4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain-like protease
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
5E6JA 5KO3A 4WURA 4P16A 4OVZB 4RNAA 4OVZA 4OW0A 4RF1A 4R3DA 4RF0A 3MP2A 4M0WA 3E9SA 4REZA 2FE8A 3MJ5A 4PT5A 4MM3B
chains in the Genus database with same CATH superfamily
3AULA 1FJGM 4HCNB 3APFA 2B3TA 1ZMUA 5L95C 4Z6YA 3EHVA 3ZDMC 3H8CA 4A3VB 2FFJA 2N7EA 1DF0A 1MIRA 1WXVA 1H8CA 4KKIA 1IBXA 3ENEA 3IG5A 2DZIA 2MJDA 2DJFB 2LNHC 2BWEA 1EWOA 4NNJB 2L05A 3NRZA 2M56B 2K1FA 1AWDA 2NS5A 4LNNA 2L7HA 4YSXB 4JE3B 3FILA 2M8SA 5D3DA 3BB7A 1QAQA 1PJSA 4IBBA 3PHWB 5AZHA 2O2VB 2F1GA 2UUCM 3KS8A 3WAMA 1EWLA 3GPPA 2JWZA 2H7JA 1NL6A 2CHQA 3SAWA 1FNWA 2C5LC 2CUZA 3EIHA 4KGTA 2Y0QA 4YYQA 2DCDA 3I57A 2FCSA 4GDLB 3AEBB 4BPVA 3CGWA 1GG3A 2WZJA 3UGBB 3LJ3A 3CF2A 2EKFA 3M3JA 4ZRQA 2OP3A 2PREA 4GKKM 2R45A 3QAUA 2IJ0A 1F9JA 2N1WA 5HG2A 2RRUA 2YEPB 4I07A 1QMYA 1DGBA 4G3XB 3CSTA 4CO7A 3VTVA 1C79A 4KHPM 4XWTA 1C78A 3K24A 1YK8A 1UWMA 3PRZA 7PCKA 4HK2A 2A4ZA 1IBXB 2R4JA 2PKOA 2HTME 1ZAEA 4IDIA 3D8LA 4F7ZA 2O5RA 5FTMA 1F1HA 4ZUXU 2SEBD 3TNXA 4WWNA 1ISNA 4PS3A 3M95A 5KHOA 2GI9A 2WU2B 1SSNA 2KACA 1K8RB 5JH3A 1MEGA 1OQYA 1DYQA 3PHXB 4WW0A 1TF0B 2QBYB 3Q8BA 4FHKA 2ZPNA 1HTOA 4ANUA 3B89A 5DYIA 1D5XC 1XCTL 3AECB 2MJ3A 4LJ7A 1GC6A 3ZNID 4UDUC 1HNZM 2UUAM 1KJTA 4LF8M 1ZDXA 2B1NA 5JHBA 2CV1A 3T8MA 3DHIC 3P4PB 1GABA 2G5GX 3D8BA 2JNHA 2LWXA 1N75A 2YVCA 4L6V6 1L6UA 3GO8A 4EUTA 2D7GA 4YHHM 4LF6M 1WH3A 2Y5BA 2KHWB 3RI7C 2GRIA 2C98A 5DPRA 2JWUA 3LQQA 3PREA 1L8QA 4PP1A 4GC5A 2XF3A 3V76A 1R2ZA 2DZYA 4P1CC 2WXMA 3GS2A 4L8RC 1H4RA 2DOSA 2DYOA 2H88B 1CK1A 1AYFA 1FPYA 5F02A 1IXSA 3QYEA 2KNVA 5GKNA 1E0ZA 2DENA 3ZNHA 1I4XA 3B7NA 1C3TA 3PVLA 2KLCA 3GE3C 1YD8U 4W9IA 1ZV1A 4LJ4A 2XSZD 5H8YE 5FLXS 4EFOA 1J7AA 1MX0A 3HKPA 1IPGA 1YQ3B 3HHAA 4QOZC 2V1UA 1RWSA 4WAAA 4JI0M 4FJYA 3J27B 3IG8A 1SGHA 3GRUA 1C76A 2IO1B 2JQRB 2ZNVB 3ZNZB 4D8IA 1DOIA 4G54A 5E26A 3NJTA 3MHSA 1KM7A 3UJNA 1YN3A 3ZDTA 2H5XA 1WYGA 2E6XA 1KLVA 2DHYA 3MMPA 4P1BC 1STFE 1Q10A 2Y5BB 3NVWA 3ZJTA 1KLUD 4IUMA 4WA6A 3CIRB 2MSED 3C0RB 4K3BA 1LV7A 1VEGA 2XFTA 4M02A 2DAKA 4AZFA 4B95A 4IWOA 2KN5A 3PRMA 1EF5A 2O6VD 3BYTB 1AU3A 4B3SM 3OAWA 3H6SA 4I5SA 1WGHA 4K7WA 2QIEB 1BGOA 1QOFA 1P3QQ 1IXSB 3RYTA 4KZ0A 5AUIA 3RE8A 2MLBA 1CS8A 4MDKE 4JI4M 1TKEA 1V81A 2JYEA 3VQIA 1HA5A 1TS3A 3MHHA 1W5SA 1QT9A 3M0EA 4C4VA 4W9CA 2QJLA 4XK8F 1K3XA 1J7BA 1XT9B 1V86A 2ZW0A 3MC0B 2OOAA 2LTUA 2ZVNA 3AOEC 1E32A 3Q2AC 1D3ZA 1PPNA 3IV2A 2XLJA 4OEMA 1YX5B 2L1AA 2BYFA 4GH9A 3UGJA 3B2GA 2MH8A 1T0YA 4WP2A 1JWAD 1Z2MA 1XNRM 1WXAA 4IG7B 5E6NA 4YT0B 5CVNB 1G71A 2NTSA 4AQYM 3MTNA 2WQYB 3DCGA 3DVGY 1IY1A 2V1CA 1NJFA 3Q8GA 3USVA 5HKHA 1FFUA 2XK5B 5EGWA 2FBWB 2G1EA 3AE6B 3AU4A 3DOWA 2BYTA 1WGGA 1L0VB 1V9JA 5HHDG 2XZUA 1G8PA 3GRYA 1HEZE 2KN4A 1WFYA 5IAAC 4DMYA 3OISA 3GP1A 4RF0A 4IW0A 1SJED 1IXZA 2FUDA 4AG5A 2JZ0A 1U9WA 2DCCA 4IBDA 3I4VA 4GIVA 1VD2A 3TEWA 1YE9A 3FRHA 1IFYA 2WHIA 3Q8AA 4GIPA 4LG2A 1NY5A 1F2RC 4AJYB 3KUDB 1V5OA 1PPDA 1HQYE 3ABVB 2JSVX 3JW0X 3TRKA 3KKUA 2RKOA 2MP2A 2EUCA 2A5YB 3AOGA 4FCVA 2CHXA 2OEDA 2AUXA 4OHJA 4BVUC 4KKJA 1SIFA 3OLMD 2XU5A 3LQRA 1UKFA 1YLAA 4BB9A 1VZ8A 2HXZA 3BPFA 5AZFA 4LRSA 2KK8A 3AEGB 3RZFA 4ICUA 4OX9M 5C2TB 2OULA 4G4NA 1AARA 1HT1E 2D7HA 3GP7A 3GQ5A 3BVZA 4PK1A 4D8BA 1FIQA 1P9DU 4AS1A 2W55A 2OQ4A 3ILKA 2K9XA 2KLGA 1L2NA 3P5VA 8PCHA 2N9LA 2RD0A 2AQ2B 4WJNA 3EUB2 1VZ6A 2D11A 1EF1A 4IBEA 4FCWA 4AOFA 5G2NA 3CTWB 1YQBA 3IMAA 4OVZA 1U9VA 1PBHA 3BINA 3BXWA 3UI3A 3KS4A 3U61A 3H9DA 2IDYA 5I4DA 2LVQA 2C9OA 1YJIA 3W0LB 2Z4SA 2DLBA 2KWVB 2J0KA 2MP2B 3V60A 4XGAB 5J18A 1S4VA 1V8CA 1ENFA 1X37A 2C9CA 3U7DA 3AEEB 3H7SA 5JHAA 1V5TA 4LFAM 2UXCM 1SJHD 3JSVA 1TL9A 2RGFA 4JLCA 2QHOA 3OWEB 4EE2A 2Z84A 3NZSA 4WJPA 4II2B 2WXRA 2G45B 3FTDA 3TIXA 2CS4A 3PTFC 3P4RB 1PPOA 2CHZA 1YZBA 3KXEC 2R9FA 1SP4B 3CBKA 2WS3B 4JPSA 4P17A 2UZJA 1WGKA 4BQVA 1L7YA 1VCBA 1XB2B 3B79A 2LGIA 2ACZB 4AG6A 1TDZA 1JMLA 3L16A 2KJRA 4MGYE 1K3WA 1TH4A 2P5TA 2N1VA 3N3KB 3PNVA 2M4NA 3TCAA 4R3DA 1V92A 3U8ZA 1G59A 4KO8A 1OQRA 2LRUA 3AI5A 5IP4D 2B1MA 5EXTA 2R2QA 1ESFA 2DI0A 2X8AA 3NBIA 4XR7A 3U5ZB 2FH0A 3GLFA 4CYEA 2KW0A 4Q7JA 2L52A 4NZLB 4LDTD 2M1MA 4HVBA 3O65A 2FTDA 3J7BA 2LGXA 2MJEA 3CF6E 2QILA 3OVXA 3QAQA 3CWIA 2JRHA 3DDCB 3HM6X 3KWLA 3ML9A 4KSKC 1PGXA 1WRDB 4M8NA 3MHVC 1LGRA 2ZAMA 1PGYA 2LVPA 1I4GA 3RCZA 2OPFA 2E00A 2HDEA 1CB5A 1OFFA 1SBBB 1YJJA 2FIDA 2PMVA 5EE0A 3RNVA 3S3QA 4O1NA 3TEZA 3BCNA 1WX7A 1C1KA 3MC8A 1WGNA 4JI3M 1ZW7A 2JPHA 2V4LA 3N30A 3QQ8B 2JY5A 2ERCA 2DBYA 4PYUA 2JQGR 3VUWA 2LGDA 4ZPXA 1QVRA 2DZOB 2RPVA 2UWQA 3A9JA 1DGHA 1CVZA 4XC2A 1QYRA 4RGOS 3VRBB 4DR1M 3O0UA 5GMVA 4GDKB 3GLIA 4M0WA 1SE3A 3TBLD 1QANA 1JRUA 1TZOA 2DKLA 4MEMA 3PRPB 3KVWA 1GJTA 4DV5M 1RM6C 1HUCB 1JRPA 1GNUA 4W9EA 2NBVB 2WSEF 3KQ4A 5G55A 4BKTA 3LVVA 2QNJA 2J7QA 1JALA 1R2YA 5FTJA 3BIID 2IY1B 2G6DA 2KTFA 1QDQA 3U4EG 1GMYA 3TMPA 1MVKA 4N9F4 1TTNA 1QILA 3H4JA 4A20A 3R3MA 3K9PA 4QNRA 3LB8C 1IN7A 4W5WA 1Q39A 1D6EC 1JWUD 4X6JA 2Z7JA 2G7YA 4G3OA 4MELA 2J7OA 1FM0D 3DA1A 1KF6B 2Y3AA 5H92C 3VHTC 4LFCM 1WZ3A 3LDZE 3J2PB 2ARYA 4QBBA 2FCMA 3U6LA 5HFYA 3ZJVA 1I7HA 2C7NB 4EIWA 2DAIA 3H8BA 1NNUC 3HHMA 3L54A 4GU2A 1G4AE 3QJZA 4P6EA 2CFOA 2WXPA 3H7PA 4M0WB 3T9LA 1K50A 3H89A 3GQ3A 3B9PA 4YWGG 2N35A 3SC3A 1NI2A 2KMMA 1T5XD 1F2AA 3L08A 1M94A 4EKUA 2W54A 1I4RA 3KYCD 3AFHA 5IA7A 1JQJC 2F5PA 2WSFF 3R8BA 1X1MA 4HKZE 3FKYA 3V6CB 5FTNA 1WWTA 4YTPB 2INNE 3KUCB 3VDZA 1N77A 4MSXA 2IPPB 3H4MA 2Q5WD 4PI3A 3LXSA 3TMPB 3HHIA 3VRAB 1FNNA 3KOXE 2BB6A 3U30A 4X62M 3NY5A 4DV4M 2IPKD 1PADA 2LD9A 3EGRA 3NS1A 3QJ3A 3PZ7A 2J5YA 1OQQA 4D80A 2K6DB 2X38A 4BFRA 3PZ8A 1J7CA 3PGEA 3RVVA 3UQBA 4PADA 4WQMA 3T1HM 1F77A 3EC8A 3R2TA 4KDIC 3N9YC 2JZ1A 5DFLA 5E6JA 2ATOA 1ZDVA 4AJWA 5IO9A 3VH3B 2KX0A 2ON8A 2VH1A 2L3ZA 3NS8A 3RFWA 4JWUC 3AI8A 1IN5A 1GCBA 2EJSA 3ONSA 2GBNA 2DX5B 1B1ZA 4HLEA 3U6CA 2NBWB 1C4CA 2XZFA 1AU0A 2DVWB 4GSWA 1E5WA 1EWYC 1IN8A 1BP4A 4HCPB 1XXHB 2HCBA 2ZJDA 4X6HA 2WXHA 1BXTA 4FWHA 2LUEA 2LRWA 3MORA 5JZEB 4NQKE 2ONQA 3GOEA 2N0SB 3B0AA 4FCTA 3GLHA 2PIAA 2PADA 1R6BX 2AQ1B 2JXXA 1NHWC 3GLIE 4ANXA 1N33M 2HD5B 2KTRB 4RF1A 1NENB 4OVVA 3ETRA 4S0RA 4XZ4A 1FCLA 1L1TA 2J52A 3NG0A 3K9MA 1IXRC 3N32A 1TJEA 2DYBA 1V1PA 2Y5PA 3GPUA 4KIKA 3KUZA 4LJOB 2NQIA 4BOSA 4IIWA 2R46A 3FKEA 2BKFA 1EIJA 3I06A 2PPHA 1PJIA 1WE6A 3FAHA 4FXCA 5J17A 3SASA 4KGSA 2MH7A 2AYNA 3M7GA 4B3RM 3BC3A 2INCC 3KW5B 1FRDA 2I38A 4K1RB 1V97A 2DWNA 2P7UA 2Y6EA 2N4FA 1KLGD 1VEKA 1WMHB 1WGYA 1ZOYB 3IBEA 2HHHM 1QF6A 1CQVA 2UUBM 1XMOM 3L29A 2IO2B 1WSPA 2OJRA 3RGSA 4MJSA 2G4SA 3UIPB 3I3TA 2KT7A 4WH4A 5CHWA 4BOSC 1I4PA 2WDVB 2CE7A 2DWLA 2D07B 1HQRD 1WYWB 3RPFC 3ZC7B 2MROB 5BYRA 1D0LA 5CTRC 6PADA 1MHHE 1ZGUB 3I4YA 2EKEC 2RDHA 2LASA 1XD3B 4CJ6A 3OQCA 3EFUA 2MBQA 2PE9A 2R9CA 1IBKM 1R4MI 1J0GA 3MHZA 2RDGA 2QENA 1K52A 4DR2M 1TR8A 5IN7A 1OAIA 2BT6A 3DOAA 4BKGA 4KIKB 2K0BX 3CH3X 2ICIA 4IP3A 1YN5A 3W5VB 1XXHE 3TL4X 2BS2B 1YVBA 4W9KA 2V0GA 1U4AA 3KSJA 1WJUA 3DBRI 2JRIA 2R9MA 4DHZE 3B7ZA 4N4ZA 3WHLA 4KODA 1JROA 3PNYA 1QOBA 4ZYSA 1GPXA 3DZDA 2XGNA 1RAXA 3H7DA 3C9PA 2KHHA 4DR4M 3VLFB 2E02A 4CZWA 3FTEA 1K53A 4OZCA 2IO3B 1IWDA 1JQ4A 1RFKA 3NWLA 4KGRA 4M01A 2BJVA 3TE6A 2R44A 1KHPA 1QXPA 4MJSB 4II7A 4D81A 2CKHB 3AEDB 4PDGA 2YLMA 1VJVA 2KC1A 1KOTA 3JYUA 4K0KM 1CQDA 2D5GA 2BKRB 2LWPA 1VEJA 2L00B 2J7NA 2WXQA 1T6OA 4IM3A 2Z0DB 4LJ6A 3HY5A 1TYGB 3B74A 2L6OA 2JZPA 2E03A 3Q8EA 1Q02A 2NPTB 1AIMA 2CU3A 3B2FA 5LLIA 4TUUA 1OIPA 1WGLA 4LNKA 3FUWA 4DXAB 2KFKB 4Y28F 4DV3M 3GQ4A 5F3WA 2NQGA 1IBLM 1KFVA 3OF9A 1IY0A 2KYWA 4TQ1A 4MZOA 2R6FA 1F4IA 1NDDA 4GMQA 2PNSA 9PAPA 4DDID 3K8UA 2R0IA 2WX1A 1OJLA 4J3OD 4W9HA 3GLHE 2G8JA 2P86A 4DUYM 4LK0M 4YYWA 4W5BA 3NVYA 3A42A 3RNEC 3E46A 2KXEA 1MDWA 1QAOA 3GRVA 3Q3OC 5EDSA 4YVAA 2GBRA 2QZ4A 4W5CA 2VQEM 3FILB 4YV8A 1L2CA 2C99A 2DWZB 4L15A 3PPAA 3QARA 2WLBA 2AX5A 3SR6A 3GE8C 2JY7A 5IREB 4JI8M 4HLQA 1UD7A 1VQ1A 2LUMA 3FYCA 3BYYB 3N20C 4C7YA 3IOQA 2DWQA 4WAFA 3DBLI 1BT0A 4HDQA 3SYKA 3S2AA 2YJ8A 3PXGA 4PS7A 3ZXRA 5E6PA 1WR1A 2CHVA 3VK7A 2KDMA 3DWGC 2VF8A 1EFUB 4D82A 2EA0A 3W67A 2V3NA 2C9WB 4KT0F 3UINB 1UBQA 4FJCA 1JR3A 4FHJA 4P6VF 3PNRA 1ATKA 1LFDA 2IZVB 1S3SG 2K0PA 3NOBA 4DR5M 3KVFB 1FEHA 3JAMS 2Z4RA 1J09A 2FE8A 1K82A 2XU1A 4XX5A 1QOAA 2WYQA 3DBRB 4RM9A 1C4AA 2MHJA 4GOCA 2LVQD 3PW3A 4LLGM 1GECE 2JF5A 3FUVA 2D10A 3K2LA 5BYQA 3TJPA 2LMCA 3W2DA 3FYDA 3DF0A 3SMPA 2VQFM 3LFYA 4UN2B 4WJOA 3R7QA 4GB9A 4RGMA 3FTFA 4XBOA 5CX3A 4BKSA 2FNAA 4B7FA 1E9MA 4BLCA 1A5TA 1GL7A 2WXIA 1ZQ9A 4XDDA 4LGYA 2MBEA 1QOGA 1D4BA 3BBZA 2RSUA 1OTRA 1M4VA 2IGGA 2KNBA 1CV8A 2Z8LA 3T6PA 3ZQ4A 3RNBC 4G4QA 4P16A 1XKGA 2G3QA 2JXNA 4MGZE 2K22A 3JVZX 2BDZA 2BJWA 2WSCF 2DC7A 5IWAM 2WWZA 4A90A 3N4CA 3QK0A 1HQCA 2YJCA 2JY6A 3CBJA 1DOXA 4ZHPA 2R18A 1YT7A 1XO3A 4M9XA 3AKZA 2UU7A 4B9KA 3P4SB 1H6UA 1QUTA 5C23A 3OJ4B 2W82A 2K6QA 3ZO5B 1L1ZA 2DC8A 3DPDA 1VDDA 2ZANA 4LF7M 1EM7A 2KRKA 2WDTB 4JI5M 3A1QA 4M0DA 3O13A 2D3CA 3APDA 1TBEA 3DVGX 1Z6TA 4QNMA 4I05A 5D94A 2DENB 2DZKA 2KO3A 1PE6A 3VKGA 3ZNHB 3HZJA 1XLOA 4HROA 5EXSA 4PP2E 1RFAA 3AE1B 5KQ8A 1TDHA 4TV3A 1E7VA 5KPZA 4G4OA 2HJ1A 4EEWA 2KNAA 5BPVA 5TSSA 4DV0M 1ZCMA 2K9DA 4TSSA 4BBNF 4BSQA 2D2QA 4N8WA 2LXEA 1YK7A 1HZ5A 4W9FA 1PGAA 1HT2E 4GHAA 3HVDA 2CIOA 4AI6A 4GEWA 4IUMB 4FVMA 2KC2A 3PV1A 2JQFR 1T0QC 2EKIA 3L0WB 3PRMB 1OFIA 3AM9A 5KHQA 4CISA 4IWQA 2BW2A 5CHTA 1ORYB 1C9FA 2DNFA 4NC6A 4DV1M 4DBGA 3VUXA 2KFJA 2QC8A 2L0TA 4OU7A 3ZH9B 2E3TA 5D7GA 2VDBB 1QAMA 1HE8A 3Q8XA 1PJJA 1EUVB 3RUIB 3PVSA 1ZE3D 3AB5A 3VAWA 4C4VB 2Y5CA 2WXOA 5EP4A 1SXJA 2JP7A 5KQDA 2C7MB 1JR3E 3TWKA 4CDDB 3HGIA 1AYWA 1FO4A 3ZRCA 1UELA 2FUHB 2NR2A 1PPPA 1GOZA 2X49A 1QOLA 1CZPA 1NBFC 3BZDB 2DC9A 4J6IA 1L0XB 4NAMA 5BR8M 2JTCA 1NQCA 3MTNB 3GZNI 2CV0A 3Q6BA 1SB3C 1J5EM 3AE5B 3HRDD 3TPZA 3VDUA 5IT9S 3QT4A 3KW9A 3IHPA 2JXTA 4JX1C 4YSYB 1IM2A 1NY6A 1NNJA 4RKUF 1SXJC 5C1ZA 5EXXA 3VVWB 2L7IA 5EP3A 3KOYE 1CTEA 1WY8A 4DBGB 2EELA 4WIPA 2ACTA 3ML8A 1S1QB 4A55A 2LVOA 3KP1E 3LCUA 3IT4B 4JQWC 3QX1A 3L13A 2WDRB 2O01F 2AQ3B 4BOZA 3KOWE 1JQPA 4AXMA 1SXJB 4IBCA 1E7PB 4F8CB 1ZUD2 1CSBB 2V9HA 4K3CA 1PVJA 2JUJA 4LTUA 1WM2A 1V2YA 1NYQA 3KYDD 2E5LM 4TKNA 3PBHA 3RULA 2C7HA 3DQVA 4L2YA 1V6EA 2FO5A 3HWSA 3Q8FA 3VXWA 1WIAA 1JW9D 2W3RA 4XYCA 1RYJA 1AUAA 1WF9A 2LVOC 5AEKB 2ZZPB 1XC8A 1KSFX 1QZMA 2CP8A 4ZRIA 5IZ7D 1T43A 1R5LA 1P7FA 2NVUI 3QIJA 3HJQA 4MM3A 1BUIC 1FD6A 3KX1A 1N60A 4OVZB 1XEEA 3GB1A 2XSZA 4US9A 4WJQA 3U61B 1L2DA 4IOIE 4Z8XA 3AN1A 3GPXA 3SAVA 1NYRA 4RCOA 3P42A 4YYRA 2QPAA 3RNCC 2EKKA 3WIMA 4R71A 4BBNC 1R7RA 4LNOA 1PDXA 2D7EA 4WQOB 4LZJA 4FJVB 4PT5A 4B7HA 4MSQB 2CHWA 1KFXL 2DZZA 1EO6A 1QDRA 3ALBA 2BWBA 2KZSA 1L5PA 5MPOA 3JSVB 4HWYA 5IKCM 1PJQA 2QHOB 4DV7M 5E6OA 1AYUA 2XFSA 4ICVA 3THGA 4LRTA 2RGHA 3PT2A 2O6VA 4IBIA 5ITXA 4GKJM 3OG5A 2VZKB 5EP1A 1E94E 3AE7B 3N1ZC 2FQ9A 4GUAA 3IVFA 1UGJA 4REZA 1V49A 2LHEA 3I51A 2X8XX 4NJ7A 2NQDB 4MM3B 4MGHA 3WALA 1SXJE 1NO1A 2L2DA 4B08A 1WXQA 1NI3A 2EMSA 3QYBA 2AUZA 3B21A 1A70A 1QLBB 5DYGA 2MJ5B 5EP2A 2MW5A 2IO0B 2ZTCA 4BBAA 1GB4A 1NEKB 1IBMM 3RD2A 4ZRJA 4B0EA 2OOBA 2MA9B 1VJKA 1ACCA 1Q0WB 3AV0A 3TSSA 3D32A 2LVPC 1OGWA 3HIZA 4HPLB 4C56C 3LYYA 4BS5A 2LXCA 3KLSX 3GLFB 2LHGA 4S17A 3RNGC 3VTUA 4NPNA 2FRQA 2L76A 3O65B 4FA6A 1VRAB 1UFZA 1Q3BA 2KVRA 3IXSA 1U5IA 2YFQA 1AIPC 5L8RF 4X65M 2XU3A 3AJIB 2QSDA 2BTWA 3PT2B 2XH9A 1VZ7A 5TR5A 4NL4H 3MK6A 1UBIA 3AEFB 1F52A 5GXGB 4FN2A 4A9AA 3TWLA 1WIVA 3SFZA 2PBHA 5LMNM 2D3AA 2LHCA 1NHGC 1NVMA 1YN4A 2MEKA 2AS8A 2AVWA 1I94M 1XMQM 3AL0C 2AHMA 1PCIA 2DJGB 3F75A 4X6IA 2RPQA 3HU1A 3X23A 1Y8GA 3T38A 1WI0A 3A9JB 4LFBM 4W9DA 4IM2A 1DGHB 1Q5WB 3SEBA 2CJOA 2J7QC 2NCNA 1T6BX 1LM8B 4DUZM 1SXTA 1E90A 5A24A 4YTMB 3GLIB 3M62B 2KMAA 1YSYA 2KQSA 2YJBA 5EXPA 4OZBA 5PADA 2HKJA 2ZW1A 3ECIA 3J7AS 4AUQC 1KFUL 2A5UA 2LVNC 1AU4A 2IYDB 3KW6A 3JR4A 3BWUD 3L10B 2KQ7A 1SIJA 3SFEB 4MH8A 3KFQA 2FAZA 2J7QB 3NZUA 3GRRA 1JWMD 2Y21A 1RU3A 1KH0A 1AW7A 1N61A 3ZIMA 4ANWA 1U9XA 3IEJA 4KLNA 2XEWA 2I7NA 5CHFA 4FWGA 1NSFA 2RMMA 3K9PB 4XUIA 3K9OA 3BWKA 3H1UA 1FNUA 1L4ZB 2J53A 2KDEB 4EZLA 3GLFE 2K39A 2BQQA 5FR6A 1X9YA 1GVNA 3BY4A 3F92A 3PSEA 3VUYA 2HWKA 2JZ3B 4L16A 1GAQB 4HXDA 1S3SA 2N9PC 3ZTCA 1CMXB 1ITOA 1C77A 5BO4B 5ITQA 3HU3A 5ITXE 3ZCBB 3P63A 4WWMA 5G5HA 5JXVA 1ZKHA 3L27A 3H7PB 4HJGE 2UU9M 4FD2A 1TKGA 5EF4A 3VR8B 4CIZA 3C19A 3ZUAA 1YX6B 3AXCA 1UNSA 3EA6A 1UGMA 4M8MA 4ITQA 2W3SA 3I63C 3OF8A 3V6EA 2INPE 3HHYA 2WXKA 3ZGZA 5CVOB 1F2BA 4KVGB 3ERVA 5AUKA 2O25A 1QQWA 1XLQA 3B1LX 1JWSD 2HWJA 4G11A 4WWPA 3MJ5A 1KRHA 2ASQA 5FSWA 3EFCA 2KZRA 5G5GA 4TQ0A 3RMKC 4ARIA 1P98A 5JH5C 4DHZB 5JI2E 2L83A 2GQFA 4QHTA 4LF9M 2KDBA 2YEPF 2BDLA 4F1IA 2JU6X 3ZKJC 3IFUA 3K9OB 4FADA 1MEMA 1STEA 5AZGA 2V4IB 2MRPA 2RDBC 1LTMA 3GLGA 5D6JB 4YL8A 2MR9A 2F5QA 3A9KA 3MC9A 1N36M 4RFBA 3M99A 4CDFB 2CHGA 4X64M 2WXJA 3BY4B 3PSEB 1OIZA 1K51A 2F5NA 2IBIA 2WU5B 1TS5A 1WM3A 4NSRA 1N6ZA 3PLVA 4JI2M 4W9LA 3RVWA 4PS8A 2KRUA 3O1GA 3A46A 2R61A 3I5JC 1F2CA 4NQLB 3HX3A 2KWUB 1TGUA 1Y8RC 2MX2A 1ROEA 5CVMA 2DAMA 2QSFX 3AE3B 2NMQA 4P7IA 3V6EB 5FTKA 4QOSA 4LJ5A 4ZTBA 3VFDA 1OKSA 4IC7B 1MU5A 3QC8B 3ZTDA 3PZDA 3Q3JA 4DDGD 1GB1A 4HDOA 3TWMA 2PW9A 4EZKA 3BK1A 3BVMA 2PLPA 3VFKA 4H2AA 1LXDA 1TKYA 2J4XA 1DGFA 2JVCA 3U7ZA 1EWPA 4GGQA 4JXJA 3TQSA 3GLHB 1TLOA 1NV8A 2H89B 1N78A 3HJ8A 4LCBA 1WGDA 4LJPB 3GLGB 1R4GA 2DZNB 1PGBA 3A9KB 3DBSA 2G4DB 2LBCA 3HVZA 2HE7A 1MJGM 4HPPA 2AGAA 2ZM6M 1DO0A 4PYZA 2H1RA 4I81A 3SATA 3PLUA 4BOPA 3MHSD 3A45A 4Q8HA 5J94A 3W0FA 1D2NA 3W68A 4YYUA 2RR9A 1V1PB 3SFDB 3IECA 4DXFA 2QP9X 1MS6A 2BB5A 4Q2JA 1FXIA 3PHWA 4ANVA 2O2VA 3RGPA 1Q3CA 2DZLA 1TY0A 1WXSA 1YQ4B 3IAS1 4FBJB 1DOYA 4FJZA 4A5UA 4NXMM 1GLNA 1CPJA 3HU2A 4LGMA 2Z3XA 1R7SA 1LO5D 3AH7A 3SAUA 4ACFA 4G4RA 1J8CA 2LGSA 3BVGA 4AQ7A 4JI6M 2AWTA 3R66C 4DR6M 1KTKA 2YR0A 3QWLA 3VDPA 1THEA 2KJHB 4GXBA 1P0RA 1NLJA 3Q69A 4DR7M 1PXVA 2J0MA 1N5XA 3I3TB 1QZEA 4JGHB 1AECA 2Y0TA 2DZJA 2KNZA 4LY6A 4C00A 4TUWA 2QDFA 3L26A 2WBFX 1V1OA 1ZPSA 1GJSA 4WURA 3WXGA 1WR6E 3TEXA 1Y08A 3WAPA 3U6QA 1ET9A 3U8EA 4HEOA 1PM5A 2LZ6A 2F5OA 1AN8A 3NZ3A 2I2YA 2WDQB 3CH2X 2M0AA 1POPA 3T1YM 2CV2A 4I8OA 2JRIB 3QCAA 2K5PA 4AKHA 5BYSA 3PHXA 2INDC 2QBYA 1ZMVA 2R65A 1TGZB 2K8CA 5FTLA 2GBJA 3U52E 4XGIA 2GBMA 2DCAA 2J0JA 1ZXIA 2KX3A 4NAWA 2GFOA 1FFVA 3GLGE 1ET6A 1I35A 4PCZA 4FLHA 1IN6A 1E8ZA 2PE6B 2IGDA 1VSNA 4FK5A 1XHBA 1FMAD 4FIPA 4MACA 2KEBA 2G8EA 1SXJD 3I9V1 3QSDA 3C8YA 7CATA 2WXGA 4KZCA 1TT5B 3AE4B 2AL3A 3DVNV 1XLNA 2MCNB 4K7SA 3W9CB 1TZ1A 1GC7A 4A3OA 4X66M 3J9CA 3MJWA 4X57B 4I6NB 3HHZA 2K3UA 2P0RA 4AXLA 1VLBA 4ZOHC 1IGDA 1C7YA 1Q1OA 2EO2A 4BOQA 2ZCBA 1LQBA 4MZSA 1JWBD 4BOUA 1GO5A 2HTHA 3Q3NC 4DQOC 4D8EA 3RVXA 3URYA 1E10A 3HD3A 4QRXA 1R4MB 1D5ZC 3Q8CA 4KLBA 3BBAA 1ZP0B 2F5SA 3KSEA 3SARA 3AE9B 3HM3A 4I04A 1J7KA 4R7GA 1IY2A 4NAWB 3R9XB 1D5MC 4LNFA 4OZAA 4L4UA 3V62A 3E4RA 2LJIA 4BZAA 2Z8YM 1WX8A 2GOWA 2N9KA 4B7GA 2WXNA 3OTOM 2FOIC 4AKGA 4XZXA 4AWJA 3X0WA 2BWES 4K7UA 2APLA 2L4FA 4JI7M 3DBHI 4IKGA 1XLPA 4OELA 2KDLA 1E9SA 3DWMA 1HJPA 2XEPA 4IBFA 2N7DA 3L4PA 4XDCA 5DPSA 4M9SA 3C0RA 4B3TM 1MN3A 3AU5A 1ZIVA 2FCQA 2PTLA 1D0KA 1WR1B 2IGHA 2VZKD 1N63A 3B9JA 4KSLC 2KANA 2ZNVC 2M19A 1YALA 2C5RA 3I01M 1V34A 1YIWA 3TUOA 4Q8GA 1IN4A 1E8YA 2F4VM 3KWBX 1Q6KA 1SE4A 2DYMA 2L32A 3ZQJA 1EF7A 4P6GA 3U6SA 1F2RI 5ITTA 4HJKA 4JV5M 3UQAA 2R4EA 3HK0A 3L2AA 2ZTDA 4F1SA 4RGTA 3W1SA 1RRBA 1E7UA 3IT6B 4GLSC 3L25A 5HI1A 2SAKA 3P5XA 5IOIA 1WJ4A 3NHEA 2DAJA 3TEYA 3SBJA 1T0RC 4GC9A 3NUHB 4KDLB 1DO2A 1ZMWA 1L2BA 2XK5A 2E01A 1PIPA 2N9XA 3AOEA 1MHWA 5H37D 3A4SC 4LCDE 4XE0A 1WE7A 5BMIA 1JB0F 4JI1M 5ITRA 1VR9A 2I1KA 1OTRB 1Y4HA 3FTCA 2ZEQA 2XBBC 4ZYNA 3W1SC 1WJNA 4LJAA 3OVZA 2QMTA 1MG4A 1CUKA 3DBLB 1FCCC 2G3QB 4IJFA 4S12A 3M63B 4DHJD 1FXAA 3R2IA 2JY6B 2NQ8C 1T0SC 3LMMA 5ITUA 2V6ZM 1YOVB 1FRRA 4OVUA 2XU4A 3ZW3A 2DAEA 1EWMA 1TS2A 3Q3MC 1YNTE 3ZLZA 2DHZA 2FT2A 1EU3A 2GMIC 3A1QB 4W9GA 4BS6A 1E8XA 5LXHA 2VIIA 2FYEA 3NHEB 2KJ6A 3BOSA 4K81A 3DVNU 3CMMB 3IFWB 1F0ZA 3U6EA 5KO3A 2LJ5A 1NV9A 4GN1A 1WHCA 1MG8A 2DCBA 2KZUA 4CGYB 2CU1A 4QRVA 1SG9A 4W4UA 4FWDA 1UZXB 5EE3A 3AE2B 4HEA1 2JZZA 1G41A 3DBHB 4QAYA 4FW9A 2FUG1 5T8IA 4IJEA 1Y56A 1TS4A 1NB5A 3QHTA 4AKIA 4N58A 2NBUA 5D3IB 3DHHC 4L1BA 3RT3B 1QKZA 3KWZA 2R2OA 2HL7A 8CATA 3J81S 2CEAA 2FCNA 3MP9A 4HKQA 1PQSA 1P3QU 1B9RA 3V05A 3KOZE 2DXIA 3AMZA 1TTEA 4DXGA 2UXBM 4N79A 3FRIA 3CF0A 2JX5A 5KPTA 2L0FA 4JIOU 1NPZA 4F2LA 4PDIA 4QH6A 4ZHOA 2ZVOA 3T15A 2ZCCA 3IAM1 4JWSC 2MBBB 1OEYJ 1I4WA 4E3CA 4JYAM 1N62A 1W5TA 5LMUM 2K25A 4FULA 4LJ9A 3N1XC 3IHPC 2WXLA 3WCQA 4RNAA 2IY0B 5C1BA 3E21A 4WWOA 1IP9A 1XWIA 3SMSA 2D3GA 3KH0A 3Q3FA 2CWBA 3FE3A 3V3XA 3N3KA 2DWMA 2R9OA 3WHKA 5DNYA 4GITA 2BVCA 2VRRB 1NVID 4RM8A 2BYEA 3E9SA 2CRUA 5DCNA 2AYOA 2RGOA 1C4PA 2OJWA 5LXIB 5J2RA 1U9QX 1GJZA 2YQZA 3U6DA 1DEUA 3A98B 1I4QA 3U5ZA 4EOYA 1UWXA 2D3BA 1IYFA 5EZQA 1Z5SB 3U6PA 3FC4A 2VF7A 5DPWA 3VH4B 3WANA 4K7CA 4NRVA 3FUXA 5EQTA 2BS4B 4B6WA 1WGRA 2BPSA 1YMHE 3J80S 5ITYA 1BQIA 1P1AA 3A33B 1KHQA 2G8LA 2KVZA 1PRBA 3WXEA 2OZ2A 4JN6A 4RKXA 4LJ8A 1T3QA 3LXFA 1WX9A 2KAJA 1ME3A 3RNAC 5DPTA 4BOZB 1KFYB 4NRWA 3HWNA 1WJ7A 3B08A 2JWSA 4QHSA 3QWZB 4LNIA 1Z59A 3HJSA 3C58A 3SHGB 4JL9A 4US8A 1HR0M 2KD0A 2DHRA 2V3PA 5JA7A 2M60A 1T3TA 1A5RA 4MSMB 3P2BA 3E56A 1E8WA 2UYZB 3CSFA 3P5UA 3AE8B 4ARCA 4IBKA 5C18A 2AYOB 2LEKA 1MFWA 4B3MM 1HXYD 2JYTA 4RMAA 1ME4A 1Z5BA 3E1ZB 1TH2A 4NJ6A 4GDKA 4HWIB 1WRIA 3DFZA 2AEHA 2DNAA 2LXAA 2BF8B 3GZNB 4G50A 2MWSB 3K92A 3KWVA 4QRGA 3PDFA 2G9HD 3PRPA 2NTTA 2W9NA 1IGCA 1BY8A 3C3DA 2BYVE 4C7ZA 1PJTA 3L17A 1C1YB 4HRSA 2UXDM 5FR3A 3HHWA 3KFUG 3SHQA 2K8HA 4GHLA 3RFZB 3NVVA 3BOWA 3ZNGC 2M0XA 1L4DB 1AU2A 4A8XC 4ZRPA 3FUUA 2ZAOA 1UUPA 2C96A 1RLFA 1QUSA 4YSZB 4MGKE 1TU6A 3KP0E 3FD9A 2KA6B 3H8HA 4N6EB 3UF8A 2L09A 2Q2EB 1DGGA 4LF4M 4CHTB 2VHSA 3IG3A 1KXRA 4I4LA 2NQAA 1QDTA 2B3AA 2O6VB 2BU3A 4USAA 4YTNB 2BNKA 4C80A 2C0YA 5EE1A 4DR3M 2AL6A 3VKHA 1F29A 3P5WA 3VTWA 1N5WA 3W5UB 4L78A 2K8BA 4NJCA 3DHGC 4D2KA 3EECA 2JA2A 4DHJB 3M6AA 1QQRA 3LW5F 2R9NA 5FPWA 1IQPA 1GUAB 1SE9A 2O6XA 5FK9C 4RH6A 2Y20A 1VDLA 2PVGC 2WGSA 2WX0A 4MGIE 4RGNA 3V6CA 3SDLC 1NJGA 1OFHA 2OOBB 2GNOA 1HTQA 1ZXHA 2N7JA 4G0NB 4IM0A 3I04M 2I1JA 2KWCA 2QQ8A 2GBKA 1D0MA 3ZYYX 4A3PA 3U6MA 3BPMA 2WXFA 4L23A 1R4NI 2K47A 2L4EA 1XQQA 4KX6B 1HNWM 4YYVA 3AV8A 1O0EA 1FXTB 2BS3B 1FH0A 4W9JA 5C3JB 2LH0A 4CDCB 3PO0A 3PFIA 2BTWB 4ANRA 4GRIA 2FIFA 1DGJA 2HJ8A 3AEAB 4YXDB 4RY2A 2DAFA 5FKAC 2ZPYA 2GHUA 4EZJA 4IWPA 3TL5A 4DK5A 2DAGA 4KV2A 5BMHA 4YY3M 3W30A 2ZBKB 3MFGA 4MT5A 1V33A 4IBJA 3L28A 4DV6M 3RN9C 2GB1A 3ZVVA 5K16A 1Z5CA 1HNXM 4ASWC 1MPEA 2HAKA 2LVAA 2MQJA 2OO9A 5JI3E 1IUEA 2HHNA 1Z5AA 2FNJB 4M00A 3A4RA 1GL6A 1XXHA 1MI0A 3Q14C 2OHFA 3QA8A 1L6VA 3R7RA 2AIMA 2YNMD 3NBXX 3F5VA 3SD5A 3GCBA 1M6DA 5JZEA 1TIFA 1VG5A 4OW0A 4A6QA 5EZSA 2AU1A 3GPYA 3UIOB 4BAXA 3MP2A 1DV0A 2Z59B 3PS6A 1N34M 1CJEA 1UF0A 4LZZA 2KTRA 3VK8A 2HD5A 3NVZA 4NOOB 1UH6A 1XCQL 4I6PA 5D2MB 3C3EA 1AYVA 2M5ZA 3SYLA 3U2SC 1WXMA 1V80A 2XNAC 2GLSA 3UZUA 1MHXA 1SE2A 1A6RA 1JCKB 2LI5A 2MGWA 4NY0A 4URKA 2FRAA 3ZXVA 2K6BA 1EWCA 2R6NA 2CR5A 2PJHA 2BGFA 1K3BB 4G6ZA 2KDFB 1PYWD 3T3OA 3H6NA 2KDIA 2LGYA 4CDEB 2QEJC 3APCA 4M9ZA 2QCUA 3U60A 1KYIA 1MJDA 2N9EB 3RZWC 2BTEA 2QCZA 2XN9C 2KXJA 5EJCA 3KSXA 4PD2A 1UM8A 1SEBD 5LNK1 4HXDB 1WMHA 4ZRKA 5A2QS 4HL4A 1HZ6A 1VDVA 2MBHA 2M17A 2FS1A 2KMCA 1JR3D 1L0YB 3N1YC 1GLOA 2R62A 4DMXA 3KDSE 3V61A 1PUTA 3VR9B 4TMAB 3K1JA 1J19A 4N59A 2B76B 1OAOC 4DV2M 4NSOB 3ZJUA 4CQNA 1GKIA 5BMGA 2KOXA 1BVSA 1DKIA 2L8JA 2F7DA 1EE8A 3N3GA 4IBGA 4II3B 2BWFA 3WAOA 2CJNA 4AW4A 3OJ3A 4HPMB 1CJLA 2KKCA 4NXNM 1R4NB 3UMMA 1I42A 2DZMA 2PVOD 3PHUA 3S3RA 5L83A 1P7EA 1N32M 3R8FA 4BKSD 3JR5A 3EIEA 2X4AA 1SF0A 2BBCA 2V3SA 2KWDA 2JY8A 4ITKA 1EU4A 3ZUNA 2J42A 1BMLC 3B7QA 3FUTA 1E6EB 2WNMA 1G6JA 2DC6A 3C9EA 1FNVA 2VH2A 3U60B 2L7RA 1OEYA 3HHXA 3T3NA 3LVWA 4CHKA 4E74A 4LDTB 1ICFA 4LF5M 2CB5A 4MI7A 2IBIB 2KQ4X 3P1MA 4DWFA 3WXFA 2JUOA 3W31A 2YJ2A 3ZRFA 3D6SA 4B0MA 3W1YA 1TY2A 1YJ1A 2I7PA 1XNQM 2VHFA 5CHVA 2WP9B 1WZ0A 1I4HA 4MH0E 3P4QB 4E71A 4XWWA 3BK2A 1YUBA 1G3IA 5KPRA 2V1YA 2Z0EB 3LCVB 1PFDA 3UK6A 1SNKA 2LHDA 2TSSA 2EMTA 3SHFA 4YYSA 3U6OA 2PEAA 4GMVA 3RNFC 5EE9A 4GDLA 4MB7A 2NPTA 3WA0A 3MTVA 4ZDVA 2LFIA 1XXGA 1NB3A 3K8ZA 1TH3A 2C60A 2KFKA 1XF5L 4I6LB 4AP4C 2JT4B 2MBOA 2HH5A 2YJ9A 5CHVC 3HUIA 1E9RA 3SU8X 3IUTA 1WJ6A 2REXA
chains in the Genus database with same CATH topology
1FJGM 4Z6YA 4A3VB 2FFJA 4KKIA 1IBXA 3IG5A 2MJDA 2LNHC 3NRZA 2M56B 1AWDA 2L7HA 4YSXB 4JE3B 3FILA 5D3DA 3BB7A 1QAQA 4IBBA 2UUCM 3KS8A 3GPPA 2CHQA 3SAWA 1FNWA 2CUZA 3EIHA 4KGTA 2Y0QA 3I57A 4GDLB 3AEBB 3CF2A 4ZRQA 4GKKM 2R45A 3QAUA 2IJ0A 5HG2A 2YEPB 1DGBA 1C79A 4KHPM 4XWTA 1C78A 1UWMA 1IBXB 2R4JA 2PKOA 2HTME 1ZAEA 4IDIA 3D8LA 2O5RA 5FTMA 2SEBD 2GI9A 2WU2B 1SSNA 2KACA 1DYQA 4WW0A 2QBYB 3Q8BA 5DYIA 1D5XC 1XCTL 3AECB 2MJ3A 4LJ7A 4UDUC 1HNZM 2UUAM 4LF8M 1ZDXA 2CV1A 3P4PB 2G5GX 3D8BA 2LWXA 1N75A 1L6UA 3GO8A 2D7GA 4YHHM 4LF6M 2GRIA 2C98A 2JWUA 3LQQA 1L8QA 4GC5A 2XF3A 1R2ZA 2WXMA 3GS2A 4L8RC 2DOSA 2DYOA 2H88B 1CK1A 1AYFA 5GKNA 1E0ZA 3ZNHA 1I4XA 4LJ4A 2XSZD 5H8YE 5FLXS 1J7AA 1MX0A 3HKPA 1YQ3B 4QOZC 2V1UA 1RWSA 4JI0M 3J27B 3IG8A 3GRUA 1C76A 2JQRB 4D8IA 1DOIA 5E26A 3UJNA 1YN3A 1WYGA 2E6XA 1Q10A 3NVWA 3ZJTA 1KLUD 4IUMA 3CIRB 1LV7A 2XFTA 3PRMA 4AZFA 3BYTB 4B3SM 4I5SA 2QIEB 1QOFA 1IXSB 5AUIA 3RE8A 4JI4M 1TKEA 2JYEA 3VQIA 1HA5A 1TS3A 1W5SA 1QT9A 3M0EA 2QJLA 1K3XA 1J7BA 3MC0B 2ZW0A 3AOEC 1E32A 2XLJA 2L1AA 3B2GA 4GH9A 3UGJA 1JWAD 1XNRM 4YT0B 2NTSA 4AQYM 2WQYB 1IY1A 2V1CA 1NJFA 1FFUA 2FBWB 2G1EA 3AE6B 2BYTA 1L0VB 5HHDG 2XZUA 1G8PA 3GRYA 1HEZE 2KN4A 3GP1A 4RF0A 1SJED 1IXZA 4AG5A 4IBDA 3I4VA 3TEWA 1YE9A 3Q8AA 4GIPA 4LG2A 1NY5A 1F2RC 1HQYE 3ABVB 2JSVX 3TRKA 2RKOA 2EUCA 2A5YB 3AOGA 4FCVA 2OEDA 4OHJA 4KKJA 3LQRA 1UKFA 4BB9A 1VZ8A 4LRSA 3AEGB 5C2TB 4OX9M 4G4NA 1HT1E 2D7HA 3GP7A 3GQ5A 3BVZA 4D8BA 1FIQA 4AS1A 2W55A 2OQ4A 3ILKA 2K9XA 2N9LA 2AQ2B 3EUB2 1VZ6A 4IBEA 4FCWA 3CTWB 4OVZA 3UI3A 3KS4A 3U61A 2IDYA 5I4DA 2C9OA 1YJIA 3W0LB 2Z4SA 2DLBA 1V8CA 1ENFA 1X37A 2C9CA 3AEEB 4LFAM 2UXCM 1SJHD 3OWEB 4EE2A 2Z84A 2WXRA 3FTDA 3P4RB 1YZBA 3KXEC 2WS3B 4JPSA 2UZJA 1WGKA 2LGIA 2ACZB 4AG6A 1TDZA 1JMLA 4MGYE 1K3WA 1TH4A 2P5TA 3PNVA 4R3DA 1G59A 4KO8A 1OQRA 5EXTA 1ESFA 2X8AA 3NBIA 3U5ZB 3GLFA 2KW0A 2L52A 4NZLB 3O65A 3J7BA 2MJEA 3CF6E 2QILA 3CWIA 3KWLA 1PGXA 3MHVC 2ZAMA 1I4GA 2OPFA 2HDEA 1OFFA 1SBBB 1YJJA 3RNVA 2PMVA 5EE0A 4O1NA 3TEZA 1C1KA 4JI3M 2ERCA 2DBYA 4ZPXA 1QVRA 2DZOB 2RPVA 1DGHA 1QYRA 4RGOS 3VRBB 4DR1M 4GDKB 3GLIA 4M0WA 1SE3A 1QANA 1TZOA 3KVWA 4DV5M 1RM6C 1JRPA 3KQ4A 3LVVA 2J7QA 1JALA 1R2YA 5FTJA 3BIID 3U4EG 3TMPA 1MVKA 1QILA 4QNRA 3LB8C 1IN7A 4W5WA 1Q39A 1D6EC 1JWUD 2Z7JA 2J7OA 1FM0D 3DA1A 1KF6B 2Y3AA 5H92C 4LFCM 3J2PB 3U6LA 5HFYA 3ZJVA 1I7HA 4EIWA 1NNUC 1G4AE 2CFOA 2WXPA 1K50A 3GQ3A 3B9PA 4YWGG 3SC3A 2KMMA 1T5XD 2W54A 1I4RA 3AFHA 1JQJC 2F5PA 3R8BA 4HKZE 5FTNA 1WWTA 4YTPB 2INNE 1N77A 3H4MA 2Q5WD 3VRAB 1FNNA 3KOXE 2BB6A 4X62M 4DV4M 2IPKD 3EGRA 3NS1A 3PZ7A 1OQQA 4D80A 2X38A 3PZ8A 1J7CA 4WQMA 3T1HM 1F77A 3R2TA 3N9YC 5E6JA 1ZDVA 2ON8A 3RFWA 4JWUC 1IN5A 1B1ZA 3U6CA 1C4CA 2XZFA 2DVWB 1EWYC 1IN8A 1XXHB 2HCBA 2WXHA 1BXTA 4FWHA 2ONQA 2N0SB 4FCTA 3GLHA 2PIAA 1R6BX 2AQ1B 1NHWC 1N33M 4RF1A 1NENB 3ETRA 1FCLA 1L1TA 2J52A 1IXRC 1TJEA 1V1PA 2Y5PA 3GPUA 4BOSA 4IIWA 2R46A 3FKEA 1PJIA 3FAHA 4FXCA 3SASA 4KGSA 2MH7A 3M7GA 4B3RM 1FRDA 2I38A 1V97A 2DWNA 1KLGD 1ZOYB 2HHHM 1QF6A 1CQVA 2UUBM 1XMOM 3L29A 1WSPA 3RGSA 4WH4A 1I4PA 2WDVB 2CE7A 2DWLA 1HQRD 3RPFC 3ZC7B 5BYRA 1MHHE 3I4YA 2RDHA 3OQCA 1IBKM 3MHZA 2RDGA 2QENA 1K52A 4DR2M 2BT6A 3DOAA 2ICIA 4IP3A 1YN5A 3W5VB 3TL4X 2BS2B 2V0GA 2JRIA 3KSJA 3WHLA 4KODA 1JROA 3PNYA 1QOBA 4ZYSA 1GPXA 3DZDA 2XGNA 4DR4M 3VLFB 3FTEA 1K53A 4OZCA 1JQ4A 1RFKA 3NWLA 4KGRA 2BJVA 3TE6A 4II7A 4D81A 3AEDB 4PDGA 4K0KM 2D5GA 2WXQA 2J7NA 4LJ6A 1TYGB 2L6OA 2JZPA 3Q8EA 2CU3A 3B2FA 3FUWA 4DV3M 3GQ4A 5F3WA 1IBLM 1KFVA 1IY0A 4TQ1A 4GMQA 1OJLA 4J3OD 4DUYM 4LK0M 3NVYA 3A42A 2KXEA 1QAOA 3GRVA 2QZ4A 2VQEM 3FILB 1L2CA 2C99A 2DWZB 4L15A 2WLBA 2AX5A 3SR6A 5IREB 4JI8M 4HLQA 2LUMA 3BYYB 3FYCA 4C7YA 2DWQA 4WAFA 3SYKA 3PXGA 2CHVA 3VK7A 2KDMA 3DWGC 4D82A 2EA0A 2V3NA 1JR3A 4P6VF 2K0PA 4DR5M 1FEHA 3JAMS 2Z4RA 1J09A 2FE8A 1K82A 1QOAA 1C4AA 4LLGM 3FUVA 5BYQA 3K2LA 3W2DA 2LMCA 3FYDA 3SMPA 2VQFM 4RGMA 3FTFA 4XBOA 2FNAA 4B7FA 1E9MA 4BLCA 1GL7A 2WXIA 1ZQ9A 4XDDA 4LGYA 1QOGA 1D4BA 1M4VA 2IGGA 2Z8LA 3ZQ4A 4G4QA 4P16A 4MGZE 2K22A 2BJWA 5IWAM 4A90A 1HQCA 1DOXA 4ZHPA 2R18A 1XO3A 4M9XA 3AKZA 3P4SB 1H6UA 2W82A 1L1ZA 1VDDA 2ZANA 4LF7M 1EM7A 2KRKA 4JI5M 3O13A 4M0DA 1Z6TA 4QNMA 3VKGA 1XLOA 4HROA 5EXSA 3AE1B 5KQ8A 1TDHA 5KPZA 4G4OA 5BPVA 5TSSA 4DV0M 4TSSA 2LXEA 1HZ5A 1PGAA 1HT2E 4GHAA 3HVDA 4AI6A 4FVMA 2EKIA 1OFIA 3AM9A 4CISA 2BW2A 1ORYB 1C9FA 4DV1M 4OU7A 3ZH9B 2E3TA 5D7GA 1QAMA 3Q8XA 1PJJA 3PVSA 1ZE3D 3AB5A 2Y5CA 2WXOA 5EP4A 1SXJA 5KQDA 3TWKA 3HGIA 1FO4A 1GOZA 2X49A 1CZPA 3BZDB 1L0XB 4NAMA 5BR8M 2JTCA 2CV0A 1SB3C 1J5EM 3AE5B 3HRDD 3TPZA 3VDUA 5IT9S 2JXTA 4JX1C 4YSYB 1IM2A 1NY6A 1NNJA 1SXJC 5EXXA 2L7IA 5EP3A 3KOYE 2EELA 4WIPA 4A55A 3KP1E 3IT4B 2WDRB 2AQ3B 4BOZA 3KOWE 1SXJB 4IBCA 1E7PB 1ZUD2 1PVJA 4LTUA 1NYQA 2E5LM 4L2YA 3HWSA 3Q8FA 1JW9D 2W3RA 1RYJA 1XC8A 1KSFX 1QZMA 5IZ7D 1P7FA 3HJQA 1BUIC 1FD6A 1N60A 4OVZB 1XEEA 3GB1A 2XSZA 4US9A 3U61B 1L2DA 4IOIE 4Z8XA 3AN1A 3GPXA 3SAVA 1NYRA 4RCOA 3P42A 2QPAA 1R7RA 1PDXA 2D7EA 4LZJA 4PT5A 4B7HA 2KZSA 1L5PA 5MPOA 4DV7M 2XFSA 3THGA 4LRTA 2RGHA 3PT2A 4IBIA 5ITXA 4GKJM 2VZKB 5EP1A 1E94E 3AE7B 4GUAA 1UGJA 4REZA 2LHEA 3I51A 4MM3B 4MGHA 1SXJE 4B08A 1WXQA 1NI3A 3B21A 1A70A 1QLBB 5DYGA 5EP2A 4BBAA 1GB4A 1NEKB 1IBMM 4B0EA 1VJKA 1ACCA 3TSSA 3AV0A 4C56C 3LYYA 3KLSX 3GLFB 1VRAB 1Q3BA 3IXSA 2YFQA 4X65M 3AJIB 2QSDA 2BTWA 2XH9A 1VZ7A 4NL4H 3MK6A 3AEFB 5GXGB 4A9AA 3TWLA 3SFZA 5LMNM 1NHGC 1NVMA 1YN4A 2MEKA 1I94M 1XMQM 3AL0C 2AHMA 3HU1A 3T38A 4LFBM 1DGHB 3SEBA 2CJOA 2J7QC 1T6BX 4DUZM 1SXTA 4YTMB 3GLIB 1YSYA 5EXPA 4OZBA 2HKJA 2ZW1A 3J7AS 3KW6A 3JR4A 3BWUD 1SIJA 3SFEB 4MH8A 3GRRA 1JWMD 2Y21A 1KH0A 1AW7A 1N61A 4KLNA 2I7NA 4FWGA 1NSFA 2RMMA 1FNUA 1L4ZB 2J53A 3BY4A 1GVNA 3PSEA 2HWKA 4L16A 1GAQB 1S3SA 1C77A 5ITQA 3HU3A 5ITXE 3ZCBB 3P63A 4WWMA 5G5HA 5JXVA 3L27A 4HJGE 2UU9M 4FD2A 1TKGA 3VR8B 1UNSA 3EA6A 4ITQA 2W3SA 2INPE 3HHYA 2WXKA 3ZGZA 5AUKA 1QQWA 1XLQA 1JWSD 3MJ5A 1KRHA 5FSWA 5G5GA 4TQ0A 4ARIA 5JI2E 2L83A 4QHTA 2YEPF 4LF9M 2JU6X 3IFUA 1STEA 2V4IB 3GLGA 2F5QA 4RFBA 1N36M 2CHGA 4X64M 2WXJA 1K51A 2F5NA 2WU5B 1TS5A 4NSRA 4JI2M 2KRUA 3A46A 2R61A 1TGUA 1ROEA 3AE3B 2NMQA 5FTKA 4QOSA 4LJ5A 4ZTBA 3VFDA 1MU5A 1GB1A 3TWMA 2PW9A 3BK1A 3BVMA 2PLPA 4H2AA 1TKYA 2J4XA 1DGFA 3U7ZA 4JXJA 3TQSA 3GLHB 2H89B 1N78A 3HJ8A 4LCBA 3GLGB 2DZNB 1PGBA 3HVZA 2AGAA 2ZM6M 1DO0A 2H1RA 4I81A 3SATA 4BOPA 3A45A 3W0FA 1D2NA 1V1PB 3SFDB 4DXFA 2QP9X 2BB5A 4Q2JA 1FXIA 3PHWA 3RGPA 1Q3CA 1TY0A 3IAS1 1YQ4B 1DOYA 4A5UA 4NXMM 1GLNA 3HU2A 4LGMA 2Z3XA 1R7SA 1LO5D 3AH7A 3SAUA 4G4RA 3BVGA 4AQ7A 4JI6M 4DR6M 1KTKA 2YR0A 3QWLA 3VDPA 3Q69A 4DR7M 1N5XA 2Y0TA 4LY6A 4TUWA 3L26A 1V1OA 1ZPSA 4WURA 3TEXA 3U6QA 1ET9A 1PM5A 2F5OA 1AN8A 3NZ3A 2I2YA 2WDQB 2M0AA 3T1YM 2CV2A 4I8OA 2K5PA 4AKHA 5BYSA 3PHXA 2QBYA 2R65A 5FTLA 3U52E 4XGIA 1ZXIA 1FFVA 1ET6A 4PCZA 1IN6A 2IGDA 1XHBA 1FMAD 4MACA 2KEBA 1SXJD 3I9V1 3C8YA 7CATA 2WXGA 3AE4B 1XLNA 3W9CB 4X66M 3J9CA 3HHZA 2K3UA 1VLBA 4ZOHC 1IGDA 2EO2A 4BOQA 1JWBD 4BOUA 4DQOC 4D8EA 3URYA 1E10A 1D5ZC 3Q8CA 3BBAA 1ZP0B 2F5SA 3SARA 3AE9B 1J7KA 4R7GA 1IY2A 4NAWB 3R9XB 1D5MC 4OZAA 4L4UA 3E4RA 2LJIA 2N9KA 4B7GA 2WXNA 3OTOM 2FOIC 4AKGA 4XZXA 4JI7M 4IKGA 1XLPA 1E9SA 3DWMA 4IBFA 2XEPA 4XDCA 3L4PA 4M9SA 3C0RA 4B3TM 2PTLA 2IGHA 2VZKD 1N63A 3B9JA 2M19A 2C5RA 3TUOA 1IN4A 2F4VM 1SE4A 2DYMA 2L32A 3U6SA 1F2RI 5ITTA 4JV5M 2R4EA 3L2AA 4RGTA 3W1SA 3IT6B 4GLSC 3L25A 5HI1A 2SAKA 3TEYA 3SBJA 4GC9A 3NUHB 1DO2A 1L2BA 3AOEA 5H37D 4XE0A 5BMIA 4JI1M 5ITRA 1VR9A 3FTCA 4LJAA 2QMTA 1FCCC 4IJFA 4S12A 1FXAA 3R2IA 2NQ8C 3LMMA 5ITUA 2V6ZM 1FRRA 1TS2A 1YNTE 1EU3A 2VIIA 3BOSA 1F0ZA 3U6EA 5KO3A 2KZUA 4CGYB 4FWDA 5EE3A 3AE2B 4HEA1 1G41A 4FW9A 2FUG1 5T8IA 4IJEA 1Y56A 1TS4A 4AKIA 4N58A 5D3IB 4L1BA 1QKZA 2HL7A 8CATA 3J81S 2CEAA 3MP9A 4HKQA 1B9RA 3V05A 3KOZE 2DXIA 3AMZA 4DXGA 2UXBM 3CF0A 2JX5A 5KPTA 4PDIA 4ZHOA 3T15A 3IAM1 4JWSC 1I4WA 4JYAM 1N62A 1W5TA 5LMUM 4LJ9A 2WXLA 3WCQA 4RNAA 5C1BA 1XWIA 3SMSA 3V3XA 2DWMA 3WHKA 5DNYA 4GITA 1NVID 3E9SA 2RGOA 1C4PA 2YQZA 3U6DA 3A98B 1I4QA 3U5ZA 1UWXA 5EZQA 3U6PA 3FC4A 4NRVA 3FUXA 5EQTA 2BS4B 1YMHE 3J80S 5ITYA 2G8LA 4JN6A 4RKXA 4LJ8A 1T3QA 3LXFA 2KAJA 1KFYB 4NRWA 4QHSA 1Z59A 3HJSA 3C58A 3SHGB 4US8A 1HR0M 2DHRA 2V3PA 2M60A 1T3TA 3E56A 3AE8B 4ARCA 4IBKA 5C18A 2LEKA 4B3MM 1HXYD 2JYTA 1Z5BA 1TH2A 1WRIA 3DFZA 3K92A 3KWVA 2G9HD 3PRPA 2NTTA 1IGCA 4C7ZA 4HRSA 2UXDM 5FR3A 3HHWA 3KFUG 4GHLA 3RFZB 3NVVA 1L4DB 4A8XC 4ZRPA 3FUUA 2ZAOA 1UUPA 2C96A 4YSZB 4MGKE 3H8HA 3KP0E 3FD9A 2KA6B 4N6EB 2L09A 2Q2EB 1DGGA 4LF4M 4CHTB 4I4LA 2BU3A 4USAA 4YTNB 2BNKA 4C80A 5EE1A 4DR3M 3VKHA 1N5WA 3W5UB 4L78A 4NJCA 4D2KA 2JA2A 3M6AA 1QQRA 1IQPA 5FK9C 4RH6A 2Y20A 2PVGC 4MGIE 4RGNA 1NJGA 1OFHA 1ZXHA 2N7JA 3ZYYX 3U6MA 2WXFA 4L23A 2K47A 4KX6B 1HNWM 3AV8A 2BS3B 5C3JB 2LH0A 3PO0A 3PFIA 2BTWB 4GRIA 1DGJA 3AEAB 4YXDB 5FKAC 5BMHA 4YY3M 3W30A 2ZBKB 3MFGA 4MT5A 4IBJA 3L28A 4DV6M 2GB1A 1Z5CA 1HNXM 1MPEA 5JI3E 1IUEA 1Z5AA 1GL6A 1XXHA 1MI0A 2OHFA 1L6VA 2YNMD 5JZEA 4OW0A 4A6QA 5EZSA 3GPYA 3MP2A 1N34M 1CJEA 4LZZA 3VK8A 3NVZA 4NOOB 1XCQL 2M5ZA 3SYLA 3U2SC 2XNAC 3UZUA 1MHXA 1SE2A 1JCKB 1EWCA 4G6ZA 1PYWD 3T3OA 2QEJC 4M9ZA 2QCUA 3U60A 1KYIA 2BTEA 2XN9C 5EJCA 3KSXA 4PD2A 1UM8A 1SEBD 5LNK1 4HXDB 5A2QS 4HL4A 1HZ6A 1VDVA 1JR3D 1L0YB 2R62A 3KDSE 1PUTA 3VR9B 4TMAB 3K1JA 4N59A 2B76B 4DV2M 4NSOB 3ZJUA 4CQNA 1GKIA 5BMGA 1DKIA 1EE8A 4IBGA 2CJNA 4AW4A 4NXNM 3UMMA 2PVOD 3PHUA 1P7EA 1N32M 3R8FA 3JR5A 3EIEA 2X4AA 1SF0A 2BBCA 2KWDA 4ITKA 1EU4A 2J42A 1BMLC 3FUTA 1E6EB 2WNMA 1FNVA 3U60B 3HHXA 3T3NA 3LVWA 4LF5M 4MI7A 2KQ4X 3P1MA 3W31A 4B0MA 1TY2A 2I7PA 1XNQM 2WP9B 1I4HA 4MH0E 3P4QB 4XWWA 3BK2A 1YUBA 1G3IA 5KPRA 1PFDA 3UK6A 2LHDA 2TSSA 3SHFA 3U6OA 5EE9A 4MB7A 3MTVA 2LFIA 1XXGA 3K8ZA 1TH3A 1XF5L 3HUIA 1E9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6J A;  5KO3 A;  4WUR A;  4P16 A;  4OVZ B;  4RNA A;  4OVZ A;  4OW0 A;  4RF1 A;  4R3D A;  4RF0 A;  3MP2 A;  4M0W A;  3E9S A;  4REZ A;  2FE8 A;  3MJ5 A;  4PT5 A;  4MM3 B; 
#chains in the Genus database with same CATH topology
 3AUL A;  1FJG M;  4HCN B;  3APF A;  2B3T A;  1ZMU A;  5L95 C;  4Z6Y A;  3EHV A;  3ZDM C;  3H8C A;  4A3V B;  2FFJ A;  2N7E A;  1DF0 A;  1MIR A;  1WXV A;  1H8C A;  4KKI A;  1IBX A;  3ENE A;  3IG5 A;  2DZI A;  2MJD A;  2DJF B;  2LNH C;  2BWE A;  1EWO A;  4NNJ B;  2L05 A;  3NRZ A;  2M56 B;  2K1F A;  1AWD A;  2NS5 A;  4LNN A;  2L7H A;  4YSX B;  4JE3 B;  3FIL A;  2M8S A;  5D3D A;  3BB7 A;  1QAQ A;  1PJS A;  4IBB A;  3PHW B;  5AZH A;  2O2V B;  2F1G A;  2UUC M;  3KS8 A;  3WAM A;  1EWL A;  3GPP A;  2JWZ A;  2H7J A;  1NL6 A;  2CHQ A;  3SAW A;  1FNW A;  2C5L C;  2CUZ A;  3EIH A;  4KGT A;  2Y0Q A;  4YYQ A;  2DCD A;  3I57 A;  2FCS A;  4GDL B;  3AEB B;  4BPV A;  3CGW A;  1GG3 A;  2WZJ A;  3UGB B;  3LJ3 A;  3CF2 A;  2EKF A;  3M3J A;  4ZRQ A;  2OP3 A;  2PRE A;  4GKK M;  2R45 A;  3QAU A;  2IJ0 A;  1F9J A;  2N1W A;  5HG2 A;  2RRU A;  2YEP B;  4I07 A;  1QMY A;  1DGB A;  4G3X B;  3CST A;  4CO7 A;  3VTV A;  1C79 A;  4KHP M;  4XWT A;  1C78 A;  3K24 A;  1YK8 A;  1UWM A;  3PRZ A;  7PCK A;  4HK2 A;  2A4Z A;  1IBX B;  2R4J A;  2PKO A;  2HTM E;  1ZAE A;  4IDI A;  3D8L A;  4F7Z A;  2O5R A;  5FTM A;  1F1H A;  4ZUX U;  2SEB D;  3TNX A;  4WWN A;  1ISN A;  4PS3 A;  3M95 A;  5KHO A;  2GI9 A;  2WU2 B;  1SSN A;  2KAC A;  1K8R B;  5JH3 A;  1MEG A;  1OQY A;  1DYQ A;  3PHX B;  4WW0 A;  1TF0 B;  2QBY B;  3Q8B A;  4FHK A;  2ZPN A;  1HTO A;  4ANU A;  3B89 A;  5DYI A;  1D5X C;  1XCT L;  3AEC B;  2MJ3 A;  4LJ7 A;  1GC6 A;  3ZNI D;  4UDU C;  1HNZ M;  2UUA M;  1KJT A;  4LF8 M;  1ZDX A;  2B1N A;  5JHB A;  2CV1 A;  3T8M A;  3DHI C;  3P4P B;  1GAB A;  2G5G X;  3D8B A;  2JNH A;  2LWX A;  1N75 A;  2YVC A;  4L6V 6;  1L6U A;  3GO8 A;  4EUT A;  2D7G A;  4YHH M;  4LF6 M;  1WH3 A;  2Y5B A;  2KHW B;  3RI7 C;  2GRI A;  2C98 A;  5DPR A;  2JWU A;  3LQQ A;  3PRE A;  1L8Q A;  4PP1 A;  4GC5 A;  2XF3 A;  3V76 A;  1R2Z A;  2DZY A;  4P1C C;  2WXM A;  3GS2 A;  4L8R C;  1H4R A;  2DOS A;  2DYO A;  2H88 B;  1CK1 A;  1AYF A;  1FPY A;  5F02 A;  1IXS A;  3QYE A;  2KNV A;  5GKN A;  1E0Z A;  2DEN A;  3ZNH A;  1I4X A;  3B7N A;  1C3T A;  3PVL A;  2KLC A;  3GE3 C;  1YD8 U;  4W9I A;  1ZV1 A;  4LJ4 A;  2XSZ D;  5H8Y E;  5FLX S;  4EFO A;  1J7A A;  1MX0 A;  3HKP A;  1IPG A;  1YQ3 B;  3HHA A;  4QOZ C;  2V1U A;  1RWS A;  4WAA A;  4JI0 M;  4FJY A;  3J27 B;  3IG8 A;  1SGH A;  3GRU A;  1C76 A;  2IO1 B;  2JQR B;  2ZNV B;  3ZNZ B;  4D8I A;  1DOI A;  4G54 A;  5E26 A;  3NJT A;  3MHS A;  1KM7 A;  3UJN A;  1YN3 A;  3ZDT A;  2H5X A;  1WYG A;  2E6X A;  1KLV A;  2DHY A;  3MMP A;  4P1B C;  1STF E;  1Q10 A;  2Y5B B;  3NVW A;  3ZJT A;  1KLU D;  4IUM A;  4WA6 A;  3CIR B;  2MSE D;  3C0R B;  4K3B A;  1LV7 A;  1VEG A;  2XFT A;  4M02 A;  2DAK A;  4AZF A;  4B95 A;  4IWO A;  2KN5 A;  3PRM A;  1EF5 A;  2O6V D;  3BYT B;  1AU3 A;  4B3S M;  3OAW A;  3H6S A;  4I5S A;  1WGH A;  4K7W A;  2QIE B;  1BGO A;  1QOF A;  1P3Q Q;  1IXS B;  3RYT A;  4KZ0 A;  5AUI A;  3RE8 A;  2MLB A;  1CS8 A;  4MDK E;  4JI4 M;  1TKE A;  1V81 A;  2JYE A;  3VQI A;  1HA5 A;  1TS3 A;  3MHH A;  1W5S A;  1QT9 A;  3M0E A;  4C4V A;  4W9C A;  2QJL A;  4XK8 F;  1K3X A;  1J7B A;  1XT9 B;  1V86 A;  2ZW0 A;  3MC0 B;  2OOA A;  2LTU A;  2ZVN A;  3AOE C;  1E32 A;  3Q2A C;  1D3Z A;  1PPN A;  3IV2 A;  2XLJ A;  4OEM A;  1YX5 B;  2L1A A;  2BYF A;  4GH9 A;  3UGJ A;  3B2G A;  2MH8 A;  1T0Y A;  4WP2 A;  1JWA D;  1Z2M A;  1XNR M;  1WXA A;  4IG7 B;  5E6N A;  4YT0 B;  5CVN B;  1G71 A;  2NTS A;  4AQY M;  3MTN A;  2WQY B;  3DCG A;  3DVG Y;  1IY1 A;  2V1C A;  1NJF A;  3Q8G A;  3USV A;  5HKH A;  1FFU A;  2XK5 B;  5EGW A;  2FBW B;  2G1E A;  3AE6 B;  3AU4 A;  3DOW A;  2BYT A;  1WGG A;  1L0V B;  1V9J A;  5HHD G;  2XZU A;  1G8P A;  3GRY A;  1HEZ E;  2KN4 A;  1WFY A;  5IAA C;  4DMY A;  3OIS A;  3GP1 A;  4RF0 A;  4IW0 A;  1SJE D;  1IXZ A;  2FUD A;  4AG5 A;  2JZ0 A;  1U9W A;  2DCC A;  4IBD A;  3I4V A;  4GIV A;  1VD2 A;  3TEW A;  1YE9 A;  3FRH A;  1IFY A;  2WHI A;  3Q8A A;  4GIP A;  4LG2 A;  1NY5 A;  1F2R C;  4AJY B;  3KUD B;  1V5O A;  1PPD A;  1HQY E;  3ABV B;  2JSV X;  3JW0 X;  3TRK A;  3KKU A;  2RKO A;  2MP2 A;  2EUC A;  2A5Y B;  3AOG A;  4FCV A;  2CHX A;  2OED A;  2AUX A;  4OHJ A;  4BVU C;  4KKJ A;  1SIF A;  3OLM D;  2XU5 A;  3LQR A;  1UKF A;  1YLA A;  4BB9 A;  1VZ8 A;  2HXZ A;  3BPF A;  5AZF A;  4LRS A;  2KK8 A;  3AEG B;  3RZF A;  4ICU A;  4OX9 M;  5C2T B;  2OUL A;  4G4N A;  1AAR A;  1HT1 E;  2D7H A;  3GP7 A;  3GQ5 A;  3BVZ A;  4PK1 A;  4D8B A;  1FIQ A;  1P9D U;  4AS1 A;  2W55 A;  2OQ4 A;  3ILK A;  2K9X A;  2KLG A;  1L2N A;  3P5V A;  8PCH A;  2N9L A;  2RD0 A;  2AQ2 B;  4WJN A;  3EUB 2;  1VZ6 A;  2D11 A;  1EF1 A;  4IBE A;  4FCW A;  4AOF A;  5G2N A;  3CTW B;  1YQB A;  3IMA A;  4OVZ A;  1U9V A;  1PBH A;  3BIN A;  3BXW A;  3UI3 A;  3KS4 A;  3U61 A;  3H9D A;  2IDY A;  5I4D A;  2LVQ A;  2C9O A;  1YJI A;  3W0L B;  2Z4S A;  2DLB A;  2KWV B;  2J0K A;  2MP2 B;  3V60 A;  4XGA B;  5J18 A;  1S4V A;  1V8C A;  1ENF A;  1X37 A;  2C9C A;  3U7D A;  3AEE B;  3H7S A;  5JHA A;  1V5T A;  4LFA M;  2UXC M;  1SJH D;  3JSV A;  1TL9 A;  2RGF A;  4JLC A;  2QHO A;  3OWE B;  4EE2 A;  2Z84 A;  3NZS A;  4WJP A;  4II2 B;  2WXR A;  2G45 B;  3FTD A;  3TIX A;  2CS4 A;  3PTF C;  3P4R B;  1PPO A;  2CHZ A;  1YZB A;  3KXE C;  2R9F A;  1SP4 B;  3CBK A;  2WS3 B;  4JPS A;  4P17 A;  2UZJ A;  1WGK A;  4BQV A;  1L7Y A;  1VCB A;  1XB2 B;  3B79 A;  2LGI A;  2ACZ B;  4AG6 A;  1TDZ A;  1JML A;  3L16 A;  2KJR A;  4MGY E;  1K3W A;  1TH4 A;  2P5T A;  2N1V A;  3N3K B;  3PNV A;  2M4N A;  3TCA A;  4R3D A;  1V92 A;  3U8Z A;  1G59 A;  4KO8 A;  1OQR A;  2LRU A;  3AI5 A;  5IP4 D;  2B1M A;  5EXT A;  2R2Q A;  1ESF A;  2DI0 A;  2X8A A;  3NBI A;  4XR7 A;  3U5Z B;  2FH0 A;  3GLF A;  4CYE A;  2KW0 A;  4Q7J A;  2L52 A;  4NZL B;  4LDT D;  2M1M A;  4HVB A;  3O65 A;  2FTD A;  3J7B A;  2LGX A;  2MJE A;  3CF6 E;  2QIL A;  3OVX A;  3QAQ A;  3CWI A;  2JRH A;  3DDC B;  3HM6 X;  3KWL A;  3ML9 A;  4KSK C;  1PGX A;  1WRD B;  4M8N A;  3MHV C;  1LGR A;  2ZAM A;  1PGY A;  2LVP A;  1I4G A;  3RCZ A;  2OPF A;  2E00 A;  2HDE A;  1CB5 A;  1OFF A;  1SBB B;  1YJJ A;  2FID A;  2PMV A;  5EE0 A;  3RNV A;  3S3Q A;  4O1N A;  3TEZ A;  3BCN A;  1WX7 A;  1C1K A;  3MC8 A;  1WGN A;  4JI3 M;  1ZW7 A;  2JPH A;  2V4L A;  3N30 A;  3QQ8 B;  2JY5 A;  2ERC A;  2DBY A;  4PYU A;  2JQG R;  3VUW A;  2LGD A;  4ZPX A;  1QVR A;  2DZO B;  2RPV A;  2UWQ A;  3A9J A;  1DGH A;  1CVZ A;  4XC2 A;  1QYR A;  4RGO S;  3VRB B;  4DR1 M;  3O0U A;  5GMV A;  4GDK B;  3GLI A;  4M0W A;  1SE3 A;  3TBL D;  1QAN A;  1JRU A;  1TZO A;  2DKL A;  4MEM A;  3PRP B;  3KVW A;  1GJT A;  4DV5 M;  1RM6 C;  1HUC B;  1JRP A;  1GNU A;  4W9E A;  2NBV B;  2WSE F;  3KQ4 A;  5G55 A;  4BKT A;  3LVV A;  2QNJ A;  2J7Q A;  1JAL A;  1R2Y A;  5FTJ A;  3BII D;  2IY1 B;  2G6D A;  2KTF A;  1QDQ A;  3U4E G;  1GMY A;  3TMP A;  1MVK A;  4N9F 4;  1TTN A;  1QIL A;  3H4J A;  4A20 A;  3R3M A;  3K9P A;  4QNR A;  3LB8 C;  1IN7 A;  4W5W A;  1Q39 A;  1D6E C;  1JWU D;  4X6J A;  2Z7J A;  2G7Y A;  4G3O A;  4MEL A;  2J7O A;  1FM0 D;  3DA1 A;  1KF6 B;  2Y3A A;  5H92 C;  3VHT C;  4LFC M;  1WZ3 A;  3LDZ E;  3J2P B;  2ARY A;  4QBB A;  2FCM A;  3U6L A;  5HFY A;  3ZJV A;  1I7H A;  2C7N B;  4EIW A;  2DAI A;  3H8B A;  1NNU C;  3HHM A;  3L54 A;  4GU2 A;  1G4A E;  3QJZ A;  4P6E A;  2CFO A;  2WXP A;  3H7P A;  4M0W B;  3T9L A;  1K50 A;  3H89 A;  3GQ3 A;  3B9P A;  4YWG G;  2N35 A;  3SC3 A;  1NI2 A;  2KMM A;  1T5X D;  1F2A A;  3L08 A;  1M94 A;  4EKU A;  2W54 A;  1I4R A;  3KYC D;  3AFH A;  5IA7 A;  1JQJ C;  2F5P A;  2WSF F;  3R8B A;  1X1M A;  4HKZ E;  3FKY A;  3V6C B;  5FTN A;  1WWT A;  4YTP B;  2INN E;  3KUC B;  3VDZ A;  1N77 A;  4MSX A;  2IPP B;  3H4M A;  2Q5W D;  4PI3 A;  3LXS A;  3TMP B;  3HHI A;  3VRA B;  1FNN A;  3KOX E;  2BB6 A;  3U30 A;  4X62 M;  3NY5 A;  4DV4 M;  2IPK D;  1PAD A;  2LD9 A;  3EGR A;  3NS1 A;  3QJ3 A;  3PZ7 A;  2J5Y A;  1OQQ A;  4D80 A;  2K6D B;  2X38 A;  4BFR A;  3PZ8 A;  1J7C A;  3PGE A;  3RVV A;  3UQB A;  4PAD A;  4WQM A;  3T1H M;  1F77 A;  3EC8 A;  3R2T A;  4KDI C;  3N9Y C;  2JZ1 A;  5DFL A;  5E6J A;  2ATO A;  1ZDV A;  4AJW A;  5IO9 A;  3VH3 B;  2KX0 A;  2ON8 A;  2VH1 A;  2L3Z A;  3NS8 A;  3RFW A;  4JWU C;  3AI8 A;  1IN5 A;  1GCB A;  2EJS A;  3ONS A;  2GBN A;  2DX5 B;  1B1Z A;  4HLE A;  3U6C A;  2NBW B;  1C4C A;  2XZF A;  1AU0 A;  2DVW B;  4GSW A;  1E5W A;  1EWY C;  1IN8 A;  1BP4 A;  4HCP B;  1XXH B;  2HCB A;  2ZJD A;  4X6H A;  2WXH A;  1BXT A;  4FWH A;  2LUE A;  2LRW A;  3MOR A;  5JZE B;  4NQK E;  2ONQ A;  3GOE A;  2N0S B;  3B0A A;  4FCT A;  3GLH A;  2PIA A;  2PAD A;  1R6B X;  2AQ1 B;  2JXX A;  1NHW C;  3GLI E;  4ANX A;  1N33 M;  2HD5 B;  2KTR B;  4RF1 A;  1NEN B;  4OVV A;  3ETR A;  4S0R A;  4XZ4 A;  1FCL A;  1L1T A;  2J52 A;  3NG0 A;  3K9M A;  1IXR C;  3N32 A;  1TJE A;  2DYB A;  1V1P A;  2Y5P A;  3GPU A;  4KIK A;  3KUZ A;  4LJO B;  2NQI A;  4BOS A;  4IIW A;  2R46 A;  3FKE A;  2BKF A;  1EIJ A;  3I06 A;  2PPH A;  1PJI A;  1WE6 A;  3FAH A;  4FXC A;  5J17 A;  3SAS A;  4KGS A;  2MH7 A;  2AYN A;  3M7G A;  4B3R M;  3BC3 A;  2INC C;  3KW5 B;  1FRD A;  2I38 A;  4K1R B;  1V97 A;  2DWN A;  2P7U A;  2Y6E A;  2N4F A;  1KLG D;  1VEK A;  1WMH B;  1WGY A;  1ZOY B;  3IBE A;  2HHH M;  1QF6 A;  1CQV A;  2UUB M;  1XMO M;  3L29 A;  2IO2 B;  1WSP A;  2OJR A;  3RGS A;  4MJS A;  2G4S A;  3UIP B;  3I3T A;  2KT7 A;  4WH4 A;  5CHW A;  4BOS C;  1I4P A;  2WDV B;  2CE7 A;  2DWL A;  2D07 B;  1HQR D;  1WYW B;  3RPF C;  3ZC7 B;  2MRO B;  5BYR A;  1D0L A;  5CTR C;  6PAD A;  1MHH E;  1ZGU B;  3I4Y A;  2EKE C;  2RDH A;  2LAS A;  1XD3 B;  4CJ6 A;  3OQC A;  3EFU A;  2MBQ A;  2PE9 A;  2R9C A;  1IBK M;  1R4M I;  1J0G A;  3MHZ A;  2RDG A;  2QEN A;  1K52 A;  4DR2 M;  1TR8 A;  5IN7 A;  1OAI A;  2BT6 A;  3DOA A;  4BKG A;  4KIK B;  2K0B X;  3CH3 X;  2ICI A;  4IP3 A;  1YN5 A;  3W5V B;  1XXH E;  3TL4 X;  2BS2 B;  1YVB A;  4W9K A;  2V0G A;  1U4A A;  3KSJ A;  1WJU A;  3DBR I;  2JRI A;  2R9M A;  4DHZ E;  3B7Z A;  4N4Z A;  3WHL A;  4KOD A;  1JRO A;  3PNY A;  1QOB A;  4ZYS A;  1GPX A;  3DZD A;  2XGN A;  1RAX A;  3H7D A;  3C9P A;  2KHH A;  4DR4 M;  3VLF B;  2E02 A;  4CZW A;  3FTE A;  1K53 A;  4OZC A;  2IO3 B;  1IWD A;  1JQ4 A;  1RFK A;  3NWL A;  4KGR A;  4M01 A;  2BJV A;  3TE6 A;  2R44 A;  1KHP A;  1QXP A;  4MJS B;  4II7 A;  4D81 A;  2CKH B;  3AED B;  4PDG A;  2YLM A;  1VJV A;  2KC1 A;  1KOT A;  3JYU A;  4K0K M;  1CQD A;  2D5G A;  2BKR B;  2LWP A;  1VEJ A;  2L00 B;  2J7N A;  2WXQ A;  1T6O A;  4IM3 A;  2Z0D B;  4LJ6 A;  3HY5 A;  1TYG B;  3B74 A;  2L6O A;  2JZP A;  2E03 A;  3Q8E A;  1Q02 A;  2NPT B;  1AIM A;  2CU3 A;  3B2F A;  5LLI A;  4TUU A;  1OIP A;  1WGL A;  4LNK A;  3FUW A;  4DXA B;  2KFK B;  4Y28 F;  4DV3 M;  3GQ4 A;  5F3W A;  2NQG A;  1IBL M;  1KFV A;  3OF9 A;  1IY0 A;  2KYW A;  4TQ1 A;  4MZO A;  2R6F A;  1F4I A;  1NDD A;  4GMQ A;  2PNS A;  9PAP A;  4DDI D;  3K8U A;  2R0I A;  2WX1 A;  1OJL A;  4J3O D;  4W9H A;  3GLH E;  2G8J A;  2P86 A;  4DUY M;  4LK0 M;  4YYW A;  4W5B A;  3NVY A;  3A42 A;  3RNE C;  3E46 A;  2KXE A;  1MDW A;  1QAO A;  3GRV A;  3Q3O C;  5EDS A;  4YVA A;  2GBR A;  2QZ4 A;  4W5C A;  2VQE M;  3FIL B;  4YV8 A;  1L2C A;  2C99 A;  2DWZ B;  4L15 A;  3PPA A;  3QAR A;  2WLB A;  2AX5 A;  3SR6 A;  3GE8 C;  2JY7 A;  5IRE B;  4JI8 M;  4HLQ A;  1UD7 A;  1VQ1 A;  2LUM A;  3FYC A;  3BYY B;  3N20 C;  4C7Y A;  3IOQ A;  2DWQ A;  4WAF A;  3DBL I;  1BT0 A;  4HDQ A;  3SYK A;  3S2A A;  2YJ8 A;  3PXG A;  4PS7 A;  3ZXR A;  5E6P A;  1WR1 A;  2CHV A;  3VK7 A;  2KDM A;  3DWG C;  2VF8 A;  1EFU B;  4D82 A;  2EA0 A;  3W67 A;  2V3N A;  2C9W B;  4KT0 F;  3UIN B;  1UBQ A;  4FJC A;  1JR3 A;  4FHJ A;  4P6V F;  3PNR A;  1ATK A;  1LFD A;  2IZV B;  1S3S G;  2K0P A;  3NOB A;  4DR5 M;  3KVF B;  1FEH A;  3JAM S;  2Z4R A;  1J09 A;  2FE8 A;  1K82 A;  2XU1 A;  4XX5 A;  1QOA A;  2WYQ A;  3DBR B;  4RM9 A;  1C4A A;  2MHJ A;  4GOC A;  2LVQ D;  3PW3 A;  4LLG M;  1GEC E;  2JF5 A;  3FUV A;  2D10 A;  3K2L A;  5BYQ A;  3TJP A;  2LMC A;  3W2D A;  3FYD A;  3DF0 A;  3SMP A;  2VQF M;  3LFY A;  4UN2 B;  4WJO A;  3R7Q A;  4GB9 A;  4RGM A;  3FTF A;  4XBO A;  5CX3 A;  4BKS A;  2FNA A;  4B7F A;  1E9M A;  4BLC A;  1A5T A;  1GL7 A;  2WXI A;  1ZQ9 A;  4XDD A;  4LGY A;  2MBE A;  1QOG A;  1D4B A;  3BBZ A;  2RSU A;  1OTR A;  1M4V A;  2IGG A;  2KNB A;  1CV8 A;  2Z8L A;  3T6P A;  3ZQ4 A;  3RNB C;  4G4Q A;  4P16 A;  1XKG A;  2G3Q A;  2JXN A;  4MGZ E;  2K22 A;  3JVZ X;  2BDZ A;  2BJW A;  2WSC F;  2DC7 A;  5IWA M;  2WWZ A;  4A90 A;  3N4C A;  3QK0 A;  1HQC A;  2YJC A;  2JY6 A;  3CBJ A;  1DOX A;  4ZHP A;  2R18 A;  1YT7 A;  1XO3 A;  4M9X A;  3AKZ A;  2UU7 A;  4B9K A;  3P4S B;  1H6U A;  1QUT A;  5C23 A;  3OJ4 B;  2W82 A;  2K6Q A;  3ZO5 B;  1L1Z A;  2DC8 A;  3DPD A;  1VDD A;  2ZAN A;  4LF7 M;  1EM7 A;  2KRK A;  2WDT B;  4JI5 M;  3A1Q A;  4M0D A;  3O13 A;  2D3C A;  3APD A;  1TBE A;  3DVG X;  1Z6T A;  4QNM A;  4I05 A;  5D94 A;  2DEN B;  2DZK A;  2KO3 A;  1PE6 A;  3VKG A;  3ZNH B;  3HZJ A;  1XLO A;  4HRO A;  5EXS A;  4PP2 E;  1RFA A;  3AE1 B;  5KQ8 A;  1TDH A;  4TV3 A;  1E7V A;  5KPZ A;  4G4O A;  2HJ1 A;  4EEW A;  2KNA A;  5BPV A;  5TSS A;  4DV0 M;  1ZCM A;  2K9D A;  4TSS A;  4BBN F;  4BSQ A;  2D2Q A;  4N8W A;  2LXE A;  1YK7 A;  1HZ5 A;  4W9F A;  1PGA A;  1HT2 E;  4GHA A;  3HVD A;  2CIO A;  4AI6 A;  4GEW A;  4IUM B;  4FVM A;  2KC2 A;  3PV1 A;  2JQF R;  1T0Q C;  2EKI A;  3L0W B;  3PRM B;  1OFI A;  3AM9 A;  5KHQ A;  4CIS A;  4IWQ A;  2BW2 A;  5CHT A;  1ORY B;  1C9F A;  2DNF A;  4NC6 A;  4DV1 M;  4DBG A;  3VUX A;  2KFJ A;  2QC8 A;  2L0T A;  4OU7 A;  3ZH9 B;  2E3T A;  5D7G A;  2VDB B;  1QAM A;  1HE8 A;  3Q8X A;  1PJJ A;  1EUV B;  3RUI B;  3PVS A;  1ZE3 D;  3AB5 A;  3VAW A;  4C4V B;  2Y5C A;  2WXO A;  5EP4 A;  1SXJ A;  2JP7 A;  5KQD A;  2C7M B;  1JR3 E;  3TWK A;  4CDD B;  3HGI A;  1AYW A;  1FO4 A;  3ZRC A;  1UEL A;  2FUH B;  2NR2 A;  1PPP A;  1GOZ A;  2X49 A;  1QOL A;  1CZP A;  1NBF C;  3BZD B;  2DC9 A;  4J6I A;  1L0X B;  4NAM A;  5BR8 M;  2JTC A;  1NQC A;  3MTN B;  3GZN I;  2CV0 A;  3Q6B A;  1SB3 C;  1J5E M;  3AE5 B;  3HRD D;  3TPZ A;  3VDU A;  5IT9 S;  3QT4 A;  3KW9 A;  3IHP A;  2JXT A;  4JX1 C;  4YSY B;  1IM2 A;  1NY6 A;  1NNJ A;  4RKU F;  1SXJ C;  5C1Z A;  5EXX A;  3VVW B;  2L7I A;  5EP3 A;  3KOY E;  1CTE A;  1WY8 A;  4DBG B;  2EEL A;  4WIP A;  2ACT A;  3ML8 A;  1S1Q B;  4A55 A;  2LVO A;  3KP1 E;  3LCU A;  3IT4 B;  4JQW C;  3QX1 A;  3L13 A;  2WDR B;  2O01 F;  2AQ3 B;  4BOZ A;  3KOW E;  1JQP A;  4AXM A;  1SXJ B;  4IBC A;  1E7P B;  4F8C B;  1ZUD 2;  1CSB B;  2V9H A;  4K3C A;  1PVJ A;  2JUJ A;  4LTU A;  1WM2 A;  1V2Y A;  1NYQ A;  3KYD D;  2E5L M;  4TKN A;  3PBH A;  3RUL A;  2C7H A;  3DQV A;  4L2Y A;  1V6E A;  2FO5 A;  3HWS A;  3Q8F A;  3VXW A;  1WIA A;  1JW9 D;  2W3R A;  4XYC A;  1RYJ A;  1AUA A;  1WF9 A;  2LVO C;  5AEK B;  2ZZP B;  1XC8 A;  1KSF X;  1QZM A;  2CP8 A;  4ZRI A;  5IZ7 D;  1T43 A;  1R5L A;  1P7F A;  2NVU I;  3QIJ A;  3HJQ A;  4MM3 A;  1BUI C;  1FD6 A;  3KX1 A;  1N60 A;  4OVZ B;  1XEE A;  3GB1 A;  2XSZ A;  4US9 A;  4WJQ A;  3U61 B;  1L2D A;  4IOI E;  4Z8X A;  3AN1 A;  3GPX A;  3SAV A;  1NYR A;  4RCO A;  3P42 A;  4YYR A;  2QPA A;  3RNC C;  2EKK A;  3WIM A;  4R71 A;  4BBN C;  1R7R A;  4LNO A;  1PDX A;  2D7E A;  4WQO B;  4LZJ A;  4FJV B;  4PT5 A;  4B7H A;  4MSQ B;  2CHW A;  1KFX L;  2DZZ A;  1EO6 A;  1QDR A;  3ALB A;  2BWB A;  2KZS A;  1L5P A;  5MPO A;  3JSV B;  4HWY A;  5IKC M;  1PJQ A;  2QHO B;  4DV7 M;  5E6O A;  1AYU A;  2XFS A;  4ICV A;  3THG A;  4LRT A;  2RGH A;  3PT2 A;  2O6V A;  4IBI A;  5ITX A;  4GKJ M;  3OG5 A;  2VZK B;  5EP1 A;  1E94 E;  3AE7 B;  3N1Z C;  2FQ9 A;  4GUA A;  3IVF A;  1UGJ A;  4REZ A;  1V49 A;  2LHE A;  3I51 A;  2X8X X;  4NJ7 A;  2NQD B;  4MM3 B;  4MGH A;  3WAL A;  1SXJ E;  1NO1 A;  2L2D A;  4B08 A;  1WXQ A;  1NI3 A;  2EMS A;  3QYB A;  2AUZ A;  3B21 A;  1A70 A;  1QLB B;  5DYG A;  2MJ5 B;  5EP2 A;  2MW5 A;  2IO0 B;  2ZTC A;  4BBA A;  1GB4 A;  1NEK B;  1IBM M;  3RD2 A;  4ZRJ A;  4B0E A;  2OOB A;  2MA9 B;  1VJK A;  1ACC A;  1Q0W B;  3AV0 A;  3TSS A;  3D32 A;  2LVP C;  1OGW A;  3HIZ A;  4HPL B;  4C56 C;  3LYY A;  4BS5 A;  2LXC A;  3KLS X;  3GLF B;  2LHG A;  4S17 A;  3RNG C;  3VTU A;  4NPN A;  2FRQ A;  2L76 A;  3O65 B;  4FA6 A;  1VRA B;  1UFZ A;  1Q3B A;  2KVR A;  3IXS A;  1U5I A;  2YFQ A;  1AIP C;  5L8R F;  4X65 M;  2XU3 A;  3AJI B;  2QSD A;  2BTW A;  3PT2 B;  2XH9 A;  1VZ7 A;  5TR5 A;  4NL4 H;  3MK6 A;  1UBI A;  3AEF B;  1F52 A;  5GXG B;  4FN2 A;  4A9A A;  3TWL A;  1WIV A;  3SFZ A;  2PBH A;  5LMN M;  2D3A A;  2LHC A;  1NHG C;  1NVM A;  1YN4 A;  2MEK A;  2AS8 A;  2AVW A;  1I94 M;  1XMQ M;  3AL0 C;  2AHM A;  1PCI A;  2DJG B;  3F75 A;  4X6I A;  2RPQ A;  3HU1 A;  3X23 A;  1Y8G A;  3T38 A;  1WI0 A;  3A9J B;  4LFB M;  4W9D A;  4IM2 A;  1DGH B;  1Q5W B;  3SEB A;  2CJO A;  2J7Q C;  2NCN A;  1T6B X;  1LM8 B;  4DUZ M;  1SXT A;  1E90 A;  5A24 A;  4YTM B;  3GLI B;  3M62 B;  2KMA A;  1YSY A;  2KQS A;  2YJB A;  5EXP A;  4OZB A;  5PAD A;  2HKJ A;  2ZW1 A;  3ECI A;  3J7A S;  4AUQ C;  1KFU L;  2A5U A;  2LVN C;  1AU4 A;  2IYD B;  3KW6 A;  3JR4 A;  3BWU D;  3L10 B;  2KQ7 A;  1SIJ A;  3SFE B;  4MH8 A;  3KFQ A;  2FAZ A;  2J7Q B;  3NZU A;  3GRR A;  1JWM D;  2Y21 A;  1RU3 A;  1KH0 A;  1AW7 A;  1N61 A;  3ZIM A;  4ANW A;  1U9X A;  3IEJ A;  4KLN A;  2XEW A;  2I7N A;  5CHF A;  4FWG A;  1NSF A;  2RMM A;  3K9P B;  4XUI A;  3K9O A;  3BWK A;  3H1U A;  1FNU A;  1L4Z B;  2J53 A;  2KDE B;  4EZL A;  3GLF E;  2K39 A;  2BQQ A;  5FR6 A;  1X9Y A;  1GVN A;  3BY4 A;  3F92 A;  3PSE A;  3VUY A;  2HWK A;  2JZ3 B;  4L16 A;  1GAQ B;  4HXD A;  1S3S A;  2N9P C;  3ZTC A;  1CMX B;  1ITO A;  1C77 A;  5BO4 B;  5ITQ A;  3HU3 A;  5ITX E;  3ZCB B;  3P63 A;  4WWM A;  5G5H A;  5JXV A;  1ZKH A;  3L27 A;  3H7P B;  4HJG E;  2UU9 M;  4FD2 A;  1TKG A;  5EF4 A;  3VR8 B;  4CIZ A;  3C19 A;  3ZUA A;  1YX6 B;  3AXC A;  1UNS A;  3EA6 A;  1UGM A;  4M8M A;  4ITQ A;  2W3S A;  3I63 C;  3OF8 A;  3V6E A;  2INP E;  3HHY A;  2WXK A;  3ZGZ A;  5CVO B;  1F2B A;  4KVG B;  3ERV A;  5AUK A;  2O25 A;  1QQW A;  1XLQ A;  3B1L X;  1JWS D;  2HWJ A;  4G11 A;  4WWP A;  3MJ5 A;  1KRH A;  2ASQ A;  5FSW A;  3EFC A;  2KZR A;  5G5G A;  4TQ0 A;  3RMK C;  4ARI A;  1P98 A;  5JH5 C;  4DHZ B;  5JI2 E;  2L83 A;  2GQF A;  4QHT A;  4LF9 M;  2KDB A;  2YEP F;  2BDL A;  4F1I A;  2JU6 X;  3ZKJ C;  3IFU A;  3K9O B;  4FAD A;  1MEM A;  1STE A;  5AZG A;  2V4I B;  2MRP A;  2RDB C;  1LTM A;  3GLG A;  5D6J B;  4YL8 A;  2MR9 A;  2F5Q A;  3A9K A;  3MC9 A;  1N36 M;  4RFB A;  3M99 A;  4CDF B;  2CHG A;  4X64 M;  2WXJ A;  3BY4 B;  3PSE B;  1OIZ A;  1K51 A;  2F5N A;  2IBI A;  2WU5 B;  1TS5 A;  1WM3 A;  4NSR A;  1N6Z A;  3PLV A;  4JI2 M;  4W9L A;  3RVW A;  4PS8 A;  2KRU A;  3O1G A;  3A46 A;  2R61 A;  3I5J C;  1F2C A;  4NQL B;  3HX3 A;  2KWU B;  1TGU A;  1Y8R C;  2MX2 A;  1ROE A;  5CVM A;  2DAM A;  2QSF X;  3AE3 B;  2NMQ A;  4P7I A;  3V6E B;  5FTK A;  4QOS A;  4LJ5 A;  4ZTB A;  3VFD A;  1OKS A;  4IC7 B;  1MU5 A;  3QC8 B;  3ZTD A;  3PZD A;  3Q3J A;  4DDG D;  1GB1 A;  4HDO A;  3TWM A;  2PW9 A;  4EZK A;  3BK1 A;  3BVM A;  2PLP A;  3VFK A;  4H2A A;  1LXD A;  1TKY A;  2J4X A;  1DGF A;  2JVC A;  3U7Z A;  1EWP A;  4GGQ A;  4JXJ A;  3TQS A;  3GLH B;  1TLO A;  1NV8 A;  2H89 B;  1N78 A;  3HJ8 A;  4LCB A;  1WGD A;  4LJP B;  3GLG B;  1R4G A;  2DZN B;  1PGB A;  3A9K B;  3DBS A;  2G4D B;  2LBC A;  3HVZ A;  2HE7 A;  1MJG M;  4HPP A;  2AGA A;  2ZM6 M;  1DO0 A;  4PYZ A;  2H1R A;  4I81 A;  3SAT A;  3PLU A;  4BOP A;  3MHS D;  3A45 A;  4Q8H A;  5J94 A;  3W0F A;  1D2N A;  3W68 A;  4YYU A;  2RR9 A;  1V1P B;  3SFD B;  3IEC A;  4DXF A;  2QP9 X;  1MS6 A;  2BB5 A;  4Q2J A;  1FXI A;  3PHW A;  4ANV A;  2O2V A;  3RGP A;  1Q3C A;  2DZL A;  1TY0 A;  1WXS A;  1YQ4 B;  3IAS 1;  4FBJ B;  1DOY A;  4FJZ A;  4A5U A;  4NXM M;  1GLN A;  1CPJ A;  3HU2 A;  4LGM A;  2Z3X A;  1R7S A;  1LO5 D;  3AH7 A;  3SAU A;  4ACF A;  4G4R A;  1J8C A;  2LGS A;  3BVG A;  4AQ7 A;  4JI6 M;  2AWT A;  3R66 C;  4DR6 M;  1KTK A;  2YR0 A;  3QWL A;  3VDP A;  1THE A;  2KJH B;  4GXB A;  1P0R A;  1NLJ A;  3Q69 A;  4DR7 M;  1PXV A;  2J0M A;  1N5X A;  3I3T B;  1QZE A;  4JGH B;  1AEC A;  2Y0T A;  2DZJ A;  2KNZ A;  4LY6 A;  4C00 A;  4TUW A;  2QDF A;  3L26 A;  2WBF X;  1V1O A;  1ZPS A;  1GJS A;  4WUR A;  3WXG A;  1WR6 E;  3TEX A;  1Y08 A;  3WAP A;  3U6Q A;  1ET9 A;  3U8E A;  4HEO A;  1PM5 A;  2LZ6 A;  2F5O A;  1AN8 A;  3NZ3 A;  2I2Y A;  2WDQ B;  3CH2 X;  2M0A A;  1POP A;  3T1Y M;  2CV2 A;  4I8O A;  2JRI B;  3QCA A;  2K5P A;  4AKH A;  5BYS A;  3PHX A;  2IND C;  2QBY A;  1ZMV A;  2R65 A;  1TGZ B;  2K8C A;  5FTL A;  2GBJ A;  3U52 E;  4XGI A;  2GBM A;  2DCA A;  2J0J A;  1ZXI A;  2KX3 A;  4NAW A;  2GFO A;  1FFV A;  3GLG E;  1ET6 A;  1I35 A;  4PCZ A;  4FLH A;  1IN6 A;  1E8Z A;  2PE6 B;  2IGD A;  1VSN A;  4FK5 A;  1XHB A;  1FMA D;  4FIP A;  4MAC A;  2KEB A;  2G8E A;  1SXJ D;  3I9V 1;  3QSD A;  3C8Y A;  7CAT A;  2WXG A;  4KZC A;  1TT5 B;  3AE4 B;  2AL3 A;  3DVN V;  1XLN A;  2MCN B;  4K7S A;  3W9C B;  1TZ1 A;  1GC7 A;  4A3O A;  4X66 M;  3J9C A;  3MJW A;  4X57 B;  4I6N B;  3HHZ A;  2K3U A;  2P0R A;  4AXL A;  1VLB A;  4ZOH C;  1IGD A;  1C7Y A;  1Q1O A;  2EO2 A;  4BOQ A;  2ZCB A;  1LQB A;  4MZS A;  1JWB D;  4BOU A;  1GO5 A;  2HTH A;  3Q3N C;  4DQO C;  4D8E A;  3RVX A;  3URY A;  1E10 A;  3HD3 A;  4QRX A;  1R4M B;  1D5Z C;  3Q8C A;  4KLB A;  3BBA A;  1ZP0 B;  2F5S A;  3KSE A;  3SAR A;  3AE9 B;  3HM3 A;  4I04 A;  1J7K A;  4R7G A;  1IY2 A;  4NAW B;  3R9X B;  1D5M C;  4LNF A;  4OZA A;  4L4U A;  3V62 A;  3E4R A;  2LJI A;  4BZA A;  2Z8Y M;  1WX8 A;  2GOW A;  2N9K A;  4B7G A;  2WXN A;  3OTO M;  2FOI C;  4AKG A;  4XZX A;  4AWJ A;  3X0W A;  2BWE S;  4K7U A;  2APL A;  2L4F A;  4JI7 M;  3DBH I;  4IKG A;  1XLP A;  4OEL A;  2KDL A;  1E9S A;  3DWM A;  1HJP A;  2XEP A;  4IBF A;  2N7D A;  3L4P A;  4XDC A;  5DPS A;  4M9S A;  3C0R A;  4B3T M;  1MN3 A;  3AU5 A;  1ZIV A;  2FCQ A;  2PTL A;  1D0K A;  1WR1 B;  2IGH A;  2VZK D;  1N63 A;  3B9J A;  4KSL C;  2KAN A;  2ZNV C;  2M19 A;  1YAL A;  2C5R A;  3I01 M;  1V34 A;  1YIW A;  3TUO A;  4Q8G A;  1IN4 A;  1E8Y A;  2F4V M;  3KWB X;  1Q6K A;  1SE4 A;  2DYM A;  2L32 A;  3ZQJ A;  1EF7 A;  4P6G A;  3U6S A;  1F2R I;  5ITT A;  4HJK A;  4JV5 M;  3UQA A;  2R4E A;  3HK0 A;  3L2A A;  2ZTD A;  4F1S A;  4RGT A;  3W1S A;  1RRB A;  1E7U A;  3IT6 B;  4GLS C;  3L25 A;  5HI1 A;  2SAK A;  3P5X A;  5IOI A;  1WJ4 A;  3NHE A;  2DAJ A;  3TEY A;  3SBJ A;  1T0R C;  4GC9 A;  3NUH B;  4KDL B;  1DO2 A;  1ZMW A;  1L2B A;  2XK5 A;  2E01 A;  1PIP A;  2N9X A;  3AOE A;  1MHW A;  5H37 D;  3A4S C;  4LCD E;  4XE0 A;  1WE7 A;  5BMI A;  1JB0 F;  4JI1 M;  5ITR A;  1VR9 A;  2I1K A;  1OTR B;  1Y4H A;  3FTC A;  2ZEQ A;  2XBB C;  4ZYN A;  3W1S C;  1WJN A;  4LJA A;  3OVZ A;  2QMT A;  1MG4 A;  1CUK A;  3DBL B;  1FCC C;  2G3Q B;  4IJF A;  4S12 A;  3M63 B;  4DHJ D;  1FXA A;  3R2I A;  2JY6 B;  2NQ8 C;  1T0S C;  3LMM A;  5ITU A;  2V6Z M;  1YOV B;  1FRR A;  4OVU A;  2XU4 A;  3ZW3 A;  2DAE A;  1EWM A;  1TS2 A;  3Q3M C;  1YNT E;  3ZLZ A;  2DHZ A;  2FT2 A;  1EU3 A;  2GMI C;  3A1Q B;  4W9G A;  4BS6 A;  1E8X A;  5LXH A;  2VII A;  2FYE A;  3NHE B;  2KJ6 A;  3BOS A;  4K81 A;  3DVN U;  3CMM B;  3IFW B;  1F0Z A;  3U6E A;  5KO3 A;  2LJ5 A;  1NV9 A;  4GN1 A;  1WHC A;  1MG8 A;  2DCB A;  2KZU A;  4CGY B;  2CU1 A;  4QRV A;  1SG9 A;  4W4U A;  4FWD A;  1UZX B;  5EE3 A;  3AE2 B;  4HEA 1;  2JZZ A;  1G41 A;  3DBH B;  4QAY A;  4FW9 A;  2FUG 1;  5T8I A;  4IJE A;  1Y56 A;  1TS4 A;  1NB5 A;  3QHT A;  4AKI A;  4N58 A;  2NBU A;  5D3I B;  3DHH C;  4L1B A;  3RT3 B;  1QKZ A;  3KWZ A;  2R2O A;  2HL7 A;  8CAT A;  3J81 S;  2CEA A;  2FCN A;  3MP9 A;  4HKQ A;  1PQS A;  1P3Q U;  1B9R A;  3V05 A;  3KOZ E;  2DXI A;  3AMZ A;  1TTE A;  4DXG A;  2UXB M;  4N79 A;  3FRI A;  3CF0 A;  2JX5 A;  5KPT A;  2L0F A;  4JIO U;  1NPZ A;  4F2L A;  4PDI A;  4QH6 A;  4ZHO A;  2ZVO A;  3T15 A;  2ZCC A;  3IAM 1;  4JWS C;  2MBB B;  1OEY J;  1I4W A;  4E3C A;  4JYA M;  1N62 A;  1W5T A;  5LMU M;  2K25 A;  4FUL A;  4LJ9 A;  3N1X C;  3IHP C;  2WXL A;  3WCQ A;  4RNA A;  2IY0 B;  5C1B A;  3E21 A;  4WWO A;  1IP9 A;  1XWI A;  3SMS A;  2D3G A;  3KH0 A;  3Q3F A;  2CWB A;  3FE3 A;  3V3X A;  3N3K A;  2DWM A;  2R9O A;  3WHK A;  5DNY A;  4GIT A;  2BVC A;  2VRR B;  1NVI D;  4RM8 A;  2BYE A;  3E9S A;  2CRU A;  5DCN A;  2AYO A;  2RGO A;  1C4P A;  2OJW A;  5LXI B;  5J2R A;  1U9Q X;  1GJZ A;  2YQZ A;  3U6D A;  1DEU A;  3A98 B;  1I4Q A;  3U5Z A;  4EOY A;  1UWX A;  2D3B A;  1IYF A;  5EZQ A;  1Z5S B;  3U6P A;  3FC4 A;  2VF7 A;  5DPW A;  3VH4 B;  3WAN A;  4K7C A;  4NRV A;  3FUX A;  5EQT A;  2BS4 B;  4B6W A;  1WGR A;  2BPS A;  1YMH E;  3J80 S;  5ITY A;  1BQI A;  1P1A A;  3A33 B;  1KHQ A;  2G8L A;  2KVZ A;  1PRB A;  3WXE A;  2OZ2 A;  4JN6 A;  4RKX A;  4LJ8 A;  1T3Q A;  3LXF A;  1WX9 A;  2KAJ A;  1ME3 A;  3RNA C;  5DPT A;  4BOZ B;  1KFY B;  4NRW A;  3HWN A;  1WJ7 A;  3B08 A;  2JWS A;  4QHS A;  3QWZ B;  4LNI A;  1Z59 A;  3HJS A;  3C58 A;  3SHG B;  4JL9 A;  4US8 A;  1HR0 M;  2KD0 A;  2DHR A;  2V3P A;  5JA7 A;  2M60 A;  1T3T A;  1A5R A;  4MSM B;  3P2B A;  3E56 A;  1E8W A;  2UYZ B;  3CSF A;  3P5U A;  3AE8 B;  4ARC A;  4IBK A;  5C18 A;  2AYO B;  2LEK A;  1MFW A;  4B3M M;  1HXY D;  2JYT A;  4RMA A;  1ME4 A;  1Z5B A;  3E1Z B;  1TH2 A;  4NJ6 A;  4GDK A;  4HWI B;  1WRI A;  3DFZ A;  2AEH A;  2DNA A;  2LXA A;  2BF8 B;  3GZN B;  4G50 A;  2MWS B;  3K92 A;  3KWV A;  4QRG A;  3PDF A;  2G9H D;  3PRP A;  2NTT A;  2W9N A;  1IGC A;  1BY8 A;  3C3D A;  2BYV E;  4C7Z A;  1PJT A;  3L17 A;  1C1Y B;  4HRS A;  2UXD M;  5FR3 A;  3HHW A;  3KFU G;  3SHQ A;  2K8H A;  4GHL A;  3RFZ B;  3NVV A;  3BOW A;  3ZNG C;  2M0X A;  1L4D B;  1AU2 A;  4A8X C;  4ZRP A;  3FUU A;  2ZAO A;  1UUP A;  2C96 A;  1RLF A;  1QUS A;  4YSZ B;  4MGK E;  1TU6 A;  3KP0 E;  3FD9 A;  2KA6 B;  3H8H A;  4N6E B;  3UF8 A;  2L09 A;  2Q2E B;  1DGG A;  4LF4 M;  4CHT B;  2VHS A;  3IG3 A;  1KXR A;  4I4L A;  2NQA A;  1QDT A;  2B3A A;  2O6V B;  2BU3 A;  4USA A;  4YTN B;  2BNK A;  4C80 A;  2C0Y A;  5EE1 A;  4DR3 M;  2AL6 A;  3VKH A;  1F29 A;  3P5W A;  3VTW A;  1N5W A;  3W5U B;  4L78 A;  2K8B A;  4NJC A;  3DHG C;  4D2K A;  3EEC A;  2JA2 A;  4DHJ B;  3M6A A;  1QQR A;  3LW5 F;  2R9N A;  5FPW A;  1IQP A;  1GUA B;  1SE9 A;  2O6X A;  5FK9 C;  4RH6 A;  2Y20 A;  1VDL A;  2PVG C;  2WGS A;  2WX0 A;  4MGI E;  4RGN A;  3V6C A;  3SDL C;  1NJG A;  1OFH A;  2OOB B;  2GNO A;  1HTQ A;  1ZXH A;  2N7J A;  4G0N B;  4IM0 A;  3I04 M;  2I1J A;  2KWC A;  2QQ8 A;  2GBK A;  1D0M A;  3ZYY X;  4A3P A;  3U6M A;  3BPM A;  2WXF A;  4L23 A;  1R4N I;  2K47 A;  2L4E A;  1XQQ A;  4KX6 B;  1HNW M;  4YYV A;  3AV8 A;  1O0E A;  1FXT B;  2BS3 B;  1FH0 A;  4W9J A;  5C3J B;  2LH0 A;  4CDC B;  3PO0 A;  3PFI A;  2BTW B;  4ANR A;  4GRI A;  2FIF A;  1DGJ A;  2HJ8 A;  3AEA B;  4YXD B;  4RY2 A;  2DAF A;  5FKA C;  2ZPY A;  2GHU A;  4EZJ A;  4IWP A;  3TL5 A;  4DK5 A;  2DAG A;  4KV2 A;  5BMH A;  4YY3 M;  3W30 A;  2ZBK B;  3MFG A;  4MT5 A;  1V33 A;  4IBJ A;  3L28 A;  4DV6 M;  3RN9 C;  2GB1 A;  3ZVV A;  5K16 A;  1Z5C A;  1HNX M;  4ASW C;  1MPE A;  2HAK A;  2LVA A;  2MQJ A;  2OO9 A;  5JI3 E;  1IUE A;  2HHN A;  1Z5A A;  2FNJ B;  4M00 A;  3A4R A;  1GL6 A;  1XXH A;  1MI0 A;  3Q14 C;  2OHF A;  3QA8 A;  1L6V A;  3R7R A;  2AIM A;  2YNM D;  3NBX X;  3F5V A;  3SD5 A;  3GCB A;  1M6D A;  5JZE A;  1TIF A;  1VG5 A;  4OW0 A;  4A6Q A;  5EZS A;  2AU1 A;  3GPY A;  3UIO B;  4BAX A;  3MP2 A;  1DV0 A;  2Z59 B;  3PS6 A;  1N34 M;  1CJE A;  1UF0 A;  4LZZ A;  2KTR A;  3VK8 A;  2HD5 A;  3NVZ A;  4NOO B;  1UH6 A;  1XCQ L;  4I6P A;  5D2M B;  3C3E A;  1AYV A;  2M5Z A;  3SYL A;  3U2S C;  1WXM A;  1V80 A;  2XNA C;  2GLS A;  3UZU A;  1MHX A;  1SE2 A;  1A6R A;  1JCK B;  2LI5 A;  2MGW A;  4NY0 A;  4URK A;  2FRA A;  3ZXV A;  2K6B A;  1EWC A;  2R6N A;  2CR5 A;  2PJH A;  2BGF A;  1K3B B;  4G6Z A;  2KDF B;  1PYW D;  3T3O A;  3H6N A;  2KDI A;  2LGY A;  4CDE B;  2QEJ C;  3APC A;  4M9Z A;  2QCU A;  3U60 A;  1KYI A;  1MJD A;  2N9E B;  3RZW C;  2BTE A;  2QCZ A;  2XN9 C;  2KXJ A;  5EJC A;  3KSX A;  4PD2 A;  1UM8 A;  1SEB D;  5LNK 1;  4HXD B;  1WMH A;  4ZRK A;  5A2Q S;  4HL4 A;  1HZ6 A;  1VDV A;  2MBH A;  2M17 A;  2FS1 A;  2KMC A;  1JR3 D;  1L0Y B;  3N1Y C;  1GLO A;  2R62 A;  4DMX A;  3KDS E;  3V61 A;  1PUT A;  3VR9 B;  4TMA B;  3K1J A;  1J19 A;  4N59 A;  2B76 B;  1OAO C;  4DV2 M;  4NSO B;  3ZJU A;  4CQN A;  1GKI A;  5BMG A;  2KOX A;  1BVS A;  1DKI A;  2L8J A;  2F7D A;  1EE8 A;  3N3G A;  4IBG A;  4II3 B;  2BWF A;  3WAO A;  2CJN A;  4AW4 A;  3OJ3 A;  4HPM B;  1CJL A;  2KKC A;  4NXN M;  1R4N B;  3UMM A;  1I42 A;  2DZM A;  2PVO D;  3PHU A;  3S3R A;  5L83 A;  1P7E A;  1N32 M;  3R8F A;  4BKS D;  3JR5 A;  3EIE A;  2X4A A;  1SF0 A;  2BBC A;  2V3S A;  2KWD A;  2JY8 A;  4ITK A;  1EU4 A;  3ZUN A;  2J42 A;  1BML C;  3B7Q A;  3FUT A;  1E6E B;  2WNM A;  1G6J A;  2DC6 A;  3C9E A;  1FNV A;  2VH2 A;  3U60 B;  2L7R A;  1OEY A;  3HHX A;  3T3N A;  3LVW A;  4CHK A;  4E74 A;  4LDT B;  1ICF A;  4LF5 M;  2CB5 A;  4MI7 A;  2IBI B;  2KQ4 X;  3P1M A;  4DWF A;  3WXF A;  2JUO A;  3W31 A;  2YJ2 A;  3ZRF A;  3D6S A;  4B0M A;  3W1Y A;  1TY2 A;  1YJ1 A;  2I7P A;  1XNQ M;  2VHF A;  5CHV A;  2WP9 B;  1WZ0 A;  1I4H A;  4MH0 E;  3P4Q B;  4E71 A;  4XWW A;  3BK2 A;  1YUB A;  1G3I A;  5KPR A;  2V1Y A;  2Z0E B;  3LCV B;  1PFD A;  3UK6 A;  1SNK A;  2LHD A;  2TSS A;  2EMT A;  3SHF A;  4YYS A;  3U6O A;  2PEA A;  4GMV A;  3RNF C;  5EE9 A;  4GDL A;  4MB7 A;  2NPT A;  3WA0 A;  3MTV A;  4ZDV A;  2LFI A;  1XXG A;  1NB3 A;  3K8Z A;  1TH3 A;  2C60 A;  2KFK A;  1XF5 L;  4I6L B;  4AP4 C;  2JT4 B;  2MBO A;  2HH5 A;  2YJ9 A;  5CHV C;  3HUI A;  1E9R A;  3SU8 X;  3IUT A;  1WJ6 A;  2REX A; 
#chains in the Genus database with same CATH homology
 1FJG M;  4Z6Y A;  4A3V B;  2FFJ A;  4KKI A;  1IBX A;  3IG5 A;  2MJD A;  2LNH C;  3NRZ A;  2M56 B;  1AWD A;  2L7H A;  4YSX B;  4JE3 B;  3FIL A;  5D3D A;  3BB7 A;  1QAQ A;  4IBB A;  2UUC M;  3KS8 A;  3GPP A;  2CHQ A;  3SAW A;  1FNW A;  2CUZ A;  3EIH A;  4KGT A;  2Y0Q A;  3I57 A;  4GDL B;  3AEB B;  3CF2 A;  4ZRQ A;  4GKK M;  2R45 A;  3QAU A;  2IJ0 A;  5HG2 A;  2YEP B;  1DGB A;  1C79 A;  4KHP M;  4XWT A;  1C78 A;  1UWM A;  1IBX B;  2R4J A;  2PKO A;  2HTM E;  1ZAE A;  4IDI A;  3D8L A;  2O5R A;  5FTM A;  2SEB D;  2GI9 A;  2WU2 B;  1SSN A;  2KAC A;  1DYQ A;  4WW0 A;  2QBY B;  3Q8B A;  5DYI A;  1D5X C;  1XCT L;  3AEC B;  2MJ3 A;  4LJ7 A;  4UDU C;  1HNZ M;  2UUA M;  4LF8 M;  1ZDX A;  2CV1 A;  3P4P B;  2G5G X;  3D8B A;  2LWX A;  1N75 A;  1L6U A;  3GO8 A;  2D7G A;  4YHH M;  4LF6 M;  2GRI A;  2C98 A;  2JWU A;  3LQQ A;  1L8Q A;  4GC5 A;  2XF3 A;  1R2Z A;  2WXM A;  3GS2 A;  4L8R C;  2DOS A;  2DYO A;  2H88 B;  1CK1 A;  1AYF A;  5GKN A;  1E0Z A;  3ZNH A;  1I4X A;  4LJ4 A;  2XSZ D;  5H8Y E;  5FLX S;  1J7A A;  1MX0 A;  3HKP A;  1YQ3 B;  4QOZ C;  2V1U A;  1RWS A;  4JI0 M;  3J27 B;  3IG8 A;  3GRU A;  1C76 A;  2JQR B;  4D8I A;  1DOI A;  5E26 A;  3UJN A;  1YN3 A;  1WYG A;  2E6X A;  1Q10 A;  3NVW A;  3ZJT A;  1KLU D;  4IUM A;  3CIR B;  1LV7 A;  2XFT A;  3PRM A;  4AZF A;  3BYT B;  4B3S M;  4I5S A;  2QIE B;  1QOF A;  1IXS B;  5AUI A;  3RE8 A;  4JI4 M;  1TKE A;  2JYE A;  3VQI A;  1HA5 A;  1TS3 A;  1W5S A;  1QT9 A;  3M0E A;  2QJL A;  1K3X A;  1J7B A;  3MC0 B;  2ZW0 A;  3AOE C;  1E32 A;  2XLJ A;  2L1A A;  3B2G A;  4GH9 A;  3UGJ A;  1JWA D;  1XNR M;  4YT0 B;  2NTS A;  4AQY M;  2WQY B;  1IY1 A;  2V1C A;  1NJF A;  1FFU A;  2FBW B;  2G1E A;  3AE6 B;  2BYT A;  1L0V B;  5HHD G;  2XZU A;  1G8P A;  3GRY A;  1HEZ E;  2KN4 A;  3GP1 A;  4RF0 A;  1SJE D;  1IXZ A;  4AG5 A;  4IBD A;  3I4V A;  3TEW A;  1YE9 A;  3Q8A A;  4GIP A;  4LG2 A;  1NY5 A;  1F2R C;  1HQY E;  3ABV B;  2JSV X;  3TRK A;  2RKO A;  2EUC A;  2A5Y B;  3AOG A;  4FCV A;  2OED A;  4OHJ A;  4KKJ A;  3LQR A;  1UKF A;  4BB9 A;  1VZ8 A;  4LRS A;  3AEG B;  5C2T B;  4OX9 M;  4G4N A;  1HT1 E;  2D7H A;  3GP7 A;  3GQ5 A;  3BVZ A;  4D8B A;  1FIQ A;  4AS1 A;  2W55 A;  2OQ4 A;  3ILK A;  2K9X A;  2N9L A;  2AQ2 B;  3EUB 2;  1VZ6 A;  4IBE A;  4FCW A;  3CTW B;  4OVZ A;  3UI3 A;  3KS4 A;  3U61 A;  2IDY A;  5I4D A;  2C9O A;  1YJI A;  3W0L B;  2Z4S A;  2DLB A;  1V8C A;  1ENF A;  1X37 A;  2C9C A;  3AEE B;  4LFA M;  2UXC M;  1SJH D;  3OWE B;  4EE2 A;  2Z84 A;  2WXR A;  3FTD A;  3P4R B;  1YZB A;  3KXE C;  2WS3 B;  4JPS A;  2UZJ A;  1WGK A;  2LGI A;  2ACZ B;  4AG6 A;  1TDZ A;  1JML A;  4MGY E;  1K3W A;  1TH4 A;  2P5T A;  3PNV A;  4R3D A;  1G59 A;  4KO8 A;  1OQR A;  5EXT A;  1ESF A;  2X8A A;  3NBI A;  3U5Z B;  3GLF A;  2KW0 A;  2L52 A;  4NZL B;  3O65 A;  3J7B A;  2MJE A;  3CF6 E;  2QIL A;  3CWI A;  3KWL A;  1PGX A;  3MHV C;  2ZAM A;  1I4G A;  2OPF A;  2HDE A;  1OFF A;  1SBB B;  1YJJ A;  3RNV A;  2PMV A;  5EE0 A;  4O1N A;  3TEZ A;  1C1K A;  4JI3 M;  2ERC A;  2DBY A;  4ZPX A;  1QVR A;  2DZO B;  2RPV A;  1DGH A;  1QYR A;  4RGO S;  3VRB B;  4DR1 M;  4GDK B;  3GLI A;  4M0W A;  1SE3 A;  1QAN A;  1TZO A;  3KVW A;  4DV5 M;  1RM6 C;  1JRP A;  3KQ4 A;  3LVV A;  2J7Q A;  1JAL A;  1R2Y A;  5FTJ A;  3BII D;  3U4E G;  3TMP A;  1MVK A;  1QIL A;  4QNR A;  3LB8 C;  1IN7 A;  4W5W A;  1Q39 A;  1D6E C;  1JWU D;  2Z7J A;  2J7O A;  1FM0 D;  3DA1 A;  1KF6 B;  2Y3A A;  5H92 C;  4LFC M;  3J2P B;  3U6L A;  5HFY A;  3ZJV A;  1I7H A;  4EIW A;  1NNU C;  1G4A E;  2CFO A;  2WXP A;  1K50 A;  3GQ3 A;  3B9P A;  4YWG G;  3SC3 A;  2KMM A;  1T5X D;  2W54 A;  1I4R A;  3AFH A;  1JQJ C;  2F5P A;  3R8B A;  4HKZ E;  5FTN A;  1WWT A;  4YTP B;  2INN E;  1N77 A;  3H4M A;  2Q5W D;  3VRA B;  1FNN A;  3KOX E;  2BB6 A;  4X62 M;  4DV4 M;  2IPK D;  3EGR A;  3NS1 A;  3PZ7 A;  1OQQ A;  4D80 A;  2X38 A;  3PZ8 A;  1J7C A;  4WQM A;  3T1H M;  1F77 A;  3R2T A;  3N9Y C;  5E6J A;  1ZDV A;  2ON8 A;  3RFW A;  4JWU C;  1IN5 A;  1B1Z A;  3U6C A;  1C4C A;  2XZF A;  2DVW B;  1EWY C;  1IN8 A;  1XXH B;  2HCB A;  2WXH A;  1BXT A;  4FWH A;  2ONQ A;  2N0S B;  4FCT A;  3GLH A;  2PIA A;  1R6B X;  2AQ1 B;  1NHW C;  1N33 M;  4RF1 A;  1NEN B;  3ETR A;  1FCL A;  1L1T A;  2J52 A;  1IXR C;  1TJE A;  1V1P A;  2Y5P A;  3GPU A;  4BOS A;  4IIW A;  2R46 A;  3FKE A;  1PJI A;  3FAH A;  4FXC A;  3SAS A;  4KGS A;  2MH7 A;  3M7G A;  4B3R M;  1FRD A;  2I38 A;  1V97 A;  2DWN A;  1KLG D;  1ZOY B;  2HHH M;  1QF6 A;  1CQV A;  2UUB M;  1XMO M;  3L29 A;  1WSP A;  3RGS A;  4WH4 A;  1I4P A;  2WDV B;  2CE7 A;  2DWL A;  1HQR D;  3RPF C;  3ZC7 B;  5BYR A;  1MHH E;  3I4Y A;  2RDH A;  3OQC A;  1IBK M;  3MHZ A;  2RDG A;  2QEN A;  1K52 A;  4DR2 M;  2BT6 A;  3DOA A;  2ICI A;  4IP3 A;  1YN5 A;  3W5V B;  3TL4 X;  2BS2 B;  2V0G A;  2JRI A;  3KSJ A;  3WHL A;  4KOD A;  1JRO A;  3PNY A;  1QOB A;  4ZYS A;  1GPX A;  3DZD A;  2XGN A;  4DR4 M;  3VLF B;  3FTE A;  1K53 A;  4OZC A;  1JQ4 A;  1RFK A;  3NWL A;  4KGR A;  2BJV A;  3TE6 A;  4II7 A;  4D81 A;  3AED B;  4PDG A;  4K0K M;  2D5G A;  2WXQ A;  2J7N A;  4LJ6 A;  1TYG B;  2L6O A;  2JZP A;  3Q8E A;  2CU3 A;  3B2F A;  3FUW A;  4DV3 M;  3GQ4 A;  5F3W A;  1IBL M;  1KFV A;  1IY0 A;  4TQ1 A;  4GMQ A;  1OJL A;  4J3O D;  4DUY M;  4LK0 M;  3NVY A;  3A42 A;  2KXE A;  1QAO A;  3GRV A;  2QZ4 A;  2VQE M;  3FIL B;  1L2C A;  2C99 A;  2DWZ B;  4L15 A;  2WLB A;  2AX5 A;  3SR6 A;  5IRE B;  4JI8 M;  4HLQ A;  2LUM A;  3BYY B;  3FYC A;  4C7Y A;  2DWQ A;  4WAF A;  3SYK A;  3PXG A;  2CHV A;  3VK7 A;  2KDM A;  3DWG C;  4D82 A;  2EA0 A;  2V3N A;  1JR3 A;  4P6V F;  2K0P A;  4DR5 M;  1FEH A;  3JAM S;  2Z4R A;  1J09 A;  2FE8 A;  1K82 A;  1QOA A;  1C4A A;  4LLG M;  3FUV A;  5BYQ A;  3K2L A;  3W2D A;  2LMC A;  3FYD A;  3SMP A;  2VQF M;  4RGM A;  3FTF A;  4XBO A;  2FNA A;  4B7F A;  1E9M A;  4BLC A;  1GL7 A;  2WXI A;  1ZQ9 A;  4XDD A;  4LGY A;  1QOG A;  1D4B A;  1M4V A;  2IGG A;  2Z8L A;  3ZQ4 A;  4G4Q A;  4P16 A;  4MGZ E;  2K22 A;  2BJW A;  5IWA M;  4A90 A;  1HQC A;  1DOX A;  4ZHP A;  2R18 A;  1XO3 A;  4M9X A;  3AKZ A;  3P4S B;  1H6U A;  2W82 A;  1L1Z A;  1VDD A;  2ZAN A;  4LF7 M;  1EM7 A;  2KRK A;  4JI5 M;  3O13 A;  4M0D A;  1Z6T A;  4QNM A;  3VKG A;  1XLO A;  4HRO A;  5EXS A;  3AE1 B;  5KQ8 A;  1TDH A;  5KPZ A;  4G4O A;  5BPV A;  5TSS A;  4DV0 M;  4TSS A;  2LXE A;  1HZ5 A;  1PGA A;  1HT2 E;  4GHA A;  3HVD A;  4AI6 A;  4FVM A;  2EKI A;  1OFI A;  3AM9 A;  4CIS A;  2BW2 A;  1ORY B;  1C9F A;  4DV1 M;  4OU7 A;  3ZH9 B;  2E3T A;  5D7G A;  1QAM A;  3Q8X A;  1PJJ A;  3PVS A;  1ZE3 D;  3AB5 A;  2Y5C A;  2WXO A;  5EP4 A;  1SXJ A;  5KQD A;  3TWK A;  3HGI A;  1FO4 A;  1GOZ A;  2X49 A;  1CZP A;  3BZD B;  1L0X B;  4NAM A;  5BR8 M;  2JTC A;  2CV0 A;  1SB3 C;  1J5E M;  3AE5 B;  3HRD D;  3TPZ A;  3VDU A;  5IT9 S;  2JXT A;  4JX1 C;  4YSY B;  1IM2 A;  1NY6 A;  1NNJ A;  1SXJ C;  5EXX A;  2L7I A;  5EP3 A;  3KOY E;  2EEL A;  4WIP A;  4A55 A;  3KP1 E;  3IT4 B;  2WDR B;  2AQ3 B;  4BOZ A;  3KOW E;  1SXJ B;  4IBC A;  1E7P B;  1ZUD 2;  1PVJ A;  4LTU A;  1NYQ A;  2E5L M;  4L2Y A;  3HWS A;  3Q8F A;  1JW9 D;  2W3R A;  1RYJ A;  1XC8 A;  1KSF X;  1QZM A;  5IZ7 D;  1P7F A;  3HJQ A;  1BUI C;  1FD6 A;  1N60 A;  4OVZ B;  1XEE A;  3GB1 A;  2XSZ A;  4US9 A;  3U61 B;  1L2D A;  4IOI E;  4Z8X A;  3AN1 A;  3GPX A;  3SAV A;  1NYR A;  4RCO A;  3P42 A;  2QPA A;  1R7R A;  1PDX A;  2D7E A;  4LZJ A;  4PT5 A;  4B7H A;  2KZS A;  1L5P A;  5MPO A;  4DV7 M;  2XFS A;  3THG A;  4LRT A;  2RGH A;  3PT2 A;  4IBI A;  5ITX A;  4GKJ M;  2VZK B;  5EP1 A;  1E94 E;  3AE7 B;  4GUA A;  1UGJ A;  4REZ A;  2LHE A;  3I51 A;  4MM3 B;  4MGH A;  1SXJ E;  4B08 A;  1WXQ A;  1NI3 A;  3B21 A;  1A70 A;  1QLB B;  5DYG A;  5EP2 A;  4BBA A;  1GB4 A;  1NEK B;  1IBM M;  4B0E A;  1VJK A;  1ACC A;  3TSS A;  3AV0 A;  4C56 C;  3LYY A;  3KLS X;  3GLF B;  1VRA B;  1Q3B A;  3IXS A;  2YFQ A;  4X65 M;  3AJI B;  2QSD A;  2BTW A;  2XH9 A;  1VZ7 A;  4NL4 H;  3MK6 A;  3AEF B;  5GXG B;  4A9A A;  3TWL A;  3SFZ A;  5LMN M;  1NHG C;  1NVM A;  1YN4 A;  2MEK A;  1I94 M;  1XMQ M;  3AL0 C;  2AHM A;  3HU1 A;  3T38 A;  4LFB M;  1DGH B;  3SEB A;  2CJO A;  2J7Q C;  1T6B X;  4DUZ M;  1SXT A;  4YTM B;  3GLI B;  1YSY A;  5EXP A;  4OZB A;  2HKJ A;  2ZW1 A;  3J7A S;  3KW6 A;  3JR4 A;  3BWU D;  1SIJ A;  3SFE B;  4MH8 A;  3GRR A;  1JWM D;  2Y21 A;  1KH0 A;  1AW7 A;  1N61 A;  4KLN A;  2I7N A;  4FWG A;  1NSF A;  2RMM A;  1FNU A;  1L4Z B;  2J53 A;  3BY4 A;  1GVN A;  3PSE A;  2HWK A;  4L16 A;  1GAQ B;  1S3S A;  1C77 A;  5ITQ A;  3HU3 A;  5ITX E;  3ZCB B;  3P63 A;  4WWM A;  5G5H A;  5JXV A;  3L27 A;  4HJG E;  2UU9 M;  4FD2 A;  1TKG A;  3VR8 B;  1UNS A;  3EA6 A;  4ITQ A;  2W3S A;  2INP E;  3HHY A;  2WXK A;  3ZGZ A;  5AUK A;  1QQW A;  1XLQ A;  1JWS D;  3MJ5 A;  1KRH A;  5FSW A;  5G5G A;  4TQ0 A;  4ARI A;  5JI2 E;  2L83 A;  4QHT A;  2YEP F;  4LF9 M;  2JU6 X;  3IFU A;  1STE A;  2V4I B;  3GLG A;  2F5Q A;  4RFB A;  1N36 M;  2CHG A;  4X64 M;  2WXJ A;  1K51 A;  2F5N A;  2WU5 B;  1TS5 A;  4NSR A;  4JI2 M;  2KRU A;  3A46 A;  2R61 A;  1TGU A;  1ROE A;  3AE3 B;  2NMQ A;  5FTK A;  4QOS A;  4LJ5 A;  4ZTB A;  3VFD A;  1MU5 A;  1GB1 A;  3TWM A;  2PW9 A;  3BK1 A;  3BVM A;  2PLP A;  4H2A A;  1TKY A;  2J4X A;  1DGF A;  3U7Z A;  4JXJ A;  3TQS A;  3GLH B;  2H89 B;  1N78 A;  3HJ8 A;  4LCB A;  3GLG B;  2DZN B;  1PGB A;  3HVZ A;  2AGA A;  2ZM6 M;  1DO0 A;  2H1R A;  4I81 A;  3SAT A;  4BOP A;  3A45 A;  3W0F A;  1D2N A;  1V1P B;  3SFD B;  4DXF A;  2QP9 X;  2BB5 A;  4Q2J A;  1FXI A;  3PHW A;  3RGP A;  1Q3C A;  1TY0 A;  3IAS 1;  1YQ4 B;  1DOY A;  4A5U A;  4NXM M;  1GLN A;  3HU2 A;  4LGM A;  2Z3X A;  1R7S A;  1LO5 D;  3AH7 A;  3SAU A;  4G4R A;  3BVG A;  4AQ7 A;  4JI6 M;  4DR6 M;  1KTK A;  2YR0 A;  3QWL A;  3VDP A;  3Q69 A;  4DR7 M;  1N5X A;  2Y0T A;  4LY6 A;  4TUW A;  3L26 A;  1V1O A;  1ZPS A;  4WUR A;  3TEX A;  3U6Q A;  1ET9 A;  1PM5 A;  2F5O A;  1AN8 A;  3NZ3 A;  2I2Y A;  2WDQ B;  2M0A A;  3T1Y M;  2CV2 A;  4I8O A;  2K5P A;  4AKH A;  5BYS A;  3PHX A;  2QBY A;  2R65 A;  5FTL A;  3U52 E;  4XGI A;  1ZXI A;  1FFV A;  1ET6 A;  4PCZ A;  1IN6 A;  2IGD A;  1XHB A;  1FMA D;  4MAC A;  2KEB A;  1SXJ D;  3I9V 1;  3C8Y A;  7CAT A;  2WXG A;  3AE4 B;  1XLN A;  3W9C B;  4X66 M;  3J9C A;  3HHZ A;  2K3U A;  1VLB A;  4ZOH C;  1IGD A;  2EO2 A;  4BOQ A;  1JWB D;  4BOU A;  4DQO C;  4D8E A;  3URY A;  1E10 A;  1D5Z C;  3Q8C A;  3BBA A;  1ZP0 B;  2F5S A;  3SAR A;  3AE9 B;  1J7K A;  4R7G A;  1IY2 A;  4NAW B;  3R9X B;  1D5M C;  4OZA A;  4L4U A;  3E4R A;  2LJI A;  2N9K A;  4B7G A;  2WXN A;  3OTO M;  2FOI C;  4AKG A;  4XZX A;  4JI7 M;  4IKG A;  1XLP A;  1E9S A;  3DWM A;  4IBF A;  2XEP A;  4XDC A;  3L4P A;  4M9S A;  3C0R A;  4B3T M;  2PTL A;  2IGH A;  2VZK D;  1N63 A;  3B9J A;  2M19 A;  2C5R A;  3TUO A;  1IN4 A;  2F4V M;  1SE4 A;  2DYM A;  2L32 A;  3U6S A;  1F2R I;  5ITT A;  4JV5 M;  2R4E A;  3L2A A;  4RGT A;  3W1S A;  3IT6 B;  4GLS C;  3L25 A;  5HI1 A;  2SAK A;  3TEY A;  3SBJ A;  4GC9 A;  3NUH B;  1DO2 A;  1L2B A;  3AOE A;  5H37 D;  4XE0 A;  5BMI A;  4JI1 M;  5ITR A;  1VR9 A;  3FTC A;  4LJA A;  2QMT A;  1FCC C;  4IJF A;  4S12 A;  1FXA A;  3R2I A;  2NQ8 C;  3LMM A;  5ITU A;  2V6Z M;  1FRR A;  1TS2 A;  1YNT E;  1EU3 A;  2VII A;  3BOS A;  1F0Z A;  3U6E A;  5KO3 A;  2KZU A;  4CGY B;  4FWD A;  5EE3 A;  3AE2 B;  4HEA 1;  1G41 A;  4FW9 A;  2FUG 1;  5T8I A;  4IJE A;  1Y56 A;  1TS4 A;  4AKI A;  4N58 A;  5D3I B;  4L1B A;  1QKZ A;  2HL7 A;  8CAT A;  3J81 S;  2CEA A;  3MP9 A;  4HKQ A;  1B9R A;  3V05 A;  3KOZ E;  2DXI A;  3AMZ A;  4DXG A;  2UXB M;  3CF0 A;  2JX5 A;  5KPT A;  4PDI A;  4ZHO A;  3T15 A;  3IAM 1;  4JWS C;  1I4W A;  4JYA M;  1N62 A;  1W5T A;  5LMU M;  4LJ9 A;  2WXL A;  3WCQ A;  4RNA A;  5C1B A;  1XWI A;  3SMS A;  3V3X A;  2DWM A;  3WHK A;  5DNY A;  4GIT A;  1NVI D;  3E9S A;  2RGO A;  1C4P A;  2YQZ A;  3U6D A;  3A98 B;  1I4Q A;  3U5Z A;  1UWX A;  5EZQ A;  3U6P A;  3FC4 A;  4NRV A;  3FUX A;  5EQT A;  2BS4 B;  1YMH E;  3J80 S;  5ITY A;  2G8L A;  4JN6 A;  4RKX A;  4LJ8 A;  1T3Q A;  3LXF A;  2KAJ A;  1KFY B;  4NRW A;  4QHS A;  1Z59 A;  3HJS A;  3C58 A;  3SHG B;  4US8 A;  1HR0 M;  2DHR A;  2V3P A;  2M60 A;  1T3T A;  3E56 A;  3AE8 B;  4ARC A;  4IBK A;  5C18 A;  2LEK A;  4B3M M;  1HXY D;  2JYT A;  1Z5B A;  1TH2 A;  1WRI A;  3DFZ A;  3K92 A;  3KWV A;  2G9H D;  3PRP A;  2NTT A;  1IGC A;  4C7Z A;  4HRS A;  2UXD M;  5FR3 A;  3HHW A;  3KFU G;  4GHL A;  3RFZ B;  3NVV A;  1L4D B;  4A8X C;  4ZRP A;  3FUU A;  2ZAO A;  1UUP A;  2C96 A;  4YSZ B;  4MGK E;  3H8H A;  3KP0 E;  3FD9 A;  2KA6 B;  4N6E B;  2L09 A;  2Q2E B;  1DGG A;  4LF4 M;  4CHT B;  4I4L A;  2BU3 A;  4USA A;  4YTN B;  2BNK A;  4C80 A;  5EE1 A;  4DR3 M;  3VKH A;  1N5W A;  3W5U B;  4L78 A;  4NJC A;  4D2K A;  2JA2 A;  3M6A A;  1QQR A;  1IQP A;  5FK9 C;  4RH6 A;  2Y20 A;  2PVG C;  4MGI E;  4RGN A;  1NJG A;  1OFH A;  1ZXH A;  2N7J A;  3ZYY X;  3U6M A;  2WXF A;  4L23 A;  2K47 A;  4KX6 B;  1HNW M;  3AV8 A;  2BS3 B;  5C3J B;  2LH0 A;  3PO0 A;  3PFI A;  2BTW B;  4GRI A;  1DGJ A;  3AEA B;  4YXD B;  5FKA C;  5BMH A;  4YY3 M;  3W30 A;  2ZBK B;  3MFG A;  4MT5 A;  4IBJ A;  3L28 A;  4DV6 M;  2GB1 A;  1Z5C A;  1HNX M;  1MPE A;  5JI3 E;  1IUE A;  1Z5A A;  1GL6 A;  1XXH A;  1MI0 A;  2OHF A;  1L6V A;  2YNM D;  5JZE A;  4OW0 A;  4A6Q A;  5EZS A;  3GPY A;  3MP2 A;  1N34 M;  1CJE A;  4LZZ A;  3VK8 A;  3NVZ A;  4NOO B;  1XCQ L;  2M5Z A;  3SYL A;  3U2S C;  2XNA C;  3UZU A;  1MHX A;  1SE2 A;  1JCK B;  1EWC A;  4G6Z A;  1PYW D;  3T3O A;  2QEJ C;  4M9Z A;  2QCU A;  3U60 A;  1KYI A;  2BTE A;  2XN9 C;  5EJC A;  3KSX A;  4PD2 A;  1UM8 A;  1SEB D;  5LNK 1;  4HXD B;  5A2Q S;  4HL4 A;  1HZ6 A;  1VDV A;  1JR3 D;  1L0Y B;  2R62 A;  3KDS E;  1PUT A;  3VR9 B;  4TMA B;  3K1J A;  4N59 A;  2B76 B;  4DV2 M;  4NSO B;  3ZJU A;  4CQN A;  1GKI A;  5BMG A;  1DKI A;  1EE8 A;  4IBG A;  2CJN A;  4AW4 A;  4NXN M;  3UMM A;  2PVO D;  3PHU A;  1P7E A;  1N32 M;  3R8F A;  3JR5 A;  3EIE A;  2X4A A;  1SF0 A;  2BBC A;  2KWD A;  4ITK A;  1EU4 A;  2J42 A;  1BML C;  3FUT A;  1E6E B;  2WNM A;  1FNV A;  3U60 B;  3HHX A;  3T3N A;  3LVW A;  4LF5 M;  4MI7 A;  2KQ4 X;  3P1M A;  3W31 A;  4B0M A;  1TY2 A;  2I7P A;  1XNQ M;  2WP9 B;  1I4H A;  4MH0 E;  3P4Q B;  4XWW A;  3BK2 A;  1YUB A;  1G3I A;  5KPR A;  1PFD A;  3UK6 A;  2LHD A;  2TSS A;  3SHF A;  3U6O A;  5EE9 A;  4MB7 A;  3MTV A;  2LFI A;  1XXG A;  3K8Z A;  1TH3 A;  1XF5 L;  3HUI A;  1E9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...