4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Papain-like protease
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
3MJ5A 5E6JA 4REZA 4WURA 3E9SA 4OW0A 4M0WA 4MM3B 4PT5A 4R3DA 2FE8A 4RF0A 4RNAA 4OVZB 3MP2A 4OVZA 4RF1A 4P16A 5KO3A
chains in the Genus database with same CATH superfamily
5LXHA 3VAWA 4F2LA 8CATA 3QK0A 1EWLA 3C19A 2ACZB 4KO8A 1OQQA 3DDCB 4MSMB 1T6BX 2NBWB 3P5XA 2L8JA 3U7ZA 2AGAA 1QQRA 4GOCA 1QOAA 4ICUA 2VQFM 3SARA 2OOAA 3N20C 1Q3CA 4JI3M 2WXNA 2GQFA 1YX6B 1F2AA 5DPRA 4PDGA 4WWPA 1EUVB 1TS4A 2WX0A 2PMVA 4XGAB 3K9PA 4P1CC 3FRIA 2VZKD 4B3RM 1ROEA 2KFKB 3VKHA 2E3TA 1KTKA 4XWTA 1HT1E 2C9CA 3KDSE 1J7BA 2Y5BB 2F5PA 4FCTA 1TDZA 3UIOB 3W68A 3IV2A 3PW3A 4RM8A 2O6VB 1KLUD 4IBKA 1WGLA 2C5RA 3RGPA 1UF0A 3M6AA 2OEDA 4OVVA 1D2NA 1XXHA 5L8RF 4G4OA 3SHFA 1FFUA 4M02A 4IBJA 3THGA 1IY1A 4BAXA 3ZUAA 4L6V6 4ZDVA 1J19A 1DOYA 2MBHA 3J7AS 4LLGM 3AM9A 1F0ZA 2CHQA 3GLFB 1NHGC 1UH6A 1K82A 4GSWA 2DWMA 2Z84A 1I4WA 2G45B 4TV3A 1XNRM 1NY6A 1C4PA 1P1AA 4MT5A 3WHKA 1YALA 4HCPB 3SYLA 1EFUB 5EF4A 2WXGA 3U52E 4G11A 4HDQA 4DR1M 3L4PA 1PJJA 1ZDVA 2CR5A 5EDSA 4IJEA 3HY5A 1SXTA 4GIVA 1Q6KA 1FJGM 2KTFA 2K9DA 2DWQA 1E8ZA 1SIFA 3V61A 3ZH9B 3H8CA 3MHSA 4DV0M 1YQBA 5EQTA 5H8YE 2UU9M 2BGFA 4LJ5A 2JF5A 4LFAM 1U9XA 1UWMA 4GGQA 4DV6M 4B0EA 1THEA 4FK5A 4D8EA 2SAKA 3QAUA 3A98B 1T3TA 1M94A 3PTFC 4JXJA 3H7SA 1GOZA 1S3SG 4JN6A 3HU1A 5AEKB 3P2BA 2MBQA 3CH3X 1VR9A 1CQVA 4AWJA 3UQAA 4L4UA 1HT2E 1GECE 2DCAA 3BPFA 3BBAA 4WJOA 2YLMA 2INCC 1CSBB 1KXRA 3HU2A 3MTNB 2R4JA 3BVGA 4URKA 3R9XB 5ITQA 1Y8GA 1AW7A 2GI9A 3U61B 4FCVA 3O65B 2P0RA 3OWEB 2UXBM 1E10A 3W0FA 2BS4B 4GH9A 3GQ5A 2Y21A 2YR0A 4CYEA 2K9XA 2LEKA 2K25A 4CDCB 2QIEB 1C1YB 3QSDA 1F2RI 3DPDA 2CV1A 1TKEA 3PXGA 1N36M 4YSXB 3HJSA 3OTOM 3U8ZA 3AEBB 4FWDA 4AQYM 3P42A 3GCBA 4XDCA 1FMAD 3NHEB 1ZW7A 2H89B 5AZHA 1VEJA 3U2SC 4FADA 2EA0A 2WU2B 3KOYE 2DCCA 3I63C 4YTMB 2Y0QA 2HJ1A 3DHHC 3W2DA 4M0WA 3LYYA 4RKXA 1VLBA 2KEBA 4PD2A 1MN3A 1ZXHA 3N1ZC 4GKKM 1CVZA 1MIRA 2F7DA 3QJ3A 3BY4B 4PDIA 3PSEA 3BXWA 3VUXA 2LTUA 2MLBA 1E9MA 1C77A 1V1PB 2LRUA 2QENA 3RCZA 3U60A 5LMUM 3HVDA 3RYTA 3NOBA 1XB2B 2QBYA 4WIPA 3MMPA 4MEMA 4AG6A 2VHFA 3PHXA 3U6CA 2N9PC 4DHJB 2LUEA 4LF9M 4EFOA 1AUAA 5EP1A 1BGOA 4I6PA 3H6NA 3H4JA 1JR3D 2DAFA 1HNWM 3QHTA 2JY7A 3U6LA 3BPMA 1C7YA 2WBFX 3MP2A 1PVJA 4D82A 4DR4M 2QEJC 4OVZA 4YSZB 4NZLB 3UF8A 1V6EA 1SXJC 1BMLC 2RGHA 4KLNA 3AI8A 2VQEM 1HTQA 2Z0DB 3MHVC 4DV4M 3P1MA 3VDZA 1P9DU 4W9KA 3CF2A 3NVZA 1C79A 4LJPB 4CQNA 4MSQB 2KYWA 5FR6A 4C56C 1SXJE 4W9CA 3ZQ4A 3HU3A 1AECA 2DYOA 1ORYB 1HE8A 2QNJA 1O0EA 3DWGC 2DJFB 5HFYA 1V2YA 4B7HA 4D8IA 3PV1A 2LH0A 3QX1A 2ZVNA 2GHUA 3LQQA 4AS1A 2XEPA 4PP2E 4BLCA 2SEBD 3U30A 4GEWA 1Z5SB 4M8MA 2JY6A 3B2GA 3U6DA 5IP4D 4PCZA 1MVKA 1R6BX 1YOVB 1Z6TA 2R9FA 2DI0A 3AE8B 1QYRA 1S1QB 1C3TA 1GVNA 3SAWA 1AIMA 4MGZE 1PIPA 1CK1A 2JUOA 3ZTDA 2P86A 2BWEA 4M01A 2G8EA 4TQ1A 4R3DA 5HHDG 1Y4HA 4CHTB 1Z2MA 3I4YA 3BZDB 2FBWB 3K24A 4M00A 3GPXA 4W5BA 1E0ZA 2CHGA 2NPTA 2Z4RA 1AWDA 1V5TA 3DBHB 2KNZA 2V4LA 3KH0A 2LJIA 2DCBA 1WHCA 2D7EA 4YTPB 3BYYB 2FRQA 3CF6E 3BB7A 3GRVA 2E6XA 2CV2A 4XBOA 2ZPNA 1UBIA 4ANWA 2BKRB 3I3TB 3T3NA 1GJZA 1XMOM 2D3GA 1GB4A 2MJ5B 3B89A 4MM3B 4MGYE 4N59A 2F4VM 1MG4A 3VR9B 3V62A 1DGHA 1DOXA 4JGHB 5AUIA 1TYGB 3VDUA 4AJYB 2BF8B 5C2TB 4AQ7A 3AV8A 3M3JA 3I04M 2G6DA 3I51A 1LO5D 1AYVA 2JQRB 3PNRA 1OEYA 1SXJB 3HHYA 1WIVA 1FRDA 5E26A 2FTDA 2DNAA 5DPWA 2F5SA 2L4FA 1N77A 2WHIA 1YJIA 3VH4B 2XN9C 2KNAA 2K6DB 1Q39A 2LGSA 1V9JA 4ZYNA 3VTUA 1PE6A 1PGBA 2M56B 4BOUA 1WR1B 1VEGA 1QZEA 3PHWB 3V6EB 4A3VB 4KVGB 3MTVA 3WXGA 2O2VA 4MSXA 3PFIA 3IUTA 1WX9A 2D3BA 1GJSA 3OQCA 5IO9A 2OOBA 4DMYA 4B95A 1TTNA 2W54A 4HPPA 2JP7A 3RNFC 2M5ZA 1EWYC 5H37D 1FCLA 2MA9B 1T0YA 2WZJA 4IWQA 4KDIC 4MDKE 4IBGA 4G3OA 1XKGA 3K9OB 2AQ3B 2MH7A 4WWOA 3BIID 3AU4A 1D3ZA 2DLBA 2HXZA 4I07A 1T0QC 2FCNA 3PO0A 1TS2A 4K3CA 1NBFC 4CDDB 3CSTA 2LMCA 4ZTBA 1VCBA 4GN1A 4WAFA 4DV1M 4G0NB 4BOZB 1FRRA 2FCQA 1YT7A 1E7VA 2PPHA 1GJTA 2DX5B 4OZAA 1AU4A 1TBEA 4LF5M 3OVZA 2X4AA 3MFGA 4JI8M 4YSYB 4MB7A 2XSZA 3GRYA 4PI3A 1IPGA 2W82A 1OKSA 5EXTA 2V1CA 4NSRA 4JI6M 4ANXA 2J7QC 2DENA 3K8ZA 3A1QB 3AEAB 2MBOA 3PNVA 3FTFA 3WAMA 1IXSA 4Q8GA 3L17A 3JAMS 1JQ4A 1D6EC 2M0XA 4ZRIA 1UBQA 1R5LA 2JUJA 1H8CA 1UD7A 3QWLA 4FCWA 1TKGA 3CWIA 5KHOA 1HUCB 5GKNA 1KFXL 2V9HA 4Z8XA 3D6SA 4B3MM 2AYOA 1R4NB 2K1FA 3OG5A 1YD8U 2IO2B 4K7SA 3ZXRA 2QZ4A 3GP1A 1T0RC 1HJPA 2DZJA 1I7HA 1YJ1A 1UFZA 2KO3A 4YTNB 1VZ8A 4IBDA 3NWLA 1GO5A 3DQVA 2DZMA 2AL6A 3TL4X 5F3WA 1QT9A 3LJ3A 3SFDB 1NEKB 1QAQA 3IFWB 4ZRPA 1OAIA 4FLHA 1EWCA 3N3KB 4HJKA 1STFE 2GBNA 3NJTA 3GO8A 2CE7A 3SFZA 1EO6A 2FAZA 2MX2A 1LQBA 2MEKA 3OF8A 2KDFB 3ZGZA 3FYDA 3AE5B 5E6OA 3DVNU 1STEA 3QQ8B 3Q8CA 2MJDA 3L08A 3VQIA 3PNYA 4CO7A 3SC3A 1I94M 1L2NA 1PJTA 4K81A 3A33B 5JXVA 3UIPB 2NQGA 2JT4B 3Q6BA 4K7UA 3SFEB 5C3JB 2K6BA 1JALA 3OVXA 1L0VB 3RN9C 5BYSA 2AX5A 5BPVA 3P5UA 3NRZA 3IHPC 3BINA 1EF7A 5IOIA 4REZA 1YSYA 4G50A 3HX3A 3ZNHA 2OJRA 4DXFA 2KZSA 4R71A 3TEYA 1KJTA 1TL9A 2LHDA 2KTRB 5BMGA 1NNJA 3U4EG 2REXA 4JI2M 4A9AA 3VXWA 4K7WA 1CJLA 1R2ZA 2L7IA 4DUYM 2EJSA 4B7FA 3VRAB 4BQVA 4GITA 5GXGB 4RF1A 1L4DB 3PHUA 3FTEA 2GOWA 3KUDB 4XUIA 4BKSD 3FKYA 3PBHA 1TKYA 3C9PA 4LNOA 1JWAD 4XGIA 2C7NB 4QNMA 4ITKA 4UDUC 2R45A 3V05A 2MWSB 1GG3A 3AEEB 3GOEA 2WDVB 2O5RA 4RGMA 3ZO5B 2K8CA 3LCUA 3GLGE 1ISNA 3AU5A 1SP4B 1NI2A 3DBRB 1L5PA 3A9JA 3AL0C 2CHXA 4BFRA 1MFWA 2FT2A 3TPZA 5E6NA 3TBLD 3PZ7A 4TUUA 4LJOB 1T5XD 3GLIA 2FRAA 5IWAM 1QQWA 3KWBX 4GDKB 3LB8C 4JWSC 4LRSA 2N1VA 3H7DA 3AULA 3ZCBB 3QWZB 3LVWA 2JWZA 3NVYA 4XDDA 4YXDB 2D11A 5E6PA 2JZ3B 2JZPA 4PS3A 4AUQC 4YHHM 3ZUNA 3F5VA 4LNFA 1ZOYB 2KHHA 3EC8A 2LXAA 4D81A 1NB3A 1HR0M 3L13A 4M0DA 2C7HA 4W9HA 4ZOHC 4GLSC 4NJ6A 4B9KA 2LASA 3BVMA 2KFKA 4XZXA 2TSSA 3Q3MC 2MH8A 2V6ZM 1MHWA 2Y5BA 3HK0A 3BC3A 4CIZA 1C4AA 4DWFA 3FTCA 4G6ZA 5BMHA 3HHAA 1D4BA 4G54A 3AB5A 2AYNA 3GE8C 4ACFA 3DBSA 2O6VA 5EZQA 4AI6A 4HLEA 5J18A 2I1JA 2KAJA 2RSUA 1UWXA 1XCQL 2EMSA 3IEJA 3BK2A 1N33M 1JRPA 1M4VA 2A4ZA 3AOEC 3M7GA 4X64M 2MBEA 2V3SA 2G8JA 2WXMA 5KO3A 1BVSA 1Z5CA 2G4DB 2HCBA 4B3SM 3SHGB 2QSDA 1TTEA 1GCBA 2HJ8A 1QF6A 1PUTA 3GLGB 4EZKA 5FPWA 5C23A 2N7JA 4IG7B 3T15A 3U6QA 3AFHA 4HEOA 1PJSA 2L83A 4AZFA 1ACCA 1RWSA 3C8YA 1XT9B 3GZNB 4II7A 1VD2A 2D10A 5KPTA 2RDGA 4X62M 3RFWA 2H5XA 3AOGA 1WZ0A 2KNBA 2JYTA 4P16A 2WGSA 5EE3A 1QOBA 1X9YA 1N5XA 4Y28F 2LVQA 1H6UA 1TH2A 1WM3A 2L0TA 3PLUA 3R66C 2BJVA 3KOWE 1IN6A 1AN8A 1OGWA 1QOGA 3TL5A 1IN5A 2O01F 4HVBA 2ZBKB 1BXTA 1QOLA 4CDFB 2K47A 4P6VF 1N62A 2WXKA 4JLCA 2XNAC 1EWMA 3R2IA 1UNSA 2JZ0A 1HA5A 1YX5B 2DWNA 1WR6E 3B79A 4DQOC 1HEZE 2J7NA 3O0UA 2J7OA 1VDVA 1C1KA 3J27B 4XZ4A 5A2QS 4Q7JA 1IGDA 2BWES 4YYVA 2ARYA 1HXYD 4LJ7A 3DBLI 1HZ6A 2ZAMA 3AE9B 2YJ2A 4C7ZA 3U61A 3B9PA 4HPMB 3ZXVA 1LTMA 3T1HM 3W1YA 3O65A 3AE1B 5FK9C 2PKOA 3HHIA 1OFIA 4LNKA 2NQIA 4W9JA 3FRHA 4XX5A 3LW5F 1R4MI 2H88B 3TE6A 3R7RA 1V34A 3OJ3A 2KVZA 3MC9A 1F77A 4DV3M 2KDEB 3N1XC 5ITRA 2UU7A 4B6WA 2QCZA 1TGUA 2N9LA 5JI3E 4ASWC 2KRKA 1BY8A 3KSXA 1Z5BA 1A6RA 2HD5B 4WAAA 4PP1A 3CF0A 3RUIB 1WGKA 3ZTCA 2Y3AA 2O6XA 2LVAA 2H1RA 4DXGA 5C1ZA 2XZUA 1PJQA 4L2YA 1WWTA 2IGHA 4IW0A 3CSFA 4P17A 1Y08A 1PGYA 2ZAOA 2AL3A 3I5JC 4S12A 5CVMA 3BY4A 4RH6A 5EP2A 1JWMD 1NJFA 1V1PA 1ZGUB 1TJEA 4MELA 2XLJA 1LGRA 2NTSA 3H7PB 4O1NA 4A3OA 3MC8A 2J0MA 1QILA 2KN5A 2VZKB 2XEWA 3DFZA 4EEWA 4GC9A 1YIWA 1U9WA 1K53A 2LFIA 2DZIA 2WSFF 2XGNA 3L26A 4H2AA 3RNBC 4OZCA 2UYZB 2KWVB 1NL6A 2ZNVC 3HJQA 2RKOA 3JR4A 1FNVA 3ECIA 4US9A 2Y0TA 3TSSA 3AJIB 1N78A 1TY0A 2KOXA 1BUIC 1FFVA 3QJZA 1FXIA 1G59A 2DHZA 1DGBA 2HTME 5EE1A 1PPOA 2MHJA 3DWMA 2CJNA 2MR9A 4JI0M 3ERVA 2L09A 2Q5WD 1SG9A 2LVNC 3CGWA 1WZ3A 1TDHA 2FOIC 3KKUA 3S2AA 3E9SA 2UXCM 3P4PB 2KLGA 3ZRCA 1DGFA 2K0PA 1QDTA 5KHQA 3DCGA 4W9DA 2XBBC 2X49A 2QHOB 5G55A 2HE7A 1J5EM 1MPEA 1WXQA 1DGJA 2YJ8A 1G4AE 1SSNA 1P98A 1AYUA 2X8AA 4LF6M 3VDPA 3UJNA 1LFDA 1P3QU 3ZW3A 1MX0A 4RGOS 1DYQA 3I57A 4W9FA 2ACTA 3KYDD 1EWOA 2ON8A 4MGIE 1KOTA 4LNIA 3GRUA 4AXMA 3IXSA 4ZHPA 2Y5PA 2CEAA 4DV2M 3Q3NC 3Q8AA 4A3PA 3KS4A 2XU1A 3KOZE 1E7UA 1PGAA 4YYWA 4LF8M 2FE8A 5FTKA 1YMHE 4KGSA 1JR3E 3EFCA 1N34M 3RPFC 3K9MA 1WGDA 3GRRA 3HHMA 4AJWA 3UINB 2A5YB 1V8CA 1XLQA 4ZRJA 4EIWA 1TU6A 5CVNB 2LGDA 3IT6B 2FNJB 2WX1A 2OO9A 1I4RA 3X0WA 1FO4A 1MEGA 3NY5A 3CBKA 1L0YB 4GB9A 1KSFX 4IDIA 3ZQJA 1CMXB 1ET9A 3AE3B 3WXFA 1ZE3D 3DHGC 1C4CA 1F29A 2PADA 2M4NA 3I3TA 5CHWA 3KOXE 3KW6A 4BS6A 2K22A 2ZNVB 2N4FA 2FYEA 3RVVA 3W31A 3AEDB 4MM3A 1CS8A 3CH2X 1DO0A 2AQ1B 1NVID 3GE3C 3IFUA 3EIEA 1JWUD 2KXJA 1KYIA 2EUCA 2X38A 1E8YA 1Q0WB 1SF0A 2C0YA 2Q2EB 3SD5A 3E4RA 4L15A 1ESFA 3OJ4B 4QHSA 1MHXA 2OJWA 1TY2A 2ASQA 3RNVA 2IBIB 2G7YA 1YVBA 2KQSA 2V1YA 3BOWA 1SXJA 3ABVB 3L25A 1VG5A 2L76A 2B1MA 2UZJA 2VH2A 2KQ7A 5FSWA 1MJGM 3U6PA 3TRKA 1U4AA 3VK7A 5D2MB 4BOQA 4X6JA 1QAOA 1TLOA 1PQSA 3BWUD 3LXFA 4DV5M 2D5GA 1SJED 4EE2A 2E00A 1FXAA 1WR1A 3PHWA 3V6EA 3GLHA 3TWKA 4JI4M 2L0FA 3MHSD 2XZFA 1KHQA 3WALA 4MJSB 4HXDB 1VDDA 4C4VB 3O1GA 4JE3B 2C5LC 4HCNB 4YVAA 1TH3A 3TNXA 2CUZA 2INNE 2L00B 1LXDA 4K7CA 3CTWB 5FTMA 5BYRA 4FBJB 2JA2A 3K9OA 3APDA 3ZLZA 3PDFA 1KFYB 2KACA 4RY2A 4DV7M 2BU3A 2VF7A 1R7RA 2NVUI 3TEXA 1G6JA 1PPPA 1NLJA 4BKGA 2KANA 2N7DA 2KRUA 1N6ZA 2CHWA 2M0AA 2AU1A 3GQ4A 2BB5A 4KKIA 3AECB 1NJGA 1RRBA 4IBFA 2LUMA 1G3IA 1PGXA 2PVGC 3F75A 5IAAC 1RLFA 4AXLA 4F1SA 1CJEA 2KT7A 2FQ9A 3Q69A 2CFOA 2DWZB 1TZ1A 5EXSA 3MHHA 4LK0M 3EHVA 4WP2A 2W3RA 3ZC7B 4WJQA 5HKHA 3AEFB 1IBXB 3QA8A 3U5ZB 7PCKA 1IUEA 3A1QA 4CJ6A 3Q8GA 1DOIA 3RZWC 5J17A 3LXSA 1NV9A 3HKPA 1X1MA 3GQ3A 4DBGB 5JA7A 2BYTA 2OQ4A 3I4VA 5BR8M 4G4RA 4LFCM 4RKUF 2GRIA 1WXVA 3MC0B 2MRPA 3H4MA 2DOSA 4QBBA 3SDLC 2N9EB 3SR6A 3VVWB 4ZYSA 1IFYA 3RNGC 3UZUA 2JRHA 3H1UA 1QZMA 3BVZA 3AE6B 4HJGE 2WXPA 3IG3A 3J81S 3SEBA 5IKCM 3KFQA 2BDZA 2HWKA 1ZMVA 3KXEC 2QILA 2DYBA 4A6QA 1WXAA 4F8CB 2R2OA 3SU8X 1E6EB 1J7KA 5L95C 4A55A 1AARA 1GMYA 2ZJDA 4KSLC 5HI1A 3E56A 4CHKA 1RFKA 1ZUD2 4KDLB 1YZBA 3VRBB 3M99A 3KSJA 3L16A 3TUOA 1R7SA 2D3CA 1UUPA 4MZSA 1V97A 2KJHB 1IQPA 3A4RA 1ATKA 2L32A 2KDIA 4MH8A 2GLSA 2V0GA 3HJ8A 2MJEA 2IGGA 2DZLA 2LVPC 1L2BA 1QKZA 1HQYE 1OJLA 3GZNI 4K1RB 1E32A 1J7AA 3QYBA 1L2CA 4NPNA 5TR5A 4QOSA 1TIFA 4RGNA 2XFSA 3RMKC 3DHIC 2FIDA 4N8WA 2CU3A 2G8LA 3I9V1 5J2RA 5FKAC 4FWGA 1JROA 2QMTA 3NVWA 2BJWA 3U7DA 1Q02A 4EOYA 1ET6A 2M19A 5E6JA 2XF3A 3UQBA 1CB5A 4P6EA 4BBAA 2J52A 3DF0A 2N9KA 2XU4A 3D8BA 4YY3M 3PRMB 3C3EA 3VFDA 3V60A 2JX5A 5DCNA 1UKFA 5ITYA 1WY8A 2HDEA 1IGCA 5PADA 4JV5M 1L4ZB 1N60A 2KTRA 2MJ3A 2BT6A 2WXHA 3R2TA 4JWUC 2CHVA 4ARCA 2DZOB 3U6EA 2QC8A 2VHSA 3Q8EA 1G41A 3P63A 2YNMD 2J7QA 2DC9A 1D5ZC 5BO4B 4IM2A 2GBJA 3ILKA 5KQ8A 1ME4A 2Z8LA 2LBCA 4PYZA 4RF0A 2NTTA 4BSQA 3E21A 1SE3A 3KUCB 1PPNA 3CMMB 4OHJA 1E94E 2AHMA 2C99A 2HL7A 2IO1B 3NG0A 6PADA 2F5QA 2J5YA 1AU3A 4XE0A 4FIPA 2K5PA 4FULA 1DGGA 4AKGA 3GPYA 1I4GA 2WSEF 4GKJM 1TS5A 1QOFA 3GPUA 2I7NA 3A4SC 1IM2A 1OFFA 1QVRA 5ITTA 1UGMA 3T38A 1F4IA 3KSEA 4LNNA 1TS3A 2WDTB 1UM8A 4OX9M 3SAVA 2BTWB 1A5RA 3NBXX 3KFUG 4KIKB 1PADA 4I8OA 3FILB 3GB1A 1GNUA 3O13A 4RCOA 2V4IB 2E03A 1L6UA 1XO3A 4QH6A 3FKEA 3GS2A 4JI5M 3KLSX 2GNOA 3VTVA 4B7GA 1Q1OA 3PGEA 4RGTA 3RZFA 2DAKA 3WIMA 4HRSA 4GDKA 2APLA 2BPSA 3VTWA 1AYFA 4IUMB 4LG2A 4LFBM 1SEBD 2C60A 1TH4A 2YJ9A 5MPOA 3W5UB 1OIPA 3OISA 2WNMA 2OHFA 2JYEA 3A46A 2ZCCA 2XU3A 4OELA 2C7MB 2NS5A 1WGNA 3UGJA 3IAM1 2BTEA 2QSFX 3I06A 5FR3A 1K8RB 3B7NA 1GUAB 2LGIA 3RNEC 2W55A 3Q3FA 1KLVA 1UGJA 2KMAA 2R2QA 3S3RA 2PBHA 3I01M 2KDLA 4FVMA 2LD9A 4A90A 3RD2A 2ZVOA 1IY2A 3IHPA 1DKIA 2L7HA 1AIPC 3PRPB 1SE4A 4BOPA 2LNHC 2NMQA 5T8IA 4LJ4A 3LMMA 1GPXA 3TEZA 3WAOA 2KK8A 3D8LA 4GXBA 5D3DA 2R6FA 2QPAA 1D5MC 1SJHD 1Y8RC 4HWIB 4Z6YA 4LJAA 2O25A 4US8A 1QAMA 2AIMA 3KW9A 4TSSA 1NY5A 3S3QA 3QT4A 4GHAA 1CTEA 1WGGA 2GBRA 4IOIE 3B2FA 1JRUA 4F1IA 3PS6A 3DVGY 5DNYA 2CV0A 3H8BA 4LZJA 2CP8A 5JZEB 1ZKHA 2C96A 2J53A 5G5GA 2RPVA 2ZZPB 3NS8A 3HGIA 2HWJA 1P7FA 3R3MA 3ZNID 1PCIA 1FPYA 1TR8A 2CHZA 3LDZE 3ONSA 2GMIC 2O2VB 2PNSA 1UZXB 4P6GA 3T1YM 1L7YA 5CHTA 1WXMA 3B74A 3T6PA 3WA0A 2D7HA 2R44A 5L83A 5IN7A 2LHEA 2AEHA 4N4ZA 4LGMA 4KX6B 4D80A 1U5IA 2XSZD 3ENEA 5CVOB 4NRWA 3T3OA 1IBMM 1EF1A 1LM8B 4OEMA 5LLIA 3IAS1 2KWCA 1FNUA 7CATA 4GDLB 2FS1A 2MROB 3FUXA 5DYGA 4I6LB 4II3B 3ZRFA 4Q2JA 3LQRA 3Q8XA 2AQ2B 1YN5A 3RT3B 2KX0A 2FFJA 5K16A 1YLAA 4IM0A 4HEA1 5ITXE 2JRIB 2G5GX 4EZLA 3HIZA 2DC8A 2WDRB 4DR6M 1ZDXA 3BWKA 2VH1A 1PJIA 4BB9A 1P0RA 2DHYA 1N75A 4X6IA 2WXFA 5EE0A 1IN4A 1C9FA 3PLVA 2UUBM 2XFTA 2XH9A 4ZRKA 1N63A 2LXCA 1EIJA 1HQRD 3IVFA 2OULA 3FAHA 2DZNB 4GU2A 1VJKA 5LMNM 3Q8FA 4NAWB 3P5WA 4ZRQA 3H89A 3BK1A 3F92A 4TUWA 4B0MA 3ZIMA 3BOSA 4LJ6A 3H6SA 1WRDB 1WM2A 3V6CB 3SYKA 4CZWA 3AMZA 1E5WA 1WJNA 1AYWA 2DJGB 1WJ6A 1ZP0B 1PBHA 2PVOD 2JXNA 3AOEA 4YT0B 4K0KM 4W9GA 3EECA 4DR5M 1OQRA 2HD5A 2WXOA 2FNAA 3UK6A 3V76A 1WSPA 3KWLA 2PW9A 4XWWA 3C0RB 2JPHA 3HWNA 3RFZB 2BYVE 2N1WA 4HDOA 1JMLA 2KZRA 1VDLA 5FTLA 4P1BC 4JPSA 4KT0F 1I4QA 1C76A 4QRXA 5J94A 1I35A 1BQIA 3A42A 4YYSA 4KGTA 1I4XA 1V80A 1EWPA 5IA7A 2CWBA 4LJ8A 4XR7A 2R62A 4IWPA 2DCDA 1TGZB 2A5UA 3BYTB 1ME3A 1YN3A 2WLBA 4DHZE 2QP9X 2BS3B 1VRAB 3H9DA 1MEMA 1YK7A 2FO5A 2KHWB 2CKHB 3HVZA 3GLFA 3QAQA 2J4XA 4HWYA 3L2AA 4X65M 2K8BA 1D5XC 3U6SA 1VSNA 2RGOA 3TEWA 3HHXA 2DZYA 2F5OA 5DPTA 3HUIA 3AH7A 4W5WA 1KRHA 1K3WA 2IPKD 2ZEQA 2ZTDA 2LI5A 2N0SB 5AZGA 4BKTA 2YJCA 3BCNA 3GPPA 1YQ4B 4JQWC 1NDDA 4YYUA 2K0BX 1MS6A 4E71A 4X66M 2I2YA 1U9VA 3IG5A 1F9JA 2L05A 4KKJA 2IY1B 3UGBB 1T3QA 2YVCA 4ANVA 2R9MA 1EM7A 4LGYA 4WA6A 1KLGD 2QHOA 3MJWA 4WQMA 4BBNC 3TMPB 2BYFA 3N3GA 3B7QA 1WRIA 2BB6A 1WXSA 5H92C 1XCTL 4J3OD 1EF5A 5EZSA 3DBHI 3Q3JA 4AP4C 3C58A 1K50A 5EXPA 3ZVVA 2EMTA 2JXTA 1V81A 1FNNA 4IJFA 4ARIA 2M1MA 3SMSA 3RNAC 3MTNA 4LF4M 2R4EA 1WJUA 1RYJA 3APFA 2IGDA 1GLOA 2V3PA 4FA6A 3DOWA 3OAWA 3HM6X 4LY6A 1IN7A 1Q10A 3VHTC 2V1UA 4OZBA 1CPJA 4YYQA 4D2KA 3Q14C 1PM5A 3R8FA 4JL9A 5EXXA 4NL4H 1IBLM 1Q5WB 3UI3A 2MP2B 4DHZB 1QXPA 1GABA 2VF8A 3L0WB 4XC2A 4MH0E 1IYFA 4NQKE 5JHBA 1ITOA 1C78A 2EKFA 1BT0A 4N58A 3NHEA 2GBKA 3A9KB 5EGWA 3SATA 1RFAA 2R61A 3RGSA 5FLXS 5G5HA 1BP4A 4WWNA 2JQGR 2JNHA 3FTDA 1T6OA 2O6VD 3AE7B 2MCNB 1N32M 3N30A 3PPAA 1PDXA 2R18A 4MI7A 2L4EA 3W9CB 3LVVA 4FHJA 1SNKA 3K2LA 3TWMA 4KLBA 3JSVB 4RNAA 2B3TA 3SASA 2JZZA 4S17A 2EKIA 2ATOA 2OZ2A 2WXJA 4AOFA 4IC7B 4IBCA 2LHCA 4A8XC 8PCHA 1E8XA 1NQCA 2EO2A 2BYEA 1WMHB 2AUXA 4E74A 1DO2A 2IBIA 4CGYB 1GC6A 1D0LA 1XWIA 1ZV1A 1NB5A 2KXEA 1GL7A 3Q2AC 3P4SB 3EUB2 2LXEA 2L7RA 3VK8A 4C80A 1OAOC 1RAXA 2P7UA 4G3XB 3N1YC 2MSED 3IMAA 4MZOA 4PS7A 3CBJA 3KVFB 4IP3A 3RULA 3DOAA 4NNJB 2YQZA 1FXTB 3J80S 1WYGA 3B1LX 4IIWA 4CISA 3M62B 2LVQD 2WS3B 2LZ6A 4WJPA 2G3QB 1VJVA 4M8NA 1TF0B 1PYWD 3B08A 1XQQA 3J9CA 4HXDA 4MJSA 2UXDM 2IDYA 4DR3M 2PLPA 4C4VA 1J7CA 2BQQA 1OTRB 1EE8A 2GBMA 2UWQA 2XK5B 2DWLA 4AKHA 4FJYA 4NJ7A 2Z3XA 3DVNV 1Q3BA 2RDBC 3EGRA 1FM0D 2LJ5A 1WJ4A 1IP9A 2DBYA 4M9XA 3FUWA 2LHGA 2DZKA 1YJJA 1ZAEA 3KW5B 2J0JA 4TQ0A 2KD0A 1JR3A 1NNUC 1VQ1A 2WQYB 2KQ4X 3URYA 1QUSA 2I7PA 2LWPA 2IPPB 3PT2B 1XXHE 3L28A 1ENFA 1I4PA 4A5UA 2JU6X 2KJRA 2Z4SA 2ZANA 5FTJA 1T43A 2IY0B 5EJCA 3IT4B 1N61A 4BS5A 4JI1M 2L3ZA 1R4NI 1FH0A 3N9YC 4N9F4 1NYRA 2DAGA 3NS1A 3T8MA 5EE9A 2K39A 2K8HA 3HRDD 3KVWA 1WI0A 3ETRA 4K3BA 5D94A 2XU5A 3MP9A 1IBXA 4UN2B 1IXRC 3UMMA 4BVUC 3U5ZA 4NY0A 2AVWA 5DYIA 2HHNA 1G71A 5IT9S 3P4QB 3FUUA 3KWVA 1Y56A 3EFUA 1M6DA 2FCMA 2MBBB 3AEGB 4DBGA 1E8WA 2KZUA 2D2QA 1NHWC 2PE9A 1ZCMA 2BS2B 3AN1A 3W1SA 5C1BA 2KC1A 4C7YA 3ZDMC 2VRRB 1JB0F 1DF0A 1WIAA 2R65A 1WE7A 5ITUA 3EA6A 5LNK1 4PADA 3H8HA 1RU3A 2INPE 2D3AA 4OU7A 2WXLA 4BOSA 1OQYA 4NXNM 4IKGA 3KQ4A 5JH5C 3K9PB 5EP4A 1MU5A 1V49A 4ANUA 1XNQM 3W1SC 4DXAB 5C18A 4WJNA 2WDQB 4DHJD 1T0SC 1YK8A 4GMVA 4N6EB 3L29A 5AZFA 1OFHA 3E1ZB 2K6QA 1OEYJ 4DDID 1QMYA 1GL6A 3VKGA 2YEPB 2KX3A 2H7JA 1Z5AA 4G4QA 4I81A 2ERCA 2R9OA 1CUKA 2D7GA 4BOSC 1NI3A 1GLNA 3C9EA 3KX1A 1XXHB 1QANA 3FC4A 2EKKA 3PZDA 1ICFA 1YN4A 3QIJA 4RM9A 2DVWB 1G8PA 3K92A 1XLOA 3QC8B 5KPRA 1YQ3B 4B08A 4GMQA 1L1ZA 2ZW1A 3U6OA 1A5TA 1V33A 3PRMA 3HD3A 4DR7M 5DFLA 3DBRI 3VFKA 1IBKM 2CIOA 4BPVA 1OIZA 2W3SA 5HG2A 2M8SA 2G9HD 2FIFA 4ICVA 1IWDA 2HTHA 1F52A 4NQLB 4S0RA 2KVRA 2Z59B 2KWDA 4DR2M 5CTRC 4D8BA 2NBUA 2ZTCA 5KQDA 4R7GA 2LRWA 1MI0A 2BWBA 2KFJA 2B1NA 2ZPYA 1QLBB 2CS4A 3JR5A 3B0AA 4BOZA 2EELA 3N32A 4J6IA 2QCUA 1ZXIA 2DYMA 1JW9D 2KDMA 4P7IA 2JWUA 2BDLA 4A20A 1KHPA 4AW4A 3NZ3A 2JTCA 3Q3OC 1P7EA 1AU0A 3K1JA 4GUAA 4DMXA 1ZIVA 1SE9A 1NENB 4EKUA 2QDFA 1CV8A 2BTWA 3ZJVA 2AWTA 1D0MA 4KIKA 3OF9A 2KNVA 1TZOA 4DUZM 2LGXA 3GLHE 2RDHA 3FILA 1P3QQ 1V86A 3U8EA 5GMVA 4EUTA 2WSCF 4WWMA 4PYUA 4WH4A 1WJ7A 2WP9B 2BBCA 4L8RC 2RPQA 5DPSA 5TSSA 4IUMA 4QHTA 1EU4A 2L1AA 2CU1A 3W30A 1SIJA 2LVPA 5BMIA 4TKNA 2NQAA 1WX8A 4NSOB 3GP7A 4X6HA 3FUVA 4ZHOA 3IOQA 2ZCBA 1AU2A 4MGHA 5JHAA 2DAMA 3QYEA 4ITQA 2E5LM 3TJPA 1L2DA 4KODA 2OPFA 2FUG1 2DKLA 2DC7A 3N3KA 1SXJD 1K52A 3VUWA 4JYAM 1WGHA 2KN4A 3FUTA 4I4LA 2UUAM 1POPA 2E02A 2KLCA 3ML9A 3HHZA 3DBLB 4LF7M 1WF9A 5JH3A 1B9RA 4YL8A 4ANRA 4JIOU 3PRPA 4M0WB 4FHKA 2FUDA 1U9QX 3MHZA 3IBEA 4ZPXA 3PSEB 1E7PB 2RMMA 2DAJA 1R4MB 2BW2A 2LVOA 4W4UA 2KA6B 3U60B 3M0EA 1R4GA 4HKQA 2MQJA 2QBYB 1FIQA 2MGWA 1FEHA 2L2DA 4XYCA 3PHXB 1FD6A 2INDC 4PS8A 3W0LB 3PREA 2LWXA 4AKIA 1QDQA 5JZEA 2FUHB 1NV8A 3BBZA 4BZAA 1MDWA 1SE2A 4M9ZA 1NVMA 2PIAA 4NC6A 2PJHA 1XHBA 2LVOC 2GFOA 2B76B 3GLHB 1JQJC 3OLMD 2IYDB 3R8BA 2ZW0A 2HHHM 1F2RC 5D3IB 4OVZB 3L54A 2Y5CA 2ONQA 3L27A 2JY5A 1J09A 1ZMUA 2KDBA 1E90A 4C00A 4LDTD 3NBIA 4ZUXU 3VH3B 4YWGG 3RI7C 1D0KA 4HKZE 4NJCA 2BKFA 1YNTE 3AKZA 2JWSA 4KSKC 1L0XB 1XD3B 4FD2A 1WGYA 3VR8B 2DZZA 1S3SA 2DAEA 3TCAA 1ZMWA 4GDLA 2KJ6A 4N79A 1Z59A 1L1TA 4E3CA 2Y20A 4W9IA 4FW9A 2MW5A 2HAKA 2J0KA 1NPZA 2JY6B 2I38A 3K8UA 4MACA 5AUKA 2JRIA 2NQDB 2G4SA 3NZSA 2F1GA 3FYCA 3L10B 4HPLB 4W9EA 4LDTB 1X37A 4BKSA 3SBJA 1HTOA 5KPZA 4I6NB 4FXCA 4LTUA 4YV8A 4Q8HA 3Q8BA 9PAPA 4IM3A 2E01A 3NZUA 2HH5A 2RRUA 1MHHE 2KKCA 3AV0A 4KHPM 4NAWA 4YYRA 2WXIA 3D32A 3J7BA 3N4CA 2NPTB 1PXVA 4IWOA 3V6CA 4DDGD 1GC7A 2FH0A 3DZDA 1XLNA 1JCKB 1VZ6A 3ML8A 1FNWA 3AE4B 3P5VA 2ZM6M 1GB1A 1IXZA 3V3XA 3FD9A 3VLFB 2LGYA 4WQOB 3C0RA 3AE2B 3CIRB 4EZJA 2JZ1A 3JYUA 4NOOB 5FTNA 1ZPSA 1XF5L 2AS8A 4HK2A 3IG8A 2NBVB 2F5NA 2RGFA 3KS8A 1DGHB 4I04A 1RM6C 2IJ0A 3LCVB 1XC8A 2ICIA 1V1OA 3J2PB 1N5WA 1NYQA 1K51A 1PFDA 3AXCA 3T9LA 2BVCA 4RMAA 3NVVA 2KMCA 3ZDTA 3ZYYX 4FJCA 4FJZA 1VZ7A 1J8CA 2EKEC 4GIPA 2I1KA 2L52A 3PRZA 4QAYA 3WCQA 5BYQA 3C3DA 4LCDE 4IBEA 3GLGA 3WANA 3W5VB 4F7ZA 3B9JA 4TMAB 2KW0A 2PEAA 3ZNZB 1HNXM 2NCNA 4L1BA 1WE6A 3VUYA 1GAQB 4USAA 3TQSA 4LCBA 5ITXA 2V3NA 2OOBB 4LJ9A 4I5SA 1WYWB 2R9CA 3SMPA 5CHVA 4HROA 2DHRA 1SBBB 3RVXA 3QARA 5I4DA 4W5CA 5F02A 2GB1A 5CHFA 3A45A 1WX7A 2WWZA 1CZPA 2Z7JA 1EU3A 3U6MA 4OW0A 5JI2E 4FJVB 4L23A 1R2YA 2QQ8A 1DV0A 2PTLA 2DAIA 3TMPA 1JWBD 2IO3B 2J7QB 4QRGA 1MJDA 3TWLA 2JQFR 3MORA 3WAPA 1IN8A 2YFQA 1F2CA 2R9NA 3KP0E 5CHVC 1HZ5A 1MG8A 3QCAA 4KZCA 4WW0A 4KV2A 4FWHA 4HLQA 5IZ7D 4BBNF 3LFYA 5IREB 1XMQM 2BNKA 2L6OA 1XXGA 3X23A 4FN2A 4JX1C 3AI5A 1A70A 1SB3C 2DENB 4OVUA 4W9LA 1PPDA 4X57B 2N9XA 1YUBA 3R7QA 2CRUA 1YE9A 2X8XX 1IXSB 2P5TA 3ALBA 1H4RA 2KC2A 3ZKJC 1VEKA 4LZZA 2MP2A 3HM3A 5LXIB 4KGRA 2DXIA 2Y6EA 3ZJUA 1GKIA 1KF6B 4L16A 2WU5B 1UELA 1KFUL 1J0GA 3HZJA 3JW0X 3A9KA 1L6VA 3RE8A 4AG5A 2AYOB 2JXXA 4HL4A 1TT5B 3ZNGC 3USVA 3JVZX 3KYCD 4RFBA 1CQDA 4NRVA 4PK1A 1KFVA 4PT5A 1W5TA 3B21A 2JSVX 3JSVA 1PRBA 1QUTA 2NQ8C 2OP3A 2PREA 5A24A 3RNCC 2R46A 2N35A 3GLIE 1XLPA 4NAMA 2UUCM 2NR2A 3H7PA 3DA1A 1WMHA 1I42A 4B3TM 4WURA 4M9SA 2YJBA 2M60A 2BWFA 2IO0B 2CB5A 1V92A 2C9OA 4QNRA 3P4RB 5D7GA 1JQPA 1K3XA 1SGHA 2J42A 1KH0A 1L8QA 1F2BA 1V5OA 3KUZA 2D07B 2VIIA 2RR9A 1WGRA 3FE3A 2W9NA 2Z0EB 4I05A 2JY8A 3PVLA 3KWZA 4LRTA 2FCSA 2M17A 4CDEB 2AUZA 2QJLA 4XK8F 3SAUA 4MGKE 5EP3A 5G2NA 1NO1A 2G3QA 3ZNHB 2B3AA 1HNZM 2R0IA 2VDBB 2WXQA 1NSFA 1OTRA 4JI7M 2XK5A 1WFYA 4L78A 2N7EA 4NXMM 4KZ0A 1QDRA 1W5SA 4QRVA 4GC5A 2C98A 4QOZC 2WYQA 1DEUA 1HQCA 1E9SA 1XEEA 3RVWA 4GHLA 2CJOA 3TIXA 4IBIA 3E46A 2RD0A 2IZVB 2KWUB 3WHLA 2G1EA 3PT2A 1LV7A 2KMMA 3HHWA 2YEPF 3NUHB 1JWSD 2JVCA 3MJ5A 3PZ8A 3SHQA 1B1ZA 1WH3A 5D6JB 2HKJA 3MK6A 1K3BB 3PVSA 3ZJTA 2DC6A 4II2B 2R6NA 3KP1E 1F1HA 1I4HA 3IECA 3GLFE 1FCCC 3APCA 1KM7A 3W67A 3HWSA 2C9WB 4G4NA 3EIHA 5CX3A 3A9JB 2K3UA 4GRIA 2WXRA 2Z8YM 3M63B 4IBBA 3B7ZA 3M95A 2PE6B 1S4VA 1ZQ9A 4DK5A 2DNFA 3GLIB 1E9RA 3DVGX 1IY0A 3WXEA
chains in the Genus database with same CATH topology
8CATA 2ACZB 4KO8A 1OQQA 1T6BX 3U7ZA 2AGAA 1QQRA 1QOAA 2VQFM 3SARA 1Q3CA 4JI3M 2WXNA 4PDGA 1TS4A 2PMVA 2VZKD 4B3RM 1ROEA 3VKHA 2E3TA 1KTKA 4XWTA 1HT1E 2C9CA 3KDSE 1J7BA 2F5PA 4FCTA 1TDZA 1KLUD 4IBKA 2C5RA 3RGPA 2OEDA 3M6AA 1D2NA 1XXHA 4G4OA 3SHFA 1FFUA 4IBJA 3THGA 1IY1A 1DOYA 3J7AS 4LLGM 3AM9A 1F0ZA 2CHQA 3GLFB 1NHGC 1K82A 2DWMA 2Z84A 1I4WA 1XNRM 1NY6A 1C4PA 4MT5A 3WHKA 3SYLA 2WXGA 3U52E 4DR1M 3L4PA 1PJJA 1ZDVA 4IJEA 1SXTA 1FJGM 2DWQA 3ZH9B 4DV0M 5EQTA 5H8YE 2UU9M 4LJ5A 4LFAM 1UWMA 4DV6M 4B0EA 4D8EA 2SAKA 3QAUA 3A98B 1T3TA 4JXJA 1GOZA 4JN6A 3HU1A 1VR9A 1CQVA 4L4UA 1HT2E 3BBAA 3HU2A 2R4JA 3BVGA 3R9XB 5ITQA 1AW7A 2GI9A 3U61B 4FCVA 3OWEB 2UXBM 1E10A 3W0FA 2BS4B 4GH9A 3GQ5A 2Y21A 2YR0A 2K9XA 2LEKA 2QIEB 1F2RI 2CV1A 1TKEA 3PXGA 1N36M 4YSXB 3HJSA 3OTOM 3AEBB 4FWDA 4AQYM 3P42A 4XDCA 1FMAD 2H89B 3U2SC 2EA0A 2WU2B 3KOYE 4YTMB 2Y0QA 3W2DA 4M0WA 3LYYA 4RKXA 1VLBA 2KEBA 4PD2A 1ZXHA 4GKKM 4PDIA 3PSEA 1E9MA 1C77A 1V1PB 2QENA 3U60A 5LMUM 3HVDA 2QBYA 4WIPA 4AG6A 3PHXA 3U6CA 4LF9M 5EP1A 1JR3D 1HNWM 3U6LA 3MP2A 1PVJA 4D82A 4DR4M 2QEJC 4OVZA 4YSZB 4NZLB 1SXJC 1BMLC 2RGHA 4KLNA 2VQEM 3MHVC 4DV4M 3P1MA 3CF2A 3NVZA 1C79A 4CQNA 4C56C 1SXJE 3ZQ4A 3HU3A 2DYOA 1ORYB 3DWGC 5HFYA 4B7HA 4D8IA 2LH0A 3LQQA 4AS1A 2XEPA 4BLCA 2SEBD 3B2GA 3U6DA 4PCZA 1MVKA 1R6BX 1Z6TA 3AE8B 1QYRA 1GVNA 3SAWA 4MGZE 1CK1A 4TQ1A 4R3DA 5HHDG 4CHTB 3I4YA 3BZDB 2FBWB 3GPXA 1E0ZA 2CHGA 2Z4RA 1AWDA 2LJIA 2D7EA 4YTPB 3BYYB 3CF6E 3BB7A 3GRVA 2E6XA 2CV2A 4XBOA 3T3NA 1XMOM 1GB4A 4MGYE 4MM3B 4N59A 2F4VM 3VR9B 1DGHA 1DOXA 5AUIA 1TYGB 3VDUA 5C2TB 4AQ7A 3AV8A 3I51A 1LO5D 2JQRB 1SXJB 3HHYA 1FRDA 5E26A 2F5SA 1N77A 1YJIA 2XN9C 1Q39A 1PGBA 2M56B 4BOUA 3MTVA 4A3VB 3PFIA 3OQCA 2W54A 2M5ZA 1EWYC 5H37D 1FCLA 4IBGA 2AQ3B 2MH7A 3BIID 2DLBA 3PO0A 1TS2A 2LMCA 4ZTBA 4WAFA 4DV1M 1FRRA 4OZAA 4LF5M 2X4AA 3MFGA 4JI8M 4YSYB 4MB7A 2XSZA 3GRYA 2W82A 5EXTA 2V1CA 4NSRA 4JI6M 2J7QC 3K8ZA 3AEAB 3PNVA 3FTFA 3JAMS 1JQ4A 1D6EC 3QWLA 4FCWA 1TKGA 3CWIA 5GKNA 4Z8XA 4B3MM 2QZ4A 3GP1A 1I7HA 4YTNB 1VZ8A 4IBDA 3NWLA 3TL4X 5F3WA 1QT9A 3SFDB 1NEKB 1QAQA 4ZRPA 1EWCA 3GO8A 2CE7A 3SFZA 2MEKA 3ZGZA 3FYDA 3AE5B 1STEA 3Q8CA 2MJDA 3VQIA 3PNYA 3SC3A 1I94M 5JXVA 3SFEB 5C3JB 1JALA 1L0VB 5BYSA 2AX5A 5BPVA 3NRZA 4REZA 1YSYA 3ZNHA 4DXFA 2KZSA 3TEYA 2LHDA 5BMGA 1NNJA 3U4EG 4JI2M 4A9AA 1R2ZA 2L7IA 4DUYM 4B7FA 3VRAB 4GITA 5GXGB 4RF1A 1L4DB 3PHUA 3FTEA 1TKYA 1JWAD 4XGIA 4ITKA 4QNMA 4UDUC 2R45A 3V05A 4RGMA 3AEEB 2WDVB 2O5RA 1L5PA 3AL0C 3TPZA 3PZ7A 1T5XD 3GLIA 5IWAM 1QQWA 4GDKB 3LB8C 4JWSC 4LRSA 3ZCBB 3LVWA 3NVYA 4YXDB 4XDDA 2JZPA 4YHHM 1ZOYB 4D81A 1HR0M 4M0DA 4ZOHC 4GLSC 3BVMA 4XZXA 2TSSA 2V6ZM 1C4AA 3FTCA 4G6ZA 5BMHA 1D4BA 3AB5A 5EZQA 4AI6A 2KAJA 1UWXA 1XCQL 3BK2A 1N33M 1JRPA 1M4VA 3AOEC 3M7GA 4X64M 2WXMA 5KO3A 1Z5CA 2HCBA 4B3SM 3SHGB 2QSDA 1QF6A 1PUTA 3GLGB 2N7JA 3T15A 3U6QA 3AFHA 2L83A 4AZFA 1ACCA 1RWSA 3C8YA 4II7A 5KPTA 2RDGA 4X62M 3RFWA 3AOGA 2JYTA 4P16A 5EE3A 1QOBA 1N5XA 1H6UA 1TH2A 2BJVA 3KOWE 1IN6A 1AN8A 1QOGA 1IN5A 2ZBKB 1BXTA 2K47A 4P6VF 1N62A 2WXKA 2XNAC 3R2IA 1UNSA 1HA5A 2DWNA 4DQOC 1HEZE 2J7NA 2J7OA 1VDVA 1C1KA 3J27B 5A2QS 1IGDA 1HXYD 4LJ7A 1HZ6A 2ZAMA 3AE9B 4C7ZA 3U61A 3B9PA 3T1HM 3O65A 3AE1B 5FK9C 2PKOA 1OFIA 2H88B 3TE6A 1F77A 4DV3M 5ITRA 1TGUA 2N9LA 5JI3E 2KRKA 3KSXA 1Z5BA 3CF0A 1WGKA 2Y3AA 2H1RA 4DXGA 2XZUA 4L2YA 1WWTA 2IGHA 2ZAOA 4S12A 3BY4A 4RH6A 5EP2A 1JWMD 1NJFA 1V1PA 1TJEA 2XLJA 2NTSA 4O1NA 1QILA 2VZKB 3DFZA 4GC9A 1K53A 2LFIA 2XGNA 3L26A 4H2AA 4OZCA 3HJQA 2RKOA 3JR4A 1FNVA 4US9A 2Y0TA 3TSSA 3AJIB 1N78A 1TY0A 1BUIC 1FFVA 1FXIA 1G59A 2HTME 1DGBA 5EE1A 3DWMA 2CJNA 4JI0M 2L09A 2Q5WD 1TDHA 2FOIC 3E9SA 2UXCM 3P4PB 1DGFA 2K0PA 2X49A 1J5EM 1MPEA 1WXQA 1DGJA 1G4AE 1SSNA 2X8AA 4LF6M 3VDPA 3UJNA 1MX0A 4RGOS 1DYQA 3I57A 2ON8A 4MGIE 3GRUA 3IXSA 4ZHPA 2Y5PA 2CEAA 4DV2M 3Q8AA 3KS4A 3KOZE 1PGAA 4LF8M 2FE8A 5FTKA 1YMHE 4KGSA 1N34M 3RPFC 3GRRA 1XLQA 2A5YB 1V8CA 4EIWA 3IT6B 1I4RA 1FO4A 1L0YB 1KSFX 4IDIA 1ET9A 3AE3B 1ZE3D 1C4CA 3KOXE 3KW6A 2K22A 3W31A 3AEDB 1DO0A 2AQ1B 1NVID 3IFUA 3EIEA 1JWUD 2X38A 1KYIA 2EUCA 1SF0A 2Q2EB 3E4RA 4L15A 1ESFA 4QHSA 1MHXA 1TY2A 3RNVA 1SXJA 3ABVB 3L25A 2UZJA 5FSWA 3U6PA 3TRKA 3VK7A 4BOQA 1QAOA 3BWUD 3LXFA 4DV5M 2D5GA 1SJED 4EE2A 1FXAA 3PHWA 3GLHA 3TWKA 4JI4M 2XZFA 4HXDB 1VDDA 4JE3B 1TH3A 2CUZA 2INNE 3CTWB 5FTMA 5BYRA 2JA2A 1KFYB 2KACA 4DV7M 2BU3A 1R7RA 3TEXA 2KRUA 2M0AA 3GQ4A 2BB5A 4KKIA 3AECB 1NJGA 4IBFA 2LUMA 1G3IA 1PGXA 2PVGC 1CJEA 3Q69A 2CFOA 2DWZB 5EXSA 4LK0M 2W3RA 3ZC7B 3AEFB 1IBXB 3U5ZB 1IUEA 1DOIA 3HKPA 3GQ3A 2BYTA 2OQ4A 3I4VA 5BR8M 4G4RA 4LFCM 2GRIA 3MC0B 3H4MA 2DOSA 3SR6A 4ZYSA 3UZUA 1QZMA 3BVZA 3AE6B 4HJGE 2WXPA 3J81S 3SEBA 2HWKA 3KXEC 2QILA 4A6QA 1E6EB 1J7KA 4A55A 5HI1A 3E56A 1RFKA 1ZUD2 1YZBA 3VRBB 3KSJA 3TUOA 1R7SA 1UUPA 1V97A 1IQPA 2L32A 4MH8A 2V0GA 3HJ8A 2MJEA 2IGGA 1L2BA 1QKZA 1HQYE 1OJLA 1E32A 1J7AA 1L2CA 4QOSA 4RGNA 2XFSA 2CU3A 2G8LA 3I9V1 5FKAC 4FWGA 1JROA 2QMTA 3NVWA 2BJWA 1ET6A 2M19A 5E6JA 2XF3A 4BBAA 2J52A 2N9KA 3D8BA 4YY3M 3VFDA 2JX5A 1UKFA 5ITYA 2HDEA 1IGCA 4JV5M 1L4ZB 1N60A 2MJ3A 2BT6A 2WXHA 3R2TA 4JWUC 2CHVA 4ARCA 2DZOB 3U6EA 3Q8EA 1G41A 3P63A 2YNMD 2J7QA 1D5ZC 3ILKA 5KQ8A 2Z8LA 4RF0A 2NTTA 1SE3A 4OHJA 1E94E 2AHMA 2C99A 2HL7A 2F5QA 4XE0A 2K5PA 1DGGA 4AKGA 3GPYA 1I4GA 4GKJM 1TS5A 1QOFA 3GPUA 2I7NA 1IM2A 1OFFA 1QVRA 5ITTA 3T38A 1TS3A 1UM8A 4OX9M 3SAVA 2BTWB 3KFUG 4I8OA 3FILB 3GB1A 3O13A 4RCOA 2V4IB 1L6UA 1XO3A 3FKEA 3GS2A 4JI5M 3KLSX 4B7GA 4RGTA 4HRSA 1AYFA 4LG2A 4LFBM 1SEBD 1TH4A 5MPOA 3W5UB 2WNMA 2OHFA 2JYEA 3A46A 3UGJA 3IAM1 2BTEA 5FR3A 2LGIA 2W55A 1UGJA 4FVMA 4A90A 1IY2A 1DKIA 2L7HA 1SE4A 4BOPA 2LNHC 2NMQA 5T8IA 4LJ4A 3LMMA 1GPXA 3TEZA 3D8LA 5D3DA 2QPAA 1D5MC 1SJHD 4Z6YA 4LJAA 4US8A 1QAMA 4TSSA 1NY5A 4GHAA 4IOIE 3B2FA 5DNYA 2CV0A 4LZJA 2C96A 2J53A 5G5GA 2RPVA 3HGIA 1P7FA 3T1YM 2D7HA 2LHEA 4LGMA 4KX6B 4D80A 2XSZD 4NRWA 3T3OA 1IBMM 3IAS1 1FNUA 7CATA 4GDLB 3FUXA 5DYGA 4Q2JA 3LQRA 3Q8XA 2AQ2B 1YN5A 2FFJA 4HEA1 5ITXE 2G5GX 2WDRB 4DR6M 1ZDXA 1PJIA 4BB9A 1N75A 2WXFA 5EE0A 1IN4A 1C9FA 2UUBM 2XFTA 2XH9A 1N63A 1HQRD 3FAHA 2DZNB 1VJKA 5LMNM 3Q8FA 4NAWB 4ZRQA 3BK1A 4TUWA 4B0MA 3BOSA 4LJ6A 3SYKA 3AMZA 1ZP0B 2PVOD 3AOEA 4YT0B 4K0KM 4DR5M 1OQRA 2WXOA 2FNAA 3UK6A 1WSPA 3KWLA 2PW9A 4XWWA 3RFZB 1JMLA 5FTLA 4JPSA 1I4QA 1C76A 3A42A 4KGTA 1I4XA 4LJ8A 2R62A 3BYTB 1YN3A 2WLBA 2QP9X 2BS3B 1VRAB 3HVZA 3GLFA 2J4XA 3L2AA 4X65M 1D5XC 3U6SA 2RGOA 3TEWA 3HHXA 2F5OA 3HUIA 3AH7A 4W5WA 1KRHA 1K3WA 2IPKD 2N0SB 3GPPA 1YQ4B 4X66M 2I2YA 3IG5A 4KKJA 1T3QA 1EM7A 4LGYA 1KLGD 4WQMA 1WRIA 2BB6A 5H92C 1XCTL 4J3OD 5EZSA 3C58A 1K50A 5EXPA 2JXTA 4ARIA 1FNNA 4IJFA 3SMSA 4LF4M 2R4EA 1RYJA 2IGDA 2V3PA 4LY6A 1IN7A 1Q10A 2V1UA 4OZBA 4D2KA 1PM5A 3R8FA 5EXXA 4NL4H 1IBLM 3UI3A 4MH0E 1C78A 4N58A 3SATA 2R61A 3RGSA 5FLXS 5G5HA 3FTDA 3AE7B 1N32M 1PDXA 2R18A 4MI7A 3W9CB 3LVVA 3K2LA 3TWMA 4RNAA 3SASA 2EKIA 2WXJA 4IBCA 4A8XC 2EO2A 1DO2A 4CGYB 1XWIA 2KXEA 1GL7A 3P4SB 3EUB2 2LXEA 4C80A 3VK8A 4IP3A 3DOAA 2YQZA 3J80S 1WYGA 4IIWA 4CISA 2WS3B 1PYWD 3J9CA 2UXDM 2IDYA 4DR3M 2PLPA 1J7CA 1EE8A 2DWLA 4AKHA 2Z3XA 1Q3BA 3EGRA 1FM0D 2DBYA 4M9XA 3FUWA 1YJJA 1ZAEA 4TQ0A 1JR3A 1NNUC 2WQYB 2KQ4X 3URYA 2I7PA 3L28A 1ENFA 1I4PA 4A5UA 2JU6X 2Z4SA 2ZANA 5FTJA 5EJCA 3IT4B 1N61A 4JI1M 3N9YC 1NYRA 3NS1A 5EE9A 3HRDD 3KVWA 3ETRA 3MP9A 1IBXA 3UMMA 1IXRC 3U5ZA 5DYIA 3P4QB 5IT9S 3FUUA 3KWVA 1Y56A 3AEGB 2KZUA 1NHWC 2BS2B 3AN1A 3W1SA 5C1BA 4C7YA 2R65A 5ITUA 3EA6A 5LNK1 3H8HA 2INPE 4OU7A 2WXLA 4BOSA 4NXNM 4IKGA 3KQ4A 5EP4A 1MU5A 1XNQM 5C18A 2WDQB 4N6EB 3L29A 1OFHA 1GL6A 3VKGA 2YEPB 1Z5AA 4G4QA 4I81A 2ERCA 2D7GA 1NI3A 1GLNA 1XXHB 1QANA 3FC4A 1YN4A 2DVWB 1G8PA 3K92A 1XLOA 5KPRA 1YQ3B 4B08A 4GMQA 1L1ZA 2ZW1A 3U6OA 3PRMA 4DR7M 1IBKM 2W3SA 5HG2A 2G9HD 2KWDA 4DR2M 4D8BA 5KQDA 4R7GA 1MI0A 1QLBB 3JR5A 4BOZA 2EELA 2QCUA 1ZXIA 2DYMA 1JW9D 2KDMA 2JWUA 4AW4A 3NZ3A 2JTCA 1P7EA 3K1JA 4GUAA 1NENB 2BTWA 3ZJVA 1TZOA 4DUZM 3FILA 2RDHA 4WWMA 4WH4A 2WP9B 2BBCA 4L8RC 5TSSA 4IUMA 4QHTA 1EU4A 2L1AA 3W30A 1SIJA 5BMIA 4NSOB 3GP7A 3FUVA 4ZHOA 4MGHA 4ITQA 2E5LM 1L2DA 4KODA 2OPFA 2FUG1 1SXJD 1K52A 4JYAM 2KN4A 3FUTA 4I4LA 2UUAM 3HHZA 4LF7M 1B9RA 3PRPA 3MHZA 4ZPXA 1E7PB 2RMMA 2BW2A 2KA6B 3U60B 3M0EA 4HKQA 2QBYB 1FIQA 1FEHA 1FD6A 3W0LB 2LWXA 4AKIA 5JZEA 4M9ZA 1SE2A 1NVMA 2PIAA 1XHBA 2B76B 3GLHB 1JQJC 3R8BA 2ZW0A 2HHHM 1F2RC 5D3IB 4OVZB 2Y5CA 2ONQA 3L27A 1J09A 3NBIA 4YWGG 4HKZE 4NJCA 1YNTE 3AKZA 1L0XB 4FD2A 3VR8B 1S3SA 1Z59A 1L1TA 2Y20A 4FW9A 2I38A 4MACA 5AUKA 2JRIA 3FYCA 1X37A 3SBJA 5KPZA 4FXCA 4LTUA 3Q8BA 1MHHE 3AV0A 4KHPM 2WXIA 3J7BA 3DZDA 1XLNA 1JCKB 1VZ6A 1FNWA 3AE4B 2ZM6M 1GB1A 1IXZA 3V3XA 3FD9A 3VLFB 3C0RA 3AE2B 3CIRB 4NOOB 5FTNA 1ZPSA 1XF5L 3IG8A 2F5NA 3KS8A 1DGHB 1RM6C 2IJ0A 1XC8A 2ICIA 1V1OA 3J2PB 1N5WA 1NYQA 1K51A 1PFDA 3NVVA 3ZYYX 1VZ7A 4GIPA 2L52A 3WCQA 5BYQA 4IBEA 3GLGA 3W5VB 3B9JA 4TMAB 2KW0A 1HNXM 4L1BA 1GAQB 4USAA 3TQSA 4LCBA 5ITXA 2V3NA 4LJ9A 4I5SA 3SMPA 4HROA 2DHRA 1SBBB 5I4DA 2GB1A 3A45A 1CZPA 2Z7JA 1EU3A 3U6MA 4OW0A 5JI2E 4L23A 1R2YA 2PTLA 3TMPA 1JWBD 3TWLA 1IN8A 2YFQA 3KP0E 1HZ5A 4WW0A 4FWHA 4HLQA 5IZ7D 5IREB 1XMQM 2BNKA 2L6OA 1XXGA 4JX1C 1A70A 1SB3C 1YUBA 1YE9A 1IXSB 2P5TA 4LZZA 4KGRA 2DXIA 3ZJUA 1GKIA 1KF6B 4L16A 2WU5B 1L6VA 3RE8A 4AG5A 4HL4A 4RFBA 4NRVA 1KFVA 4PT5A 1W5TA 3B21A 2JSVX 2NQ8C 2R46A 1XLPA 4NAMA 2UUCM 3DA1A 4B3TM 4WURA 4M9SA 2M60A 2C9OA 4QNRA 3P4RB 5D7GA 1K3XA 2J42A 1KH0A 1L8QA 2VIIA 4LRTA 2QJLA 3SAUA 4MGKE 5EP3A 1HNZM 2WXQA 1NSFA 4JI7M 4L78A 4NXMM 1W5SA 4GC5A 2C98A 4QOZC 1HQCA 1E9SA 1XEEA 4GHLA 2CJOA 4IBIA 3WHLA 2G1EA 3PT2A 1LV7A 2KMMA 3HHWA 2YEPF 3NUHB 1JWSD 3MJ5A 3PZ8A 1B1ZA 2HKJA 3MK6A 3PVSA 3ZJTA 3KP1E 1I4HA 1FCCC 3HWSA 4G4NA 3EIHA 2K3UA 4GRIA 2WXRA 4IBBA 1ZQ9A 3GLIB 1E9RA 1IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  5E6J A;  4REZ A;  4WUR A;  3E9S A;  4OW0 A;  4M0W A;  4MM3 B;  4PT5 A;  4R3D A;  2FE8 A;  4RF0 A;  4RNA A;  4OVZ B;  3MP2 A;  4OVZ A;  4RF1 A;  4P16 A;  5KO3 A; 
#chains in the Genus database with same CATH topology
 5LXH A;  3VAW A;  4F2L A;  8CAT A;  3QK0 A;  1EWL A;  3C19 A;  2ACZ B;  4KO8 A;  1OQQ A;  3DDC B;  4MSM B;  1T6B X;  2NBW B;  3P5X A;  2L8J A;  3U7Z A;  2AGA A;  1QQR A;  4GOC A;  1QOA A;  4ICU A;  2VQF M;  3SAR A;  2OOA A;  3N20 C;  1Q3C A;  4JI3 M;  2WXN A;  2GQF A;  1YX6 B;  1F2A A;  5DPR A;  4PDG A;  4WWP A;  1EUV B;  1TS4 A;  2WX0 A;  2PMV A;  4XGA B;  3K9P A;  4P1C C;  3FRI A;  2VZK D;  4B3R M;  1ROE A;  2KFK B;  3VKH A;  2E3T A;  1KTK A;  4XWT A;  1HT1 E;  2C9C A;  3KDS E;  1J7B A;  2Y5B B;  2F5P A;  4FCT A;  1TDZ A;  3UIO B;  3W68 A;  3IV2 A;  3PW3 A;  4RM8 A;  2O6V B;  1KLU D;  4IBK A;  1WGL A;  2C5R A;  3RGP A;  1UF0 A;  3M6A A;  2OED A;  4OVV A;  1D2N A;  1XXH A;  5L8R F;  4G4O A;  3SHF A;  1FFU A;  4M02 A;  4IBJ A;  3THG A;  1IY1 A;  4BAX A;  3ZUA A;  4L6V 6;  4ZDV A;  1J19 A;  1DOY A;  2MBH A;  3J7A S;  4LLG M;  3AM9 A;  1F0Z A;  2CHQ A;  3GLF B;  1NHG C;  1UH6 A;  1K82 A;  4GSW A;  2DWM A;  2Z84 A;  1I4W A;  2G45 B;  4TV3 A;  1XNR M;  1NY6 A;  1C4P A;  1P1A A;  4MT5 A;  3WHK A;  1YAL A;  4HCP B;  3SYL A;  1EFU B;  5EF4 A;  2WXG A;  3U52 E;  4G11 A;  4HDQ A;  4DR1 M;  3L4P A;  1PJJ A;  1ZDV A;  2CR5 A;  5EDS A;  4IJE A;  3HY5 A;  1SXT A;  4GIV A;  1Q6K A;  1FJG M;  2KTF A;  2K9D A;  2DWQ A;  1E8Z A;  1SIF A;  3V61 A;  3ZH9 B;  3H8C A;  3MHS A;  4DV0 M;  1YQB A;  5EQT A;  5H8Y E;  2UU9 M;  2BGF A;  4LJ5 A;  2JF5 A;  4LFA M;  1U9X A;  1UWM A;  4GGQ A;  4DV6 M;  4B0E A;  1THE A;  4FK5 A;  4D8E A;  2SAK A;  3QAU A;  3A98 B;  1T3T A;  1M94 A;  3PTF C;  4JXJ A;  3H7S A;  1GOZ A;  1S3S G;  4JN6 A;  3HU1 A;  5AEK B;  3P2B A;  2MBQ A;  3CH3 X;  1VR9 A;  1CQV A;  4AWJ A;  3UQA A;  4L4U A;  1HT2 E;  1GEC E;  2DCA A;  3BPF A;  3BBA A;  4WJO A;  2YLM A;  2INC C;  1CSB B;  1KXR A;  3HU2 A;  3MTN B;  2R4J A;  3BVG A;  4URK A;  3R9X B;  5ITQ A;  1Y8G A;  1AW7 A;  2GI9 A;  3U61 B;  4FCV A;  3O65 B;  2P0R A;  3OWE B;  2UXB M;  1E10 A;  3W0F A;  2BS4 B;  4GH9 A;  3GQ5 A;  2Y21 A;  2YR0 A;  4CYE A;  2K9X A;  2LEK A;  2K25 A;  4CDC B;  2QIE B;  1C1Y B;  3QSD A;  1F2R I;  3DPD A;  2CV1 A;  1TKE A;  3PXG A;  1N36 M;  4YSX B;  3HJS A;  3OTO M;  3U8Z A;  3AEB B;  4FWD A;  4AQY M;  3P42 A;  3GCB A;  4XDC A;  1FMA D;  3NHE B;  1ZW7 A;  2H89 B;  5AZH A;  1VEJ A;  3U2S C;  4FAD A;  2EA0 A;  2WU2 B;  3KOY E;  2DCC A;  3I63 C;  4YTM B;  2Y0Q A;  2HJ1 A;  3DHH C;  3W2D A;  4M0W A;  3LYY A;  4RKX A;  1VLB A;  2KEB A;  4PD2 A;  1MN3 A;  1ZXH A;  3N1Z C;  4GKK M;  1CVZ A;  1MIR A;  2F7D A;  3QJ3 A;  3BY4 B;  4PDI A;  3PSE A;  3BXW A;  3VUX A;  2LTU A;  2MLB A;  1E9M A;  1C77 A;  1V1P B;  2LRU A;  2QEN A;  3RCZ A;  3U60 A;  5LMU M;  3HVD A;  3RYT A;  3NOB A;  1XB2 B;  2QBY A;  4WIP A;  3MMP A;  4MEM A;  4AG6 A;  2VHF A;  3PHX A;  3U6C A;  2N9P C;  4DHJ B;  2LUE A;  4LF9 M;  4EFO A;  1AUA A;  5EP1 A;  1BGO A;  4I6P A;  3H6N A;  3H4J A;  1JR3 D;  2DAF A;  1HNW M;  3QHT A;  2JY7 A;  3U6L A;  3BPM A;  1C7Y A;  2WBF X;  3MP2 A;  1PVJ A;  4D82 A;  4DR4 M;  2QEJ C;  4OVZ A;  4YSZ B;  4NZL B;  3UF8 A;  1V6E A;  1SXJ C;  1BML C;  2RGH A;  4KLN A;  3AI8 A;  2VQE M;  1HTQ A;  2Z0D B;  3MHV C;  4DV4 M;  3P1M A;  3VDZ A;  1P9D U;  4W9K A;  3CF2 A;  3NVZ A;  1C79 A;  4LJP B;  4CQN A;  4MSQ B;  2KYW A;  5FR6 A;  4C56 C;  1SXJ E;  4W9C A;  3ZQ4 A;  3HU3 A;  1AEC A;  2DYO A;  1ORY B;  1HE8 A;  2QNJ A;  1O0E A;  3DWG C;  2DJF B;  5HFY A;  1V2Y A;  4B7H A;  4D8I A;  3PV1 A;  2LH0 A;  3QX1 A;  2ZVN A;  2GHU A;  3LQQ A;  4AS1 A;  2XEP A;  4PP2 E;  4BLC A;  2SEB D;  3U30 A;  4GEW A;  1Z5S B;  4M8M A;  2JY6 A;  3B2G A;  3U6D A;  5IP4 D;  4PCZ A;  1MVK A;  1R6B X;  1YOV B;  1Z6T A;  2R9F A;  2DI0 A;  3AE8 B;  1QYR A;  1S1Q B;  1C3T A;  1GVN A;  3SAW A;  1AIM A;  4MGZ E;  1PIP A;  1CK1 A;  2JUO A;  3ZTD A;  2P86 A;  2BWE A;  4M01 A;  2G8E A;  4TQ1 A;  4R3D A;  5HHD G;  1Y4H A;  4CHT B;  1Z2M A;  3I4Y A;  3BZD B;  2FBW B;  3K24 A;  4M00 A;  3GPX A;  4W5B A;  1E0Z A;  2CHG A;  2NPT A;  2Z4R A;  1AWD A;  1V5T A;  3DBH B;  2KNZ A;  2V4L A;  3KH0 A;  2LJI A;  2DCB A;  1WHC A;  2D7E A;  4YTP B;  3BYY B;  2FRQ A;  3CF6 E;  3BB7 A;  3GRV A;  2E6X A;  2CV2 A;  4XBO A;  2ZPN A;  1UBI A;  4ANW A;  2BKR B;  3I3T B;  3T3N A;  1GJZ A;  1XMO M;  2D3G A;  1GB4 A;  2MJ5 B;  3B89 A;  4MM3 B;  4MGY E;  4N59 A;  2F4V M;  1MG4 A;  3VR9 B;  3V62 A;  1DGH A;  1DOX A;  4JGH B;  5AUI A;  1TYG B;  3VDU A;  4AJY B;  2BF8 B;  5C2T B;  4AQ7 A;  3AV8 A;  3M3J A;  3I04 M;  2G6D A;  3I51 A;  1LO5 D;  1AYV A;  2JQR B;  3PNR A;  1OEY A;  1SXJ B;  3HHY A;  1WIV A;  1FRD A;  5E26 A;  2FTD A;  2DNA A;  5DPW A;  2F5S A;  2L4F A;  1N77 A;  2WHI A;  1YJI A;  3VH4 B;  2XN9 C;  2KNA A;  2K6D B;  1Q39 A;  2LGS A;  1V9J A;  4ZYN A;  3VTU A;  1PE6 A;  1PGB A;  2M56 B;  4BOU A;  1WR1 B;  1VEG A;  1QZE A;  3PHW B;  3V6E B;  4A3V B;  4KVG B;  3MTV A;  3WXG A;  2O2V A;  4MSX A;  3PFI A;  3IUT A;  1WX9 A;  2D3B A;  1GJS A;  3OQC A;  5IO9 A;  2OOB A;  4DMY A;  4B95 A;  1TTN A;  2W54 A;  4HPP A;  2JP7 A;  3RNF C;  2M5Z A;  1EWY C;  5H37 D;  1FCL A;  2MA9 B;  1T0Y A;  2WZJ A;  4IWQ A;  4KDI C;  4MDK E;  4IBG A;  4G3O A;  1XKG A;  3K9O B;  2AQ3 B;  2MH7 A;  4WWO A;  3BII D;  3AU4 A;  1D3Z A;  2DLB A;  2HXZ A;  4I07 A;  1T0Q C;  2FCN A;  3PO0 A;  1TS2 A;  4K3C A;  1NBF C;  4CDD B;  3CST A;  2LMC A;  4ZTB A;  1VCB A;  4GN1 A;  4WAF A;  4DV1 M;  4G0N B;  4BOZ B;  1FRR A;  2FCQ A;  1YT7 A;  1E7V A;  2PPH A;  1GJT A;  2DX5 B;  4OZA A;  1AU4 A;  1TBE A;  4LF5 M;  3OVZ A;  2X4A A;  3MFG A;  4JI8 M;  4YSY B;  4MB7 A;  2XSZ A;  3GRY A;  4PI3 A;  1IPG A;  2W82 A;  1OKS A;  5EXT A;  2V1C A;  4NSR A;  4JI6 M;  4ANX A;  2J7Q C;  2DEN A;  3K8Z A;  3A1Q B;  3AEA B;  2MBO A;  3PNV A;  3FTF A;  3WAM A;  1IXS A;  4Q8G A;  3L17 A;  3JAM S;  1JQ4 A;  1D6E C;  2M0X A;  4ZRI A;  1UBQ A;  1R5L A;  2JUJ A;  1H8C A;  1UD7 A;  3QWL A;  4FCW A;  1TKG A;  3CWI A;  5KHO A;  1HUC B;  5GKN A;  1KFX L;  2V9H A;  4Z8X A;  3D6S A;  4B3M M;  2AYO A;  1R4N B;  2K1F A;  3OG5 A;  1YD8 U;  2IO2 B;  4K7S A;  3ZXR A;  2QZ4 A;  3GP1 A;  1T0R C;  1HJP A;  2DZJ A;  1I7H A;  1YJ1 A;  1UFZ A;  2KO3 A;  4YTN B;  1VZ8 A;  4IBD A;  3NWL A;  1GO5 A;  3DQV A;  2DZM A;  2AL6 A;  3TL4 X;  5F3W A;  1QT9 A;  3LJ3 A;  3SFD B;  1NEK B;  1QAQ A;  3IFW B;  4ZRP A;  1OAI A;  4FLH A;  1EWC A;  3N3K B;  4HJK A;  1STF E;  2GBN A;  3NJT A;  3GO8 A;  2CE7 A;  3SFZ A;  1EO6 A;  2FAZ A;  2MX2 A;  1LQB A;  2MEK A;  3OF8 A;  2KDF B;  3ZGZ A;  3FYD A;  3AE5 B;  5E6O A;  3DVN U;  1STE A;  3QQ8 B;  3Q8C A;  2MJD A;  3L08 A;  3VQI A;  3PNY A;  4CO7 A;  3SC3 A;  1I94 M;  1L2N A;  1PJT A;  4K81 A;  3A33 B;  5JXV A;  3UIP B;  2NQG A;  2JT4 B;  3Q6B A;  4K7U A;  3SFE B;  5C3J B;  2K6B A;  1JAL A;  3OVX A;  1L0V B;  3RN9 C;  5BYS A;  2AX5 A;  5BPV A;  3P5U A;  3NRZ A;  3IHP C;  3BIN A;  1EF7 A;  5IOI A;  4REZ A;  1YSY A;  4G50 A;  3HX3 A;  3ZNH A;  2OJR A;  4DXF A;  2KZS A;  4R71 A;  3TEY A;  1KJT A;  1TL9 A;  2LHD A;  2KTR B;  5BMG A;  1NNJ A;  3U4E G;  2REX A;  4JI2 M;  4A9A A;  3VXW A;  4K7W A;  1CJL A;  1R2Z A;  2L7I A;  4DUY M;  2EJS A;  4B7F A;  3VRA B;  4BQV A;  4GIT A;  5GXG B;  4RF1 A;  1L4D B;  3PHU A;  3FTE A;  2GOW A;  3KUD B;  4XUI A;  4BKS D;  3FKY A;  3PBH A;  1TKY A;  3C9P A;  4LNO A;  1JWA D;  4XGI A;  2C7N B;  4QNM A;  4ITK A;  4UDU C;  2R45 A;  3V05 A;  2MWS B;  1GG3 A;  3AEE B;  3GOE A;  2WDV B;  2O5R A;  4RGM A;  3ZO5 B;  2K8C A;  3LCU A;  3GLG E;  1ISN A;  3AU5 A;  1SP4 B;  1NI2 A;  3DBR B;  1L5P A;  3A9J A;  3AL0 C;  2CHX A;  4BFR A;  1MFW A;  2FT2 A;  3TPZ A;  5E6N A;  3TBL D;  3PZ7 A;  4TUU A;  4LJO B;  1T5X D;  3GLI A;  2FRA A;  5IWA M;  1QQW A;  3KWB X;  4GDK B;  3LB8 C;  4JWS C;  4LRS A;  2N1V A;  3H7D A;  3AUL A;  3ZCB B;  3QWZ B;  3LVW A;  2JWZ A;  3NVY A;  4XDD A;  4YXD B;  2D11 A;  5E6P A;  2JZ3 B;  2JZP A;  4PS3 A;  4AUQ C;  4YHH M;  3ZUN A;  3F5V A;  4LNF A;  1ZOY B;  2KHH A;  3EC8 A;  2LXA A;  4D81 A;  1NB3 A;  1HR0 M;  3L13 A;  4M0D A;  2C7H A;  4W9H A;  4ZOH C;  4GLS C;  4NJ6 A;  4B9K A;  2LAS A;  3BVM A;  2KFK A;  4XZX A;  2TSS A;  3Q3M C;  2MH8 A;  2V6Z M;  1MHW A;  2Y5B A;  3HK0 A;  3BC3 A;  4CIZ A;  1C4A A;  4DWF A;  3FTC A;  4G6Z A;  5BMH A;  3HHA A;  1D4B A;  4G54 A;  3AB5 A;  2AYN A;  3GE8 C;  4ACF A;  3DBS A;  2O6V A;  5EZQ A;  4AI6 A;  4HLE A;  5J18 A;  2I1J A;  2KAJ A;  2RSU A;  1UWX A;  1XCQ L;  2EMS A;  3IEJ A;  3BK2 A;  1N33 M;  1JRP A;  1M4V A;  2A4Z A;  3AOE C;  3M7G A;  4X64 M;  2MBE A;  2V3S A;  2G8J A;  2WXM A;  5KO3 A;  1BVS A;  1Z5C A;  2G4D B;  2HCB A;  4B3S M;  3SHG B;  2QSD A;  1TTE A;  1GCB A;  2HJ8 A;  1QF6 A;  1PUT A;  3GLG B;  4EZK A;  5FPW A;  5C23 A;  2N7J A;  4IG7 B;  3T15 A;  3U6Q A;  3AFH A;  4HEO A;  1PJS A;  2L83 A;  4AZF A;  1ACC A;  1RWS A;  3C8Y A;  1XT9 B;  3GZN B;  4II7 A;  1VD2 A;  2D10 A;  5KPT A;  2RDG A;  4X62 M;  3RFW A;  2H5X A;  3AOG A;  1WZ0 A;  2KNB A;  2JYT A;  4P16 A;  2WGS A;  5EE3 A;  1QOB A;  1X9Y A;  1N5X A;  4Y28 F;  2LVQ A;  1H6U A;  1TH2 A;  1WM3 A;  2L0T A;  3PLU A;  3R66 C;  2BJV A;  3KOW E;  1IN6 A;  1AN8 A;  1OGW A;  1QOG A;  3TL5 A;  1IN5 A;  2O01 F;  4HVB A;  2ZBK B;  1BXT A;  1QOL A;  4CDF B;  2K47 A;  4P6V F;  1N62 A;  2WXK A;  4JLC A;  2XNA C;  1EWM A;  3R2I A;  1UNS A;  2JZ0 A;  1HA5 A;  1YX5 B;  2DWN A;  1WR6 E;  3B79 A;  4DQO C;  1HEZ E;  2J7N A;  3O0U A;  2J7O A;  1VDV A;  1C1K A;  3J27 B;  4XZ4 A;  5A2Q S;  4Q7J A;  1IGD A;  2BWE S;  4YYV A;  2ARY A;  1HXY D;  4LJ7 A;  3DBL I;  1HZ6 A;  2ZAM A;  3AE9 B;  2YJ2 A;  4C7Z A;  3U61 A;  3B9P A;  4HPM B;  3ZXV A;  1LTM A;  3T1H M;  3W1Y A;  3O65 A;  3AE1 B;  5FK9 C;  2PKO A;  3HHI A;  1OFI A;  4LNK A;  2NQI A;  4W9J A;  3FRH A;  4XX5 A;  3LW5 F;  1R4M I;  2H88 B;  3TE6 A;  3R7R A;  1V34 A;  3OJ3 A;  2KVZ A;  3MC9 A;  1F77 A;  4DV3 M;  2KDE B;  3N1X C;  5ITR A;  2UU7 A;  4B6W A;  2QCZ A;  1TGU A;  2N9L A;  5JI3 E;  4ASW C;  2KRK A;  1BY8 A;  3KSX A;  1Z5B A;  1A6R A;  2HD5 B;  4WAA A;  4PP1 A;  3CF0 A;  3RUI B;  1WGK A;  3ZTC A;  2Y3A A;  2O6X A;  2LVA A;  2H1R A;  4DXG A;  5C1Z A;  2XZU A;  1PJQ A;  4L2Y A;  1WWT A;  2IGH A;  4IW0 A;  3CSF A;  4P17 A;  1Y08 A;  1PGY A;  2ZAO A;  2AL3 A;  3I5J C;  4S12 A;  5CVM A;  3BY4 A;  4RH6 A;  5EP2 A;  1JWM D;  1NJF A;  1V1P A;  1ZGU B;  1TJE A;  4MEL A;  2XLJ A;  1LGR A;  2NTS A;  3H7P B;  4O1N A;  4A3O A;  3MC8 A;  2J0M A;  1QIL A;  2KN5 A;  2VZK B;  2XEW A;  3DFZ A;  4EEW A;  4GC9 A;  1YIW A;  1U9W A;  1K53 A;  2LFI A;  2DZI A;  2WSF F;  2XGN A;  3L26 A;  4H2A A;  3RNB C;  4OZC A;  2UYZ B;  2KWV B;  1NL6 A;  2ZNV C;  3HJQ A;  2RKO A;  3JR4 A;  1FNV A;  3ECI A;  4US9 A;  2Y0T A;  3TSS A;  3AJI B;  1N78 A;  1TY0 A;  2KOX A;  1BUI C;  1FFV A;  3QJZ A;  1FXI A;  1G59 A;  2DHZ A;  1DGB A;  2HTM E;  5EE1 A;  1PPO A;  2MHJ A;  3DWM A;  2CJN A;  2MR9 A;  4JI0 M;  3ERV A;  2L09 A;  2Q5W D;  1SG9 A;  2LVN C;  3CGW A;  1WZ3 A;  1TDH A;  2FOI C;  3KKU A;  3S2A A;  3E9S A;  2UXC M;  3P4P B;  2KLG A;  3ZRC A;  1DGF A;  2K0P A;  1QDT A;  5KHQ A;  3DCG A;  4W9D A;  2XBB C;  2X49 A;  2QHO B;  5G55 A;  2HE7 A;  1J5E M;  1MPE A;  1WXQ A;  1DGJ A;  2YJ8 A;  1G4A E;  1SSN A;  1P98 A;  1AYU A;  2X8A A;  4LF6 M;  3VDP A;  3UJN A;  1LFD A;  1P3Q U;  3ZW3 A;  1MX0 A;  4RGO S;  1DYQ A;  3I57 A;  4W9F A;  2ACT A;  3KYD D;  1EWO A;  2ON8 A;  4MGI E;  1KOT A;  4LNI A;  3GRU A;  4AXM A;  3IXS A;  4ZHP A;  2Y5P A;  2CEA A;  4DV2 M;  3Q3N C;  3Q8A A;  4A3P A;  3KS4 A;  2XU1 A;  3KOZ E;  1E7U A;  1PGA A;  4YYW A;  4LF8 M;  2FE8 A;  5FTK A;  1YMH E;  4KGS A;  1JR3 E;  3EFC A;  1N34 M;  3RPF C;  3K9M A;  1WGD A;  3GRR A;  3HHM A;  4AJW A;  3UIN B;  2A5Y B;  1V8C A;  1XLQ A;  4ZRJ A;  4EIW A;  1TU6 A;  5CVN B;  2LGD A;  3IT6 B;  2FNJ B;  2WX1 A;  2OO9 A;  1I4R A;  3X0W A;  1FO4 A;  1MEG A;  3NY5 A;  3CBK A;  1L0Y B;  4GB9 A;  1KSF X;  4IDI A;  3ZQJ A;  1CMX B;  1ET9 A;  3AE3 B;  3WXF A;  1ZE3 D;  3DHG C;  1C4C A;  1F29 A;  2PAD A;  2M4N A;  3I3T A;  5CHW A;  3KOX E;  3KW6 A;  4BS6 A;  2K22 A;  2ZNV B;  2N4F A;  2FYE A;  3RVV A;  3W31 A;  3AED B;  4MM3 A;  1CS8 A;  3CH2 X;  1DO0 A;  2AQ1 B;  1NVI D;  3GE3 C;  3IFU A;  3EIE A;  1JWU D;  2KXJ A;  1KYI A;  2EUC A;  2X38 A;  1E8Y A;  1Q0W B;  1SF0 A;  2C0Y A;  2Q2E B;  3SD5 A;  3E4R A;  4L15 A;  1ESF A;  3OJ4 B;  4QHS A;  1MHX A;  2OJW A;  1TY2 A;  2ASQ A;  3RNV A;  2IBI B;  2G7Y A;  1YVB A;  2KQS A;  2V1Y A;  3BOW A;  1SXJ A;  3ABV B;  3L25 A;  1VG5 A;  2L76 A;  2B1M A;  2UZJ A;  2VH2 A;  2KQ7 A;  5FSW A;  1MJG M;  3U6P A;  3TRK A;  1U4A A;  3VK7 A;  5D2M B;  4BOQ A;  4X6J A;  1QAO A;  1TLO A;  1PQS A;  3BWU D;  3LXF A;  4DV5 M;  2D5G A;  1SJE D;  4EE2 A;  2E00 A;  1FXA A;  1WR1 A;  3PHW A;  3V6E A;  3GLH A;  3TWK A;  4JI4 M;  2L0F A;  3MHS D;  2XZF A;  1KHQ A;  3WAL A;  4MJS B;  4HXD B;  1VDD A;  4C4V B;  3O1G A;  4JE3 B;  2C5L C;  4HCN B;  4YVA A;  1TH3 A;  3TNX A;  2CUZ A;  2INN E;  2L00 B;  1LXD A;  4K7C A;  3CTW B;  5FTM A;  5BYR A;  4FBJ B;  2JA2 A;  3K9O A;  3APD A;  3ZLZ A;  3PDF A;  1KFY B;  2KAC A;  4RY2 A;  4DV7 M;  2BU3 A;  2VF7 A;  1R7R A;  2NVU I;  3TEX A;  1G6J A;  1PPP A;  1NLJ A;  4BKG A;  2KAN A;  2N7D A;  2KRU A;  1N6Z A;  2CHW A;  2M0A A;  2AU1 A;  3GQ4 A;  2BB5 A;  4KKI A;  3AEC B;  1NJG A;  1RRB A;  4IBF A;  2LUM A;  1G3I A;  1PGX A;  2PVG C;  3F75 A;  5IAA C;  1RLF A;  4AXL A;  4F1S A;  1CJE A;  2KT7 A;  2FQ9 A;  3Q69 A;  2CFO A;  2DWZ B;  1TZ1 A;  5EXS A;  3MHH A;  4LK0 M;  3EHV A;  4WP2 A;  2W3R A;  3ZC7 B;  4WJQ A;  5HKH A;  3AEF B;  1IBX B;  3QA8 A;  3U5Z B;  7PCK A;  1IUE A;  3A1Q A;  4CJ6 A;  3Q8G A;  1DOI A;  3RZW C;  5J17 A;  3LXS A;  1NV9 A;  3HKP A;  1X1M A;  3GQ3 A;  4DBG B;  5JA7 A;  2BYT A;  2OQ4 A;  3I4V A;  5BR8 M;  4G4R A;  4LFC M;  4RKU F;  2GRI A;  1WXV A;  3MC0 B;  2MRP A;  3H4M A;  2DOS A;  4QBB A;  3SDL C;  2N9E B;  3SR6 A;  3VVW B;  4ZYS A;  1IFY A;  3RNG C;  3UZU A;  2JRH A;  3H1U A;  1QZM A;  3BVZ A;  3AE6 B;  4HJG E;  2WXP A;  3IG3 A;  3J81 S;  3SEB A;  5IKC M;  3KFQ A;  2BDZ A;  2HWK A;  1ZMV A;  3KXE C;  2QIL A;  2DYB A;  4A6Q A;  1WXA A;  4F8C B;  2R2O A;  3SU8 X;  1E6E B;  1J7K A;  5L95 C;  4A55 A;  1AAR A;  1GMY A;  2ZJD A;  4KSL C;  5HI1 A;  3E56 A;  4CHK A;  1RFK A;  1ZUD 2;  4KDL B;  1YZB A;  3VRB B;  3M99 A;  3KSJ A;  3L16 A;  3TUO A;  1R7S A;  2D3C A;  1UUP A;  4MZS A;  1V97 A;  2KJH B;  1IQP A;  3A4R A;  1ATK A;  2L32 A;  2KDI A;  4MH8 A;  2GLS A;  2V0G A;  3HJ8 A;  2MJE A;  2IGG A;  2DZL A;  2LVP C;  1L2B A;  1QKZ A;  1HQY E;  1OJL A;  3GZN I;  4K1R B;  1E32 A;  1J7A A;  3QYB A;  1L2C A;  4NPN A;  5TR5 A;  4QOS A;  1TIF A;  4RGN A;  2XFS A;  3RMK C;  3DHI C;  2FID A;  4N8W A;  2CU3 A;  2G8L A;  3I9V 1;  5J2R A;  5FKA C;  4FWG A;  1JRO A;  2QMT A;  3NVW A;  2BJW A;  3U7D A;  1Q02 A;  4EOY A;  1ET6 A;  2M19 A;  5E6J A;  2XF3 A;  3UQB A;  1CB5 A;  4P6E A;  4BBA A;  2J52 A;  3DF0 A;  2N9K A;  2XU4 A;  3D8B A;  4YY3 M;  3PRM B;  3C3E A;  3VFD A;  3V60 A;  2JX5 A;  5DCN A;  1UKF A;  5ITY A;  1WY8 A;  2HDE A;  1IGC A;  5PAD A;  4JV5 M;  1L4Z B;  1N60 A;  2KTR A;  2MJ3 A;  2BT6 A;  2WXH A;  3R2T A;  4JWU C;  2CHV A;  4ARC A;  2DZO B;  3U6E A;  2QC8 A;  2VHS A;  3Q8E A;  1G41 A;  3P63 A;  2YNM D;  2J7Q A;  2DC9 A;  1D5Z C;  5BO4 B;  4IM2 A;  2GBJ A;  3ILK A;  5KQ8 A;  1ME4 A;  2Z8L A;  2LBC A;  4PYZ A;  4RF0 A;  2NTT A;  4BSQ A;  3E21 A;  1SE3 A;  3KUC B;  1PPN A;  3CMM B;  4OHJ A;  1E94 E;  2AHM A;  2C99 A;  2HL7 A;  2IO1 B;  3NG0 A;  6PAD A;  2F5Q A;  2J5Y A;  1AU3 A;  4XE0 A;  4FIP A;  2K5P A;  4FUL A;  1DGG A;  4AKG A;  3GPY A;  1I4G A;  2WSE F;  4GKJ M;  1TS5 A;  1QOF A;  3GPU A;  2I7N A;  3A4S C;  1IM2 A;  1OFF A;  1QVR A;  5ITT A;  1UGM A;  3T38 A;  1F4I A;  3KSE A;  4LNN A;  1TS3 A;  2WDT B;  1UM8 A;  4OX9 M;  3SAV A;  2BTW B;  1A5R A;  3NBX X;  3KFU G;  4KIK B;  1PAD A;  4I8O A;  3FIL B;  3GB1 A;  1GNU A;  3O13 A;  4RCO A;  2V4I B;  2E03 A;  1L6U A;  1XO3 A;  4QH6 A;  3FKE A;  3GS2 A;  4JI5 M;  3KLS X;  2GNO A;  3VTV A;  4B7G A;  1Q1O A;  3PGE A;  4RGT A;  3RZF A;  2DAK A;  3WIM A;  4HRS A;  4GDK A;  2APL A;  2BPS A;  3VTW A;  1AYF A;  4IUM B;  4LG2 A;  4LFB M;  1SEB D;  2C60 A;  1TH4 A;  2YJ9 A;  5MPO A;  3W5U B;  1OIP A;  3OIS A;  2WNM A;  2OHF A;  2JYE A;  3A46 A;  2ZCC A;  2XU3 A;  4OEL A;  2C7M B;  2NS5 A;  1WGN A;  3UGJ A;  3IAM 1;  2BTE A;  2QSF X;  3I06 A;  5FR3 A;  1K8R B;  3B7N A;  1GUA B;  2LGI A;  3RNE C;  2W55 A;  3Q3F A;  1KLV A;  1UGJ A;  2KMA A;  2R2Q A;  3S3R A;  2PBH A;  3I01 M;  2KDL A;  4FVM A;  2LD9 A;  4A90 A;  3RD2 A;  2ZVO A;  1IY2 A;  3IHP A;  1DKI A;  2L7H A;  1AIP C;  3PRP B;  1SE4 A;  4BOP A;  2LNH C;  2NMQ A;  5T8I A;  4LJ4 A;  3LMM A;  1GPX A;  3TEZ A;  3WAO A;  2KK8 A;  3D8L A;  4GXB A;  5D3D A;  2R6F A;  2QPA A;  1D5M C;  1SJH D;  1Y8R C;  4HWI B;  4Z6Y A;  4LJA A;  2O25 A;  4US8 A;  1QAM A;  2AIM A;  3KW9 A;  4TSS A;  1NY5 A;  3S3Q A;  3QT4 A;  4GHA A;  1CTE A;  1WGG A;  2GBR A;  4IOI E;  3B2F A;  1JRU A;  4F1I A;  3PS6 A;  3DVG Y;  5DNY A;  2CV0 A;  3H8B A;  4LZJ A;  2CP8 A;  5JZE B;  1ZKH A;  2C96 A;  2J53 A;  5G5G A;  2RPV A;  2ZZP B;  3NS8 A;  3HGI A;  2HWJ A;  1P7F A;  3R3M A;  3ZNI D;  1PCI A;  1FPY A;  1TR8 A;  2CHZ A;  3LDZ E;  3ONS A;  2GMI C;  2O2V B;  2PNS A;  1UZX B;  4P6G A;  3T1Y M;  1L7Y A;  5CHT A;  1WXM A;  3B74 A;  3T6P A;  3WA0 A;  2D7H A;  2R44 A;  5L83 A;  5IN7 A;  2LHE A;  2AEH A;  4N4Z A;  4LGM A;  4KX6 B;  4D80 A;  1U5I A;  2XSZ D;  3ENE A;  5CVO B;  4NRW A;  3T3O A;  1IBM M;  1EF1 A;  1LM8 B;  4OEM A;  5LLI A;  3IAS 1;  2KWC A;  1FNU A;  7CAT A;  4GDL B;  2FS1 A;  2MRO B;  3FUX A;  5DYG A;  4I6L B;  4II3 B;  3ZRF A;  4Q2J A;  3LQR A;  3Q8X A;  2AQ2 B;  1YN5 A;  3RT3 B;  2KX0 A;  2FFJ A;  5K16 A;  1YLA A;  4IM0 A;  4HEA 1;  5ITX E;  2JRI B;  2G5G X;  4EZL A;  3HIZ A;  2DC8 A;  2WDR B;  4DR6 M;  1ZDX A;  3BWK A;  2VH1 A;  1PJI A;  4BB9 A;  1P0R A;  2DHY A;  1N75 A;  4X6I A;  2WXF A;  5EE0 A;  1IN4 A;  1C9F A;  3PLV A;  2UUB M;  2XFT A;  2XH9 A;  4ZRK A;  1N63 A;  2LXC A;  1EIJ A;  1HQR D;  3IVF A;  2OUL A;  3FAH A;  2DZN B;  4GU2 A;  1VJK A;  5LMN M;  3Q8F A;  4NAW B;  3P5W A;  4ZRQ A;  3H89 A;  3BK1 A;  3F92 A;  4TUW A;  4B0M A;  3ZIM A;  3BOS A;  4LJ6 A;  3H6S A;  1WRD B;  1WM2 A;  3V6C B;  3SYK A;  4CZW A;  3AMZ A;  1E5W A;  1WJN A;  1AYW A;  2DJG B;  1WJ6 A;  1ZP0 B;  1PBH A;  2PVO D;  2JXN A;  3AOE A;  4YT0 B;  4K0K M;  4W9G A;  3EEC A;  4DR5 M;  1OQR A;  2HD5 A;  2WXO A;  2FNA A;  3UK6 A;  3V76 A;  1WSP A;  3KWL A;  2PW9 A;  4XWW A;  3C0R B;  2JPH A;  3HWN A;  3RFZ B;  2BYV E;  2N1W A;  4HDO A;  1JML A;  2KZR A;  1VDL A;  5FTL A;  4P1B C;  4JPS A;  4KT0 F;  1I4Q A;  1C76 A;  4QRX A;  5J94 A;  1I35 A;  1BQI A;  3A42 A;  4YYS A;  4KGT A;  1I4X A;  1V80 A;  1EWP A;  5IA7 A;  2CWB A;  4LJ8 A;  4XR7 A;  2R62 A;  4IWP A;  2DCD A;  1TGZ B;  2A5U A;  3BYT B;  1ME3 A;  1YN3 A;  2WLB A;  4DHZ E;  2QP9 X;  2BS3 B;  1VRA B;  3H9D A;  1MEM A;  1YK7 A;  2FO5 A;  2KHW B;  2CKH B;  3HVZ A;  3GLF A;  3QAQ A;  2J4X A;  4HWY A;  3L2A A;  4X65 M;  2K8B A;  1D5X C;  3U6S A;  1VSN A;  2RGO A;  3TEW A;  3HHX A;  2DZY A;  2F5O A;  5DPT A;  3HUI A;  3AH7 A;  4W5W A;  1KRH A;  1K3W A;  2IPK D;  2ZEQ A;  2ZTD A;  2LI5 A;  2N0S B;  5AZG A;  4BKT A;  2YJC A;  3BCN A;  3GPP A;  1YQ4 B;  4JQW C;  1NDD A;  4YYU A;  2K0B X;  1MS6 A;  4E71 A;  4X66 M;  2I2Y A;  1U9V A;  3IG5 A;  1F9J A;  2L05 A;  4KKJ A;  2IY1 B;  3UGB B;  1T3Q A;  2YVC A;  4ANV A;  2R9M A;  1EM7 A;  4LGY A;  4WA6 A;  1KLG D;  2QHO A;  3MJW A;  4WQM A;  4BBN C;  3TMP B;  2BYF A;  3N3G A;  3B7Q A;  1WRI A;  2BB6 A;  1WXS A;  5H92 C;  1XCT L;  4J3O D;  1EF5 A;  5EZS A;  3DBH I;  3Q3J A;  4AP4 C;  3C58 A;  1K50 A;  5EXP A;  3ZVV A;  2EMT A;  2JXT A;  1V81 A;  1FNN A;  4IJF A;  4ARI A;  2M1M A;  3SMS A;  3RNA C;  3MTN A;  4LF4 M;  2R4E A;  1WJU A;  1RYJ A;  3APF A;  2IGD A;  1GLO A;  2V3P A;  4FA6 A;  3DOW A;  3OAW A;  3HM6 X;  4LY6 A;  1IN7 A;  1Q10 A;  3VHT C;  2V1U A;  4OZB A;  1CPJ A;  4YYQ A;  4D2K A;  3Q14 C;  1PM5 A;  3R8F A;  4JL9 A;  5EXX A;  4NL4 H;  1IBL M;  1Q5W B;  3UI3 A;  2MP2 B;  4DHZ B;  1QXP A;  1GAB A;  2VF8 A;  3L0W B;  4XC2 A;  4MH0 E;  1IYF A;  4NQK E;  5JHB A;  1ITO A;  1C78 A;  2EKF A;  1BT0 A;  4N58 A;  3NHE A;  2GBK A;  3A9K B;  5EGW A;  3SAT A;  1RFA A;  2R61 A;  3RGS A;  5FLX S;  5G5H A;  1BP4 A;  4WWN A;  2JQG R;  2JNH A;  3FTD A;  1T6O A;  2O6V D;  3AE7 B;  2MCN B;  1N32 M;  3N30 A;  3PPA A;  1PDX A;  2R18 A;  4MI7 A;  2L4E A;  3W9C B;  3LVV A;  4FHJ A;  1SNK A;  3K2L A;  3TWM A;  4KLB A;  3JSV B;  4RNA A;  2B3T A;  3SAS A;  2JZZ A;  4S17 A;  2EKI A;  2ATO A;  2OZ2 A;  2WXJ A;  4AOF A;  4IC7 B;  4IBC A;  2LHC A;  4A8X C;  8PCH A;  1E8X A;  1NQC A;  2EO2 A;  2BYE A;  1WMH B;  2AUX A;  4E74 A;  1DO2 A;  2IBI A;  4CGY B;  1GC6 A;  1D0L A;  1XWI A;  1ZV1 A;  1NB5 A;  2KXE A;  1GL7 A;  3Q2A C;  3P4S B;  3EUB 2;  2LXE A;  2L7R A;  3VK8 A;  4C80 A;  1OAO C;  1RAX A;  2P7U A;  4G3X B;  3N1Y C;  2MSE D;  3IMA A;  4MZO A;  4PS7 A;  3CBJ A;  3KVF B;  4IP3 A;  3RUL A;  3DOA A;  4NNJ B;  2YQZ A;  1FXT B;  3J80 S;  1WYG A;  3B1L X;  4IIW A;  4CIS A;  3M62 B;  2LVQ D;  2WS3 B;  2LZ6 A;  4WJP A;  2G3Q B;  1VJV A;  4M8N A;  1TF0 B;  1PYW D;  3B08 A;  1XQQ A;  3J9C A;  4HXD A;  4MJS A;  2UXD M;  2IDY A;  4DR3 M;  2PLP A;  4C4V A;  1J7C A;  2BQQ A;  1OTR B;  1EE8 A;  2GBM A;  2UWQ A;  2XK5 B;  2DWL A;  4AKH A;  4FJY A;  4NJ7 A;  2Z3X A;  3DVN V;  1Q3B A;  2RDB C;  3EGR A;  1FM0 D;  2LJ5 A;  1WJ4 A;  1IP9 A;  2DBY A;  4M9X A;  3FUW A;  2LHG A;  2DZK A;  1YJJ A;  1ZAE A;  3KW5 B;  2J0J A;  4TQ0 A;  2KD0 A;  1JR3 A;  1NNU C;  1VQ1 A;  2WQY B;  2KQ4 X;  3URY A;  1QUS A;  2I7P A;  2LWP A;  2IPP B;  3PT2 B;  1XXH E;  3L28 A;  1ENF A;  1I4P A;  4A5U A;  2JU6 X;  2KJR A;  2Z4S A;  2ZAN A;  5FTJ A;  1T43 A;  2IY0 B;  5EJC A;  3IT4 B;  1N61 A;  4BS5 A;  4JI1 M;  2L3Z A;  1R4N I;  1FH0 A;  3N9Y C;  4N9F 4;  1NYR A;  2DAG A;  3NS1 A;  3T8M A;  5EE9 A;  2K39 A;  2K8H A;  3HRD D;  3KVW A;  1WI0 A;  3ETR A;  4K3B A;  5D94 A;  2XU5 A;  3MP9 A;  1IBX A;  4UN2 B;  1IXR C;  3UMM A;  4BVU C;  3U5Z A;  4NY0 A;  2AVW A;  5DYI A;  2HHN A;  1G71 A;  5IT9 S;  3P4Q B;  3FUU A;  3KWV A;  1Y56 A;  3EFU A;  1M6D A;  2FCM A;  2MBB B;  3AEG B;  4DBG A;  1E8W A;  2KZU A;  2D2Q A;  1NHW C;  2PE9 A;  1ZCM A;  2BS2 B;  3AN1 A;  3W1S A;  5C1B A;  2KC1 A;  4C7Y A;  3ZDM C;  2VRR B;  1JB0 F;  1DF0 A;  1WIA A;  2R65 A;  1WE7 A;  5ITU A;  3EA6 A;  5LNK 1;  4PAD A;  3H8H A;  1RU3 A;  2INP E;  2D3A A;  4OU7 A;  2WXL A;  4BOS A;  1OQY A;  4NXN M;  4IKG A;  3KQ4 A;  5JH5 C;  3K9P B;  5EP4 A;  1MU5 A;  1V49 A;  4ANU A;  1XNQ M;  3W1S C;  4DXA B;  5C18 A;  4WJN A;  2WDQ B;  4DHJ D;  1T0S C;  1YK8 A;  4GMV A;  4N6E B;  3L29 A;  5AZF A;  1OFH A;  3E1Z B;  2K6Q A;  1OEY J;  4DDI D;  1QMY A;  1GL6 A;  3VKG A;  2YEP B;  2KX3 A;  2H7J A;  1Z5A A;  4G4Q A;  4I81 A;  2ERC A;  2R9O A;  1CUK A;  2D7G A;  4BOS C;  1NI3 A;  1GLN A;  3C9E A;  3KX1 A;  1XXH B;  1QAN A;  3FC4 A;  2EKK A;  3PZD A;  1ICF A;  1YN4 A;  3QIJ A;  4RM9 A;  2DVW B;  1G8P A;  3K92 A;  1XLO A;  3QC8 B;  5KPR A;  1YQ3 B;  4B08 A;  4GMQ A;  1L1Z A;  2ZW1 A;  3U6O A;  1A5T A;  1V33 A;  3PRM A;  3HD3 A;  4DR7 M;  5DFL A;  3DBR I;  3VFK A;  1IBK M;  2CIO A;  4BPV A;  1OIZ A;  2W3S A;  5HG2 A;  2M8S A;  2G9H D;  2FIF A;  4ICV A;  1IWD A;  2HTH A;  1F52 A;  4NQL B;  4S0R A;  2KVR A;  2Z59 B;  2KWD A;  4DR2 M;  5CTR C;  4D8B A;  2NBU A;  2ZTC A;  5KQD A;  4R7G A;  2LRW A;  1MI0 A;  2BWB A;  2KFJ A;  2B1N A;  2ZPY A;  1QLB B;  2CS4 A;  3JR5 A;  3B0A A;  4BOZ A;  2EEL A;  3N32 A;  4J6I A;  2QCU A;  1ZXI A;  2DYM A;  1JW9 D;  2KDM A;  4P7I A;  2JWU A;  2BDL A;  4A20 A;  1KHP A;  4AW4 A;  3NZ3 A;  2JTC A;  3Q3O C;  1P7E A;  1AU0 A;  3K1J A;  4GUA A;  4DMX A;  1ZIV A;  1SE9 A;  1NEN B;  4EKU A;  2QDF A;  1CV8 A;  2BTW A;  3ZJV A;  2AWT A;  1D0M A;  4KIK A;  3OF9 A;  2KNV A;  1TZO A;  4DUZ M;  2LGX A;  3GLH E;  2RDH A;  3FIL A;  1P3Q Q;  1V86 A;  3U8E A;  5GMV A;  4EUT A;  2WSC F;  4WWM A;  4PYU A;  4WH4 A;  1WJ7 A;  2WP9 B;  2BBC A;  4L8R C;  2RPQ A;  5DPS A;  5TSS A;  4IUM A;  4QHT A;  1EU4 A;  2L1A A;  2CU1 A;  3W30 A;  1SIJ A;  2LVP A;  5BMI A;  4TKN A;  2NQA A;  1WX8 A;  4NSO B;  3GP7 A;  4X6H A;  3FUV A;  4ZHO A;  3IOQ A;  2ZCB A;  1AU2 A;  4MGH A;  5JHA A;  2DAM A;  3QYE A;  4ITQ A;  2E5L M;  3TJP A;  1L2D A;  4KOD A;  2OPF A;  2FUG 1;  2DKL A;  2DC7 A;  3N3K A;  1SXJ D;  1K52 A;  3VUW A;  4JYA M;  1WGH A;  2KN4 A;  3FUT A;  4I4L A;  2UUA M;  1POP A;  2E02 A;  2KLC A;  3ML9 A;  3HHZ A;  3DBL B;  4LF7 M;  1WF9 A;  5JH3 A;  1B9R A;  4YL8 A;  4ANR A;  4JIO U;  3PRP A;  4M0W B;  4FHK A;  2FUD A;  1U9Q X;  3MHZ A;  3IBE A;  4ZPX A;  3PSE B;  1E7P B;  2RMM A;  2DAJ A;  1R4M B;  2BW2 A;  2LVO A;  4W4U A;  2KA6 B;  3U60 B;  3M0E A;  1R4G A;  4HKQ A;  2MQJ A;  2QBY B;  1FIQ A;  2MGW A;  1FEH A;  2L2D A;  4XYC A;  3PHX B;  1FD6 A;  2IND C;  4PS8 A;  3W0L B;  3PRE A;  2LWX A;  4AKI A;  1QDQ A;  5JZE A;  2FUH B;  1NV8 A;  3BBZ A;  4BZA A;  1MDW A;  1SE2 A;  4M9Z A;  1NVM A;  2PIA A;  4NC6 A;  2PJH A;  1XHB A;  2LVO C;  2GFO A;  2B76 B;  3GLH B;  1JQJ C;  3OLM D;  2IYD B;  3R8B A;  2ZW0 A;  2HHH M;  1F2R C;  5D3I B;  4OVZ B;  3L54 A;  2Y5C A;  2ONQ A;  3L27 A;  2JY5 A;  1J09 A;  1ZMU A;  2KDB A;  1E90 A;  4C00 A;  4LDT D;  3NBI A;  4ZUX U;  3VH3 B;  4YWG G;  3RI7 C;  1D0K A;  4HKZ E;  4NJC A;  2BKF A;  1YNT E;  3AKZ A;  2JWS A;  4KSK C;  1L0X B;  1XD3 B;  4FD2 A;  1WGY A;  3VR8 B;  2DZZ A;  1S3S A;  2DAE A;  3TCA A;  1ZMW A;  4GDL A;  2KJ6 A;  4N79 A;  1Z59 A;  1L1T A;  4E3C A;  2Y20 A;  4W9I A;  4FW9 A;  2MW5 A;  2HAK A;  2J0K A;  1NPZ A;  2JY6 B;  2I38 A;  3K8U A;  4MAC A;  5AUK A;  2JRI A;  2NQD B;  2G4S A;  3NZS A;  2F1G A;  3FYC A;  3L10 B;  4HPL B;  4W9E A;  4LDT B;  1X37 A;  4BKS A;  3SBJ A;  1HTO A;  5KPZ A;  4I6N B;  4FXC A;  4LTU A;  4YV8 A;  4Q8H A;  3Q8B A;  9PAP A;  4IM3 A;  2E01 A;  3NZU A;  2HH5 A;  2RRU A;  1MHH E;  2KKC A;  3AV0 A;  4KHP M;  4NAW A;  4YYR A;  2WXI A;  3D32 A;  3J7B A;  3N4C A;  2NPT B;  1PXV A;  4IWO A;  3V6C A;  4DDG D;  1GC7 A;  2FH0 A;  3DZD A;  1XLN A;  1JCK B;  1VZ6 A;  3ML8 A;  1FNW A;  3AE4 B;  3P5V A;  2ZM6 M;  1GB1 A;  1IXZ A;  3V3X A;  3FD9 A;  3VLF B;  2LGY A;  4WQO B;  3C0R A;  3AE2 B;  3CIR B;  4EZJ A;  2JZ1 A;  3JYU A;  4NOO B;  5FTN A;  1ZPS A;  1XF5 L;  2AS8 A;  4HK2 A;  3IG8 A;  2NBV B;  2F5N A;  2RGF A;  3KS8 A;  1DGH B;  4I04 A;  1RM6 C;  2IJ0 A;  3LCV B;  1XC8 A;  2ICI A;  1V1O A;  3J2P B;  1N5W A;  1NYQ A;  1K51 A;  1PFD A;  3AXC A;  3T9L A;  2BVC A;  4RMA A;  3NVV A;  2KMC A;  3ZDT A;  3ZYY X;  4FJC A;  4FJZ A;  1VZ7 A;  1J8C A;  2EKE C;  4GIP A;  2I1K A;  2L52 A;  3PRZ A;  4QAY A;  3WCQ A;  5BYQ A;  3C3D A;  4LCD E;  4IBE A;  3GLG A;  3WAN A;  3W5V B;  4F7Z A;  3B9J A;  4TMA B;  2KW0 A;  2PEA A;  3ZNZ B;  1HNX M;  2NCN A;  4L1B A;  1WE6 A;  3VUY A;  1GAQ B;  4USA A;  3TQS A;  4LCB A;  5ITX A;  2V3N A;  2OOB B;  4LJ9 A;  4I5S A;  1WYW B;  2R9C A;  3SMP A;  5CHV A;  4HRO A;  2DHR A;  1SBB B;  3RVX A;  3QAR A;  5I4D A;  4W5C A;  5F02 A;  2GB1 A;  5CHF A;  3A45 A;  1WX7 A;  2WWZ A;  1CZP A;  2Z7J A;  1EU3 A;  3U6M A;  4OW0 A;  5JI2 E;  4FJV B;  4L23 A;  1R2Y A;  2QQ8 A;  1DV0 A;  2PTL A;  2DAI A;  3TMP A;  1JWB D;  2IO3 B;  2J7Q B;  4QRG A;  1MJD A;  3TWL A;  2JQF R;  3MOR A;  3WAP A;  1IN8 A;  2YFQ A;  1F2C A;  2R9N A;  3KP0 E;  5CHV C;  1HZ5 A;  1MG8 A;  3QCA A;  4KZC A;  4WW0 A;  4KV2 A;  4FWH A;  4HLQ A;  5IZ7 D;  4BBN F;  3LFY A;  5IRE B;  1XMQ M;  2BNK A;  2L6O A;  1XXG A;  3X23 A;  4FN2 A;  4JX1 C;  3AI5 A;  1A70 A;  1SB3 C;  2DEN B;  4OVU A;  4W9L A;  1PPD A;  4X57 B;  2N9X A;  1YUB A;  3R7Q A;  2CRU A;  1YE9 A;  2X8X X;  1IXS B;  2P5T A;  3ALB A;  1H4R A;  2KC2 A;  3ZKJ C;  1VEK A;  4LZZ A;  2MP2 A;  3HM3 A;  5LXI B;  4KGR A;  2DXI A;  2Y6E A;  3ZJU A;  1GKI A;  1KF6 B;  4L16 A;  2WU5 B;  1UEL A;  1KFU L;  1J0G A;  3HZJ A;  3JW0 X;  3A9K A;  1L6V A;  3RE8 A;  4AG5 A;  2AYO B;  2JXX A;  4HL4 A;  1TT5 B;  3ZNG C;  3USV A;  3JVZ X;  3KYC D;  4RFB A;  1CQD A;  4NRV A;  4PK1 A;  1KFV A;  4PT5 A;  1W5T A;  3B21 A;  2JSV X;  3JSV A;  1PRB A;  1QUT A;  2NQ8 C;  2OP3 A;  2PRE A;  5A24 A;  3RNC C;  2R46 A;  2N35 A;  3GLI E;  1XLP A;  4NAM A;  2UUC M;  2NR2 A;  3H7P A;  3DA1 A;  1WMH A;  1I42 A;  4B3T M;  4WUR A;  4M9S A;  2YJB A;  2M60 A;  2BWF A;  2IO0 B;  2CB5 A;  1V92 A;  2C9O A;  4QNR A;  3P4R B;  5D7G A;  1JQP A;  1K3X A;  1SGH A;  2J42 A;  1KH0 A;  1L8Q A;  1F2B A;  1V5O A;  3KUZ A;  2D07 B;  2VII A;  2RR9 A;  1WGR A;  3FE3 A;  2W9N A;  2Z0E B;  4I05 A;  2JY8 A;  3PVL A;  3KWZ A;  4LRT A;  2FCS A;  2M17 A;  4CDE B;  2AUZ A;  2QJL A;  4XK8 F;  3SAU A;  4MGK E;  5EP3 A;  5G2N A;  1NO1 A;  2G3Q A;  3ZNH B;  2B3A A;  1HNZ M;  2R0I A;  2VDB B;  2WXQ A;  1NSF A;  1OTR A;  4JI7 M;  2XK5 A;  1WFY A;  4L78 A;  2N7E A;  4NXM M;  4KZ0 A;  1QDR A;  1W5S A;  4QRV A;  4GC5 A;  2C98 A;  4QOZ C;  2WYQ A;  1DEU A;  1HQC A;  1E9S A;  1XEE A;  3RVW A;  4GHL A;  2CJO A;  3TIX A;  4IBI A;  3E46 A;  2RD0 A;  2IZV B;  2KWU B;  3WHL A;  2G1E A;  3PT2 A;  1LV7 A;  2KMM A;  3HHW A;  2YEP F;  3NUH B;  1JWS D;  2JVC A;  3MJ5 A;  3PZ8 A;  3SHQ A;  1B1Z A;  1WH3 A;  5D6J B;  2HKJ A;  3MK6 A;  1K3B B;  3PVS A;  3ZJT A;  2DC6 A;  4II2 B;  2R6N A;  3KP1 E;  1F1H A;  1I4H A;  3IEC A;  3GLF E;  1FCC C;  3APC A;  1KM7 A;  3W67 A;  3HWS A;  2C9W B;  4G4N A;  3EIH A;  5CX3 A;  3A9J B;  2K3U A;  4GRI A;  2WXR A;  2Z8Y M;  3M63 B;  4IBB A;  3B7Z A;  3M95 A;  2PE6 B;  1S4V A;  1ZQ9 A;  4DK5 A;  2DNF A;  3GLI B;  1E9R A;  3DVG X;  1IY0 A;  3WXE A; 
#chains in the Genus database with same CATH homology
 8CAT A;  2ACZ B;  4KO8 A;  1OQQ A;  1T6B X;  3U7Z A;  2AGA A;  1QQR A;  1QOA A;  2VQF M;  3SAR A;  1Q3C A;  4JI3 M;  2WXN A;  4PDG A;  1TS4 A;  2PMV A;  2VZK D;  4B3R M;  1ROE A;  3VKH A;  2E3T A;  1KTK A;  4XWT A;  1HT1 E;  2C9C A;  3KDS E;  1J7B A;  2F5P A;  4FCT A;  1TDZ A;  1KLU D;  4IBK A;  2C5R A;  3RGP A;  2OED A;  3M6A A;  1D2N A;  1XXH A;  4G4O A;  3SHF A;  1FFU A;  4IBJ A;  3THG A;  1IY1 A;  1DOY A;  3J7A S;  4LLG M;  3AM9 A;  1F0Z A;  2CHQ A;  3GLF B;  1NHG C;  1K82 A;  2DWM A;  2Z84 A;  1I4W A;  1XNR M;  1NY6 A;  1C4P A;  4MT5 A;  3WHK A;  3SYL A;  2WXG A;  3U52 E;  4DR1 M;  3L4P A;  1PJJ A;  1ZDV A;  4IJE A;  1SXT A;  1FJG M;  2DWQ A;  3ZH9 B;  4DV0 M;  5EQT A;  5H8Y E;  2UU9 M;  4LJ5 A;  4LFA M;  1UWM A;  4DV6 M;  4B0E A;  4D8E A;  2SAK A;  3QAU A;  3A98 B;  1T3T A;  4JXJ A;  1GOZ A;  4JN6 A;  3HU1 A;  1VR9 A;  1CQV A;  4L4U A;  1HT2 E;  3BBA A;  3HU2 A;  2R4J A;  3BVG A;  3R9X B;  5ITQ A;  1AW7 A;  2GI9 A;  3U61 B;  4FCV A;  3OWE B;  2UXB M;  1E10 A;  3W0F A;  2BS4 B;  4GH9 A;  3GQ5 A;  2Y21 A;  2YR0 A;  2K9X A;  2LEK A;  2QIE B;  1F2R I;  2CV1 A;  1TKE A;  3PXG A;  1N36 M;  4YSX B;  3HJS A;  3OTO M;  3AEB B;  4FWD A;  4AQY M;  3P42 A;  4XDC A;  1FMA D;  2H89 B;  3U2S C;  2EA0 A;  2WU2 B;  3KOY E;  4YTM B;  2Y0Q A;  3W2D A;  4M0W A;  3LYY A;  4RKX A;  1VLB A;  2KEB A;  4PD2 A;  1ZXH A;  4GKK M;  4PDI A;  3PSE A;  1E9M A;  1C77 A;  1V1P B;  2QEN A;  3U60 A;  5LMU M;  3HVD A;  2QBY A;  4WIP A;  4AG6 A;  3PHX A;  3U6C A;  4LF9 M;  5EP1 A;  1JR3 D;  1HNW M;  3U6L A;  3MP2 A;  1PVJ A;  4D82 A;  4DR4 M;  2QEJ C;  4OVZ A;  4YSZ B;  4NZL B;  1SXJ C;  1BML C;  2RGH A;  4KLN A;  2VQE M;  3MHV C;  4DV4 M;  3P1M A;  3CF2 A;  3NVZ A;  1C79 A;  4CQN A;  4C56 C;  1SXJ E;  3ZQ4 A;  3HU3 A;  2DYO A;  1ORY B;  3DWG C;  5HFY A;  4B7H A;  4D8I A;  2LH0 A;  3LQQ A;  4AS1 A;  2XEP A;  4BLC A;  2SEB D;  3B2G A;  3U6D A;  4PCZ A;  1MVK A;  1R6B X;  1Z6T A;  3AE8 B;  1QYR A;  1GVN A;  3SAW A;  4MGZ E;  1CK1 A;  4TQ1 A;  4R3D A;  5HHD G;  4CHT B;  3I4Y A;  3BZD B;  2FBW B;  3GPX A;  1E0Z A;  2CHG A;  2Z4R A;  1AWD A;  2LJI A;  2D7E A;  4YTP B;  3BYY B;  3CF6 E;  3BB7 A;  3GRV A;  2E6X A;  2CV2 A;  4XBO A;  3T3N A;  1XMO M;  1GB4 A;  4MGY E;  4MM3 B;  4N59 A;  2F4V M;  3VR9 B;  1DGH A;  1DOX A;  5AUI A;  1TYG B;  3VDU A;  5C2T B;  4AQ7 A;  3AV8 A;  3I51 A;  1LO5 D;  2JQR B;  1SXJ B;  3HHY A;  1FRD A;  5E26 A;  2F5S A;  1N77 A;  1YJI A;  2XN9 C;  1Q39 A;  1PGB A;  2M56 B;  4BOU A;  3MTV A;  4A3V B;  3PFI A;  3OQC A;  2W54 A;  2M5Z A;  1EWY C;  5H37 D;  1FCL A;  4IBG A;  2AQ3 B;  2MH7 A;  3BII D;  2DLB A;  3PO0 A;  1TS2 A;  2LMC A;  4ZTB A;  4WAF A;  4DV1 M;  1FRR A;  4OZA A;  4LF5 M;  2X4A A;  3MFG A;  4JI8 M;  4YSY B;  4MB7 A;  2XSZ A;  3GRY A;  2W82 A;  5EXT A;  2V1C A;  4NSR A;  4JI6 M;  2J7Q C;  3K8Z A;  3AEA B;  3PNV A;  3FTF A;  3JAM S;  1JQ4 A;  1D6E C;  3QWL A;  4FCW A;  1TKG A;  3CWI A;  5GKN A;  4Z8X A;  4B3M M;  2QZ4 A;  3GP1 A;  1I7H A;  4YTN B;  1VZ8 A;  4IBD A;  3NWL A;  3TL4 X;  5F3W A;  1QT9 A;  3SFD B;  1NEK B;  1QAQ A;  4ZRP A;  1EWC A;  3GO8 A;  2CE7 A;  3SFZ A;  2MEK A;  3ZGZ A;  3FYD A;  3AE5 B;  1STE A;  3Q8C A;  2MJD A;  3VQI A;  3PNY A;  3SC3 A;  1I94 M;  5JXV A;  3SFE B;  5C3J B;  1JAL A;  1L0V B;  5BYS A;  2AX5 A;  5BPV A;  3NRZ A;  4REZ A;  1YSY A;  3ZNH A;  4DXF A;  2KZS A;  3TEY A;  2LHD A;  5BMG A;  1NNJ A;  3U4E G;  4JI2 M;  4A9A A;  1R2Z A;  2L7I A;  4DUY M;  4B7F A;  3VRA B;  4GIT A;  5GXG B;  4RF1 A;  1L4D B;  3PHU A;  3FTE A;  1TKY A;  1JWA D;  4XGI A;  4ITK A;  4QNM A;  4UDU C;  2R45 A;  3V05 A;  4RGM A;  3AEE B;  2WDV B;  2O5R A;  1L5P A;  3AL0 C;  3TPZ A;  3PZ7 A;  1T5X D;  3GLI A;  5IWA M;  1QQW A;  4GDK B;  3LB8 C;  4JWS C;  4LRS A;  3ZCB B;  3LVW A;  3NVY A;  4YXD B;  4XDD A;  2JZP A;  4YHH M;  1ZOY B;  4D81 A;  1HR0 M;  4M0D A;  4ZOH C;  4GLS C;  3BVM A;  4XZX A;  2TSS A;  2V6Z M;  1C4A A;  3FTC A;  4G6Z A;  5BMH A;  1D4B A;  3AB5 A;  5EZQ A;  4AI6 A;  2KAJ A;  1UWX A;  1XCQ L;  3BK2 A;  1N33 M;  1JRP A;  1M4V A;  3AOE C;  3M7G A;  4X64 M;  2WXM A;  5KO3 A;  1Z5C A;  2HCB A;  4B3S M;  3SHG B;  2QSD A;  1QF6 A;  1PUT A;  3GLG B;  2N7J A;  3T15 A;  3U6Q A;  3AFH A;  2L83 A;  4AZF A;  1ACC A;  1RWS A;  3C8Y A;  4II7 A;  5KPT A;  2RDG A;  4X62 M;  3RFW A;  3AOG A;  2JYT A;  4P16 A;  5EE3 A;  1QOB A;  1N5X A;  1H6U A;  1TH2 A;  2BJV A;  3KOW E;  1IN6 A;  1AN8 A;  1QOG A;  1IN5 A;  2ZBK B;  1BXT A;  2K47 A;  4P6V F;  1N62 A;  2WXK A;  2XNA C;  3R2I A;  1UNS A;  1HA5 A;  2DWN A;  4DQO C;  1HEZ E;  2J7N A;  2J7O A;  1VDV A;  1C1K A;  3J27 B;  5A2Q S;  1IGD A;  1HXY D;  4LJ7 A;  1HZ6 A;  2ZAM A;  3AE9 B;  4C7Z A;  3U61 A;  3B9P A;  3T1H M;  3O65 A;  3AE1 B;  5FK9 C;  2PKO A;  1OFI A;  2H88 B;  3TE6 A;  1F77 A;  4DV3 M;  5ITR A;  1TGU A;  2N9L A;  5JI3 E;  2KRK A;  3KSX A;  1Z5B A;  3CF0 A;  1WGK A;  2Y3A A;  2H1R A;  4DXG A;  2XZU A;  4L2Y A;  1WWT A;  2IGH A;  2ZAO A;  4S12 A;  3BY4 A;  4RH6 A;  5EP2 A;  1JWM D;  1NJF A;  1V1P A;  1TJE A;  2XLJ A;  2NTS A;  4O1N A;  1QIL A;  2VZK B;  3DFZ A;  4GC9 A;  1K53 A;  2LFI A;  2XGN A;  3L26 A;  4H2A A;  4OZC A;  3HJQ A;  2RKO A;  3JR4 A;  1FNV A;  4US9 A;  2Y0T A;  3TSS A;  3AJI B;  1N78 A;  1TY0 A;  1BUI C;  1FFV A;  1FXI A;  1G59 A;  2HTM E;  1DGB A;  5EE1 A;  3DWM A;  2CJN A;  4JI0 M;  2L09 A;  2Q5W D;  1TDH A;  2FOI C;  3E9S A;  2UXC M;  3P4P B;  1DGF A;  2K0P A;  2X49 A;  1J5E M;  1MPE A;  1WXQ A;  1DGJ A;  1G4A E;  1SSN A;  2X8A A;  4LF6 M;  3VDP A;  3UJN A;  1MX0 A;  4RGO S;  1DYQ A;  3I57 A;  2ON8 A;  4MGI E;  3GRU A;  3IXS A;  4ZHP A;  2Y5P A;  2CEA A;  4DV2 M;  3Q8A A;  3KS4 A;  3KOZ E;  1PGA A;  4LF8 M;  2FE8 A;  5FTK A;  1YMH E;  4KGS A;  1N34 M;  3RPF C;  3GRR A;  1XLQ A;  2A5Y B;  1V8C A;  4EIW A;  3IT6 B;  1I4R A;  1FO4 A;  1L0Y B;  1KSF X;  4IDI A;  1ET9 A;  3AE3 B;  1ZE3 D;  1C4C A;  3KOX E;  3KW6 A;  2K22 A;  3W31 A;  3AED B;  1DO0 A;  2AQ1 B;  1NVI D;  3IFU A;  3EIE A;  1JWU D;  2X38 A;  1KYI A;  2EUC A;  1SF0 A;  2Q2E B;  3E4R A;  4L15 A;  1ESF A;  4QHS A;  1MHX A;  1TY2 A;  3RNV A;  1SXJ A;  3ABV B;  3L25 A;  2UZJ A;  5FSW A;  3U6P A;  3TRK A;  3VK7 A;  4BOQ A;  1QAO A;  3BWU D;  3LXF A;  4DV5 M;  2D5G A;  1SJE D;  4EE2 A;  1FXA A;  3PHW A;  3GLH A;  3TWK A;  4JI4 M;  2XZF A;  4HXD B;  1VDD A;  4JE3 B;  1TH3 A;  2CUZ A;  2INN E;  3CTW B;  5FTM A;  5BYR A;  2JA2 A;  1KFY B;  2KAC A;  4DV7 M;  2BU3 A;  1R7R A;  3TEX A;  2KRU A;  2M0A A;  3GQ4 A;  2BB5 A;  4KKI A;  3AEC B;  1NJG A;  4IBF A;  2LUM A;  1G3I A;  1PGX A;  2PVG C;  1CJE A;  3Q69 A;  2CFO A;  2DWZ B;  5EXS A;  4LK0 M;  2W3R A;  3ZC7 B;  3AEF B;  1IBX B;  3U5Z B;  1IUE A;  1DOI A;  3HKP A;  3GQ3 A;  2BYT A;  2OQ4 A;  3I4V A;  5BR8 M;  4G4R A;  4LFC M;  2GRI A;  3MC0 B;  3H4M A;  2DOS A;  3SR6 A;  4ZYS A;  3UZU A;  1QZM A;  3BVZ A;  3AE6 B;  4HJG E;  2WXP A;  3J81 S;  3SEB A;  2HWK A;  3KXE C;  2QIL A;  4A6Q A;  1E6E B;  1J7K A;  4A55 A;  5HI1 A;  3E56 A;  1RFK A;  1ZUD 2;  1YZB A;  3VRB B;  3KSJ A;  3TUO A;  1R7S A;  1UUP A;  1V97 A;  1IQP A;  2L32 A;  4MH8 A;  2V0G A;  3HJ8 A;  2MJE A;  2IGG A;  1L2B A;  1QKZ A;  1HQY E;  1OJL A;  1E32 A;  1J7A A;  1L2C A;  4QOS A;  4RGN A;  2XFS A;  2CU3 A;  2G8L A;  3I9V 1;  5FKA C;  4FWG A;  1JRO A;  2QMT A;  3NVW A;  2BJW A;  1ET6 A;  2M19 A;  5E6J A;  2XF3 A;  4BBA A;  2J52 A;  2N9K A;  3D8B A;  4YY3 M;  3VFD A;  2JX5 A;  1UKF A;  5ITY A;  2HDE A;  1IGC A;  4JV5 M;  1L4Z B;  1N60 A;  2MJ3 A;  2BT6 A;  2WXH A;  3R2T A;  4JWU C;  2CHV A;  4ARC A;  2DZO B;  3U6E A;  3Q8E A;  1G41 A;  3P63 A;  2YNM D;  2J7Q A;  1D5Z C;  3ILK A;  5KQ8 A;  2Z8L A;  4RF0 A;  2NTT A;  1SE3 A;  4OHJ A;  1E94 E;  2AHM A;  2C99 A;  2HL7 A;  2F5Q A;  4XE0 A;  2K5P A;  1DGG A;  4AKG A;  3GPY A;  1I4G A;  4GKJ M;  1TS5 A;  1QOF A;  3GPU A;  2I7N A;  1IM2 A;  1OFF A;  1QVR A;  5ITT A;  3T38 A;  1TS3 A;  1UM8 A;  4OX9 M;  3SAV A;  2BTW B;  3KFU G;  4I8O A;  3FIL B;  3GB1 A;  3O13 A;  4RCO A;  2V4I B;  1L6U A;  1XO3 A;  3FKE A;  3GS2 A;  4JI5 M;  3KLS X;  4B7G A;  4RGT A;  4HRS A;  1AYF A;  4LG2 A;  4LFB M;  1SEB D;  1TH4 A;  5MPO A;  3W5U B;  2WNM A;  2OHF A;  2JYE A;  3A46 A;  3UGJ A;  3IAM 1;  2BTE A;  5FR3 A;  2LGI A;  2W55 A;  1UGJ A;  4FVM A;  4A90 A;  1IY2 A;  1DKI A;  2L7H A;  1SE4 A;  4BOP A;  2LNH C;  2NMQ A;  5T8I A;  4LJ4 A;  3LMM A;  1GPX A;  3TEZ A;  3D8L A;  5D3D A;  2QPA A;  1D5M C;  1SJH D;  4Z6Y A;  4LJA A;  4US8 A;  1QAM A;  4TSS A;  1NY5 A;  4GHA A;  4IOI E;  3B2F A;  5DNY A;  2CV0 A;  4LZJ A;  2C96 A;  2J53 A;  5G5G A;  2RPV A;  3HGI A;  1P7F A;  3T1Y M;  2D7H A;  2LHE A;  4LGM A;  4KX6 B;  4D80 A;  2XSZ D;  4NRW A;  3T3O A;  1IBM M;  3IAS 1;  1FNU A;  7CAT A;  4GDL B;  3FUX A;  5DYG A;  4Q2J A;  3LQR A;  3Q8X A;  2AQ2 B;  1YN5 A;  2FFJ A;  4HEA 1;  5ITX E;  2G5G X;  2WDR B;  4DR6 M;  1ZDX A;  1PJI A;  4BB9 A;  1N75 A;  2WXF A;  5EE0 A;  1IN4 A;  1C9F A;  2UUB M;  2XFT A;  2XH9 A;  1N63 A;  1HQR D;  3FAH A;  2DZN B;  1VJK A;  5LMN M;  3Q8F A;  4NAW B;  4ZRQ A;  3BK1 A;  4TUW A;  4B0M A;  3BOS A;  4LJ6 A;  3SYK A;  3AMZ A;  1ZP0 B;  2PVO D;  3AOE A;  4YT0 B;  4K0K M;  4DR5 M;  1OQR A;  2WXO A;  2FNA A;  3UK6 A;  1WSP A;  3KWL A;  2PW9 A;  4XWW A;  3RFZ B;  1JML A;  5FTL A;  4JPS A;  1I4Q A;  1C76 A;  3A42 A;  4KGT A;  1I4X A;  4LJ8 A;  2R62 A;  3BYT B;  1YN3 A;  2WLB A;  2QP9 X;  2BS3 B;  1VRA B;  3HVZ A;  3GLF A;  2J4X A;  3L2A A;  4X65 M;  1D5X C;  3U6S A;  2RGO A;  3TEW A;  3HHX A;  2F5O A;  3HUI A;  3AH7 A;  4W5W A;  1KRH A;  1K3W A;  2IPK D;  2N0S B;  3GPP A;  1YQ4 B;  4X66 M;  2I2Y A;  3IG5 A;  4KKJ A;  1T3Q A;  1EM7 A;  4LGY A;  1KLG D;  4WQM A;  1WRI A;  2BB6 A;  5H92 C;  1XCT L;  4J3O D;  5EZS A;  3C58 A;  1K50 A;  5EXP A;  2JXT A;  4ARI A;  1FNN A;  4IJF A;  3SMS A;  4LF4 M;  2R4E A;  1RYJ A;  2IGD A;  2V3P A;  4LY6 A;  1IN7 A;  1Q10 A;  2V1U A;  4OZB A;  4D2K A;  1PM5 A;  3R8F A;  5EXX A;  4NL4 H;  1IBL M;  3UI3 A;  4MH0 E;  1C78 A;  4N58 A;  3SAT A;  2R61 A;  3RGS A;  5FLX S;  5G5H A;  3FTD A;  3AE7 B;  1N32 M;  1PDX A;  2R18 A;  4MI7 A;  3W9C B;  3LVV A;  3K2L A;  3TWM A;  4RNA A;  3SAS A;  2EKI A;  2WXJ A;  4IBC A;  4A8X C;  2EO2 A;  1DO2 A;  4CGY B;  1XWI A;  2KXE A;  1GL7 A;  3P4S B;  3EUB 2;  2LXE A;  4C80 A;  3VK8 A;  4IP3 A;  3DOA A;  2YQZ A;  3J80 S;  1WYG A;  4IIW A;  4CIS A;  2WS3 B;  1PYW D;  3J9C A;  2UXD M;  2IDY A;  4DR3 M;  2PLP A;  1J7C A;  1EE8 A;  2DWL A;  4AKH A;  2Z3X A;  1Q3B A;  3EGR A;  1FM0 D;  2DBY A;  4M9X A;  3FUW A;  1YJJ A;  1ZAE A;  4TQ0 A;  1JR3 A;  1NNU C;  2WQY B;  2KQ4 X;  3URY A;  2I7P A;  3L28 A;  1ENF A;  1I4P A;  4A5U A;  2JU6 X;  2Z4S A;  2ZAN A;  5FTJ A;  5EJC A;  3IT4 B;  1N61 A;  4JI1 M;  3N9Y C;  1NYR A;  3NS1 A;  5EE9 A;  3HRD D;  3KVW A;  3ETR A;  3MP9 A;  1IBX A;  3UMM A;  1IXR C;  3U5Z A;  5DYI A;  3P4Q B;  5IT9 S;  3FUU A;  3KWV A;  1Y56 A;  3AEG B;  2KZU A;  1NHW C;  2BS2 B;  3AN1 A;  3W1S A;  5C1B A;  4C7Y A;  2R65 A;  5ITU A;  3EA6 A;  5LNK 1;  3H8H A;  2INP E;  4OU7 A;  2WXL A;  4BOS A;  4NXN M;  4IKG A;  3KQ4 A;  5EP4 A;  1MU5 A;  1XNQ M;  5C18 A;  2WDQ B;  4N6E B;  3L29 A;  1OFH A;  1GL6 A;  3VKG A;  2YEP B;  1Z5A A;  4G4Q A;  4I81 A;  2ERC A;  2D7G A;  1NI3 A;  1GLN A;  1XXH B;  1QAN A;  3FC4 A;  1YN4 A;  2DVW B;  1G8P A;  3K92 A;  1XLO A;  5KPR A;  1YQ3 B;  4B08 A;  4GMQ A;  1L1Z A;  2ZW1 A;  3U6O A;  3PRM A;  4DR7 M;  1IBK M;  2W3S A;  5HG2 A;  2G9H D;  2KWD A;  4DR2 M;  4D8B A;  5KQD A;  4R7G A;  1MI0 A;  1QLB B;  3JR5 A;  4BOZ A;  2EEL A;  2QCU A;  1ZXI A;  2DYM A;  1JW9 D;  2KDM A;  2JWU A;  4AW4 A;  3NZ3 A;  2JTC A;  1P7E A;  3K1J A;  4GUA A;  1NEN B;  2BTW A;  3ZJV A;  1TZO A;  4DUZ M;  3FIL A;  2RDH A;  4WWM A;  4WH4 A;  2WP9 B;  2BBC A;  4L8R C;  5TSS A;  4IUM A;  4QHT A;  1EU4 A;  2L1A A;  3W30 A;  1SIJ A;  5BMI A;  4NSO B;  3GP7 A;  3FUV A;  4ZHO A;  4MGH A;  4ITQ A;  2E5L M;  1L2D A;  4KOD A;  2OPF A;  2FUG 1;  1SXJ D;  1K52 A;  4JYA M;  2KN4 A;  3FUT A;  4I4L A;  2UUA M;  3HHZ A;  4LF7 M;  1B9R A;  3PRP A;  3MHZ A;  4ZPX A;  1E7P B;  2RMM A;  2BW2 A;  2KA6 B;  3U60 B;  3M0E A;  4HKQ A;  2QBY B;  1FIQ A;  1FEH A;  1FD6 A;  3W0L B;  2LWX A;  4AKI A;  5JZE A;  4M9Z A;  1SE2 A;  1NVM A;  2PIA A;  1XHB A;  2B76 B;  3GLH B;  1JQJ C;  3R8B A;  2ZW0 A;  2HHH M;  1F2R C;  5D3I B;  4OVZ B;  2Y5C A;  2ONQ A;  3L27 A;  1J09 A;  3NBI A;  4YWG G;  4HKZ E;  4NJC A;  1YNT E;  3AKZ A;  1L0X B;  4FD2 A;  3VR8 B;  1S3S A;  1Z59 A;  1L1T A;  2Y20 A;  4FW9 A;  2I38 A;  4MAC A;  5AUK A;  2JRI A;  3FYC A;  1X37 A;  3SBJ A;  5KPZ A;  4FXC A;  4LTU A;  3Q8B A;  1MHH E;  3AV0 A;  4KHP M;  2WXI A;  3J7B A;  3DZD A;  1XLN A;  1JCK B;  1VZ6 A;  1FNW A;  3AE4 B;  2ZM6 M;  1GB1 A;  1IXZ A;  3V3X A;  3FD9 A;  3VLF B;  3C0R A;  3AE2 B;  3CIR B;  4NOO B;  5FTN A;  1ZPS A;  1XF5 L;  3IG8 A;  2F5N A;  3KS8 A;  1DGH B;  1RM6 C;  2IJ0 A;  1XC8 A;  2ICI A;  1V1O A;  3J2P B;  1N5W A;  1NYQ A;  1K51 A;  1PFD A;  3NVV A;  3ZYY X;  1VZ7 A;  4GIP A;  2L52 A;  3WCQ A;  5BYQ A;  4IBE A;  3GLG A;  3W5V B;  3B9J A;  4TMA B;  2KW0 A;  1HNX M;  4L1B A;  1GAQ B;  4USA A;  3TQS A;  4LCB A;  5ITX A;  2V3N A;  4LJ9 A;  4I5S A;  3SMP A;  4HRO A;  2DHR A;  1SBB B;  5I4D A;  2GB1 A;  3A45 A;  1CZP A;  2Z7J A;  1EU3 A;  3U6M A;  4OW0 A;  5JI2 E;  4L23 A;  1R2Y A;  2PTL A;  3TMP A;  1JWB D;  3TWL A;  1IN8 A;  2YFQ A;  3KP0 E;  1HZ5 A;  4WW0 A;  4FWH A;  4HLQ A;  5IZ7 D;  5IRE B;  1XMQ M;  2BNK A;  2L6O A;  1XXG A;  4JX1 C;  1A70 A;  1SB3 C;  1YUB A;  1YE9 A;  1IXS B;  2P5T A;  4LZZ A;  4KGR A;  2DXI A;  3ZJU A;  1GKI A;  1KF6 B;  4L16 A;  2WU5 B;  1L6V A;  3RE8 A;  4AG5 A;  4HL4 A;  4RFB A;  4NRV A;  1KFV A;  4PT5 A;  1W5T A;  3B21 A;  2JSV X;  2NQ8 C;  2R46 A;  1XLP A;  4NAM A;  2UUC M;  3DA1 A;  4B3T M;  4WUR A;  4M9S A;  2M60 A;  2C9O A;  4QNR A;  3P4R B;  5D7G A;  1K3X A;  2J42 A;  1KH0 A;  1L8Q A;  2VII A;  4LRT A;  2QJL A;  3SAU A;  4MGK E;  5EP3 A;  1HNZ M;  2WXQ A;  1NSF A;  4JI7 M;  4L78 A;  4NXM M;  1W5S A;  4GC5 A;  2C98 A;  4QOZ C;  1HQC A;  1E9S A;  1XEE A;  4GHL A;  2CJO A;  4IBI A;  3WHL A;  2G1E A;  3PT2 A;  1LV7 A;  2KMM A;  3HHW A;  2YEP F;  3NUH B;  1JWS D;  3MJ5 A;  3PZ8 A;  1B1Z A;  2HKJ A;  3MK6 A;  3PVS A;  3ZJT A;  3KP1 E;  1I4H A;  1FCC C;  3HWS A;  4G4N A;  3EIH A;  2K3U A;  4GRI A;  2WXR A;  4IBB A;  1ZQ9 A;  3GLI B;  1E9R A;  1IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...