4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like protease
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
4PT5A 5E6JA 4RF1A 4REZA 5KO3A 4M0WA 3MP2A 4RNAA 4R3DA 3MJ5A 4P16A 4MM3B 4OVZA 4WURA 4RF0A 2FE8A 4OVZB 3E9SA 4OW0A
chains in the Genus database with same CATH superfamily
1L0XB 1ZMUA 2X8AA 2VRRB 2FOIC 3PFIA 3AEAB 4MGKE 4MACA 4YSYB 3C0RA 3AE8B 3K9OB 3F5VA 4W9HA 2K6DB 4C4VA 4BOPA 2L0FA 3HY5A 3SYLA 1E0ZA 5D94A 4YHHM 2ATOA 4QHTA 1ZP0B 1IQPA 2RKOA 2GLSA 3VUXA 4YYQA 2AEHA 4W9EA 1EE8A 3L0WB 2WGSA 4OVVA 1VLBA 2MH7A 1WE6A 5ITXA 4HJKA 3RNEC 2V3SA 2EMSA 2JY8A 1R4NB 2MQJA 3FD9A 3HHYA 3ZQJA 2C96A 3TPZA 3I4VA 1T3QA 4BS6A 1GL6A 3J80S 4MEMA 5EP4A 5EE0A 4W5CA 3SD5A 2H1RA 2G6DA 1WMHA 1ZPSA 2FFJA 2GRIA 2PTLA 4NXNM 3RNFC 1OQRA 2BBCA 1E9SA 1K82A 1E5WA 2W54A 2C99A 5JI3E 1XLNA 3AJIB 1QUSA 3ZIMA 1NVMA 1EWPA 1GMYA 3RNAC 2DZZA 3F75A 1IN7A 5IO9A 3DBLB 4IOIE 2VDBB 2FCNA 3SBJA 3KOZE 3AH7A 3DHIC 4D8EA 4RM8A 1TR8A 2O6VB 3K2LA 4Q8HA 1TF0B 5IZ7D 4IBCA 2J7QB 2KDMA 4PP2E 2C7MB 2DXIA 4HJGE 2XGNA 2DX5B 4IBIA 4GDLA 2G4DB 2OJWA 1LTMA 3JAMS 1VEGA 3B2FA 5EZSA 4MGIE 1QYRA 3FTFA 1XCTL 1S3SG 3APCA 3DBHI 2G5GX 2E6XA 3AECB 1WHCA 4F8CB 1XLPA 3Q8FA 2WXPA 1R7SA 1YQ4B 2ZEQA 3MC0B 1F77A 3U6QA 1DV0A 2CJOA 2UYZB 3UMMA 4GOCA 3KWVA 3UZUA 4CDDB 3C58A 1MX0A 1B1ZA 2IO3B 2PMVA 1KF6B 3Q69A 1DEUA 3U61A 1IY0A 1XXHB 2MJ5B 3AXCA 3OWEB 2MRPA 1TGZB 2INCC 3LXSA 3Q8XA 2JRIB 3NHEB 5C23A 3KVFB 3HM6X 3VRBB 4XDDA 3PSEB 1K51A 3RCZA 3A33B 4DHJD 3PRPA 2JXXA 1FXIA 4NNJB 4TKNA 1F2CA 2FT2A 4R71A 1V2YA 1E7PB 2OHFA 4A8XC 1NB3A 3PV1A 2B76B 2UUAM 2DHRA 3RMKC 2Z4SA 3A9JB 3AEEB 2P5TA 2IYDB 4JWSC 4HPMB 4GMQA 4IIWA 1XXGA 4IC7B 4N6EB 2BB6A 1HZ5A 2XU1A 4BPVA 1NVID 1CMXB 1Z5BA 3IAS1 1YLAA 4HLQA 1OAIA 1TIFA 2DKLA 5BMHA 1V5OA 2P7UA 3BC3A 3GZNI 4ZRJA 3MTNA 3TL4X 5GKNA 3UK6A 1WI0A 3I01M 2PVGC 3WIMA 3PHXA 3FYDA 2FUG1 1KLVA 4RGTA 1WGGA 4RKXA 3R9XB 4WAFA 4YTNB 4B0EA 1NDDA 3L17A 1I4XA 4GUAA 2O25A 2XFTA 2KN5A 4FJYA 2AU1A 2NBVB 1QF6A 1LO5D 3SU8X 3KW9A 4K7UA 3GLHE 1C79A 3R2TA 4OX9M 1EU4A 3KW5B 1U9QX 3FUUA 3CSTA 3OJ4B 3U6DA 3TEWA 3J7BA 3HK0A 4MB7A 3PHWB 5C2TB 2WBFX 3A9KB 2YJ2A 4IKGA 5BPVA 4FA6A 4PS3A 1ZQ9A 1E6EB 2QCZA 1JWBD 3EECA 3ZNID 3ZGZA 1IN8A 3V05A 3QC8B 1T6OA 4HKZE 3PPAA 4G50A 2OEDA 3KYDD 1UNSA 3LQQA 2VQFM 2JZPA 4DR6M 4XDCA 1NENB 4JIOU 3ZNZB 3E21A 4W5BA 2B1NA 1W5TA 3LYYA 2G3QA 4JI8M 4HWIB 2MHJA 4LRSA 4HK2A 2D3CA 2LRWA 5MPOA 4F1SA 3RD2A 1TKGA 2L6OA 2PJHA 3CH2X 2ZTDA 3X0WA 4YT0B 3U8EA 1PJSA 3WHLA 3L26A 1G4AE 2KZSA 5L8RF 3H89A 2R62A 4KKIA 2XN9C 1HZ6A 3AEGB 2LVPA 4ANWA 3H8CA 3TEYA 2WSCF 1WYGA 2KEBA 5G55A 3N3GA 3A42A 4K0KM 4HKQA 2C60A 2K3UA 2VQEM 3AFHA 1TH3A 1WZ3A 4KO8A 3T8MA 1TKEA 2WXOA 2CEAA 1AU3A 2R45A 4AUQC 3CH3X 2NCNA 3QJ3A 4LF7M 5DPTA 3R8FA 1ZGUB 4XWWA 1BP4A 2CV2A 3W5UB 2R9CA 1L2DA 2KYWA 2B3AA 4MGHA 1V92A 3EUB2 1DGJA 2Y5PA 2OZ2A 3RVVA 3WALA 4LRTA 3ZXVA 4CO7A 1SIFA 3KS4A 4XBOA 3A4RA 3MHZA 3ZTDA 4YTMB 2BS4B 2BS3B 4KGSA 1FCLA 2DC8A 1J5EM 1GABA 2G8LA 2BWEA 1WGRA 2KDEB 4IBKA 4LF8M 2NQIA 3RVXA 5LXIB 3VDUA 4DR5M 3QHTA 1S4VA 2NQDB 3N1ZC 4PS7A 2DZJA 2KNAA 2C9OA 1T6BX 2VHSA 2AIMA 2DZLA 1U9WA 1UKFA 4NY0A 4P6GA 2WXQA 1DO0A 3A1QB 3KSJA 2XF3A 2KT7A 2R61A 4I5SA 2V4IB 3L13A 2B1MA 5FPWA 2C7HA 3H6NA 3VTVA 4YYRA 3KS8A 3X23A 2DOSA 2G1EA 3V61A 1H4RA 1GB1A 4CISA 4WQMA 2BWBA 5BYSA 2HAKA 3NY5A 4WAAA 5G5GA 2Z59B 4KT0F 5EXSA 2F1GA 1AU4A 3BOWA 4D8IA 1QANA 2XZUA 4N4ZA 1ZUD2 3EGRA 3AKZA 1KSFX 1CPJA 2KN4A 1PPDA 2R4JA 1SP4B 3LCUA 4WURA 4GKJM 4I07A 4HEOA 1NJFA 3RPFC 1WGHA 2JUOA 4UDUC 4AJYB 3TRKA 4RKUF 2O6VD 3M62B 2VF7A 3BPMA 3KOWE 3L25A 3DBSA 4LF5M 3IT4B 4MSXA 3U6EA 4PS8A 2K1FA 3KFQA 5EJCA 4ICUA 4AW4A 2H88B 4WWMA 2JT4B 2EKFA 3GQ3A 1SE4A 2BKRB 2R9FA 3P5XA 3HGIA 2DAKA 2CU3A 1CSBB 4WP2A 1JROA 4DV5M 1DOXA 3M3JA 4ZYNA 4NAWB 1E9RA 2C9CA 4GC5A 1P3QU 1XHBA 1LFDA 4LZJA 2CE7A 3HU1A 4OZBA 2DCCA 4PADA 2P86A 4HROA 2LTUA 2E3TA 2KWCA 2B3TA 3ZCBB 1N63A 1YALA 2MR9A 2JP7A 5H8YE 2LVOA 3OF9A 4YV8A 3GO8A 1GAQB 1WM3A 3P5UA 1N78A 1C77A 1SXJE 4DQOC 1MJGM 2AHMA 3KSXA 1N61A 3SAUA 4L8RC 1FFUA 3HRDD 2NVUI 3DZDA 2CB5A 4DBGA 2HTME 2UXCM 2N1VA 1QLBB 2XBBC 3TMPB 3FKEA 2INNE 4ZHOA 2KZRA 4G54A 3V60A 4GRIA 2WXKA 3AU4A 4MGZE 2AWTA 2BYVE 2G45B 4FJZA 3IFUA 1GLNA 4KDLB 1AIMA 2KFKB 2LUEA 2UU9M 4M0WA 3HUIA 3R7RA 2N7DA 1GC7A 2AX5A 4EZKA 2M19A 4C80A 1N60A 5KQDA 3WAOA 5FLXS 4MH8A 2QSFX 3OJ3A 1RU3A 3RZFA 3J2PB 1JR3E 3WAPA 1G6JA 1PGAA 5TR5A 2NQ8C 3P4SB 3GLIA 3K1JA 1I4GA 1V86A 1YT7A 3PLUA 1RAXA 1KM7A 2JTCA 5DPRA 4LNFA 1D4BA 3RNCC 1C4CA 2R18A 1DGGA 3H8HA 4JL9A 2BNKA 4CDCB 1NI2A 5ITYA 2V3NA 1S3SA 2LASA 4N58A 2IDYA 1E94E 4ZRKA 4RNAA 2D07B 2UWQA 1WX9A 4NPNA 1L2BA 1NI3A 4GIVA 4DXFA 3DF0A 4R3DA 2WP9B 3BZDB 3EIHA 3L29A 3IAM1 3ECIA 1JQJC 1NPZA 4JYAM 2JXTA 2DC6A 3KVWA 3ZVVA 3LCVB 3ZUNA 2JF5A 1NV9A 1R7RA 4AKGA 1E7VA 2DHZA 4IJFA 4NC6A 2ZANA 1V49A 2MX2A 3KKUA 3PVSA 1QDTA 3K9OA 2GBRA 2N7EA 3A46A 3CSFA 3PGEA 3C9EA 2KLCA 2WS3B 1Q3BA 2WYQA 2AL6A 2INPE 3QAUA 1WGDA 1IN4A 1EFUB 2LGXA 3SAVA 3D6SA 2RDBC 3W31A 2KWUB 1GB4A 5CHWA 3W9CB 5KPZA 1HTOA 4JLCA 2QNJA 3PREA 3CF2A 1YJIA 1YE9A 4ZTBA 2W9NA 2YVCA 2DCBA 2NBUA 1D2NA 2L7RA 4AKHA 4HDOA 4ASWC 3FC4A 2NPTB 3H1UA 3JYUA 2GI9A 1WXSA 5EE3A 5KHOA 3TEZA 3P5VA 1N62A 4AKIA 3IT6B 4IM3A 3B0AA 3QSDA 2YNMD 5FTJA 1P98A 1PGBA 4HEA1 4AJWA 2YJBA 4FD2A 2O6VA 2DZIA 4PYZA 3B79A 1TLOA 1IY1A 2J7QA 4ZPXA 3A45A 4A5UA 1EWMA 2KLGA 3VQIA 1XT9B 1HE8A 3KDSE 4F2LA 2MBQA 2I38A 3DVNV 3DBHB 4M0DA 4IWPA 4IWOA 3KOYE 2QMTA 1Z5AA 5CVNB 1AIPC 2IGDA 5DPWA 1TH4A 2RGHA 4JI7M 1YMHE 2MJEA 2DCAA 1TT5B 4DR4M 2H5XA 4NL4H 1KRHA 4RFBA 2EO2A 2LBCA 1PYWD 4OVUA 1FD6A 9PAPA 4CIZA 5J17A 2CV0A 1HEZE 1KTKA 5FTMA 1FXAA 2DYBA 1XXHA 1FPYA 1DGFA 4EKUA 1YUBA 1TS4A 3IV2A 1MU5A 2JRIA 2FYEA 3NHEA 1VCBA 2DNFA 4I81A 4FADA 1F1HA 3NZUA 1H8CA 4REZA 1EWLA 3PSEA 2WXFA 4M8NA 2KX3A 4L15A 2IPPB 3MK6A 2D10A 2LJ5A 5GXGB 1FCCC 3WXFA 3MORA 3AE6B 2QHOB 4B95A 5DPSA 3FE3A 2W3RA 3U7DA 4QNRA 4TUWA 4A90A 2BDZA 1AWDA 4KODA 2DZMA 2YJCA 4MZSA 1GCBA 4K1RB 3A9JA 3V6EB 3R2IA 4ZYSA 3IXSA 2E01A 2ZM6M 1BT0A 2XEPA 3GB1A 4NQLB 4DV1M 4LF4M 3GZNB 2WLBA 3HWNA 2Y6EA 3J9CA 3NJTA 3B08A 3HKPA 2LEKA 5J94A 2K0BX 1PQSA 3ZDTA 3APFA 4NSOB 1HR0M 1FO4A 2FUDA 3DA1A 3KLSX 4II2B 1RYJA 3SHGB 1WJ6A 4ZHPA 5ITQA 2FTDA 1Y4HA 1P3QQ 5CHTA 3AOEA 3Q8AA 3OAWA 3U6PA 2X38A 4RY2A 3H8BA 1D5ZC 2QBYB 1GJSA 4TUUA 4BLCA 2CU1A 3B21A 4LGYA 1YN3A 4LJAA 2MROB 3M63B 1VJKA 1CS8A 2RGFA 1EUVB 2MJDA 1KHQA 1NNUC 1EWCA 3SHQA 4GDKA 3WXGA 3DCGA 3TEXA 5HHDG 1XLQA 1Q6KA 3U6LA 2QQ8A 1G41A 2KDIA 5IA7A 3SDLC 4RMAA 3PHWA 2O2VB 4FIPA 4JI6M 2OOBB 3LVWA 1VDVA 4KGTA 1LQBA 1XNRM 1M4VA 3JW0X 1K52A 2L8JA 3UJNA 3KX1A 3QYEA 2N0SB 2UXBM 2BTWB 1V6EA 3K9PB 2R65A 3K24A 1A70A 2HHHM 1K53A 1SJED 3QAQA 4L1BA 4X62M 3GRVA 6PADA 4QRVA 1PE6A 2AQ3B 3W0LB 1QILA 3N3KB 2CRUA 3C3EA 3T3OA 4US9A 4BFRA 3HD3A 1MPEA 4D8BA 1Q0WB 3MFGA 4BBNC 1PJQA 3O13A 4KLBA 3GP1A 3W1SA 5JH5C 2KVRA 3PLVA 3E1ZB 1HT1E 1YD8U 1JWAD 1L6VA 2ZTCA 2A4ZA 3MTVA 8PCHA 4LJOB 4KZCA 1DOYA 4XR7A 4P17A 4I6LB 1DKIA 4X64M 1SB3C 3PTFC 4WJQA 2KQ4X 4IM0A 2HJ1A 4K3BA 3U8ZA 4BBNF 3E46A 3JVZX 1FRDA 4DR3M 2FQ9A 5E6PA 3J7AS 1Q1OA 3HHMA 2ZVOA 5EF4A 3GLGE 3DQVA 3UQBA 3O65B 1EF1A 4FHJA 2APLA 3N1YC 4F1IA 1A6RA 1MEGA 1NB5A 3GLFB 3LQRA 3N1XC 4GB9A 2JU6X 3KP0E 4S0RA 4FCTA 1THEA 1VDDA 2DZKA 4D81A 1SXJB 1LM8B 1AU2A 1VRAB 2Y3AA 1RFKA 2BS2B 1DGHB 4WJPA 3IG8A 1UWMA 3FUTA 2BKFA 2ERCA 1MN3A 3KSEA 1I4HA 3ZW3A 3H9DA 2DENB 4KSKC 4KSLC 1E10A 4IBDA 3BK2A 2V1CA 2HXZA 1PJJA 1CQDA 2R44A 1TS2A 3BCNA 2V0GA 3P1MA 5E6NA 4FCVA 3M6AA 1D5MC 3Q8EA 2YR0A 1U5IA 2JY6B 1JALA 2JQFR 1QDQA 1TDHA 4OZAA 2OO9A 2WSEF 2R46A 5EE9A 2BJVA 4A20A 3BBZA 2YFQA 4XK8F 4KVGB 4GH9A 3ZDMC 1YN5A 4ITKA 3SFDB 3HJ8A 1CUKA 3FUWA 1C78A 3A1QA 4OW0A 3SFEB 2OP3A 4IG7B 5F3WA 5BMIA 3GPXA 3OTOM 3FILB 3V62A 5IN7A 1L0YB 1CJLA 1JWMD 1BMLC 4XGIA 1UBQA 2FCSA 4IM2A 4R7GA 5CHFA 5FTKA 3ZTCA 4PDGA 5BO4B 2LNHC 2KW0A 4P16A 1D6EC 2BU3A 4IUMB 3VH3B 4G4QA 1PIPA 2KMCA 2QJLA 3P2BA 2DJFB 1WR1A 4G4RA 2H7JA 1ZV1A 1EF5A 4C00A 4GIPA 1NLJA 1DF0A 3ZH9B 1PFDA 4M9SA 1HQCA 2GQFA 2AGAA 5JHBA 1FM0D 1DGBA 2ZAMA 1YJJA 2WX0A 2JX5A 3HHZA 5D3DA 2QPAA 1ME4A 4GEWA 2RSUA 4KLNA 1G3IA 3VLFB 3HM3A 5AEKB 1ZE3D 4MM3B 2MW5A 1POPA 2L2DA 2BPSA 1WY8A 1D5XC 1MEMA 3BOSA 2HJ8A 2EKEC 2OQ4A 3Q3NC 4LNIA 4B7FA 3TUOA 2VIIA 3QCAA 2LXAA 2WXNA 5DNYA 4XUIA 3KQ4A 1V5TA 1NQCA 3CF0A 1YQ3B 3QX1A 2HE7A 3I3TB 2MBHA 2DAJA 2IBIB 2EKKA 3FYCA 3NVZA 4AZFA 2OJRA 3IHPC 4LNKA 2NQGA 4DV2M 2DWNA 4X6JA 4JI3M 1UM8A 1E32A 4NAWA 3AB5A 2PE6B 2PIAA 7PCKA 4LF6M 2M56B 4DHZE 3M99A 2XEWA 5J18A 4ARCA 4JI5M 2VHFA 2RDGA 5FTNA 3KFUG 2F5PA 1CQVA 4NQKE 1IN6A 1RFAA 4ITQA 3NZSA 1HT2E 4CGYB 2BT6A 3EHVA 1ROEA 4HLEA 2P0RA 4XE0A 1GOZA 2AUZA 3H4JA 3VKHA 2FBWB 2MWSB 1E90A 2E00A 4BOSA 2ZAOA 3THGA 5CHVC 1J0GA 4DDGD 4ZUXU 4EFOA 1D3ZA 4JXJA 3T38A 1OTRB 1XC8A 4YWGG 1V1PB 4EIWA 3N4CA 1QKZA 3C3DA 1WWTA 1K3WA 4BOZB 3OF8A 3E56A 1L4ZB 2R9NA 3I4YA 4HL4A 3SYKA 4LG2A 1RM6C 3QWZB 1Z6TA 2LWXA 2FNAA 5KQ8A 2D7EA 4ANXA 4LTUA 2KFKA 1F2RC 1KFXL 1OQYA 3GPYA 1HJPA 3C9PA 4Q2JA 1MIRA 3NRZA 3P4PB 3ZNHB 1IXSB 3DBRI 1C9FA 2MEKA 2R9MA 1PDXA 4A9AA 1JQPA 2KVZA 3O0UA 1GUAB 1UD7A 3DVGY 3B9PA 2A5YB 3BYYB 3CTWB 2KQSA 2KDFB 3AE3B 4C4VB 1V33A 1IXRC 1V9JA 3PDFA 4BKSD 3IVFA 2L09A 3VVWB 2JRHA 3L08A 1B9RA 3VTUA 1ENFA 4MELA 4FK5A 3C8YA 2Y21A 2AL3A 1C1YB 1D0LA 4AQYM 5FSWA 4PT5A 2J7NA 1ZDVA 5HG2A 1JRUA 3PBHA 4WJOA 4OELA 2WSFF 4H2AA 2JQGR 1GJZA 2JWZA 1UH6A 2JZ0A 1R4NI 4B9KA 3AMZA 2N7JA 1LV7A 2K5PA 1Y8RC 2NTTA 1WJ7A 4LDTB 2I7NA 1MHWA 2VF8A 4KDIC 3PRZA 2ZZPB 2DAGA 4B6WA 4BQVA 4JGHB 1ET9A 2MBOA 3UQAA 2DJGB 1VG5A 4Q7JA 2CHQA 2LVPC 2JVCA 2M0XA 3B7QA 3ML8A 4LK0M 4N9F4 3VR8B 2MGWA 2WXMA 3I5JC 5AUKA 5L83A 4HWYA 2E03A 1U4AA 1M6DA 2VZKB 2CHXA 3BYTB 5FTLA 3QQ8B 3H7DA 3GS2A 3GLHA 2DC9A 3AE2B 1N33M 4DV6M 2KNZA 1EM7A 2LWPA 4W9JA 4GSWA 3VK8A 1E9MA 4LCDE 1FMAD 2QP9X 1UBIA 4YXDB 2TSSA 4LCBA 2KDBA 3GRUA 3QT4A 1WIAA 2WXIA 5JXVA 1N75A 5KPTA 4Z6YA 4D82A 2NPTA 4LY6A 4NZLB 2FNJB 4FCWA 4M00A 3RULA 1NL6A 2ZPNA 2K9XA 1SEBD 1NHGC 2CJNA 4D80A 3RUIB 2Z84A 2QIEB 1R4MB 3MP2A 4BOUA 2L00B 4B0MA 2YJ9A 1IBXB 1AYWA 1DO2A 2MBEA 1TKYA 1QT9A 2Y0QA 3RNBC 2R6FA 1G71A 1WGNA 4FVMA 1SXJD 3FTDA 4AS1A 4OZCA 1YIWA 1BVSA 2WNMA 1XCQL 4ZOHC 1KOTA 2INDC 1EWOA 4W5WA 5EGWA 2M60A 2DAEA 3PXGA 4B3SM 1EO6A 3U60B 2J4XA 3BVMA 3TCAA 3U6MA 2V1UA 3B2GA 2J52A 4B3MM 3ZLZA 1J7BA 2XFSA 3VDPA 5E6JA 4JI0M 4LJ4A 3VK7A 1D0MA 1WR6E 4A3VB 3GQ5A 3DDCB 3APDA 4KGRA 5LLIA 3OG5A 1V97A 1V34A 2JWSA 1JWSD 3BK1A 2WDVB 5FK9C 4ANVA 2FAZA 2PNSA 1GNUA 3HJSA 3GLGB 1N34M 4M8MA 1JR3D 2V1YA 4YYUA 2LGDA 2N9PC 1IY2A 4WWOA 3DPDA 1AYVA 2KNVA 1BGOA 2IO0B 2QZ4A 2J42A 4P1CC 1XB2B 4N8WA 3GLFE 1OAOC 5JZEB 4ACFA 4C7ZA 3U6OA 4F7ZA 3LW5F 2W82A 3C19A 2BYFA 1IXZA 2FCQA 4RM9A 3V6EA 3MJWA 2ZVNA 1YN4A 2DHYA 3QA8A 1T3TA 5FKAC 1PBHA 4TV3A 2REXA 4HPLB 2M1MA 2XK5B 3PS6A 3L27A 3HHXA 1IWDA 2DCDA 3ETRA 1KFYB 2WXHA 3VXWA 2KTFA 1VD2A 5D7GA 3ZYYX 1T43A 3KWZA 3OQCA 4YSXB 2DI0A 3GPPA 1I94M 2WWZA 4L23A 4G4OA 3B9JA 3ZC7B 4ARIA 2F7DA 3HWSA 2GOWA 5EP3A 4AQ7A 2QBYA 1WIVA 2FS1A 2PBHA 2DZYA 5EP1A 3U6SA 3IMAA 1SF0A 3EIEA 2ZJDA 1R5LA 1T0RC 2WDTB 1SG9A 1FEHA 3D32A 4WA6A 5F02A 1T0SC 4BKSA 4L6V6 2D7HA 3FTCA 2RPVA 1FH0A 3L10B 2BYTA 4OU7A 3U5ZB 1AYFA 3M0EA 1TL9A 3M95A 4QOSA 4EZLA 4YVAA 2BJWA 4CHTB 4XZ4A 2O2VA 3SR6A 3AM9A 4OVZB 1PVJA 4QBBA 1O0EA 3JR4A 2OOBA 2JY7A 1YK8A 3VUYA 3AI5A 3FKYA 3E4RA 1L4DB 4W9CA 2AYOB 3BB7A 2BWFA 5ITUA 1F2AA 1ATKA 1L5PA 2X4AA 4GXBA 4CDFB 3AEFB 1V8CA 1MDWA 4FJCA 4J6IA 2I1KA 2DYMA 2BTWA 3K9PA 3T6PA 5IP4D 2BGFA 4QH6A 3MP9A 2AQ2B 4AXLA 2Y5BB 3KH0A 3Q8CA 4IBEA 4DV4M 2CHZA 3AEBB 2RR9A 3N3KA 4IBGA 1PADA 2D3BA 4DV3M 3VTWA 2KD0A 2ARYA 1NYRA 5G5HA 4GITA 5AZHA 3CBJA 4I05A 1OIZA 1YVBA 2MJ3A 2Q5WD 4G11A 1STEA 4TQ0A 1QMYA 4WH4A 3KYCD 2GMIC 2IJ0A 3RE8A 3FRHA 4LGMA 5KHQA 1AARA 3KW6A 3NG0A 3MJ5A 5T8IA 1UELA 1SXTA 3U52E 2BTEA 2R9OA 2KRKA 1TTNA 4K3CA 2G8JA 3LJ3A 1YQBA 2N4FA 3Q6BA 4YYSA 2DWLA 2F5OA 2ZCBA 4EEWA 3OLMD 2Z0EB 2LI5A 3IOQA 1KFVA 4DHZB 3BY4B 3O65A 1HNZM 4AP4C 1TGUA 2YJ8A 1NO1A 4DUZM 3CWIA 3PNYA 1E7UA 4KHPM 1SBBB 2A5UA 2FRAA 3IG3A 2K22A 1QQRA 3UINB 5KO3A 1JWUD 2VH1A 2J5YA 3BWUD 3LMMA 4B7GA 3W2DA 3P4QB 2KRUA 3I04M 1SXJA 2V3PA 4C56C 4I8OA 1LXDA 4WQOB 1KXRA 3MHHA 1BY8A 1FIQA 4NJCA 1YSYA 4W4UA 4HVBA 1WGLA 2L32A 1IPGA 1NJGA 2L7IA 1E8WA 1TS3A 2DENA 3RNGC 2IO1B 4ICVA 3CMMB 3W1YA 1MHHE 2KANA 3VUWA 3BVZA 1N5XA 1XMOM 4FWGA 4CHKA 4CJ6A 1YX6B 5C1BA 4HCPB 1S1QB 3NBXX 2JY6A 2EA0A 4DMXA 1MFWA 4FJVB 2NTSA 3TIXA 2QILA 1P0RA 2CIOA 4LDTD 1PPPA 2J53A 2KTRB 1JR3A 2WDRB 3VFDA 2GBNA 2N9LA 3ZNGC 2LRUA 1ITOA 4W9IA 3DHGC 2J0KA 2R2OA 1QDRA 2J7OA 3FILA 2ZW1A 4TMAB 3V6CB 1ET6A 2M4NA 1X37A 1NV8A 3B7ZA 2X49A 2CP8A 1FXTB 3IBEA 2K39A 2DAMA 4IUMA 2LMCA 1JB0F 1IGDA 3H6SA 3KWBX 3ILKA 1PJIA 4DMYA 3U30A 1GVNA 4FWDA 1P9DU 5JA7A 2C5LC 1AYUA 3SFZA 2D3GA 2F4VM 2O5RA 4JE3B 4JQWC 5LMNM 2L76A 2IY0B 1D0KA 2LHDA 3NVWA 1G8PA 4NJ7A 5ITXE 5ITTA 4B3TM 1MVKA 4BZAA 3FUXA 2G7YA 4L78A 5DYGA 1J7KA 3HU3A 5H92C 4HDQA 1OQQA 2IPKD 2X8XX 1R4GA 2Y20A 4MM3A 1WXAA 2BB5A 4GKKM 1N5WA 3AEDB 3VKGA 4LJ7A 1RWSA 2V6ZM 2UXDM 3H7SA 4M02A 4M9XA 2Z3XA 3NS1A 4QAYA 3VHTC 3OISA 2Z7JA 5AZGA 4USAA 3TE6A 2JPHA 1QAMA 3I3TA 1JW9D 2AQ1B 4HCNB 2IBIA 4PP1A 5FR6A 4L2YA 1N6ZA 3A4SC 4DK5A 2UU7A 3ZO5B 2WX1A 3V3XA 1QOAA 3SARA 5CX3A 3U6CA 1WXVA 3BINA 3Q3FA 1K3BB 1Z59A 1FNUA 2JZ3B 4G4NA 3EA6A 3A9KA 1TU6A 3EFUA 1SIJA 2LVAA 4Q8GA 4IJEA 1GKIA 1XKGA 1ZW7A 1AW7A 2N35A 3RFWA 2NR2A 2BWES 2KX0A 2IGHA 3W67A 5CTRC 5HKHA 5BYQA 2WQYB 2C98A 4QHSA 1NHWC 2AYNA 1XO3A 4NSRA 1V80A 1I4WA 1OTRA 1KLUD 3MHSD 1P7EA 1OKSA 1V1PA 2DWQA 2D5GA 2ACZB 3PZDA 1UZXB 2LHGA 2XZFA 3AOEC 3H7PB 1WH3A 4BOZA 2Q2EB 1UWXA 4WWPA 1MHXA 2Y0TA 5IAAC 3AV0A 1ZKHA 2HHNA 1WXMA 1AN8A 2F5QA 2KJHB 2ZPYA 2KXEA 2FIFA 5EQTA 4DR7M 1QZEA 7CATA 1N36M 4QOZC 2WU2B 3DBRB 3H4MA 4S12A 4YYWA 4DXGA 2O6XA 3ZNHA 1IXSA 4PD2A 2DWZB 2JQRB 2HH5A 4A3OA 5EXXA 4C7YA 2BDLA 4JV5M 1VJVA 1T5XD 2SEBD 3EC8A 1K8RB 3WA0A 1GPXA 2LGSA 5EZQA 2JYTA 1I4RA 1WJUA 2MP2B 5CVMA 2JUJA 1XF5L 2J0MA 3K8UA 2GNOA 5JH3A 4MJSB 1IYFA 3L2AA 4N59A 4LLGM 2LZ6A 4PI3A 4HXDB 2VH2A 2RMMA 4X6HA 3TNXA 1FNWA 1ZXHA 3QARA 1WE7A 4G0NB 1XEEA 2XU4A 1QOFA 3IEJA 4WIPA 3PRMB 3BBAA 3W1SC 3R8BA 4URKA 2YEPF 3ZRCA 2ZBKB 2FCMA 5A24A 4RF1A 3ZJUA 1C76A 2BW2A 2YQZA 4LJ8A 1TBEA 1WYWB 2PEAA 2K8BA 1C1KA 2I7PA 2H89B 5DFLA 2KXJA 3BIID 3F92A 2C9WB 2KK8A 5C1ZA 4GLSC 2NQAA 4X66M 3SAWA 2ZCCA 4ZDVA 1U9XA 1R6BX 2RGOA 1VZ6A 1L7YA 1TDZA 3J27B 1XD3B 4B08A 2PREA 3SMSA 2JSVX 1HA5A 1TS5A 2RDHA 3NUHB 3RYTA 1I4PA 5JHAA 2Z8YM 3S3QA 3PNVA 1HUCB 5D3IB 3KUDB 1X1MA 3SATA 3P4RB 1CB5A 1L1TA 4E71A 4YSZB 4I6NB 1PCIA 4Z8XA 4JWUC 3EFCA 4RGNA 3WANA 4MSMB 4MT5A 1Z5CA 3AULA 1IBXA 3Q8GA 4W9DA 5GMVA 4LF9M 3TSSA 3VH4B 3ERVA 4BKGA 1X9YA 3NOBA 1ORYB 3S3RA 2HD5B 5D6JB 3IHPA 5HFYA 2RD0A 4PYUA 2CS4A 3HHAA 1JMLA 4CQNA 3T3NA 2R6NA 4LJ9A 2KMAA 3U60A 4NOOB 1L8QA 3R3MA 3PNRA 4YL8A 3WCQA 5EDSA 3OVZA 3IUTA 5AUIA 2D3AA 3BVGA 1LGRA 2XU5A 1HQYE 5L95C 2EMTA 4IWQA 2KA6B 1TY2A 1TZ1A 1Z5SB 1VQ1A 2D11A 5CVOB 1YJ1A 3AL0C 1C4PA 1V81A 3RGSA 3SMPA 1ZAEA 3GLGA 2GBJA 5CHVA 1SNKA 2PE9A 5EXTA 1FRRA 4MH0E 2KNBA 3PT2B 2PLPA 2KJRA 5LNK1 3TBLD 1EU3A 4NAMA 2E02A 2EUCA 4XGAB 3W0FA 3L4PA 2K8HA 4ANUA 1PJTA 4LJ6A 5DCNA 3LXFA 4TQ1A 3HHIA 5JZEA 3MHSA 3MMPA 3GQ4A 1VEKA 2JZ1A 3ABVB 3RZWC 3B89A 2Z8LA 4GDKB 4I4LA 1TY0A 2R2QA 3JSVB 4LFCM 2EJSA 3TQSA 4K7WA 2DAIA 4DV0M 1GO5A 3VDZA 4JI4M 2L7HA 1XWIA 2XK5A 1JCKB 2MSED 3B1LX 2CHVA 1OJLA 5BYRA 4FBJB 3TMPA 3TWMA 1VZ8A 4A3PA 1MG8A 4UN2B 2Z4RA 3USVA 4KIKB 4AG6A 3KXEC 1WX8A 3KUZA 1I7HA 3BXWA 1ISNA 3I06A 4K7SA 4BKTA 4E3CA 2FE8A 3Q8BA 3W68A 5IKCM 2M17A 4EOYA 4JI2M 2V4LA 1IBKM 2YEPB 2JWUA 2QSDA 3E9SA 1UF0A 4IBJA 3IFWB 3HHWA 2JXNA 3LDZE 3ZJVA 1WM2A 3P63A 1TH2A 3GRYA 2CKHB 3R7QA 2F5NA 3WHKA 1CJEA 2QC8A 3NVVA 1ZMWA 2HWKA 4II7A 3J81S 1YNTE 2BVCA 4ANRA 1WX7A 3AN1A 3U5ZA 2XH9A 1P1AA 4FXCA 4W9KA 3I9V1 1DOIA 3SC3A 1Q39A 4AI6A 3C0RB 2BQQA 4OVZA 1T0QC 3NZ3A 1A5TA 1STFE 3QWLA 1RLFA 5G2NA 4IBFA 2AYOA 1QOLA 1ME3A 3L16A 1NNJA 4BOSC 3AV8A 3FTEA 4GHLA 2IGGA 3ZRFA 4YYVA 1Q10A 1Z2MA 3UIPB 1J09A 2FIDA 5FR3A 1N77A 1WSPA 4GMVA 1YZBA 4D2KA 1RRBA 4LNOA 2LHCA 2Y5BA 2LXCA 3DHHC 3Q3MC 4RGMA 3TWLA 3R66C 4XYCA 1KH0A 1R2YA 4X65M 1OGWA 3N9YC 1QUTA 1CZPA 3T9LA 1UFZA 2FRQA 2KKCA 4MDKE 4K81A 1TZOA 4LJPB 1C3TA 2KWVB 3N32A 2IO2B 4DR2M 4LFBM 1WMHB 4L16A 3LFYA 3SHFA 4BAXA 4US8A 3D8BA 1XNQM 2KC1A 3K9MA 4QRXA 4GU2A 1GLOA 2KO3A 2ASQA 3HVDA 1KFUL 4E74A 3SASA 2R4EA 1DYQA 1L2NA 1E8YA 1IBMM 2YLMA 4BBAA 2KHHA 1UUPA 4P1BC 3PW3A 3HU2A 3MC8A 1J8CA 2AVWA 2KC2A 3O1GA 1QXPA 3DBLI 1UGJA 2F5SA 2JNHA 4AOFA 3URYA 1IUEA 4DXAB 4ZRIA 1I42A 4GDLB 3BY4A 3RT3B 4G6ZA 1QOGA 1J7CA 4JX1C 2JA2A 3TL5A 1PGXA 2DLBA 4I04A 1QAOA 1YOVB 1ZXIA 3RN9C 1I4QA 4P7IA 1ZIVA 4N79A 4YTPB 1FNNA 2IZVB 2WXJA 4PCZA 3OVXA 1R2ZA 4AG5A 2PW9A 2CFOA 4XZXA 4NXMM 2KWDA 2W3SA 1CTEA 1Q3CA 5D2MB 4EZJA 3Q3JA 3CF6E 2ZW0A 5C3JB 3U61B 3GLIE 4LZZA 3DVNU 3VFKA 1AECA 2C7NB 2M5ZA 2KDLA 4A55A 2PVOD 2WXGA 4RF0A 3PVLA 2WDQB 3QIJA 3UGJA 3WAMA 8CATA 1PPNA 3AE4B 2J0JA 1NYQA 2LHEA 3PRPB 2LUMA 2MBBB 1PUTA 4ZRQA 1WR1B 5IOIA 1ACCA 4JN6A 3ENEA 4S17A 3UIOB 2KTRA 2FH0A 2AUXA 4HRSA 1MI0A 5EXPA 3FUVA 2GBKA 1H6UA 5TSSA 4RGOS 1QOBA 4NJ6A 4AXMA 4FN2A 4MSQB 3BWKA 2WZJA 1GJTA 3ZUAA 3BPFA 2L05A 1XQQA 2BF8B 3V6CA 1OFFA 4DR1M 1I35A 2NBWB 3MTNB 3GE8C 1WF9A 1PPOA 3GRRA 1L2CA 4EUTA 2KJ6A 3D8LA 4M9ZA 3W5VB 1J19A 3CBKA 3PHXB 1BUIC 3B7NA 3Q2AC 2K6QA 3QYBA 3I57A 2GBMA 4KV2A 3T15A 4PDIA 2V9HA 2XNAC 3GP7A 2I1JA 4IBBA 2QHOA 2DZNB 1GC6A 1SGHA 2G8EA 4KKJA 3WXEA 3NBIA 3ONSA 1PRBA 4DWFA 4BS5A 1K50A 2EELA 2WXRA 4XX5A 4GC9A 1PM5A 3PHUA 3AE9B 2CV1A 1WXQA 2PKOA 2RRUA 4XWTA 4GN1A 2LVQD 1ZMVA 1F52A 4RH6A 3L54A 5LXHA 1V1OA 4K7CA 2MH8A 3DOAA 4W9FA 4ZRPA 4CDEB 1Y08A 3DVGX 2XLJA 2G4SA 1UGMA 2MLBA 1CK1A 2CWBA 1ESFA 1HQRD 3ZQ4A 3MC9A 1SJHD 2K9DA 1TYGB 2CR5A 2K25A 2KHWB 3ZKJC 2IY1B 3VR9B 3ZJTA 1GECE 1AUAA 2C5RA 2DAFA 2G3QB 4WWNA 3N30A 2GFOA 1NSFA 4KX6B 1NY6A 4OEMA 2ZNVC 1NEKB 1ZDXA 1IBLM 4GHAA 2JY5A 1F4IA 2FUHB 1CVZA 4DV7M 3MHVC 2LVOC 1HTQA 1YX5B 1F2BA 2JZZA 4TSSA 3U7ZA 4IW0A 4M01A 1U9VA 4W9LA 3DOWA 2QCUA 3ALBA 3GOEA 2XSZD 2HKJA 1SE3A 4X6IA 2DWMA 4X57B 1XMQM 2HL7A 1G59A 1QQWA 3HIZA 4L4UA 4GGQA 2XU3A 1Q5WB 5PADA 1FJGM 4FW9A 4AWJA 1Y8GA 1C7YA 3RVWA 4CZWA 1XXHE 2GB1A 2LVNC 3IG5A 4B3RM 3PZ7A 3H7PA 2LH0A 1SSNA 1ZCMA 5LMUM 3ML9A 5JI2E 2CUZA 4IDIA 2LGYA 4A6QA 4BVUC 2OULA 4DUYM 2C0YA 2N9KA 1FNVA 3AOGA 2LXEA 4II3B 1VDLA 5IT9S 3RFZB 2AS8A 2LJIA 2ACTA 3AU5A 2R0IA 1ZOYB 2Y5CA 3DWMA 1L1ZA 3FRIA 1IGCA 3LB8C 1Y56A 1IM2A 2K47A 2ONQA 1PXVA 4BOQA 1P7FA 3FAHA 2LGIA 3S2AA 5J2RA 3HZJA 4O1NA 1WRIA 4CYEA 3T1YM 2MP2A 2OPFA 1Q02A 3GLFA 1FFVA 1WJNA 1E8ZA 2DBYA 4MJSA 3KP1E 5I4DA 4PK1A 1W5SA 1F9JA 5E6OA 1MS6A 1WZ0A 2L1AA 2OOAA 1BQIA 4HXDA 1DGHA 3DFZA 3GLHB 5EE1A 4DDID 1WFYA 3Q14C 4P6EA 4LJ5A 3UGBB 4DHJB 1T0YA 2N9EB 2LFIA 3PRMA 1MJDA 3GE3C 5C18A 4Y28F 1MG4A 3I51A 1AU0A 3GCBA 2W55A 4MGYE 1KLGD 2PPHA 3JR5A 2SAKA 2D7GA 1KJTA 4LNNA 5HI1A 3P5WA 4BB9A 2PADA 2L0TA 3V76A 3KWLA 1J7AA 1VZ7A 2M0AA 2DVWB 1KYIA 2JYEA 4QRGA 3T1HM 2UZJA 1C4AA 2MCNB 1JQ4A 4OHJA 3B74A 5BR8M 2NS5A 5H37D 1WGYA 3AE7B 4IP3A 1R4MI 2MA9B 1SE2A 3K92A 1TJEA 2UUCM 2DC7A 1QVRA 5ITRA 4NRWA 1CV8A 3KOXE 2KACA 3QJZA 2L4FA 3AI8A 2VZKD 2I2YA 2M8SA 3VRAB 2HCBA 2UUBM 1PGYA 1SXJC 5A2QS 3AE1B 5E26A 2GHUA 1QAQA 4BSQA 3AE5B 3U2SC 1IP9A 4QNMA 2CHGA 3KUCB 2LVQA 2KQ7A 1EIJA 3L28A 4MZOA 1F0ZA 5KPRA 3IECA 2KZUA 1JRPA 2J7QC 4WJNA 2HWJA 1IFYA 2ICIA 3RI7C 3TJPA 3RGPA 4FLHA 2K0PA 1HNWM 1GL7A 4G3OA 1VR9A 3PO0A 1VEJA 1N32M 4J3OD 1E8XA 1XLOA 3SEBA 3N20C 2HD5A 1YK7A 2LD9A 2QDFA 4FHKA 1HXYD 3GPUA 2ZNVB 1F29A 2QEJC 4B7HA 3NS8A 2EKIA 3U4EG 1IN5A 2K6BA 3LVVA 1HNXM 3NWLA 4WW0A 2QENA 3TWKA 2L52A 2HDEA 2DYOA 1WJ4A 4HPPA 1F2RI 2WHIA 4YY3M 2N1WA 5K16A 1EF7A 1OEYJ 3QK0A 5DYIA 4DBGB 2L83A 3ZXRA 3CIRB 2Z0DB 2XSZA 3PT2A 1L6UA 1L0VB 3P42A 3HJQA 2BYEA 3VAWA 5IWAM 1GG3A 1NBFC 3UI3A 2K8CA 4G3XB 3A98B 1OFIA 2WXLA 4JPSA 4M0WB 2O01F 4LFAM 2WU5B 4JI1M 3UF8A 5AZFA 1WRDB 2KOXA 2D2QA 4EE2A 2L3ZA 5BMGA 2CHWA 2KFJA 2ON8A 3JSVA 1SE9A 3GLIB 3I63C 1K3XA 5IREB 1BXTA 2HTHA 3M7GA 3RNVA 1M94A 1OEYA 2KMMA 1OIPA 4XC2A 1ICFA 4FULA 2RPQA 1A5RA 1OFHA 1VSNA 2FO5A 3K8ZA 2DNAA 1WGKA 2KAJA 3PZ8A 4KIKA 4P6VF 4FWHA 3CGWA 3DWGC 4KZ0A 1QZMA 4W9GA 4NRVA 1NY5A 2N9XA 3W30A 4I6PA 2DZOB 1TTEA 2L4EA 5EP2A 1EWYC 4RCOA 2E5LM 2G9HD 3HX3A 1KHPA 3NVYA 3Q3OC 3HVZA 4MI7A 2NMQA
chains in the Genus database with same CATH topology
1L0XB 2X8AA 2FOIC 3PFIA 3AEAB 4MGKE 4MACA 4YSYB 3C0RA 3AE8B 4BOPA 3SYLA 1E0ZA 4YHHM 4QHTA 1ZP0B 1IQPA 2RKOA 1EE8A 1VLBA 2MH7A 5ITXA 3FD9A 3HHYA 2C96A 3TPZA 3I4VA 1T3QA 1GL6A 3J80S 5EP4A 5EE0A 2H1RA 1ZPSA 2FFJA 2GRIA 2PTLA 4NXNM 1OQRA 2BBCA 1E9SA 1K82A 2W54A 2C99A 5JI3E 1XLNA 3AJIB 1NVMA 1IN7A 4IOIE 3SBJA 3KOZE 3AH7A 4D8EA 3K2LA 5IZ7D 4IBCA 2KDMA 2DXIA 4HJGE 2XGNA 4IBIA 3JAMS 3B2FA 5EZSA 4MGIE 1QYRA 3FTFA 1XCTL 2G5GX 2E6XA 3AECB 1XLPA 3Q8FA 2WXPA 1R7SA 1YQ4B 3MC0B 1F77A 3U6QA 2CJOA 3UMMA 3KWVA 3UZUA 3C58A 1MX0A 1B1ZA 2PMVA 3Q69A 1KF6B 3U61A 1IY0A 1XXHB 3OWEB 3Q8XA 3VRBB 4XDDA 1K51A 3PRPA 1FXIA 1E7PB 2OHFA 4A8XC 2B76B 2UUAM 2DHRA 2Z4SA 3AEEB 2P5TA 4JWSC 4GMQA 4IIWA 1XXGA 4N6EB 2BB6A 1HZ5A 1NVID 3IAS1 1Z5BA 4HLQA 5BMHA 3TL4X 5GKNA 3UK6A 2PVGC 3PHXA 3FYDA 2FUG1 4RGTA 4RKXA 3R9XB 4WAFA 4YTNB 4B0EA 1I4XA 4GUAA 2XFTA 1QF6A 1LO5D 1C79A 3R2TA 4OX9M 1EU4A 3FUUA 3TEWA 3U6DA 3J7BA 4MB7A 5C2TB 4IKGA 5BPVA 1ZQ9A 1E6EB 1JWBD 3ZGZA 1IN8A 3V05A 4HKZE 2OEDA 1UNSA 3LQQA 2VQFM 2JZPA 4DR6M 4XDCA 1NENB 1W5TA 3LYYA 4JI8M 4LRSA 5MPOA 1TKGA 2L6OA 4YT0B 3WHLA 3L26A 1G4AE 2KZSA 2R62A 4KKIA 2XN9C 1HZ6A 3AEGB 3TEYA 1WYGA 2KEBA 3A42A 4K0KM 4HKQA 2K3UA 2VQEM 3AFHA 1TH3A 4KO8A 1TKEA 2WXOA 2CEAA 2R45A 4LF7M 3R8FA 4XWWA 2CV2A 3W5UB 1L2DA 4MGHA 3EUB2 1DGJA 2Y5PA 4LRTA 3KS4A 4XBOA 3MHZA 4YTMB 2BS4B 2BS3B 4KGSA 1FCLA 1J5EM 2G8LA 4IBKA 4LF8M 3VDUA 4DR5M 2C9OA 1T6BX 1UKFA 2WXQA 1DO0A 3KSJA 2XF3A 2R61A 4I5SA 2V4IB 3KS8A 2DOSA 2G1EA 1GB1A 4CISA 4WQMA 5BYSA 5G5GA 5EXSA 4D8IA 1QANA 2XZUA 1ZUD2 3EGRA 3AKZA 1KSFX 2KN4A 2R4JA 4WURA 4GKJM 1NJFA 3RPFC 4UDUC 3TRKA 3KOWE 3L25A 4LF5M 3IT4B 3U6EA 5EJCA 4AW4A 2H88B 4WWMA 3GQ3A 1SE4A 3HGIA 2CU3A 1JROA 4DV5M 1DOXA 4NAWB 1E9RA 2C9CA 4GC5A 1XHBA 4LZJA 2CE7A 3HU1A 4OZBA 4HROA 2E3TA 3ZCBB 1N63A 5H8YE 3GO8A 1GAQB 1N78A 1C77A 1SXJE 4DQOC 2AHMA 3KSXA 1N61A 3SAUA 4L8RC 1FFUA 3HRDD 3DZDA 2HTME 2UXCM 1QLBB 3FKEA 2INNE 4ZHOA 4GRIA 2WXKA 4MGZE 3IFUA 1GLNA 2UU9M 4M0WA 3HUIA 2AX5A 2M19A 4C80A 1N60A 5KQDA 5FLXS 4MH8A 3J2PB 1PGAA 2NQ8C 3P4SB 3GLIA 3K1JA 1I4GA 2JTCA 1D4BA 1C4CA 2R18A 1DGGA 3H8HA 2BNKA 5ITYA 2V3NA 1S3SA 4N58A 2IDYA 1E94E 4RNAA 4DXFA 1L2BA 1NI3A 4R3DA 2WP9B 3BZDB 3EIHA 3IAM1 3L29A 1JQJC 4JYAM 2JXTA 3KVWA 1R7RA 4AKGA 4IJFA 2ZANA 3PVSA 3A46A 2WS3B 1Q3BA 2INPE 3QAUA 1IN4A 3SAVA 3W31A 1GB4A 3W9CB 5KPZA 3CF2A 1YJIA 1YE9A 4ZTBA 1D2NA 4AKHA 3FC4A 2GI9A 3TEZA 5EE3A 1N62A 4AKIA 3IT6B 2YNMD 5FTJA 1PGBA 4HEA1 4FD2A 2J7QA 1IY1A 4ZPXA 3A45A 4A5UA 3VQIA 3KDSE 2I38A 4M0DA 3KOYE 2QMTA 1Z5AA 2IGDA 1TH4A 2RGHA 4JI7M 1YMHE 2MJEA 4DR4M 4NL4H 1KRHA 4RFBA 2EO2A 1FD6A 1PYWD 2CV0A 1HEZE 1KTKA 5FTMA 1FXAA 1XXHA 1DGFA 1YUBA 1TS4A 1MU5A 2JRIA 4I81A 4REZA 3PSEA 2WXFA 4L15A 3MK6A 5GXGB 1FCCC 3AE6B 2W3RA 4A90A 4QNRA 4TUWA 1AWDA 4KODA 3R2IA 4ZYSA 3IXSA 2ZM6M 2XEPA 3GB1A 4DV1M 4LF4M 2WLBA 3J9CA 3HKPA 2LEKA 4NSOB 1HR0M 1FO4A 3DA1A 3KLSX 1RYJA 3SHGB 4ZHPA 5ITQA 3AOEA 3Q8AA 3U6PA 2X38A 1D5ZC 2QBYB 4BLCA 3B21A 4LGYA 1YN3A 4LJAA 1VJKA 2MJDA 1NNUC 1EWCA 3TEXA 5HHDG 1XLQA 3U6LA 1G41A 3PHWA 4JI6M 3LVWA 1VDVA 4KGTA 1XNRM 1M4VA 1K52A 3UJNA 2N0SB 2UXBM 2BTWB 2R65A 1A70A 2HHHM 1K53A 1SJED 4L1BA 4X62M 3GRVA 2AQ3B 3W0LB 1QILA 3T3OA 4US9A 1MPEA 4D8BA 3MFGA 3O13A 3GP1A 3W1SA 1HT1E 1JWAD 1L6VA 3MTVA 1DOYA 1DKIA 4X64M 1SB3C 2KQ4X 1FRDA 4DR3M 3J7AS 3GLFB 3LQRA 2JU6X 3KP0E 4FCTA 1VDDA 4D81A 1SXJB 1VRAB 2Y3AA 1RFKA 2BS2B 1DGHB 3IG8A 1UWMA 3FUTA 2ERCA 1I4HA 1E10A 4IBDA 3BK2A 2V1CA 1PJJA 1TS2A 2V0GA 3P1MA 4FCVA 3M6AA 1D5MC 3Q8EA 2YR0A 1JALA 1TDHA 4OZAA 2R46A 5EE9A 2BJVA 2YFQA 4GH9A 1YN5A 4ITKA 3SFDB 3HJ8A 3FUWA 1C78A 4OW0A 3SFEB 5F3WA 5BMIA 3GPXA 3OTOM 3FILB 1L0YB 1JWMD 1BMLC 4XGIA 4R7GA 5FTKA 4PDGA 2LNHC 2KW0A 4P16A 1D6EC 2BU3A 4G4QA 2QJLA 4G4RA 4GIPA 3ZH9B 1PFDA 4M9SA 1HQCA 2AGAA 1FM0D 1DGBA 2ZAMA 1YJJA 2JX5A 3HHZA 5D3DA 2QPAA 4KLNA 1G3IA 3VLFB 1ZE3D 4MM3B 1D5XC 3BOSA 2OQ4A 4B7FA 3TUOA 2VIIA 2WXNA 5DNYA 3KQ4A 3CF0A 1YQ3B 3FYCA 3NVZA 4AZFA 4DV2M 2DWNA 4JI3M 1UM8A 1E32A 3AB5A 2PIAA 4LF6M 2M56B 4ARCA 4JI5M 2RDGA 5FTNA 3KFUG 2F5PA 1CQVA 1IN6A 4ITQA 1HT2E 4CGYB 2BT6A 1ROEA 4XE0A 1GOZA 3VKHA 2FBWB 4BOSA 2ZAOA 3THGA 4JXJA 3T38A 1XC8A 4YWGG 1V1PB 4EIWA 1QKZA 1WWTA 1K3WA 3E56A 1L4ZB 3I4YA 4HL4A 3SYKA 4LG2A 1RM6C 1Z6TA 2LWXA 2FNAA 5KQ8A 2D7EA 4LTUA 1F2RC 3GPYA 4Q2JA 3NRZA 3P4PB 1IXSB 1C9FA 2MEKA 1PDXA 4A9AA 3B9PA 2A5YB 3BYYB 3CTWB 3AE3B 1IXRC 2L09A 1B9RA 1ENFA 3C8YA 2Y21A 4AQYM 5FSWA 4PT5A 2J7NA 1ZDVA 5HG2A 4H2AA 3AMZA 2N7JA 1LV7A 2K5PA 2NTTA 2I7NA 1ET9A 2CHQA 4LK0M 3VR8B 5AUKA 2WXMA 2VZKB 3BYTB 5FTLA 3GS2A 3GLHA 3AE2B 1N33M 4DV6M 1EM7A 3VK8A 1E9MA 1FMAD 2QP9X 4YXDB 2TSSA 4LCBA 3GRUA 2WXIA 5JXVA 1N75A 5KPTA 4Z6YA 4D82A 4LY6A 4NZLB 4FCWA 2K9XA 1SEBD 1NHGC 2CJNA 4D80A 2Z84A 4BOUA 2QIEB 3MP2A 4B0MA 1IBXB 1DO2A 1TKYA 1QT9A 2Y0QA 4FVMA 1SXJD 3FTDA 4AS1A 4OZCA 2WNMA 1XCQL 4ZOHC 4W5WA 2M60A 3PXGA 4B3SM 3U60B 2J4XA 3BVMA 3U6MA 2V1UA 3B2GA 2J52A 4B3MM 1J7BA 2XFSA 3VDPA 5E6JA 4JI0M 4LJ4A 3VK7A 4A3VB 3GQ5A 4KGRA 1V97A 1JWSD 3BK1A 2WDVB 5FK9C 3HJSA 3GLGB 1N34M 1JR3D 1IY2A 2QZ4A 2J42A 4C7ZA 3U6OA 2W82A 1IXZA 1YN4A 1T3TA 5FKAC 3L27A 3HHXA 3ETRA 1KFYB 2WXHA 3ZYYX 5D7GA 3OQCA 4YSXB 3GPPA 1I94M 4L23A 4G4OA 3B9JA 3ZC7B 4ARIA 3HWSA 5EP3A 4AQ7A 2QBYA 5EP1A 3U6SA 1SF0A 3EIEA 1FEHA 2D7HA 3FTCA 2RPVA 2BYTA 4OU7A 3U5ZB 1AYFA 3M0EA 4QOSA 2BJWA 4CHTB 3SR6A 1PVJA 3AM9A 4OVZB 3JR4A 3E4RA 1L4DB 3BB7A 5ITUA 1L5PA 2X4AA 3AEFB 1V8CA 2DYMA 2BTWA 3MP9A 2AQ2B 3Q8CA 4IBEA 4DV4M 3AEBB 4IBGA 4DV3M 1NYRA 5G5HA 4GITA 2MJ3A 2Q5WD 1STEA 4TQ0A 4WH4A 2IJ0A 3RE8A 4LGMA 3KW6A 3MJ5A 5T8IA 3U52E 1SXTA 2BTEA 2KRKA 2DWLA 2F5OA 1KFVA 3O65A 1HNZM 1TGUA 4DUZM 3CWIA 3PNYA 1SBBB 4KHPM 2K22A 1QQRA 5KO3A 1JWUD 3BWUD 3LMMA 4B7GA 3W2DA 3P4QB 2KRUA 1SXJA 2V3PA 4C56C 4I8OA 1FIQA 4NJCA 1YSYA 2L32A 1NJGA 2L7IA 1TS3A 1MHHE 3BVZA 1N5XA 1XMOM 4FWGA 5C1BA 2EA0A 2NTSA 2QILA 2J53A 1JR3A 2WDRB 3VFDA 2N9LA 2J7OA 3FILA 2ZW1A 4TMAB 1ET6A 1X37A 2X49A 4IUMA 2LMCA 1IGDA 3ILKA 1PJIA 1GVNA 4FWDA 3SFZA 2F4VM 2O5RA 4JE3B 5LMNM 3NVWA 2LHDA 1G8PA 5ITXE 5ITTA 4B3TM 1MVKA 3FUXA 4L78A 5DYGA 1J7KA 3HU3A 5H92C 1OQQA 2IPKD 2Y20A 2BB5A 4GKKM 1N5WA 3AEDB 3VKGA 4LJ7A 1RWSA 2V6ZM 2UXDM 4M9XA 2Z3XA 3NS1A 2Z7JA 4USAA 3TE6A 1QAMA 1JW9D 2AQ1B 4L2YA 3V3XA 1QOAA 3SARA 3U6CA 1Z59A 1FNUA 4G4NA 3EA6A 1SIJA 4IJEA 1GKIA 1AW7A 3RFWA 2IGHA 5BYQA 2WQYB 2C98A 4QHSA 1NHWC 1XO3A 4NSRA 1I4WA 1KLUD 1P7EA 1V1PA 2DWQA 2D5GA 2ACZB 2XZFA 3AOEC 4BOZA 2Q2EB 1UWXA 1MHXA 2Y0TA 3AV0A 1AN8A 2F5QA 2KXEA 5EQTA 4DR7M 7CATA 1N36M 4QOZC 2WU2B 3H4MA 4S12A 4DXGA 3ZNHA 4PD2A 2DWZB 2JQRB 5EXXA 4C7YA 4JV5M 1T5XD 2SEBD 1GPXA 5EZQA 2JYTA 1I4RA 1XF5L 3L2AA 4N59A 4LLGM 4HXDB 2RMMA 1FNWA 1ZXHA 1XEEA 1QOFA 4WIPA 3BBAA 3R8BA 2YEPF 2ZBKB 4RF1A 3ZJUA 1C76A 2BW2A 2YQZA 4LJ8A 1C1KA 2I7PA 2H89B 3BIID 4GLSC 4X66M 3SAWA 1R6BX 2RGOA 1VZ6A 1TDZA 3J27B 4B08A 3SMSA 2JSVX 1HA5A 1TS5A 2RDHA 3NUHB 1I4PA 3PNVA 5D3IB 3SATA 3P4RB 1L1TA 4YSZB 4Z8XA 4JWUC 4RGNA 4MT5A 1Z5CA 1IBXA 4LF9M 3TSSA 1ORYB 5HFYA 1JMLA 4CQNA 3T3NA 4LJ9A 3U60A 4NOOB 1L8QA 3WCQA 5AUIA 3BVGA 1HQYE 2KA6B 1TY2A 3AL0C 1C4PA 3RGSA 3SMPA 1ZAEA 3GLGA 5EXTA 1FRRA 4MH0E 2PLPA 5LNK1 1EU3A 4NAMA 2EUCA 3W0FA 3L4PA 4LJ6A 3LXFA 4TQ1A 5JZEA 3GQ4A 3ABVB 4GDKB 2Z8LA 4I4LA 1TY0A 4LFCM 3TQSA 4DV0M 4JI4M 2L7HA 1XWIA 1JCKB 2CHVA 1OJLA 5BYRA 3TMPA 3TWMA 1VZ8A 2Z4RA 4AG6A 3KXEC 1I7HA 2FE8A 3Q8BA 4JI2M 1IBKM 2YEPB 2JWUA 2QSDA 3E9SA 4IBJA 3HHWA 3ZJVA 3P63A 1TH2A 3GRYA 2F5NA 3WHKA 1CJEA 3NVVA 2HWKA 4II7A 3J81S 1YNTE 3AN1A 3U5ZA 2XH9A 4FXCA 3I9V1 1DOIA 3SC3A 1Q39A 4AI6A 4OVZA 3NZ3A 3QWLA 4IBFA 1NNJA 3AV8A 3FTEA 4GHLA 2IGGA 1Q10A 1J09A 5FR3A 1N77A 1WSPA 1YZBA 4D2KA 4RGMA 3TWLA 1KH0A 1R2YA 4X65M 3N9YC 1CZPA 1TZOA 4DR2M 4LFBM 4L16A 3SHFA 4US8A 3D8BA 1XNQM 3HVDA 3SASA 2R4EA 1DYQA 1IBMM 4BBAA 1UUPA 3HU2A 1UGJA 2F5SA 3URYA 1IUEA 4GDLB 3BY4A 4G6ZA 1QOGA 1J7CA 4JX1C 2JA2A 1PGXA 2DLBA 1QAOA 1ZXIA 1I4QA 4YTPB 1FNNA 2WXJA 4PCZA 1R2ZA 4AG5A 2PW9A 2CFOA 4XZXA 4NXMM 2KWDA 2W3SA 1Q3CA 3CF6E 2ZW0A 5C3JB 3U61B 4LZZA 2M5ZA 4A55A 2PVOD 2WXGA 4RF0A 2WDQB 3UGJA 8CATA 3AE4B 1NYQA 2LHEA 2LUMA 1PUTA 4ZRQA 1ACCA 4JN6A 4HRSA 1MI0A 5EXPA 3FUVA 5TSSA 1H6UA 4RGOS 1QOBA 1OFFA 4DR1M 3GRRA 1L2CA 3D8LA 4M9ZA 3W5VB 1BUIC 3I57A 3T15A 4PDIA 2XNAC 3GP7A 4IBBA 2DZNB 4KKJA 3NBIA 1K50A 2EELA 2WXRA 4GC9A 1PM5A 3PHUA 3AE9B 2CV1A 1WXQA 2PKOA 4XWTA 4RH6A 1V1OA 3DOAA 4ZRPA 2XLJA 1CK1A 1ESFA 1HQRD 3ZQ4A 1SJHD 1TYGB 3ZJTA 3VR9B 2C5RA 1NSFA 4KX6B 1NY6A 1NEKB 1ZDXA 1IBLM 4GHAA 4DV7M 3MHVC 3U7ZA 4TSSA 2QCUA 2XSZD 2HKJA 1SE3A 2DWMA 1XMQM 2HL7A 1G59A 1QQWA 4L4UA 1FJGM 4FW9A 2GB1A 3IG5A 4B3RM 3PZ7A 2LH0A 1SSNA 5LMUM 5JI2E 2CUZA 4IDIA 4A6QA 4DUYM 2N9KA 1FNVA 3AOGA 2LXEA 5IT9S 3RFZB 2LJIA 1ZOYB 2Y5CA 3DWMA 1L1ZA 1IGCA 3LB8C 1Y56A 1IM2A 2K47A 2ONQA 4BOQA 1P7FA 3FAHA 2LGIA 4O1NA 1WRIA 3T1YM 2OPFA 3GLFA 1FFVA 2DBYA 3KP1E 5I4DA 1W5SA 2L1AA 1DGHA 3DFZA 3GLHB 5EE1A 4LJ5A 2LFIA 3PRMA 5C18A 3I51A 2W55A 4MGYE 1KLGD 3JR5A 2SAKA 2D7GA 5HI1A 4BB9A 3KWLA 1J7AA 1VZ7A 2M0AA 2DVWB 1KYIA 2JYEA 3T1HM 2UZJA 1C4AA 1JQ4A 4OHJA 5BR8M 3AE7B 5H37D 4IP3A 1SE2A 3K92A 1TJEA 2UUCM 1QVRA 5ITRA 4NRWA 3KOXE 2KACA 2VZKD 2I2YA 3VRAB 2HCBA 2UUBM 3AE1B 1SXJC 5A2QS 5E26A 1QAQA 3AE5B 3U2SC 4QNMA 2CHGA 3L28A 1F0ZA 5KPRA 2KZUA 1JRPA 2J7QC 2ICIA 3RGPA 2K0PA 1HNWM 1GL7A 1VR9A 3PO0A 1N32M 4J3OD 1XLOA 3SEBA 1HXYD 3GPUA 2QEJC 4B7HA 2EKIA 3U4EG 1IN5A 3LVVA 1HNXM 3NWLA 4WW0A 2QENA 3TWKA 2L52A 2HDEA 2DYOA 1F2RI 4YY3M 5DYIA 2L83A 3CIRB 2XSZA 3PT2A 1L6UA 1L0VB 3P42A 3HJQA 5IWAM 3UI3A 3A98B 1OFIA 2WXLA 4JPSA 4LFAM 2WU5B 4JI1M 4EE2A 5BMGA 2ON8A 3GLIB 1K3XA 5IREB 1BXTA 3RNVA 3M7GA 2KMMA 1OFHA 3K8ZA 1WGKA 2KAJA 3PZ8A 4P6VF 4FWHA 3DWGC 1QZMA 4NRVA 1NY5A 3W30A 2DZOB 5EP2A 1EWYC 4RCOA 2E5LM 2G9HD 3NVYA 3HVZA 4MI7A 2NMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PT5 A;  5E6J A;  4RF1 A;  4REZ A;  5KO3 A;  4M0W A;  3MP2 A;  4RNA A;  4R3D A;  3MJ5 A;  4P16 A;  4MM3 B;  4OVZ A;  4WUR A;  4RF0 A;  2FE8 A;  4OVZ B;  3E9S A;  4OW0 A; 
#chains in the Genus database with same CATH topology
 1L0X B;  1ZMU A;  2X8A A;  2VRR B;  2FOI C;  3PFI A;  3AEA B;  4MGK E;  4MAC A;  4YSY B;  3C0R A;  3AE8 B;  3K9O B;  3F5V A;  4W9H A;  2K6D B;  4C4V A;  4BOP A;  2L0F A;  3HY5 A;  3SYL A;  1E0Z A;  5D94 A;  4YHH M;  2ATO A;  4QHT A;  1ZP0 B;  1IQP A;  2RKO A;  2GLS A;  3VUX A;  4YYQ A;  2AEH A;  4W9E A;  1EE8 A;  3L0W B;  2WGS A;  4OVV A;  1VLB A;  2MH7 A;  1WE6 A;  5ITX A;  4HJK A;  3RNE C;  2V3S A;  2EMS A;  2JY8 A;  1R4N B;  2MQJ A;  3FD9 A;  3HHY A;  3ZQJ A;  2C96 A;  3TPZ A;  3I4V A;  1T3Q A;  4BS6 A;  1GL6 A;  3J80 S;  4MEM A;  5EP4 A;  5EE0 A;  4W5C A;  3SD5 A;  2H1R A;  2G6D A;  1WMH A;  1ZPS A;  2FFJ A;  2GRI A;  2PTL A;  4NXN M;  3RNF C;  1OQR A;  2BBC A;  1E9S A;  1K82 A;  1E5W A;  2W54 A;  2C99 A;  5JI3 E;  1XLN A;  3AJI B;  1QUS A;  3ZIM A;  1NVM A;  1EWP A;  1GMY A;  3RNA C;  2DZZ A;  3F75 A;  1IN7 A;  5IO9 A;  3DBL B;  4IOI E;  2VDB B;  2FCN A;  3SBJ A;  3KOZ E;  3AH7 A;  3DHI C;  4D8E A;  4RM8 A;  1TR8 A;  2O6V B;  3K2L A;  4Q8H A;  1TF0 B;  5IZ7 D;  4IBC A;  2J7Q B;  2KDM A;  4PP2 E;  2C7M B;  2DXI A;  4HJG E;  2XGN A;  2DX5 B;  4IBI A;  4GDL A;  2G4D B;  2OJW A;  1LTM A;  3JAM S;  1VEG A;  3B2F A;  5EZS A;  4MGI E;  1QYR A;  3FTF A;  1XCT L;  1S3S G;  3APC A;  3DBH I;  2G5G X;  2E6X A;  3AEC B;  1WHC A;  4F8C B;  1XLP A;  3Q8F A;  2WXP A;  1R7S A;  1YQ4 B;  2ZEQ A;  3MC0 B;  1F77 A;  3U6Q A;  1DV0 A;  2CJO A;  2UYZ B;  3UMM A;  4GOC A;  3KWV A;  3UZU A;  4CDD B;  3C58 A;  1MX0 A;  1B1Z A;  2IO3 B;  2PMV A;  1KF6 B;  3Q69 A;  1DEU A;  3U61 A;  1IY0 A;  1XXH B;  2MJ5 B;  3AXC A;  3OWE B;  2MRP A;  1TGZ B;  2INC C;  3LXS A;  3Q8X A;  2JRI B;  3NHE B;  5C23 A;  3KVF B;  3HM6 X;  3VRB B;  4XDD A;  3PSE B;  1K51 A;  3RCZ A;  3A33 B;  4DHJ D;  3PRP A;  2JXX A;  1FXI A;  4NNJ B;  4TKN A;  1F2C A;  2FT2 A;  4R71 A;  1V2Y A;  1E7P B;  2OHF A;  4A8X C;  1NB3 A;  3PV1 A;  2B76 B;  2UUA M;  2DHR A;  3RMK C;  2Z4S A;  3A9J B;  3AEE B;  2P5T A;  2IYD B;  4JWS C;  4HPM B;  4GMQ A;  4IIW A;  1XXG A;  4IC7 B;  4N6E B;  2BB6 A;  1HZ5 A;  2XU1 A;  4BPV A;  1NVI D;  1CMX B;  1Z5B A;  3IAS 1;  1YLA A;  4HLQ A;  1OAI A;  1TIF A;  2DKL A;  5BMH A;  1V5O A;  2P7U A;  3BC3 A;  3GZN I;  4ZRJ A;  3MTN A;  3TL4 X;  5GKN A;  3UK6 A;  1WI0 A;  3I01 M;  2PVG C;  3WIM A;  3PHX A;  3FYD A;  2FUG 1;  1KLV A;  4RGT A;  1WGG A;  4RKX A;  3R9X B;  4WAF A;  4YTN B;  4B0E A;  1NDD A;  3L17 A;  1I4X A;  4GUA A;  2O25 A;  2XFT A;  2KN5 A;  4FJY A;  2AU1 A;  2NBV B;  1QF6 A;  1LO5 D;  3SU8 X;  3KW9 A;  4K7U A;  3GLH E;  1C79 A;  3R2T A;  4OX9 M;  1EU4 A;  3KW5 B;  1U9Q X;  3FUU A;  3CST A;  3OJ4 B;  3U6D A;  3TEW A;  3J7B A;  3HK0 A;  4MB7 A;  3PHW B;  5C2T B;  2WBF X;  3A9K B;  2YJ2 A;  4IKG A;  5BPV A;  4FA6 A;  4PS3 A;  1ZQ9 A;  1E6E B;  2QCZ A;  1JWB D;  3EEC A;  3ZNI D;  3ZGZ A;  1IN8 A;  3V05 A;  3QC8 B;  1T6O A;  4HKZ E;  3PPA A;  4G50 A;  2OED A;  3KYD D;  1UNS A;  3LQQ A;  2VQF M;  2JZP A;  4DR6 M;  4XDC A;  1NEN B;  4JIO U;  3ZNZ B;  3E21 A;  4W5B A;  2B1N A;  1W5T A;  3LYY A;  2G3Q A;  4JI8 M;  4HWI B;  2MHJ A;  4LRS A;  4HK2 A;  2D3C A;  2LRW A;  5MPO A;  4F1S A;  3RD2 A;  1TKG A;  2L6O A;  2PJH A;  3CH2 X;  2ZTD A;  3X0W A;  4YT0 B;  3U8E A;  1PJS A;  3WHL A;  3L26 A;  1G4A E;  2KZS A;  5L8R F;  3H89 A;  2R62 A;  4KKI A;  2XN9 C;  1HZ6 A;  3AEG B;  2LVP A;  4ANW A;  3H8C A;  3TEY A;  2WSC F;  1WYG A;  2KEB A;  5G55 A;  3N3G A;  3A42 A;  4K0K M;  4HKQ A;  2C60 A;  2K3U A;  2VQE M;  3AFH A;  1TH3 A;  1WZ3 A;  4KO8 A;  3T8M A;  1TKE A;  2WXO A;  2CEA A;  1AU3 A;  2R45 A;  4AUQ C;  3CH3 X;  2NCN A;  3QJ3 A;  4LF7 M;  5DPT A;  3R8F A;  1ZGU B;  4XWW A;  1BP4 A;  2CV2 A;  3W5U B;  2R9C A;  1L2D A;  2KYW A;  2B3A A;  4MGH A;  1V92 A;  3EUB 2;  1DGJ A;  2Y5P A;  2OZ2 A;  3RVV A;  3WAL A;  4LRT A;  3ZXV A;  4CO7 A;  1SIF A;  3KS4 A;  4XBO A;  3A4R A;  3MHZ A;  3ZTD A;  4YTM B;  2BS4 B;  2BS3 B;  4KGS A;  1FCL A;  2DC8 A;  1J5E M;  1GAB A;  2G8L A;  2BWE A;  1WGR A;  2KDE B;  4IBK A;  4LF8 M;  2NQI A;  3RVX A;  5LXI B;  3VDU A;  4DR5 M;  3QHT A;  1S4V A;  2NQD B;  3N1Z C;  4PS7 A;  2DZJ A;  2KNA A;  2C9O A;  1T6B X;  2VHS A;  2AIM A;  2DZL A;  1U9W A;  1UKF A;  4NY0 A;  4P6G A;  2WXQ A;  1DO0 A;  3A1Q B;  3KSJ A;  2XF3 A;  2KT7 A;  2R61 A;  4I5S A;  2V4I B;  3L13 A;  2B1M A;  5FPW A;  2C7H A;  3H6N A;  3VTV A;  4YYR A;  3KS8 A;  3X23 A;  2DOS A;  2G1E A;  3V61 A;  1H4R A;  1GB1 A;  4CIS A;  4WQM A;  2BWB A;  5BYS A;  2HAK A;  3NY5 A;  4WAA A;  5G5G A;  2Z59 B;  4KT0 F;  5EXS A;  2F1G A;  1AU4 A;  3BOW A;  4D8I A;  1QAN A;  2XZU A;  4N4Z A;  1ZUD 2;  3EGR A;  3AKZ A;  1KSF X;  1CPJ A;  2KN4 A;  1PPD A;  2R4J A;  1SP4 B;  3LCU A;  4WUR A;  4GKJ M;  4I07 A;  4HEO A;  1NJF A;  3RPF C;  1WGH A;  2JUO A;  4UDU C;  4AJY B;  3TRK A;  4RKU F;  2O6V D;  3M62 B;  2VF7 A;  3BPM A;  3KOW E;  3L25 A;  3DBS A;  4LF5 M;  3IT4 B;  4MSX A;  3U6E A;  4PS8 A;  2K1F A;  3KFQ A;  5EJC A;  4ICU A;  4AW4 A;  2H88 B;  4WWM A;  2JT4 B;  2EKF A;  3GQ3 A;  1SE4 A;  2BKR B;  2R9F A;  3P5X A;  3HGI A;  2DAK A;  2CU3 A;  1CSB B;  4WP2 A;  1JRO A;  4DV5 M;  1DOX A;  3M3J A;  4ZYN A;  4NAW B;  1E9R A;  2C9C A;  4GC5 A;  1P3Q U;  1XHB A;  1LFD A;  4LZJ A;  2CE7 A;  3HU1 A;  4OZB A;  2DCC A;  4PAD A;  2P86 A;  4HRO A;  2LTU A;  2E3T A;  2KWC A;  2B3T A;  3ZCB B;  1N63 A;  1YAL A;  2MR9 A;  2JP7 A;  5H8Y E;  2LVO A;  3OF9 A;  4YV8 A;  3GO8 A;  1GAQ B;  1WM3 A;  3P5U A;  1N78 A;  1C77 A;  1SXJ E;  4DQO C;  1MJG M;  2AHM A;  3KSX A;  1N61 A;  3SAU A;  4L8R C;  1FFU A;  3HRD D;  2NVU I;  3DZD A;  2CB5 A;  4DBG A;  2HTM E;  2UXC M;  2N1V A;  1QLB B;  2XBB C;  3TMP B;  3FKE A;  2INN E;  4ZHO A;  2KZR A;  4G54 A;  3V60 A;  4GRI A;  2WXK A;  3AU4 A;  4MGZ E;  2AWT A;  2BYV E;  2G45 B;  4FJZ A;  3IFU A;  1GLN A;  4KDL B;  1AIM A;  2KFK B;  2LUE A;  2UU9 M;  4M0W A;  3HUI A;  3R7R A;  2N7D A;  1GC7 A;  2AX5 A;  4EZK A;  2M19 A;  4C80 A;  1N60 A;  5KQD A;  3WAO A;  5FLX S;  4MH8 A;  2QSF X;  3OJ3 A;  1RU3 A;  3RZF A;  3J2P B;  1JR3 E;  3WAP A;  1G6J A;  1PGA A;  5TR5 A;  2NQ8 C;  3P4S B;  3GLI A;  3K1J A;  1I4G A;  1V86 A;  1YT7 A;  3PLU A;  1RAX A;  1KM7 A;  2JTC A;  5DPR A;  4LNF A;  1D4B A;  3RNC C;  1C4C A;  2R18 A;  1DGG A;  3H8H A;  4JL9 A;  2BNK A;  4CDC B;  1NI2 A;  5ITY A;  2V3N A;  1S3S A;  2LAS A;  4N58 A;  2IDY A;  1E94 E;  4ZRK A;  4RNA A;  2D07 B;  2UWQ A;  1WX9 A;  4NPN A;  1L2B A;  1NI3 A;  4GIV A;  4DXF A;  3DF0 A;  4R3D A;  2WP9 B;  3BZD B;  3EIH A;  3L29 A;  3IAM 1;  3ECI A;  1JQJ C;  1NPZ A;  4JYA M;  2JXT A;  2DC6 A;  3KVW A;  3ZVV A;  3LCV B;  3ZUN A;  2JF5 A;  1NV9 A;  1R7R A;  4AKG A;  1E7V A;  2DHZ A;  4IJF A;  4NC6 A;  2ZAN A;  1V49 A;  2MX2 A;  3KKU A;  3PVS A;  1QDT A;  3K9O A;  2GBR A;  2N7E A;  3A46 A;  3CSF A;  3PGE A;  3C9E A;  2KLC A;  2WS3 B;  1Q3B A;  2WYQ A;  2AL6 A;  2INP E;  3QAU A;  1WGD A;  1IN4 A;  1EFU B;  2LGX A;  3SAV A;  3D6S A;  2RDB C;  3W31 A;  2KWU B;  1GB4 A;  5CHW A;  3W9C B;  5KPZ A;  1HTO A;  4JLC A;  2QNJ A;  3PRE A;  3CF2 A;  1YJI A;  1YE9 A;  4ZTB A;  2W9N A;  2YVC A;  2DCB A;  2NBU A;  1D2N A;  2L7R A;  4AKH A;  4HDO A;  4ASW C;  3FC4 A;  2NPT B;  3H1U A;  3JYU A;  2GI9 A;  1WXS A;  5EE3 A;  5KHO A;  3TEZ A;  3P5V A;  1N62 A;  4AKI A;  3IT6 B;  4IM3 A;  3B0A A;  3QSD A;  2YNM D;  5FTJ A;  1P98 A;  1PGB A;  4HEA 1;  4AJW A;  2YJB A;  4FD2 A;  2O6V A;  2DZI A;  4PYZ A;  3B79 A;  1TLO A;  1IY1 A;  2J7Q A;  4ZPX A;  3A45 A;  4A5U A;  1EWM A;  2KLG A;  3VQI A;  1XT9 B;  1HE8 A;  3KDS E;  4F2L A;  2MBQ A;  2I38 A;  3DVN V;  3DBH B;  4M0D A;  4IWP A;  4IWO A;  3KOY E;  2QMT A;  1Z5A A;  5CVN B;  1AIP C;  2IGD A;  5DPW A;  1TH4 A;  2RGH A;  4JI7 M;  1YMH E;  2MJE A;  2DCA A;  1TT5 B;  4DR4 M;  2H5X A;  4NL4 H;  1KRH A;  4RFB A;  2EO2 A;  2LBC A;  1PYW D;  4OVU A;  1FD6 A;  9PAP A;  4CIZ A;  5J17 A;  2CV0 A;  1HEZ E;  1KTK A;  5FTM A;  1FXA A;  2DYB A;  1XXH A;  1FPY A;  1DGF A;  4EKU A;  1YUB A;  1TS4 A;  3IV2 A;  1MU5 A;  2JRI A;  2FYE A;  3NHE A;  1VCB A;  2DNF A;  4I81 A;  4FAD A;  1F1H A;  3NZU A;  1H8C A;  4REZ A;  1EWL A;  3PSE A;  2WXF A;  4M8N A;  2KX3 A;  4L15 A;  2IPP B;  3MK6 A;  2D10 A;  2LJ5 A;  5GXG B;  1FCC C;  3WXF A;  3MOR A;  3AE6 B;  2QHO B;  4B95 A;  5DPS A;  3FE3 A;  2W3R A;  3U7D A;  4QNR A;  4TUW A;  4A90 A;  2BDZ A;  1AWD A;  4KOD A;  2DZM A;  2YJC A;  4MZS A;  1GCB A;  4K1R B;  3A9J A;  3V6E B;  3R2I A;  4ZYS A;  3IXS A;  2E01 A;  2ZM6 M;  1BT0 A;  2XEP A;  3GB1 A;  4NQL B;  4DV1 M;  4LF4 M;  3GZN B;  2WLB A;  3HWN A;  2Y6E A;  3J9C A;  3NJT A;  3B08 A;  3HKP A;  2LEK A;  5J94 A;  2K0B X;  1PQS A;  3ZDT A;  3APF A;  4NSO B;  1HR0 M;  1FO4 A;  2FUD A;  3DA1 A;  3KLS X;  4II2 B;  1RYJ A;  3SHG B;  1WJ6 A;  4ZHP A;  5ITQ A;  2FTD A;  1Y4H A;  1P3Q Q;  5CHT A;  3AOE A;  3Q8A A;  3OAW A;  3U6P A;  2X38 A;  4RY2 A;  3H8B A;  1D5Z C;  2QBY B;  1GJS A;  4TUU A;  4BLC A;  2CU1 A;  3B21 A;  4LGY A;  1YN3 A;  4LJA A;  2MRO B;  3M63 B;  1VJK A;  1CS8 A;  2RGF A;  1EUV B;  2MJD A;  1KHQ A;  1NNU C;  1EWC A;  3SHQ A;  4GDK A;  3WXG A;  3DCG A;  3TEX A;  5HHD G;  1XLQ A;  1Q6K A;  3U6L A;  2QQ8 A;  1G41 A;  2KDI A;  5IA7 A;  3SDL C;  4RMA A;  3PHW A;  2O2V B;  4FIP A;  4JI6 M;  2OOB B;  3LVW A;  1VDV A;  4KGT A;  1LQB A;  1XNR M;  1M4V A;  3JW0 X;  1K52 A;  2L8J A;  3UJN A;  3KX1 A;  3QYE A;  2N0S B;  2UXB M;  2BTW B;  1V6E A;  3K9P B;  2R65 A;  3K24 A;  1A70 A;  2HHH M;  1K53 A;  1SJE D;  3QAQ A;  4L1B A;  4X62 M;  3GRV A;  6PAD A;  4QRV A;  1PE6 A;  2AQ3 B;  3W0L B;  1QIL A;  3N3K B;  2CRU A;  3C3E A;  3T3O A;  4US9 A;  4BFR A;  3HD3 A;  1MPE A;  4D8B A;  1Q0W B;  3MFG A;  4BBN C;  1PJQ A;  3O13 A;  4KLB A;  3GP1 A;  3W1S A;  5JH5 C;  2KVR A;  3PLV A;  3E1Z B;  1HT1 E;  1YD8 U;  1JWA D;  1L6V A;  2ZTC A;  2A4Z A;  3MTV A;  8PCH A;  4LJO B;  4KZC A;  1DOY A;  4XR7 A;  4P17 A;  4I6L B;  1DKI A;  4X64 M;  1SB3 C;  3PTF C;  4WJQ A;  2KQ4 X;  4IM0 A;  2HJ1 A;  4K3B A;  3U8Z A;  4BBN F;  3E46 A;  3JVZ X;  1FRD A;  4DR3 M;  2FQ9 A;  5E6P A;  3J7A S;  1Q1O A;  3HHM A;  2ZVO A;  5EF4 A;  3GLG E;  3DQV A;  3UQB A;  3O65 B;  1EF1 A;  4FHJ A;  2APL A;  3N1Y C;  4F1I A;  1A6R A;  1MEG A;  1NB5 A;  3GLF B;  3LQR A;  3N1X C;  4GB9 A;  2JU6 X;  3KP0 E;  4S0R A;  4FCT A;  1THE A;  1VDD A;  2DZK A;  4D81 A;  1SXJ B;  1LM8 B;  1AU2 A;  1VRA B;  2Y3A A;  1RFK A;  2BS2 B;  1DGH B;  4WJP A;  3IG8 A;  1UWM A;  3FUT A;  2BKF A;  2ERC A;  1MN3 A;  3KSE A;  1I4H A;  3ZW3 A;  3H9D A;  2DEN B;  4KSK C;  4KSL C;  1E10 A;  4IBD A;  3BK2 A;  2V1C A;  2HXZ A;  1PJJ A;  1CQD A;  2R44 A;  1TS2 A;  3BCN A;  2V0G A;  3P1M A;  5E6N A;  4FCV A;  3M6A A;  1D5M C;  3Q8E A;  2YR0 A;  1U5I A;  2JY6 B;  1JAL A;  2JQF R;  1QDQ A;  1TDH A;  4OZA A;  2OO9 A;  2WSE F;  2R46 A;  5EE9 A;  2BJV A;  4A20 A;  3BBZ A;  2YFQ A;  4XK8 F;  4KVG B;  4GH9 A;  3ZDM C;  1YN5 A;  4ITK A;  3SFD B;  3HJ8 A;  1CUK A;  3FUW A;  1C78 A;  3A1Q A;  4OW0 A;  3SFE B;  2OP3 A;  4IG7 B;  5F3W A;  5BMI A;  3GPX A;  3OTO M;  3FIL B;  3V62 A;  5IN7 A;  1L0Y B;  1CJL A;  1JWM D;  1BML C;  4XGI A;  1UBQ A;  2FCS A;  4IM2 A;  4R7G A;  5CHF A;  5FTK A;  3ZTC A;  4PDG A;  5BO4 B;  2LNH C;  2KW0 A;  4P16 A;  1D6E C;  2BU3 A;  4IUM B;  3VH3 B;  4G4Q A;  1PIP A;  2KMC A;  2QJL A;  3P2B A;  2DJF B;  1WR1 A;  4G4R A;  2H7J A;  1ZV1 A;  1EF5 A;  4C00 A;  4GIP A;  1NLJ A;  1DF0 A;  3ZH9 B;  1PFD A;  4M9S A;  1HQC A;  2GQF A;  2AGA A;  5JHB A;  1FM0 D;  1DGB A;  2ZAM A;  1YJJ A;  2WX0 A;  2JX5 A;  3HHZ A;  5D3D A;  2QPA A;  1ME4 A;  4GEW A;  2RSU A;  4KLN A;  1G3I A;  3VLF B;  3HM3 A;  5AEK B;  1ZE3 D;  4MM3 B;  2MW5 A;  1POP A;  2L2D A;  2BPS A;  1WY8 A;  1D5X C;  1MEM A;  3BOS A;  2HJ8 A;  2EKE C;  2OQ4 A;  3Q3N C;  4LNI A;  4B7F A;  3TUO A;  2VII A;  3QCA A;  2LXA A;  2WXN A;  5DNY A;  4XUI A;  3KQ4 A;  1V5T A;  1NQC A;  3CF0 A;  1YQ3 B;  3QX1 A;  2HE7 A;  3I3T B;  2MBH A;  2DAJ A;  2IBI B;  2EKK A;  3FYC A;  3NVZ A;  4AZF A;  2OJR A;  3IHP C;  4LNK A;  2NQG A;  4DV2 M;  2DWN A;  4X6J A;  4JI3 M;  1UM8 A;  1E32 A;  4NAW A;  3AB5 A;  2PE6 B;  2PIA A;  7PCK A;  4LF6 M;  2M56 B;  4DHZ E;  3M99 A;  2XEW A;  5J18 A;  4ARC A;  4JI5 M;  2VHF A;  2RDG A;  5FTN A;  3KFU G;  2F5P A;  1CQV A;  4NQK E;  1IN6 A;  1RFA A;  4ITQ A;  3NZS A;  1HT2 E;  4CGY B;  2BT6 A;  3EHV A;  1ROE A;  4HLE A;  2P0R A;  4XE0 A;  1GOZ A;  2AUZ A;  3H4J A;  3VKH A;  2FBW B;  2MWS B;  1E90 A;  2E00 A;  4BOS A;  2ZAO A;  3THG A;  5CHV C;  1J0G A;  4DDG D;  4ZUX U;  4EFO A;  1D3Z A;  4JXJ A;  3T38 A;  1OTR B;  1XC8 A;  4YWG G;  1V1P B;  4EIW A;  3N4C A;  1QKZ A;  3C3D A;  1WWT A;  1K3W A;  4BOZ B;  3OF8 A;  3E56 A;  1L4Z B;  2R9N A;  3I4Y A;  4HL4 A;  3SYK A;  4LG2 A;  1RM6 C;  3QWZ B;  1Z6T A;  2LWX A;  2FNA A;  5KQ8 A;  2D7E A;  4ANX A;  4LTU A;  2KFK A;  1F2R C;  1KFX L;  1OQY A;  3GPY A;  1HJP A;  3C9P A;  4Q2J A;  1MIR A;  3NRZ A;  3P4P B;  3ZNH B;  1IXS B;  3DBR I;  1C9F A;  2MEK A;  2R9M A;  1PDX A;  4A9A A;  1JQP A;  2KVZ A;  3O0U A;  1GUA B;  1UD7 A;  3DVG Y;  3B9P A;  2A5Y B;  3BYY B;  3CTW B;  2KQS A;  2KDF B;  3AE3 B;  4C4V B;  1V33 A;  1IXR C;  1V9J A;  3PDF A;  4BKS D;  3IVF A;  2L09 A;  3VVW B;  2JRH A;  3L08 A;  1B9R A;  3VTU A;  1ENF A;  4MEL A;  4FK5 A;  3C8Y A;  2Y21 A;  2AL3 A;  1C1Y B;  1D0L A;  4AQY M;  5FSW A;  4PT5 A;  2J7N A;  1ZDV A;  5HG2 A;  1JRU A;  3PBH A;  4WJO A;  4OEL A;  2WSF F;  4H2A A;  2JQG R;  1GJZ A;  2JWZ A;  1UH6 A;  2JZ0 A;  1R4N I;  4B9K A;  3AMZ A;  2N7J A;  1LV7 A;  2K5P A;  1Y8R C;  2NTT A;  1WJ7 A;  4LDT B;  2I7N A;  1MHW A;  2VF8 A;  4KDI C;  3PRZ A;  2ZZP B;  2DAG A;  4B6W A;  4BQV A;  4JGH B;  1ET9 A;  2MBO A;  3UQA A;  2DJG B;  1VG5 A;  4Q7J A;  2CHQ A;  2LVP C;  2JVC A;  2M0X A;  3B7Q A;  3ML8 A;  4LK0 M;  4N9F 4;  3VR8 B;  2MGW A;  2WXM A;  3I5J C;  5AUK A;  5L83 A;  4HWY A;  2E03 A;  1U4A A;  1M6D A;  2VZK B;  2CHX A;  3BYT B;  5FTL A;  3QQ8 B;  3H7D A;  3GS2 A;  3GLH A;  2DC9 A;  3AE2 B;  1N33 M;  4DV6 M;  2KNZ A;  1EM7 A;  2LWP A;  4W9J A;  4GSW A;  3VK8 A;  1E9M A;  4LCD E;  1FMA D;  2QP9 X;  1UBI A;  4YXD B;  2TSS A;  4LCB A;  2KDB A;  3GRU A;  3QT4 A;  1WIA A;  2WXI A;  5JXV A;  1N75 A;  5KPT A;  4Z6Y A;  4D82 A;  2NPT A;  4LY6 A;  4NZL B;  2FNJ B;  4FCW A;  4M00 A;  3RUL A;  1NL6 A;  2ZPN A;  2K9X A;  1SEB D;  1NHG C;  2CJN A;  4D80 A;  3RUI B;  2Z84 A;  2QIE B;  1R4M B;  3MP2 A;  4BOU A;  2L00 B;  4B0M A;  2YJ9 A;  1IBX B;  1AYW A;  1DO2 A;  2MBE A;  1TKY A;  1QT9 A;  2Y0Q A;  3RNB C;  2R6F A;  1G71 A;  1WGN A;  4FVM A;  1SXJ D;  3FTD A;  4AS1 A;  4OZC A;  1YIW A;  1BVS A;  2WNM A;  1XCQ L;  4ZOH C;  1KOT A;  2IND C;  1EWO A;  4W5W A;  5EGW A;  2M60 A;  2DAE A;  3PXG A;  4B3S M;  1EO6 A;  3U60 B;  2J4X A;  3BVM A;  3TCA A;  3U6M A;  2V1U A;  3B2G A;  2J52 A;  4B3M M;  3ZLZ A;  1J7B A;  2XFS A;  3VDP A;  5E6J A;  4JI0 M;  4LJ4 A;  3VK7 A;  1D0M A;  1WR6 E;  4A3V B;  3GQ5 A;  3DDC B;  3APD A;  4KGR A;  5LLI A;  3OG5 A;  1V97 A;  1V34 A;  2JWS A;  1JWS D;  3BK1 A;  2WDV B;  5FK9 C;  4ANV A;  2FAZ A;  2PNS A;  1GNU A;  3HJS A;  3GLG B;  1N34 M;  4M8M A;  1JR3 D;  2V1Y A;  4YYU A;  2LGD A;  2N9P C;  1IY2 A;  4WWO A;  3DPD A;  1AYV A;  2KNV A;  1BGO A;  2IO0 B;  2QZ4 A;  2J42 A;  4P1C C;  1XB2 B;  4N8W A;  3GLF E;  1OAO C;  5JZE B;  4ACF A;  4C7Z A;  3U6O A;  4F7Z A;  3LW5 F;  2W82 A;  3C19 A;  2BYF A;  1IXZ A;  2FCQ A;  4RM9 A;  3V6E A;  3MJW A;  2ZVN A;  1YN4 A;  2DHY A;  3QA8 A;  1T3T A;  5FKA C;  1PBH A;  4TV3 A;  2REX A;  4HPL B;  2M1M A;  2XK5 B;  3PS6 A;  3L27 A;  3HHX A;  1IWD A;  2DCD A;  3ETR A;  1KFY B;  2WXH A;  3VXW A;  2KTF A;  1VD2 A;  5D7G A;  3ZYY X;  1T43 A;  3KWZ A;  3OQC A;  4YSX B;  2DI0 A;  3GPP A;  1I94 M;  2WWZ A;  4L23 A;  4G4O A;  3B9J A;  3ZC7 B;  4ARI A;  2F7D A;  3HWS A;  2GOW A;  5EP3 A;  4AQ7 A;  2QBY A;  1WIV A;  2FS1 A;  2PBH A;  2DZY A;  5EP1 A;  3U6S A;  3IMA A;  1SF0 A;  3EIE A;  2ZJD A;  1R5L A;  1T0R C;  2WDT B;  1SG9 A;  1FEH A;  3D32 A;  4WA6 A;  5F02 A;  1T0S C;  4BKS A;  4L6V 6;  2D7H A;  3FTC A;  2RPV A;  1FH0 A;  3L10 B;  2BYT A;  4OU7 A;  3U5Z B;  1AYF A;  3M0E A;  1TL9 A;  3M95 A;  4QOS A;  4EZL A;  4YVA A;  2BJW A;  4CHT B;  4XZ4 A;  2O2V A;  3SR6 A;  3AM9 A;  4OVZ B;  1PVJ A;  4QBB A;  1O0E A;  3JR4 A;  2OOB A;  2JY7 A;  1YK8 A;  3VUY A;  3AI5 A;  3FKY A;  3E4R A;  1L4D B;  4W9C A;  2AYO B;  3BB7 A;  2BWF A;  5ITU A;  1F2A A;  1ATK A;  1L5P A;  2X4A A;  4GXB A;  4CDF B;  3AEF B;  1V8C A;  1MDW A;  4FJC A;  4J6I A;  2I1K A;  2DYM A;  2BTW A;  3K9P A;  3T6P A;  5IP4 D;  2BGF A;  4QH6 A;  3MP9 A;  2AQ2 B;  4AXL A;  2Y5B B;  3KH0 A;  3Q8C A;  4IBE A;  4DV4 M;  2CHZ A;  3AEB B;  2RR9 A;  3N3K A;  4IBG A;  1PAD A;  2D3B A;  4DV3 M;  3VTW A;  2KD0 A;  2ARY A;  1NYR A;  5G5H A;  4GIT A;  5AZH A;  3CBJ A;  4I05 A;  1OIZ A;  1YVB A;  2MJ3 A;  2Q5W D;  4G11 A;  1STE A;  4TQ0 A;  1QMY A;  4WH4 A;  3KYC D;  2GMI C;  2IJ0 A;  3RE8 A;  3FRH A;  4LGM A;  5KHQ A;  1AAR A;  3KW6 A;  3NG0 A;  3MJ5 A;  5T8I A;  1UEL A;  1SXT A;  3U52 E;  2BTE A;  2R9O A;  2KRK A;  1TTN A;  4K3C A;  2G8J A;  3LJ3 A;  1YQB A;  2N4F A;  3Q6B A;  4YYS A;  2DWL A;  2F5O A;  2ZCB A;  4EEW A;  3OLM D;  2Z0E B;  2LI5 A;  3IOQ A;  1KFV A;  4DHZ B;  3BY4 B;  3O65 A;  1HNZ M;  4AP4 C;  1TGU A;  2YJ8 A;  1NO1 A;  4DUZ M;  3CWI A;  3PNY A;  1E7U A;  4KHP M;  1SBB B;  2A5U A;  2FRA A;  3IG3 A;  2K22 A;  1QQR A;  3UIN B;  5KO3 A;  1JWU D;  2VH1 A;  2J5Y A;  3BWU D;  3LMM A;  4B7G A;  3W2D A;  3P4Q B;  2KRU A;  3I04 M;  1SXJ A;  2V3P A;  4C56 C;  4I8O A;  1LXD A;  4WQO B;  1KXR A;  3MHH A;  1BY8 A;  1FIQ A;  4NJC A;  1YSY A;  4W4U A;  4HVB A;  1WGL A;  2L32 A;  1IPG A;  1NJG A;  2L7I A;  1E8W A;  1TS3 A;  2DEN A;  3RNG C;  2IO1 B;  4ICV A;  3CMM B;  3W1Y A;  1MHH E;  2KAN A;  3VUW A;  3BVZ A;  1N5X A;  1XMO M;  4FWG A;  4CHK A;  4CJ6 A;  1YX6 B;  5C1B A;  4HCP B;  1S1Q B;  3NBX X;  2JY6 A;  2EA0 A;  4DMX A;  1MFW A;  4FJV B;  2NTS A;  3TIX A;  2QIL A;  1P0R A;  2CIO A;  4LDT D;  1PPP A;  2J53 A;  2KTR B;  1JR3 A;  2WDR B;  3VFD A;  2GBN A;  2N9L A;  3ZNG C;  2LRU A;  1ITO A;  4W9I A;  3DHG C;  2J0K A;  2R2O A;  1QDR A;  2J7O A;  3FIL A;  2ZW1 A;  4TMA B;  3V6C B;  1ET6 A;  2M4N A;  1X37 A;  1NV8 A;  3B7Z A;  2X49 A;  2CP8 A;  1FXT B;  3IBE A;  2K39 A;  2DAM A;  4IUM A;  2LMC A;  1JB0 F;  1IGD A;  3H6S A;  3KWB X;  3ILK A;  1PJI A;  4DMY A;  3U30 A;  1GVN A;  4FWD A;  1P9D U;  5JA7 A;  2C5L C;  1AYU A;  3SFZ A;  2D3G A;  2F4V M;  2O5R A;  4JE3 B;  4JQW C;  5LMN M;  2L76 A;  2IY0 B;  1D0K A;  2LHD A;  3NVW A;  1G8P A;  4NJ7 A;  5ITX E;  5ITT A;  4B3T M;  1MVK A;  4BZA A;  3FUX A;  2G7Y A;  4L78 A;  5DYG A;  1J7K A;  3HU3 A;  5H92 C;  4HDQ A;  1OQQ A;  2IPK D;  2X8X X;  1R4G A;  2Y20 A;  4MM3 A;  1WXA A;  2BB5 A;  4GKK M;  1N5W A;  3AED B;  3VKG A;  4LJ7 A;  1RWS A;  2V6Z M;  2UXD M;  3H7S A;  4M02 A;  4M9X A;  2Z3X A;  3NS1 A;  4QAY A;  3VHT C;  3OIS A;  2Z7J A;  5AZG A;  4USA A;  3TE6 A;  2JPH A;  1QAM A;  3I3T A;  1JW9 D;  2AQ1 B;  4HCN B;  2IBI A;  4PP1 A;  5FR6 A;  4L2Y A;  1N6Z A;  3A4S C;  4DK5 A;  2UU7 A;  3ZO5 B;  2WX1 A;  3V3X A;  1QOA A;  3SAR A;  5CX3 A;  3U6C A;  1WXV A;  3BIN A;  3Q3F A;  1K3B B;  1Z59 A;  1FNU A;  2JZ3 B;  4G4N A;  3EA6 A;  3A9K A;  1TU6 A;  3EFU A;  1SIJ A;  2LVA A;  4Q8G A;  4IJE A;  1GKI A;  1XKG A;  1ZW7 A;  1AW7 A;  2N35 A;  3RFW A;  2NR2 A;  2BWE S;  2KX0 A;  2IGH A;  3W67 A;  5CTR C;  5HKH A;  5BYQ A;  2WQY B;  2C98 A;  4QHS A;  1NHW C;  2AYN A;  1XO3 A;  4NSR A;  1V80 A;  1I4W A;  1OTR A;  1KLU D;  3MHS D;  1P7E A;  1OKS A;  1V1P A;  2DWQ A;  2D5G A;  2ACZ B;  3PZD A;  1UZX B;  2LHG A;  2XZF A;  3AOE C;  3H7P B;  1WH3 A;  4BOZ A;  2Q2E B;  1UWX A;  4WWP A;  1MHX A;  2Y0T A;  5IAA C;  3AV0 A;  1ZKH A;  2HHN A;  1WXM A;  1AN8 A;  2F5Q A;  2KJH B;  2ZPY A;  2KXE A;  2FIF A;  5EQT A;  4DR7 M;  1QZE A;  7CAT A;  1N36 M;  4QOZ C;  2WU2 B;  3DBR B;  3H4M A;  4S12 A;  4YYW A;  4DXG A;  2O6X A;  3ZNH A;  1IXS A;  4PD2 A;  2DWZ B;  2JQR B;  2HH5 A;  4A3O A;  5EXX A;  4C7Y A;  2BDL A;  4JV5 M;  1VJV A;  1T5X D;  2SEB D;  3EC8 A;  1K8R B;  3WA0 A;  1GPX A;  2LGS A;  5EZQ A;  2JYT A;  1I4R A;  1WJU A;  2MP2 B;  5CVM A;  2JUJ A;  1XF5 L;  2J0M A;  3K8U A;  2GNO A;  5JH3 A;  4MJS B;  1IYF A;  3L2A A;  4N59 A;  4LLG M;  2LZ6 A;  4PI3 A;  4HXD B;  2VH2 A;  2RMM A;  4X6H A;  3TNX A;  1FNW A;  1ZXH A;  3QAR A;  1WE7 A;  4G0N B;  1XEE A;  2XU4 A;  1QOF A;  3IEJ A;  4WIP A;  3PRM B;  3BBA A;  3W1S C;  3R8B A;  4URK A;  2YEP F;  3ZRC A;  2ZBK B;  2FCM A;  5A24 A;  4RF1 A;  3ZJU A;  1C76 A;  2BW2 A;  2YQZ A;  4LJ8 A;  1TBE A;  1WYW B;  2PEA A;  2K8B A;  1C1K A;  2I7P A;  2H89 B;  5DFL A;  2KXJ A;  3BII D;  3F92 A;  2C9W B;  2KK8 A;  5C1Z A;  4GLS C;  2NQA A;  4X66 M;  3SAW A;  2ZCC A;  4ZDV A;  1U9X A;  1R6B X;  2RGO A;  1VZ6 A;  1L7Y A;  1TDZ A;  3J27 B;  1XD3 B;  4B08 A;  2PRE A;  3SMS A;  2JSV X;  1HA5 A;  1TS5 A;  2RDH A;  3NUH B;  3RYT A;  1I4P A;  5JHA A;  2Z8Y M;  3S3Q A;  3PNV A;  1HUC B;  5D3I B;  3KUD B;  1X1M A;  3SAT A;  3P4R B;  1CB5 A;  1L1T A;  4E71 A;  4YSZ B;  4I6N B;  1PCI A;  4Z8X A;  4JWU C;  3EFC A;  4RGN A;  3WAN A;  4MSM B;  4MT5 A;  1Z5C A;  3AUL A;  1IBX A;  3Q8G A;  4W9D A;  5GMV A;  4LF9 M;  3TSS A;  3VH4 B;  3ERV A;  4BKG A;  1X9Y A;  3NOB A;  1ORY B;  3S3R A;  2HD5 B;  5D6J B;  3IHP A;  5HFY A;  2RD0 A;  4PYU A;  2CS4 A;  3HHA A;  1JML A;  4CQN A;  3T3N A;  2R6N A;  4LJ9 A;  2KMA A;  3U60 A;  4NOO B;  1L8Q A;  3R3M A;  3PNR A;  4YL8 A;  3WCQ A;  5EDS A;  3OVZ A;  3IUT A;  5AUI A;  2D3A A;  3BVG A;  1LGR A;  2XU5 A;  1HQY E;  5L95 C;  2EMT A;  4IWQ A;  2KA6 B;  1TY2 A;  1TZ1 A;  1Z5S B;  1VQ1 A;  2D11 A;  5CVO B;  1YJ1 A;  3AL0 C;  1C4P A;  1V81 A;  3RGS A;  3SMP A;  1ZAE A;  3GLG A;  2GBJ A;  5CHV A;  1SNK A;  2PE9 A;  5EXT A;  1FRR A;  4MH0 E;  2KNB A;  3PT2 B;  2PLP A;  2KJR A;  5LNK 1;  3TBL D;  1EU3 A;  4NAM A;  2E02 A;  2EUC A;  4XGA B;  3W0F A;  3L4P A;  2K8H A;  4ANU A;  1PJT A;  4LJ6 A;  5DCN A;  3LXF A;  4TQ1 A;  3HHI A;  5JZE A;  3MHS A;  3MMP A;  3GQ4 A;  1VEK A;  2JZ1 A;  3ABV B;  3RZW C;  3B89 A;  2Z8L A;  4GDK B;  4I4L A;  1TY0 A;  2R2Q A;  3JSV B;  4LFC M;  2EJS A;  3TQS A;  4K7W A;  2DAI A;  4DV0 M;  1GO5 A;  3VDZ A;  4JI4 M;  2L7H A;  1XWI A;  2XK5 A;  1JCK B;  2MSE D;  3B1L X;  2CHV A;  1OJL A;  5BYR A;  4FBJ B;  3TMP A;  3TWM A;  1VZ8 A;  4A3P A;  1MG8 A;  4UN2 B;  2Z4R A;  3USV A;  4KIK B;  4AG6 A;  3KXE C;  1WX8 A;  3KUZ A;  1I7H A;  3BXW A;  1ISN A;  3I06 A;  4K7S A;  4BKT A;  4E3C A;  2FE8 A;  3Q8B A;  3W68 A;  5IKC M;  2M17 A;  4EOY A;  4JI2 M;  2V4L A;  1IBK M;  2YEP B;  2JWU A;  2QSD A;  3E9S A;  1UF0 A;  4IBJ A;  3IFW B;  3HHW A;  2JXN A;  3LDZ E;  3ZJV A;  1WM2 A;  3P63 A;  1TH2 A;  3GRY A;  2CKH B;  3R7Q A;  2F5N A;  3WHK A;  1CJE A;  2QC8 A;  3NVV A;  1ZMW A;  2HWK A;  4II7 A;  3J81 S;  1YNT E;  2BVC A;  4ANR A;  1WX7 A;  3AN1 A;  3U5Z A;  2XH9 A;  1P1A A;  4FXC A;  4W9K A;  3I9V 1;  1DOI A;  3SC3 A;  1Q39 A;  4AI6 A;  3C0R B;  2BQQ A;  4OVZ A;  1T0Q C;  3NZ3 A;  1A5T A;  1STF E;  3QWL A;  1RLF A;  5G2N A;  4IBF A;  2AYO A;  1QOL A;  1ME3 A;  3L16 A;  1NNJ A;  4BOS C;  3AV8 A;  3FTE A;  4GHL A;  2IGG A;  3ZRF A;  4YYV A;  1Q10 A;  1Z2M A;  3UIP B;  1J09 A;  2FID A;  5FR3 A;  1N77 A;  1WSP A;  4GMV A;  1YZB A;  4D2K A;  1RRB A;  4LNO A;  2LHC A;  2Y5B A;  2LXC A;  3DHH C;  3Q3M C;  4RGM A;  3TWL A;  3R66 C;  4XYC A;  1KH0 A;  1R2Y A;  4X65 M;  1OGW A;  3N9Y C;  1QUT A;  1CZP A;  3T9L A;  1UFZ A;  2FRQ A;  2KKC A;  4MDK E;  4K81 A;  1TZO A;  4LJP B;  1C3T A;  2KWV B;  3N32 A;  2IO2 B;  4DR2 M;  4LFB M;  1WMH B;  4L16 A;  3LFY A;  3SHF A;  4BAX A;  4US8 A;  3D8B A;  1XNQ M;  2KC1 A;  3K9M A;  4QRX A;  4GU2 A;  1GLO A;  2KO3 A;  2ASQ A;  3HVD A;  1KFU L;  4E74 A;  3SAS A;  2R4E A;  1DYQ A;  1L2N A;  1E8Y A;  1IBM M;  2YLM A;  4BBA A;  2KHH A;  1UUP A;  4P1B C;  3PW3 A;  3HU2 A;  3MC8 A;  1J8C A;  2AVW A;  2KC2 A;  3O1G A;  1QXP A;  3DBL I;  1UGJ A;  2F5S A;  2JNH A;  4AOF A;  3URY A;  1IUE A;  4DXA B;  4ZRI A;  1I42 A;  4GDL B;  3BY4 A;  3RT3 B;  4G6Z A;  1QOG A;  1J7C A;  4JX1 C;  2JA2 A;  3TL5 A;  1PGX A;  2DLB A;  4I04 A;  1QAO A;  1YOV B;  1ZXI A;  3RN9 C;  1I4Q A;  4P7I A;  1ZIV A;  4N79 A;  4YTP B;  1FNN A;  2IZV B;  2WXJ A;  4PCZ A;  3OVX A;  1R2Z A;  4AG5 A;  2PW9 A;  2CFO A;  4XZX A;  4NXM M;  2KWD A;  2W3S A;  1CTE A;  1Q3C A;  5D2M B;  4EZJ A;  3Q3J A;  3CF6 E;  2ZW0 A;  5C3J B;  3U61 B;  3GLI E;  4LZZ A;  3DVN U;  3VFK A;  1AEC A;  2C7N B;  2M5Z A;  2KDL A;  4A55 A;  2PVO D;  2WXG A;  4RF0 A;  3PVL A;  2WDQ B;  3QIJ A;  3UGJ A;  3WAM A;  8CAT A;  1PPN A;  3AE4 B;  2J0J A;  1NYQ A;  2LHE A;  3PRP B;  2LUM A;  2MBB B;  1PUT A;  4ZRQ A;  1WR1 B;  5IOI A;  1ACC A;  4JN6 A;  3ENE A;  4S17 A;  3UIO B;  2KTR A;  2FH0 A;  2AUX A;  4HRS A;  1MI0 A;  5EXP A;  3FUV A;  2GBK A;  1H6U A;  5TSS A;  4RGO S;  1QOB A;  4NJ6 A;  4AXM A;  4FN2 A;  4MSQ B;  3BWK A;  2WZJ A;  1GJT A;  3ZUA A;  3BPF A;  2L05 A;  1XQQ A;  2BF8 B;  3V6C A;  1OFF A;  4DR1 M;  1I35 A;  2NBW B;  3MTN B;  3GE8 C;  1WF9 A;  1PPO A;  3GRR A;  1L2C A;  4EUT A;  2KJ6 A;  3D8L A;  4M9Z A;  3W5V B;  1J19 A;  3CBK A;  3PHX B;  1BUI C;  3B7N A;  3Q2A C;  2K6Q A;  3QYB A;  3I57 A;  2GBM A;  4KV2 A;  3T15 A;  4PDI A;  2V9H A;  2XNA C;  3GP7 A;  2I1J A;  4IBB A;  2QHO A;  2DZN B;  1GC6 A;  1SGH A;  2G8E A;  4KKJ A;  3WXE A;  3NBI A;  3ONS A;  1PRB A;  4DWF A;  4BS5 A;  1K50 A;  2EEL A;  2WXR A;  4XX5 A;  4GC9 A;  1PM5 A;  3PHU A;  3AE9 B;  2CV1 A;  1WXQ A;  2PKO A;  2RRU A;  4XWT A;  4GN1 A;  2LVQ D;  1ZMV A;  1F52 A;  4RH6 A;  3L54 A;  5LXH A;  1V1O A;  4K7C A;  2MH8 A;  3DOA A;  4W9F A;  4ZRP A;  4CDE B;  1Y08 A;  3DVG X;  2XLJ A;  2G4S A;  1UGM A;  2MLB A;  1CK1 A;  2CWB A;  1ESF A;  1HQR D;  3ZQ4 A;  3MC9 A;  1SJH D;  2K9D A;  1TYG B;  2CR5 A;  2K25 A;  2KHW B;  3ZKJ C;  2IY1 B;  3VR9 B;  3ZJT A;  1GEC E;  1AUA A;  2C5R A;  2DAF A;  2G3Q B;  4WWN A;  3N30 A;  2GFO A;  1NSF A;  4KX6 B;  1NY6 A;  4OEM A;  2ZNV C;  1NEK B;  1ZDX A;  1IBL M;  4GHA A;  2JY5 A;  1F4I A;  2FUH B;  1CVZ A;  4DV7 M;  3MHV C;  2LVO C;  1HTQ A;  1YX5 B;  1F2B A;  2JZZ A;  4TSS A;  3U7Z A;  4IW0 A;  4M01 A;  1U9V A;  4W9L A;  3DOW A;  2QCU A;  3ALB A;  3GOE A;  2XSZ D;  2HKJ A;  1SE3 A;  4X6I A;  2DWM A;  4X57 B;  1XMQ M;  2HL7 A;  1G59 A;  1QQW A;  3HIZ A;  4L4U A;  4GGQ A;  2XU3 A;  1Q5W B;  5PAD A;  1FJG M;  4FW9 A;  4AWJ A;  1Y8G A;  1C7Y A;  3RVW A;  4CZW A;  1XXH E;  2GB1 A;  2LVN C;  3IG5 A;  4B3R M;  3PZ7 A;  3H7P A;  2LH0 A;  1SSN A;  1ZCM A;  5LMU M;  3ML9 A;  5JI2 E;  2CUZ A;  4IDI A;  2LGY A;  4A6Q A;  4BVU C;  2OUL A;  4DUY M;  2C0Y A;  2N9K A;  1FNV A;  3AOG A;  2LXE A;  4II3 B;  1VDL A;  5IT9 S;  3RFZ B;  2AS8 A;  2LJI A;  2ACT A;  3AU5 A;  2R0I A;  1ZOY B;  2Y5C A;  3DWM A;  1L1Z A;  3FRI A;  1IGC A;  3LB8 C;  1Y56 A;  1IM2 A;  2K47 A;  2ONQ A;  1PXV A;  4BOQ A;  1P7F A;  3FAH A;  2LGI A;  3S2A A;  5J2R A;  3HZJ A;  4O1N A;  1WRI A;  4CYE A;  3T1Y M;  2MP2 A;  2OPF A;  1Q02 A;  3GLF A;  1FFV A;  1WJN A;  1E8Z A;  2DBY A;  4MJS A;  3KP1 E;  5I4D A;  4PK1 A;  1W5S A;  1F9J A;  5E6O A;  1MS6 A;  1WZ0 A;  2L1A A;  2OOA A;  1BQI A;  4HXD A;  1DGH A;  3DFZ A;  3GLH B;  5EE1 A;  4DDI D;  1WFY A;  3Q14 C;  4P6E A;  4LJ5 A;  3UGB B;  4DHJ B;  1T0Y A;  2N9E B;  2LFI A;  3PRM A;  1MJD A;  3GE3 C;  5C18 A;  4Y28 F;  1MG4 A;  3I51 A;  1AU0 A;  3GCB A;  2W55 A;  4MGY E;  1KLG D;  2PPH A;  3JR5 A;  2SAK A;  2D7G A;  1KJT A;  4LNN A;  5HI1 A;  3P5W A;  4BB9 A;  2PAD A;  2L0T A;  3V76 A;  3KWL A;  1J7A A;  1VZ7 A;  2M0A A;  2DVW B;  1KYI A;  2JYE A;  4QRG A;  3T1H M;  2UZJ A;  1C4A A;  2MCN B;  1JQ4 A;  4OHJ A;  3B74 A;  5BR8 M;  2NS5 A;  5H37 D;  1WGY A;  3AE7 B;  4IP3 A;  1R4M I;  2MA9 B;  1SE2 A;  3K92 A;  1TJE A;  2UUC M;  2DC7 A;  1QVR A;  5ITR A;  4NRW A;  1CV8 A;  3KOX E;  2KAC A;  3QJZ A;  2L4F A;  3AI8 A;  2VZK D;  2I2Y A;  2M8S A;  3VRA B;  2HCB A;  2UUB M;  1PGY A;  1SXJ C;  5A2Q S;  3AE1 B;  5E26 A;  2GHU A;  1QAQ A;  4BSQ A;  3AE5 B;  3U2S C;  1IP9 A;  4QNM A;  2CHG A;  3KUC B;  2LVQ A;  2KQ7 A;  1EIJ A;  3L28 A;  4MZO A;  1F0Z A;  5KPR A;  3IEC A;  2KZU A;  1JRP A;  2J7Q C;  4WJN A;  2HWJ A;  1IFY A;  2ICI A;  3RI7 C;  3TJP A;  3RGP A;  4FLH A;  2K0P A;  1HNW M;  1GL7 A;  4G3O A;  1VR9 A;  3PO0 A;  1VEJ A;  1N32 M;  4J3O D;  1E8X A;  1XLO A;  3SEB A;  3N20 C;  2HD5 A;  1YK7 A;  2LD9 A;  2QDF A;  4FHK A;  1HXY D;  3GPU A;  2ZNV B;  1F29 A;  2QEJ C;  4B7H A;  3NS8 A;  2EKI A;  3U4E G;  1IN5 A;  2K6B A;  3LVV A;  1HNX M;  3NWL A;  4WW0 A;  2QEN A;  3TWK A;  2L52 A;  2HDE A;  2DYO A;  1WJ4 A;  4HPP A;  1F2R I;  2WHI A;  4YY3 M;  2N1W A;  5K16 A;  1EF7 A;  1OEY J;  3QK0 A;  5DYI A;  4DBG B;  2L83 A;  3ZXR A;  3CIR B;  2Z0D B;  2XSZ A;  3PT2 A;  1L6U A;  1L0V B;  3P42 A;  3HJQ A;  2BYE A;  3VAW A;  5IWA M;  1GG3 A;  1NBF C;  3UI3 A;  2K8C A;  4G3X B;  3A98 B;  1OFI A;  2WXL A;  4JPS A;  4M0W B;  2O01 F;  4LFA M;  2WU5 B;  4JI1 M;  3UF8 A;  5AZF A;  1WRD B;  2KOX A;  2D2Q A;  4EE2 A;  2L3Z A;  5BMG A;  2CHW A;  2KFJ A;  2ON8 A;  3JSV A;  1SE9 A;  3GLI B;  3I63 C;  1K3X A;  5IRE B;  1BXT A;  2HTH A;  3M7G A;  3RNV A;  1M94 A;  1OEY A;  2KMM A;  1OIP A;  4XC2 A;  1ICF A;  4FUL A;  2RPQ A;  1A5R A;  1OFH A;  1VSN A;  2FO5 A;  3K8Z A;  2DNA A;  1WGK A;  2KAJ A;  3PZ8 A;  4KIK A;  4P6V F;  4FWH A;  3CGW A;  3DWG C;  4KZ0 A;  1QZM A;  4W9G A;  4NRV A;  1NY5 A;  2N9X A;  3W30 A;  4I6P A;  2DZO B;  1TTE A;  2L4E A;  5EP2 A;  1EWY C;  4RCO A;  2E5L M;  2G9H D;  3HX3 A;  1KHP A;  3NVY A;  3Q3O C;  3HVZ A;  4MI7 A;  2NMQ A; 
#chains in the Genus database with same CATH homology
 1L0X B;  2X8A A;  2FOI C;  3PFI A;  3AEA B;  4MGK E;  4MAC A;  4YSY B;  3C0R A;  3AE8 B;  4BOP A;  3SYL A;  1E0Z A;  4YHH M;  4QHT A;  1ZP0 B;  1IQP A;  2RKO A;  1EE8 A;  1VLB A;  2MH7 A;  5ITX A;  3FD9 A;  3HHY A;  2C96 A;  3TPZ A;  3I4V A;  1T3Q A;  1GL6 A;  3J80 S;  5EP4 A;  5EE0 A;  2H1R A;  1ZPS A;  2FFJ A;  2GRI A;  2PTL A;  4NXN M;  1OQR A;  2BBC A;  1E9S A;  1K82 A;  2W54 A;  2C99 A;  5JI3 E;  1XLN A;  3AJI B;  1NVM A;  1IN7 A;  4IOI E;  3SBJ A;  3KOZ E;  3AH7 A;  4D8E A;  3K2L A;  5IZ7 D;  4IBC A;  2KDM A;  2DXI A;  4HJG E;  2XGN A;  4IBI A;  3JAM S;  3B2F A;  5EZS A;  4MGI E;  1QYR A;  3FTF A;  1XCT L;  2G5G X;  2E6X A;  3AEC B;  1XLP A;  3Q8F A;  2WXP A;  1R7S A;  1YQ4 B;  3MC0 B;  1F77 A;  3U6Q A;  2CJO A;  3UMM A;  3KWV A;  3UZU A;  3C58 A;  1MX0 A;  1B1Z A;  2PMV A;  3Q69 A;  1KF6 B;  3U61 A;  1IY0 A;  1XXH B;  3OWE B;  3Q8X A;  3VRB B;  4XDD A;  1K51 A;  3PRP A;  1FXI A;  1E7P B;  2OHF A;  4A8X C;  2B76 B;  2UUA M;  2DHR A;  2Z4S A;  3AEE B;  2P5T A;  4JWS C;  4GMQ A;  4IIW A;  1XXG A;  4N6E B;  2BB6 A;  1HZ5 A;  1NVI D;  3IAS 1;  1Z5B A;  4HLQ A;  5BMH A;  3TL4 X;  5GKN A;  3UK6 A;  2PVG C;  3PHX A;  3FYD A;  2FUG 1;  4RGT A;  4RKX A;  3R9X B;  4WAF A;  4YTN B;  4B0E A;  1I4X A;  4GUA A;  2XFT A;  1QF6 A;  1LO5 D;  1C79 A;  3R2T A;  4OX9 M;  1EU4 A;  3FUU A;  3TEW A;  3U6D A;  3J7B A;  4MB7 A;  5C2T B;  4IKG A;  5BPV A;  1ZQ9 A;  1E6E B;  1JWB D;  3ZGZ A;  1IN8 A;  3V05 A;  4HKZ E;  2OED A;  1UNS A;  3LQQ A;  2VQF M;  2JZP A;  4DR6 M;  4XDC A;  1NEN B;  1W5T A;  3LYY A;  4JI8 M;  4LRS A;  5MPO A;  1TKG A;  2L6O A;  4YT0 B;  3WHL A;  3L26 A;  1G4A E;  2KZS A;  2R62 A;  4KKI A;  2XN9 C;  1HZ6 A;  3AEG B;  3TEY A;  1WYG A;  2KEB A;  3A42 A;  4K0K M;  4HKQ A;  2K3U A;  2VQE M;  3AFH A;  1TH3 A;  4KO8 A;  1TKE A;  2WXO A;  2CEA A;  2R45 A;  4LF7 M;  3R8F A;  4XWW A;  2CV2 A;  3W5U B;  1L2D A;  4MGH A;  3EUB 2;  1DGJ A;  2Y5P A;  4LRT A;  3KS4 A;  4XBO A;  3MHZ A;  4YTM B;  2BS4 B;  2BS3 B;  4KGS A;  1FCL A;  1J5E M;  2G8L A;  4IBK A;  4LF8 M;  3VDU A;  4DR5 M;  2C9O A;  1T6B X;  1UKF A;  2WXQ A;  1DO0 A;  3KSJ A;  2XF3 A;  2R61 A;  4I5S A;  2V4I B;  3KS8 A;  2DOS A;  2G1E A;  1GB1 A;  4CIS A;  4WQM A;  5BYS A;  5G5G A;  5EXS A;  4D8I A;  1QAN A;  2XZU A;  1ZUD 2;  3EGR A;  3AKZ A;  1KSF X;  2KN4 A;  2R4J A;  4WUR A;  4GKJ M;  1NJF A;  3RPF C;  4UDU C;  3TRK A;  3KOW E;  3L25 A;  4LF5 M;  3IT4 B;  3U6E A;  5EJC A;  4AW4 A;  2H88 B;  4WWM A;  3GQ3 A;  1SE4 A;  3HGI A;  2CU3 A;  1JRO A;  4DV5 M;  1DOX A;  4NAW B;  1E9R A;  2C9C A;  4GC5 A;  1XHB A;  4LZJ A;  2CE7 A;  3HU1 A;  4OZB A;  4HRO A;  2E3T A;  3ZCB B;  1N63 A;  5H8Y E;  3GO8 A;  1GAQ B;  1N78 A;  1C77 A;  1SXJ E;  4DQO C;  2AHM A;  3KSX A;  1N61 A;  3SAU A;  4L8R C;  1FFU A;  3HRD D;  3DZD A;  2HTM E;  2UXC M;  1QLB B;  3FKE A;  2INN E;  4ZHO A;  4GRI A;  2WXK A;  4MGZ E;  3IFU A;  1GLN A;  2UU9 M;  4M0W A;  3HUI A;  2AX5 A;  2M19 A;  4C80 A;  1N60 A;  5KQD A;  5FLX S;  4MH8 A;  3J2P B;  1PGA A;  2NQ8 C;  3P4S B;  3GLI A;  3K1J A;  1I4G A;  2JTC A;  1D4B A;  1C4C A;  2R18 A;  1DGG A;  3H8H A;  2BNK A;  5ITY A;  2V3N A;  1S3S A;  4N58 A;  2IDY A;  1E94 E;  4RNA A;  4DXF A;  1L2B A;  1NI3 A;  4R3D A;  2WP9 B;  3BZD B;  3EIH A;  3IAM 1;  3L29 A;  1JQJ C;  4JYA M;  2JXT A;  3KVW A;  1R7R A;  4AKG A;  4IJF A;  2ZAN A;  3PVS A;  3A46 A;  2WS3 B;  1Q3B A;  2INP E;  3QAU A;  1IN4 A;  3SAV A;  3W31 A;  1GB4 A;  3W9C B;  5KPZ A;  3CF2 A;  1YJI A;  1YE9 A;  4ZTB A;  1D2N A;  4AKH A;  3FC4 A;  2GI9 A;  3TEZ A;  5EE3 A;  1N62 A;  4AKI A;  3IT6 B;  2YNM D;  5FTJ A;  1PGB A;  4HEA 1;  4FD2 A;  2J7Q A;  1IY1 A;  4ZPX A;  3A45 A;  4A5U A;  3VQI A;  3KDS E;  2I38 A;  4M0D A;  3KOY E;  2QMT A;  1Z5A A;  2IGD A;  1TH4 A;  2RGH A;  4JI7 M;  1YMH E;  2MJE A;  4DR4 M;  4NL4 H;  1KRH A;  4RFB A;  2EO2 A;  1FD6 A;  1PYW D;  2CV0 A;  1HEZ E;  1KTK A;  5FTM A;  1FXA A;  1XXH A;  1DGF A;  1YUB A;  1TS4 A;  1MU5 A;  2JRI A;  4I81 A;  4REZ A;  3PSE A;  2WXF A;  4L15 A;  3MK6 A;  5GXG B;  1FCC C;  3AE6 B;  2W3R A;  4A90 A;  4QNR A;  4TUW A;  1AWD A;  4KOD A;  3R2I A;  4ZYS A;  3IXS A;  2ZM6 M;  2XEP A;  3GB1 A;  4DV1 M;  4LF4 M;  2WLB A;  3J9C A;  3HKP A;  2LEK A;  4NSO B;  1HR0 M;  1FO4 A;  3DA1 A;  3KLS X;  1RYJ A;  3SHG B;  4ZHP A;  5ITQ A;  3AOE A;  3Q8A A;  3U6P A;  2X38 A;  1D5Z C;  2QBY B;  4BLC A;  3B21 A;  4LGY A;  1YN3 A;  4LJA A;  1VJK A;  2MJD A;  1NNU C;  1EWC A;  3TEX A;  5HHD G;  1XLQ A;  3U6L A;  1G41 A;  3PHW A;  4JI6 M;  3LVW A;  1VDV A;  4KGT A;  1XNR M;  1M4V A;  1K52 A;  3UJN A;  2N0S B;  2UXB M;  2BTW B;  2R65 A;  1A70 A;  2HHH M;  1K53 A;  1SJE D;  4L1B A;  4X62 M;  3GRV A;  2AQ3 B;  3W0L B;  1QIL A;  3T3O A;  4US9 A;  1MPE A;  4D8B A;  3MFG A;  3O13 A;  3GP1 A;  3W1S A;  1HT1 E;  1JWA D;  1L6V A;  3MTV A;  1DOY A;  1DKI A;  4X64 M;  1SB3 C;  2KQ4 X;  1FRD A;  4DR3 M;  3J7A S;  3GLF B;  3LQR A;  2JU6 X;  3KP0 E;  4FCT A;  1VDD A;  4D81 A;  1SXJ B;  1VRA B;  2Y3A A;  1RFK A;  2BS2 B;  1DGH B;  3IG8 A;  1UWM A;  3FUT A;  2ERC A;  1I4H A;  1E10 A;  4IBD A;  3BK2 A;  2V1C A;  1PJJ A;  1TS2 A;  2V0G A;  3P1M A;  4FCV A;  3M6A A;  1D5M C;  3Q8E A;  2YR0 A;  1JAL A;  1TDH A;  4OZA A;  2R46 A;  5EE9 A;  2BJV A;  2YFQ A;  4GH9 A;  1YN5 A;  4ITK A;  3SFD B;  3HJ8 A;  3FUW A;  1C78 A;  4OW0 A;  3SFE B;  5F3W A;  5BMI A;  3GPX A;  3OTO M;  3FIL B;  1L0Y B;  1JWM D;  1BML C;  4XGI A;  4R7G A;  5FTK A;  4PDG A;  2LNH C;  2KW0 A;  4P16 A;  1D6E C;  2BU3 A;  4G4Q A;  2QJL A;  4G4R A;  4GIP A;  3ZH9 B;  1PFD A;  4M9S A;  1HQC A;  2AGA A;  1FM0 D;  1DGB A;  2ZAM A;  1YJJ A;  2JX5 A;  3HHZ A;  5D3D A;  2QPA A;  4KLN A;  1G3I A;  3VLF B;  1ZE3 D;  4MM3 B;  1D5X C;  3BOS A;  2OQ4 A;  4B7F A;  3TUO A;  2VII A;  2WXN A;  5DNY A;  3KQ4 A;  3CF0 A;  1YQ3 B;  3FYC A;  3NVZ A;  4AZF A;  4DV2 M;  2DWN A;  4JI3 M;  1UM8 A;  1E32 A;  3AB5 A;  2PIA A;  4LF6 M;  2M56 B;  4ARC A;  4JI5 M;  2RDG A;  5FTN A;  3KFU G;  2F5P A;  1CQV A;  1IN6 A;  4ITQ A;  1HT2 E;  4CGY B;  2BT6 A;  1ROE A;  4XE0 A;  1GOZ A;  3VKH A;  2FBW B;  4BOS A;  2ZAO A;  3THG A;  4JXJ A;  3T38 A;  1XC8 A;  4YWG G;  1V1P B;  4EIW A;  1QKZ A;  1WWT A;  1K3W A;  3E56 A;  1L4Z B;  3I4Y A;  4HL4 A;  3SYK A;  4LG2 A;  1RM6 C;  1Z6T A;  2LWX A;  2FNA A;  5KQ8 A;  2D7E A;  4LTU A;  1F2R C;  3GPY A;  4Q2J A;  3NRZ A;  3P4P B;  1IXS B;  1C9F A;  2MEK A;  1PDX A;  4A9A A;  3B9P A;  2A5Y B;  3BYY B;  3CTW B;  3AE3 B;  1IXR C;  2L09 A;  1B9R A;  1ENF A;  3C8Y A;  2Y21 A;  4AQY M;  5FSW A;  4PT5 A;  2J7N A;  1ZDV A;  5HG2 A;  4H2A A;  3AMZ A;  2N7J A;  1LV7 A;  2K5P A;  2NTT A;  2I7N A;  1ET9 A;  2CHQ A;  4LK0 M;  3VR8 B;  5AUK A;  2WXM A;  2VZK B;  3BYT B;  5FTL A;  3GS2 A;  3GLH A;  3AE2 B;  1N33 M;  4DV6 M;  1EM7 A;  3VK8 A;  1E9M A;  1FMA D;  2QP9 X;  4YXD B;  2TSS A;  4LCB A;  3GRU A;  2WXI A;  5JXV A;  1N75 A;  5KPT A;  4Z6Y A;  4D82 A;  4LY6 A;  4NZL B;  4FCW A;  2K9X A;  1SEB D;  1NHG C;  2CJN A;  4D80 A;  2Z84 A;  4BOU A;  2QIE B;  3MP2 A;  4B0M A;  1IBX B;  1DO2 A;  1TKY A;  1QT9 A;  2Y0Q A;  4FVM A;  1SXJ D;  3FTD A;  4AS1 A;  4OZC A;  2WNM A;  1XCQ L;  4ZOH C;  4W5W A;  2M60 A;  3PXG A;  4B3S M;  3U60 B;  2J4X A;  3BVM A;  3U6M A;  2V1U A;  3B2G A;  2J52 A;  4B3M M;  1J7B A;  2XFS A;  3VDP A;  5E6J A;  4JI0 M;  4LJ4 A;  3VK7 A;  4A3V B;  3GQ5 A;  4KGR A;  1V97 A;  1JWS D;  3BK1 A;  2WDV B;  5FK9 C;  3HJS A;  3GLG B;  1N34 M;  1JR3 D;  1IY2 A;  2QZ4 A;  2J42 A;  4C7Z A;  3U6O A;  2W82 A;  1IXZ A;  1YN4 A;  1T3T A;  5FKA C;  3L27 A;  3HHX A;  3ETR A;  1KFY B;  2WXH A;  3ZYY X;  5D7G A;  3OQC A;  4YSX B;  3GPP A;  1I94 M;  4L23 A;  4G4O A;  3B9J A;  3ZC7 B;  4ARI A;  3HWS A;  5EP3 A;  4AQ7 A;  2QBY A;  5EP1 A;  3U6S A;  1SF0 A;  3EIE A;  1FEH A;  2D7H A;  3FTC A;  2RPV A;  2BYT A;  4OU7 A;  3U5Z B;  1AYF A;  3M0E A;  4QOS A;  2BJW A;  4CHT B;  3SR6 A;  1PVJ A;  3AM9 A;  4OVZ B;  3JR4 A;  3E4R A;  1L4D B;  3BB7 A;  5ITU A;  1L5P A;  2X4A A;  3AEF B;  1V8C A;  2DYM A;  2BTW A;  3MP9 A;  2AQ2 B;  3Q8C A;  4IBE A;  4DV4 M;  3AEB B;  4IBG A;  4DV3 M;  1NYR A;  5G5H A;  4GIT A;  2MJ3 A;  2Q5W D;  1STE A;  4TQ0 A;  4WH4 A;  2IJ0 A;  3RE8 A;  4LGM A;  3KW6 A;  3MJ5 A;  5T8I A;  3U52 E;  1SXT A;  2BTE A;  2KRK A;  2DWL A;  2F5O A;  1KFV A;  3O65 A;  1HNZ M;  1TGU A;  4DUZ M;  3CWI A;  3PNY A;  1SBB B;  4KHP M;  2K22 A;  1QQR A;  5KO3 A;  1JWU D;  3BWU D;  3LMM A;  4B7G A;  3W2D A;  3P4Q B;  2KRU A;  1SXJ A;  2V3P A;  4C56 C;  4I8O A;  1FIQ A;  4NJC A;  1YSY A;  2L32 A;  1NJG A;  2L7I A;  1TS3 A;  1MHH E;  3BVZ A;  1N5X A;  1XMO M;  4FWG A;  5C1B A;  2EA0 A;  2NTS A;  2QIL A;  2J53 A;  1JR3 A;  2WDR B;  3VFD A;  2N9L A;  2J7O A;  3FIL A;  2ZW1 A;  4TMA B;  1ET6 A;  1X37 A;  2X49 A;  4IUM A;  2LMC A;  1IGD A;  3ILK A;  1PJI A;  1GVN A;  4FWD A;  3SFZ A;  2F4V M;  2O5R A;  4JE3 B;  5LMN M;  3NVW A;  2LHD A;  1G8P A;  5ITX E;  5ITT A;  4B3T M;  1MVK A;  3FUX A;  4L78 A;  5DYG A;  1J7K A;  3HU3 A;  5H92 C;  1OQQ A;  2IPK D;  2Y20 A;  2BB5 A;  4GKK M;  1N5W A;  3AED B;  3VKG A;  4LJ7 A;  1RWS A;  2V6Z M;  2UXD M;  4M9X A;  2Z3X A;  3NS1 A;  2Z7J A;  4USA A;  3TE6 A;  1QAM A;  1JW9 D;  2AQ1 B;  4L2Y A;  3V3X A;  1QOA A;  3SAR A;  3U6C A;  1Z59 A;  1FNU A;  4G4N A;  3EA6 A;  1SIJ A;  4IJE A;  1GKI A;  1AW7 A;  3RFW A;  2IGH A;  5BYQ A;  2WQY B;  2C98 A;  4QHS A;  1NHW C;  1XO3 A;  4NSR A;  1I4W A;  1KLU D;  1P7E A;  1V1P A;  2DWQ A;  2D5G A;  2ACZ B;  2XZF A;  3AOE C;  4BOZ A;  2Q2E B;  1UWX A;  1MHX A;  2Y0T A;  3AV0 A;  1AN8 A;  2F5Q A;  2KXE A;  5EQT A;  4DR7 M;  7CAT A;  1N36 M;  4QOZ C;  2WU2 B;  3H4M A;  4S12 A;  4DXG A;  3ZNH A;  4PD2 A;  2DWZ B;  2JQR B;  5EXX A;  4C7Y A;  4JV5 M;  1T5X D;  2SEB D;  1GPX A;  5EZQ A;  2JYT A;  1I4R A;  1XF5 L;  3L2A A;  4N59 A;  4LLG M;  4HXD B;  2RMM A;  1FNW A;  1ZXH A;  1XEE A;  1QOF A;  4WIP A;  3BBA A;  3R8B A;  2YEP F;  2ZBK B;  4RF1 A;  3ZJU A;  1C76 A;  2BW2 A;  2YQZ A;  4LJ8 A;  1C1K A;  2I7P A;  2H89 B;  3BII D;  4GLS C;  4X66 M;  3SAW A;  1R6B X;  2RGO A;  1VZ6 A;  1TDZ A;  3J27 B;  4B08 A;  3SMS A;  2JSV X;  1HA5 A;  1TS5 A;  2RDH A;  3NUH B;  1I4P A;  3PNV A;  5D3I B;  3SAT A;  3P4R B;  1L1T A;  4YSZ B;  4Z8X A;  4JWU C;  4RGN A;  4MT5 A;  1Z5C A;  1IBX A;  4LF9 M;  3TSS A;  1ORY B;  5HFY A;  1JML A;  4CQN A;  3T3N A;  4LJ9 A;  3U60 A;  4NOO B;  1L8Q A;  3WCQ A;  5AUI A;  3BVG A;  1HQY E;  2KA6 B;  1TY2 A;  3AL0 C;  1C4P A;  3RGS A;  3SMP A;  1ZAE A;  3GLG A;  5EXT A;  1FRR A;  4MH0 E;  2PLP A;  5LNK 1;  1EU3 A;  4NAM A;  2EUC A;  3W0F A;  3L4P A;  4LJ6 A;  3LXF A;  4TQ1 A;  5JZE A;  3GQ4 A;  3ABV B;  4GDK B;  2Z8L A;  4I4L A;  1TY0 A;  4LFC M;  3TQS A;  4DV0 M;  4JI4 M;  2L7H A;  1XWI A;  1JCK B;  2CHV A;  1OJL A;  5BYR A;  3TMP A;  3TWM A;  1VZ8 A;  2Z4R A;  4AG6 A;  3KXE C;  1I7H A;  2FE8 A;  3Q8B A;  4JI2 M;  1IBK M;  2YEP B;  2JWU A;  2QSD A;  3E9S A;  4IBJ A;  3HHW A;  3ZJV A;  3P63 A;  1TH2 A;  3GRY A;  2F5N A;  3WHK A;  1CJE A;  3NVV A;  2HWK A;  4II7 A;  3J81 S;  1YNT E;  3AN1 A;  3U5Z A;  2XH9 A;  4FXC A;  3I9V 1;  1DOI A;  3SC3 A;  1Q39 A;  4AI6 A;  4OVZ A;  3NZ3 A;  3QWL A;  4IBF A;  1NNJ A;  3AV8 A;  3FTE A;  4GHL A;  2IGG A;  1Q10 A;  1J09 A;  5FR3 A;  1N77 A;  1WSP A;  1YZB A;  4D2K A;  4RGM A;  3TWL A;  1KH0 A;  1R2Y A;  4X65 M;  3N9Y C;  1CZP A;  1TZO A;  4DR2 M;  4LFB M;  4L16 A;  3SHF A;  4US8 A;  3D8B A;  1XNQ M;  3HVD A;  3SAS A;  2R4E A;  1DYQ A;  1IBM M;  4BBA A;  1UUP A;  3HU2 A;  1UGJ A;  2F5S A;  3URY A;  1IUE A;  4GDL B;  3BY4 A;  4G6Z A;  1QOG A;  1J7C A;  4JX1 C;  2JA2 A;  1PGX A;  2DLB A;  1QAO A;  1ZXI A;  1I4Q A;  4YTP B;  1FNN A;  2WXJ A;  4PCZ A;  1R2Z A;  4AG5 A;  2PW9 A;  2CFO A;  4XZX A;  4NXM M;  2KWD A;  2W3S A;  1Q3C A;  3CF6 E;  2ZW0 A;  5C3J B;  3U61 B;  4LZZ A;  2M5Z A;  4A55 A;  2PVO D;  2WXG A;  4RF0 A;  2WDQ B;  3UGJ A;  8CAT A;  3AE4 B;  1NYQ A;  2LHE A;  2LUM A;  1PUT A;  4ZRQ A;  1ACC A;  4JN6 A;  4HRS A;  1MI0 A;  5EXP A;  3FUV A;  5TSS A;  1H6U A;  4RGO S;  1QOB A;  1OFF A;  4DR1 M;  3GRR A;  1L2C A;  3D8L A;  4M9Z A;  3W5V B;  1BUI C;  3I57 A;  3T15 A;  4PDI A;  2XNA C;  3GP7 A;  4IBB A;  2DZN B;  4KKJ A;  3NBI A;  1K50 A;  2EEL A;  2WXR A;  4GC9 A;  1PM5 A;  3PHU A;  3AE9 B;  2CV1 A;  1WXQ A;  2PKO A;  4XWT A;  4RH6 A;  1V1O A;  3DOA A;  4ZRP A;  2XLJ A;  1CK1 A;  1ESF A;  1HQR D;  3ZQ4 A;  1SJH D;  1TYG B;  3ZJT A;  3VR9 B;  2C5R A;  1NSF A;  4KX6 B;  1NY6 A;  1NEK B;  1ZDX A;  1IBL M;  4GHA A;  4DV7 M;  3MHV C;  3U7Z A;  4TSS A;  2QCU A;  2XSZ D;  2HKJ A;  1SE3 A;  2DWM A;  1XMQ M;  2HL7 A;  1G59 A;  1QQW A;  4L4U A;  1FJG M;  4FW9 A;  2GB1 A;  3IG5 A;  4B3R M;  3PZ7 A;  2LH0 A;  1SSN A;  5LMU M;  5JI2 E;  2CUZ A;  4IDI A;  4A6Q A;  4DUY M;  2N9K A;  1FNV A;  3AOG A;  2LXE A;  5IT9 S;  3RFZ B;  2LJI A;  1ZOY B;  2Y5C A;  3DWM A;  1L1Z A;  1IGC A;  3LB8 C;  1Y56 A;  1IM2 A;  2K47 A;  2ONQ A;  4BOQ A;  1P7F A;  3FAH A;  2LGI A;  4O1N A;  1WRI A;  3T1Y M;  2OPF A;  3GLF A;  1FFV A;  2DBY A;  3KP1 E;  5I4D A;  1W5S A;  2L1A A;  1DGH A;  3DFZ A;  3GLH B;  5EE1 A;  4LJ5 A;  2LFI A;  3PRM A;  5C18 A;  3I51 A;  2W55 A;  4MGY E;  1KLG D;  3JR5 A;  2SAK A;  2D7G A;  5HI1 A;  4BB9 A;  3KWL A;  1J7A A;  1VZ7 A;  2M0A A;  2DVW B;  1KYI A;  2JYE A;  3T1H M;  2UZJ A;  1C4A A;  1JQ4 A;  4OHJ A;  5BR8 M;  3AE7 B;  5H37 D;  4IP3 A;  1SE2 A;  3K92 A;  1TJE A;  2UUC M;  1QVR A;  5ITR A;  4NRW A;  3KOX E;  2KAC A;  2VZK D;  2I2Y A;  3VRA B;  2HCB A;  2UUB M;  3AE1 B;  1SXJ C;  5A2Q S;  5E26 A;  1QAQ A;  3AE5 B;  3U2S C;  4QNM A;  2CHG A;  3L28 A;  1F0Z A;  5KPR A;  2KZU A;  1JRP A;  2J7Q C;  2ICI A;  3RGP A;  2K0P A;  1HNW M;  1GL7 A;  1VR9 A;  3PO0 A;  1N32 M;  4J3O D;  1XLO A;  3SEB A;  1HXY D;  3GPU A;  2QEJ C;  4B7H A;  2EKI A;  3U4E G;  1IN5 A;  3LVV A;  1HNX M;  3NWL A;  4WW0 A;  2QEN A;  3TWK A;  2L52 A;  2HDE A;  2DYO A;  1F2R I;  4YY3 M;  5DYI A;  2L83 A;  3CIR B;  2XSZ A;  3PT2 A;  1L6U A;  1L0V B;  3P42 A;  3HJQ A;  5IWA M;  3UI3 A;  3A98 B;  1OFI A;  2WXL A;  4JPS A;  4LFA M;  2WU5 B;  4JI1 M;  4EE2 A;  5BMG A;  2ON8 A;  3GLI B;  1K3X A;  5IRE B;  1BXT A;  3RNV A;  3M7G A;  2KMM A;  1OFH A;  3K8Z A;  1WGK A;  2KAJ A;  3PZ8 A;  4P6V F;  4FWH A;  3DWG C;  1QZM A;  4NRV A;  1NY5 A;  3W30 A;  2DZO B;  5EP2 A;  1EWY C;  4RCO A;  2E5L M;  2G9H D;  3NVY A;  3HVZ A;  4MI7 A;  2NMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...