09 A;  2H89 B;  1XF5 L;  2IPK D;  3LQR A;  2XZF A;  1XMQ M;  1QOA A;  3J7B A;  2PVO D;  2I38 A;  2L7H A;  4LJ7 A;  4YHH M;  4WIP A;  3FAH A;  3BBA A;  4OZC A;  5BMG A;  1MX0 A;  3HU2 A;  4JI1 M;  2M5Z A;  4OX9 M;  4LRS A;  1EWC A;  1HZ6 A;  2BT6 A;  3ABV B;  4K0K M;  3HHW A;  4BOZ A;  4HLQ A;  4LLG M;  4IP3 A;  3PRP A;  5KQD A;  4GDL B;  1QZM A;  2C9O A;  2C99 A;  1L0X B;  3P4Q B;  1HZ5 A;  1YN3 A;  1HEZ E;  1FRD A;  2LWX A;  3P4P B;  4LJ4 A;  1IN4 A;  1CJE A;  1GOZ A;  2PKO A;  4PDG A;  2ERC A;  3L25 A;  5FLX S;  1E9M A;  1JR3 D;  3JAM S;  3FKE A;  2C98 A;  3WHK A;  4XWW A;  1ZQ9 A;  2WDV B;  2J7O A;  1OQR A;  2BNK A;  1MU5 A;  3K2L A;  5JI2 E;  5EXT A;  1FCC C;  2K47 A;  4RF0 A;  5TSS A;  1QT9 A;  2PVG C;  3KOY E;  1L2B A;  3B9J A;  4O1N A;  1FNN A;  3BVG A;  1YNT E;  2AQ2 B;  3CF2 A;  5DNY A;  1VZ8 A;  3SBJ A;  3E4R A;  4NXN M;  1Y56 A;  2J53 A;  2UUA M;  4ZRQ A;  3RE8 A;  4MGZ E;  3SAV A;  4LJ8 A;  4RGN A;  1NHW C;  4GLS C;  1XXH B;  3QAU A;  5BMH A;  1SJH D;  2UUB M;  1VLB A;  1IY2 A;  4MGK E;  4KGT A;  3AEF B;  2K9X A;  1E9S A;  2R45 A;  4HRS A;  3UZU A;  3EIH A;  4C7Z A;  2R65 A;  3IFU A;  2UXC M;  1BUI C;  4LF8 M;  3U60 A;  1UWX A;  4DR4 M;  3EIE A;  3TL4 X;  8CAT A;  4L8R C;  3IT4 B;  2M0A A;  2F5Q A;  2H1R A;  4GC5 A;  1GB4 A;  1IBX A;  4XBO A;  2KWD A;  4IBF A;  2DLB A;  3AED B;  3SYK A;  2KXE A;  1PJI A;  3B9P A;  3U6Q A;  3AOE C;  2GB1 A;  4R3D A;  1FJG M;  4LZJ A;  1VR9 A;  1RFK A;  2F5N A;  4LFA M;  4JYA M;  1GVN A;  3PVS A;  1HQC A;  3BB7 A;  2EKI A;  5ITT A;  2BTE A;  5EP4 A;  1C4A A;  2GI9 A;  1JWM D;  5EP3 A;  5H37 D;  1VZ7 A;  1L5P A;  3KSX A;  5EQT A;  1P7E A;  4US8 A;  1Q3B A;  1TGU A;  3GP1 A;  4BOS A;  3LXF A;  4RF1 A;  2QBY A;  3GQ5 A;  1EM7 A;  5D3D A;  4KO8 A;  1VRA B;  1Z59 A;  1C1K A;  1SXJ B;  5KPT A;  4EIW A;  1FO4 A;  1N33 M;  2ZAM A;  3GLI B;  2I2Y A;  4XGI A;  4REZ A;  3AL0 C;  4AQ7 A;  2INP E;  4AKI A;  2DZO B;  2P5T A;  4QNR A;  4B7F A;  3AKZ A;  1I94 M;  4A5U A;  2N9K A;  3TMP A;  1VJK A;  3PO0 A;  3URY A;  3U6C A;  2X38 A;  3FC4 A;  1NVM A;  2V3P A;  1HR0 M;  4I8O A;  3UMM A;  1HNX M;  1N32 M;  3R9X B;  5LMU M;  2C96 A;  1C76 A;  3Q8F A;  3K92 A;  2FBW B;  4I5S A;  1XCQ L;  1DOX A;  4MGI E;  3HJS A;  3UJN A;  1MHH E;  1QQR A;  3P4R B;  3U6E A;  4DV1 M;  1OJL A;  4BOU A;  1F2R I;  1N5X A;  1W5S A;  3PXG A;  4HXD B;  5EE0 A;  3KWL A;  1DGB A;  4JI7 M;  2WP9 B;  1I4Q A;  4G4Q A;  1YJJ A;  5EE3 A;  5C1B A;  3R8B A;  1E32 A;  1PM5 A;  2JYE A;  1JAL A;  3HHZ A;  3RFZ B;  5FR3 A;  2Z4R A;  1XHB A;  1K53 A;  3KOZ E;  3FIL A;  4PDI A;  2CE7 A;  4DR7 M;  3TEW A;  2QPA A;  2XFT A;  5KPZ A;  5D7G A;  2YEP B;  2EEL A;  2HWK A;  2WXQ A;  1QOF A;  2W55 A;  3NBI A;  1NY6 A;  4LFB M;  3J81 S;  4II7 A;  4FWH A;  3Q8B A;  1JWU D;  5IT9 S;  2MJ3 A;  2M56 B;  4DQO C;  2WXN A;  1TKG A;  2XFS A;  1SF0 A;  1UM8 A;  3U52 E;  5H92 C;  4WQM A;  3NS1 A;  1FCL A;  1FRR A;  2LJI A;  4Q2J A;  4FXC A;  2E3T A;  1R7S A;  3SYL A;  4GRI A;  2CUZ A;  1G3I A;  2XGN A;  1KLG D;  4CGY B;  2XLJ A;  1TH4 A;  4MAC A;  4ZPX A;  1BML C;  2WXP A;  5E26 A;  3U6M A;  4QOS A;  4WH4 A;  2CHV A;  1D2N A;  2Y0Q A;  2IDY A;  3SAU A;  3U7Z A;  3RGP A;  1T3Q A;  4HJG E;  5JXV A;  4L78 A;  2IGD A;  2L6O A;  3EGR A;  3M7G A;  3EUB 2;  4MI7 A;  3L4P A;  2MJE A;  3GO8 A;  2UXB M;  1SSN A;  3W0F A;  5C18 A;  3W0L B;  3MP2 A;  3LQQ A;  1L1Z A;  2UUC M;  2WXO A;  2QJL A;  1NEK B;  3TEX A;  4A3V B;  1J5E M;  2XEP A;  1M4V A;  1TZO A;  3NVW A;  4DV4 M;  2QCU A;  1XLO A;  3BVZ A;  4LY6 A;  3PNV A;  4DR2 M;  3WCQ A;  2WU5 B;  5IZ7 D;  5EXP A;  3GQ3 A;  2QP9 X;  3NUH B;  3SAT A;  3PHX A;  3R8F A;  2PMV A;  2RGH A;  3D8B A;  3GLF A;  1N5W A;  2LXE A;  2WXJ A;  3SAW A;  1Z5A A;  3TWL A;  2DWL A;  3DZD A;  2PIA A;  4YSY B;  2KAJ A;  1SE2 A;  1ZDX A;  1IN5 A;  3B2G A;  4BB9 A;  5FTK A;  4XZX A;  3ZGZ A;  5HFY A;  1E0Z A;  1IBK M;  4I4L A;  5ITX E;  1D5M C;  4DR1 M;  1CQV A;  4IDI A;  1PYW D;  1XXH A;  4ITQ A;  3GPX A;  4RGO S;  2DWN A;  5HHD G;  2ICI A;  3KOX E;  3ZNH A;  1YSY A;  4MT5 A;  1D5Z C;  4IKG A;  3I51 A;  3GLF B;  3CF0 A;  2G1E A;  1NHG C;  4DR3 M;  3AOG A;  1KLU D;  4MM3 B;  2J7Q C;  3R2T A;  3ZQ4 A;  3N9Y C;  4YTP B;  2QEN A;  1UWM A;  1EWY C;  3A98 B;  4GIP A;  4YTM B;  5E6J A;  1OFF A;  2KAC A;  3U6D A;  3BK1 A;  1OFI A;  1J09 A;  1UKF A;  2ZAN A;  1QOB A;  2R61 A;  4YSZ B;  4AKH A;  1XEE A;  3WHL A;  3VR8 B;  3LMM A;  2MH7 A;  3SHF A;  1J7C A;  3HVZ A;  1DKI A;  2R4E A;  3ZC7 B;  2JA2 A;  2VII A;  2W3R A;  2FOI C;  3HJQ A;  2DZN B;  3VFD A;  5BYQ A;  5ITY A;  1C4C A;  1GPX A;  4G4O A;  3I57 A;  4X64 M;  2BTW A;  1NSF A;  3BYT B;  2YQZ A;  2WS3 B;  2LHD A;  3GLH A;  2L32 A;  4IBE A;  4JE3 B;  4TUW A;  4ARC A;  1SEB D;  4D8E A;  1L8Q A;  3C0R A;  4C80 A;  2FFJ A;  3IXS A;  3NVZ A;  3M0E A;  3P42 A;  1B1Z A;  3GLI A;  4LFC M;  4XDD A;  4LF7 M;  2WQY B;  2CFO A;  3OWE B;  1C4P A;  2QMT A;  5EP2 A;  3KW6 A;  2X4A A;  1PUT A;  3DFZ A;  3AV8 A;  3L27 A;  2CU3 A;  1MHX A;  3MP9 A;  4GH9 A;  1ORY B;  3AE8 B;  2BW2 A;  2V6Z M;  2V1U A;  1PVJ A;  1HT2 E;  1PFD A;  5BMI A;  4DUZ M;  1TY2 A;  3W2D A;  1NYQ A;  1JRP A;  4DUY M;  3J27 B;  2V0G A;  1KF6 B;  3NRZ A;  3PHW A;  4DV7 M;  1TY0 A;  3P63 A;  3AE6 B;  1HNW M;  4A90 A;  2E5L M;  1WXQ A;  1ZAE A;  3RGS A;  2UXD M;  3IG5 A;  2DWZ B;  1KSF X;  3HHX A;  3BWU D;  2CHQ A;  1FXI A;  2Z7J A;  2X8A A;  2JXT A;  3V3X A;  2BU3 A;  4IIW A;  4OVZ A;  1XC8 A;  4CIS A;  2LFI A;  3V05 A;  1F0Z A;  4G4R A;  2QSD A;  3GP7 A;  4AKG A;  3MC0 B;  1YJI A;  3E9S A;  3BVM A;  2F5S A;  3TWK A;  1GL6 A;  2M60 A;  1J7B A;  4ARI A;  3TEY A;  1IN6 A;  3HRD D;  2BJV A;  2LMC A;  1KYI A;  1DO0 A;  2AHM A;  2XF3 A;  4M9S A;  1SXJ A;  3FTF A;  3HHY A;  3VDU A;  1GKI A;  3SEB A;  2R62 A;  4AG5 A;  3AB5 A;  3AM9 A;  4JI8 M;  2UZJ A;  5BYR A;  3PNY A;  2PW9 A;  3U5Z A;  1IXS B;  1NEN B;  4NSR A;  3D8L A;  4FCW A;  4DR6 M;  5EZS A;  2K0P A;  2KZS A;  4DV5 M;  5EJC A;  3SFD B;  1WSP A;  2Q2E B;  3LVV A;  2QIE B;  4N59 A;  1W5T A;  4RGM A;  1C78 A;  2L52 A;  2LUM A;  4YXD B;  3KLS X;  1G4A E;  3L29 A;  1S3S A;  4LTU A;  3KQ4 A;  2NTS A;  1AN8 A;  1CK1 A;  3SFZ A;  2IGH A;  2BYT A;  4KKI A;  3AEE B;  1XCT L;  2CV1 A;  1NNU C;  1QAO A;  1DGJ A;  3TPZ A;  3W30 A;  2L1A A;  1WWT A;  3U2S C;  3AE9 B;  3U6O A;  1C79 A;  3T3O A;  4H2A A;  3UI3 A;  4IBD A;  5KPR A;  1HQR D;  1QLB B;  2JSV X;  4BLC A;  1L4Z B;  1YUB A;  2LH0 A;  2CHG A;  1R6B X;  5GKN A;  1QIL A;  2N9L A;  3FYD A;  2KMM A;  1DGG A;  3FD9 A;  2QBY B;  1Z5C A;  1E6E B;  2K5P A;  1E94 E;  4QHS A;  3DOA A;  4ZTB A;  1B9R A;  1K82 A;  1IXZ A;  2ZAO A;  4DV6 M;  4RGT A;  2AGA A;  4NOO B;  4USA A;  3KS8 A;  3U60 B;  4PD2 A;  1FD6 A;  2IGG A;  1Z5B A;  4QNM A;  4FCV A;  4DV0 M;  2WXH A;  1JW9 D;  1IY1 A;  4N6E B;  1NJG A;  5FTN A;  2OPF A;  1UGJ A;  2J4X A;  3HVD A;  2WXG A;  2J7Q A;  3MK6 A;  3IT6 B;  2DWM A;  4GUA A;  3RNV A;  1V8C A;  1AW7 A;  2ACZ B;  1DGH B;  1STE A;  2OED A;  4L23 A;  3SFE B;  1IM2 A;  1T3T A;  1ET9 A;  4B0M A;  1GAQ B;  1YN5 A;  1NJF A;  1ROE A;  1SXJ D;  4DXF A;  1IBL M;  2LGI A;  1V97 A;  3ZCB B;  3U6S A;  1IXR C;  4GHL A;  4NXM M;  4D2K A;  3IG8 A;  2X49 A;  3PRM A;  4YT0 B;  5LNK 1;  1L4D B;  4D82 A;  4OVZ B;  4Z8X A;  1A70 A;  3OQC A;  3HKP A;  2LHE A;  3AJI B;  4L16 A;  1K3X A;  3AH7 A;  4AG6 A;  2JRI A;  1KH0 A;  2BS4 B;  4AQY M;  2DYM A;  2D7G A;  2ONQ A;  4YSX B;  2V4I B;  1Q3C A;  2QZ4 A;  3VR9 B;  4G4N A;  1TS4 A;  1IBX B;  4TQ1 A;  2RMM A;  1T6B X;  4LF5 M;  3PZ8 A;  1XLQ A;  3VRA B;  4A8X C;  2BBC A;  5ITQ A;  1XLN A;  1TS5 A;  1VDV A;  3Q8A A;  2HTM E;  4OZA A;  4A55 A;  1D5X C;  2VQE M;  1PGX A;  4L1B A;  2Z4S A;  3RPF C;  2Y5P A;  3BOS A;  1TYG B;  5IRE B;  4DXG A;  1L6V A;  4DV3 M;  4DR5 M;  3J9C A;  2QEJ C;  4CQN A;  1P7F A;  2PTL A;  2LEK A;  3FYC A;  2R18 A;  4D81 A;  5BPV A;  1EU3 A;  3SMP A;  3FUU A;  4GHA A;  1SIJ A;  2SAK A;  2MEK A;  4X66 M;  1SJE D;  3CTW B;  3L28 A;  2F5P A;  2PLP A;  2QIL A;  2J52 A;  2HL7 A;  1TJE A;  4ITK A;  1ZP0 B;  1I4H A;  1QYR A;  3NZ3 A;  1G59 A;  1EU4 A;  5EXS A;  2Y21 A;  3RFW A;  5DYG A;  4KGR A;  2VZK B;  2BS3 B;  4OW0 A;  2LNH C;  3J80 S;  4ZRP A;  3HJ8 A;  4NL4 H;  3P4S B;  2EO2 A;  4WUR A;  3MTV A;  2O5R A;  4M0W A;  4D8I A;  1ZXH A;  2RDH A;  2ON8 A;  4MGY E;  3Q8E A;  4NRV A;  4LG2 A;  3EA6 A;  1PGB A;  2G8L A;  3T1H M;  3IAS 1;  5A2Q S;  3O13 A;  4KLN A;  4N58 A;  2J7N A;  2DBY A;  1N62 A;  1YQ4 B;  5GXG B;  4B7G A;  1N63 A;  3VDP A;  1EE8 A;  2Y5C A;  3Q8X A;  1N34 M;  4B7H A;  1IN7 A;  4ZHP A;  1QQW A;  1JQ4 A;  1JWB D;  3FUT A;  3GLG B;  4GKJ M;  3MJ5 A;  3VK7 A;  4GIT A;  2INN E;  2CJN A;  1SB3 C;  3VKH A;  1Z6T A;  2JWU A;  4L4U A;  1HA5 A;  2DVW B;  4DV2 M;  1L2C A;  1XMO M;  3SAR A;  1I4P A;  3U6L A;  3VLF B;  3J7A S;  4IBB A;  3A45 A;  1LV7 A;  4HKZ E;  4LF9 M;  4LJ5 A;  1RYJ A;  3FTE A;  4R7G A;  1NVI D;  4MGH A;  2N7J A;  4IBI A;  1V1P B;  1I4G A;  1AYF A;  4X65 M;  1N75 A;  2BS2 B;  2M19 A;  2BJW A;  4WWM A;  2KA6 B;  1SXJ C;  1TH2 A;  2ZW1 A;  4HL4 A;  5HI1 A;  2KW0 A;  2G9H D;  2F4V M;  1I4X A;  2CJO A;  1FFU A;  3AE4 B;  1GL7 A;  5ITR A;  1L0Y B;  2AQ3 B;  3PSE A;  3BZD B;  3R2I A;  1IN8 A;  2MJD A;  1V1O A;  3MHZ A;  3AE3 B;  3JR5 A;  2NMQ A;  1HT1 E;  4OZB A;  1FXA A;  3SC3 A;  3AN1 A;  3GRU A;  5EE9 A;  3T15 A;  1MPE A;  1DGF A;  2EA0 A;  4X62 M;  1R7R A;  3MHV C;  4JI3 M;  1D6E C;  1N36 M;  4FD2 A;  3CF6 E;  3TRK A;  4PCZ A;  4LJ9 A;  1K51 A;  1XXG A;  2C9C A;  4BOP A;  2Z8L A;  2D5G A;  2ZBK B;  2VQF M;  3BY4 A;  4TQ0 A;  3VRB B;  3PT2 A;  4JX1 C;  3A42 A;  2WNM A;  1E10 A;  4KOD A;  1PGA A;  1TH3 A;  5EXX A;  2WLB A;  5F3W A;  2KEB A;  3VK8 A;  3HU1 A;  1HQY E;  1ZOY B;  4JI4 M;  1TDH A;  7CAT A;  2B76 B;  1QAM A;  4C56 C;  4XE0 A;  1F2R C;  2K22 A;  3ILK A;  3I4V A;  2W3S A;  2DYO A;  2HCB A;  5D3I B;  1OFH A;  3ETR A;  2XH9 A;  2I7N A;  4S12 A;  3AEB B;  1SXT A;  3ZH9 B;  4L15 A;  2XNA C;  2WU2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...