4WURA

The crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
TIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNSYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analysis of the interaction between the Middle-East respiratory syndrome coronavirus (MERS-CoV) papain-like protease and human ubiquitin.
pubmed doi rcsb
source organism Betacoronavirus england 1
molecule tags Hydrolase
molecule keywords Papain-like protease
total genus 84
structure length 317
sequence length 317
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4wurA02
3.10.20.540 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wurA01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4wurA03
3MJ5A 4RF1A 4REZA 4PT5A 2FE8A 4P16A 4R3DA 3MP2A 4RF0A 4OW0A 4OVZB 4WURA 3E9SA 4MM3B 4M0WA 5KO3A 4OVZA 5E6JA 4RNAA
chains in the Genus database with same CATH superfamily
2EMSA 4YL8A 1FNVA 1XNRM 1NPZA 2MBQA 1CJEA 4NQKE 3HHIA 1HA5A 2KFKB 4DMXA 2DZJA 3LCVB 2JQFR 1C79A 1HNWM 4XGIA 3W67A 4L2YA 1TL9A 2BKRB 2QHOA 2ZEQA 5FSWA 1XHBA 1XXHE 2Z59B 4REZA 1GLNA 2JYTA 4A90A 4B3RM 2ZZPB 1W5SA 5FTJA 2JNHA 2CR5A 2N9KA 2EKEC 2DC9A 4NNJB 1VG5A 3DWGC 3ZNHB 1IXZA 3X0WA 4MACA 2GQFA 4FWDA 4LJOB 5GXGB 4KIKB 1DYQA 5IREB 2KVZA 4YY3M 4F2LA 3NRZA 5CVOB 1VZ7A 1NNUC 1T0SC 4WIPA 4B0EA 1AYVA 3MC9A 3GQ3A 4IWOA 2L76A 2Y6EA 2KZSA 4OHJA 3UQBA 4XK8F 5EF4A 2P0RA 1IBMM 3B08A 1A6RA 1TBEA 1V5TA 1UKFA 3H1UA 3AL0C 3H9DA 4NRVA 7PCKA 2V3NA 3KOZE 3T38A 1XLQA 4DR6M 1BXTA 4ZRPA 4YSYB 3U4EG 3SHFA 4D82A 2RPVA 3TNXA 5CHVC 4BB9A 3HK0A 4R7GA 1N62A 4II2B 4B7HA 1UBIA 3QAUA 1L0VB 3A9KA 4B95A 3B9JA 5C1ZA 1SXJB 2N4FA 3DBRB 4BSQA 3UZUA 3S2AA 4NAWB 4EFOA 2O6VB 4K3BA 2WX1A 1EWPA 2K47A 1PJTA 5EP3A 3IT6B 3J27B 2DYMA 3KVFB 2VF8A 2INNE 2R9FA 4PD2A 2DHYA 4LZZA 2JYEA 2M8SA 4MH8A 1ZMWA 3AMZA 2WXMA 1JMLA 1IBLM 1JB0F 3HVDA 2EO2A 4YV8A 1J7KA 2FQ9A 2K6QA 1GL7A 4WW0A 2D7EA 4AW4A 5L95C 2MBBB 3H8CA 3U6PA 1YUBA 3PHXB 2GBJA 3L08A 1E94E 3IFUA 2LVPA 1ET9A 4US8A 4JI0M 1H8CA 1PIPA 1OEYA 3H7SA 1ZPSA 4G50A 2PIAA 2L05A 4A9AA 3AE7B 3DWMA 3IMAA 2X8XX 2JWUA 2KQ7A 3FTDA 3BK1A 4GEWA 4TMAB 4ANVA 5BPVA 1FJGM 3TMPB 3H6SA 3KUCB 4K7CA 1LM8B 3TIXA 3U6MA 2KAJA 1V2YA 4FLHA 5CVMA 1JWMD 2QCZA 4IJFA 3J9CA 1JR3E 2WS3B 4KODA 2LRUA 2KTRB 1QDTA 4AQ7A 4FJZA 4AS1A 5HI1A 5J17A 2K3UA 2O6VD 2QBYA 3OTOM 2NQGA 2L8JA 3PT2A 1QAOA 4MGIE 2D5GA 1JQJC 1TS2A 1IFYA 1V9JA 1SXTA 2BT6A 3A1QB 3JSVA 2R6FA 4YWGG 3MMPA 5BYQA 3JR4A 1FO4A 1LO5D 1P7EA 1TKEA 5D3IB 3C9PA 2E00A 1SNKA 2NBUA 1U9QX 2O2VA 2ZJDA 5EE1A 2J7QC 1T0QC 2D2QA 4W9DA 3P4QB 3QC8B 4WWMA 4IOIE 2J52A 4NAWA 2K8BA 3L27A 3RGSA 2FT2A 3KWBX 3SFDB 3K24A 3ZH9B 1AARA 4W9LA 2AQ3B 2XZUA 2XZFA 2E6XA 4OVZB 2CKHB 1S3SG 2QP9X 2O6XA 2KWUB 3CWIA 2JPHA 5FKAC 4L6V6 4OU7A 1WMHA 3AEGB 3A46A 3T1HM 2C7HA 4WWPA 4BAXA 2AQ2B 4BKTA 3WAPA 2D3CA 2OZ2A 3WANA 2KT7A 3ZQJA 5FTMA 1AYFA 1O0EA 2FNJB 3PRMA 2KOXA 3C8YA 2JF5A 2IO1B 1UWMA 3BIID 1HTQA 2AL6A 2R0IA 4BQVA 4JL9A 5A24A 3ZYYX 2F7DA 3KWZA 3BINA 2ZVNA 3QARA 2KTRA 3KW9A 2IGHA 1J7BA 3GLIE 4KVGB 2CHVA 3WCQA 2RD0A 2FIDA 3RT3B 4AKGA 4G4NA 3GLGA 1EU4A 2DJGB 3B74A 3B2GA 1XKGA 3MP9A 2PREA 2R9OA 2JUJA 1RWSA 1SGHA 4HJKA 1GMYA 2VRRB 1YQ4B 3F92A 4MELA 2DNFA 3GRVA 2V4IB 4ZTBA 2CUZA 4IJEA 4LNFA 3M6AA 4ANRA 2FRQA 3W1YA 2WSFF 2FCSA 2E02A 2RDHA 1CB5A 5KPZA 4GUAA 2PKOA 3TWLA 1HZ6A 3SBJA 2MJEA 1IPGA 2PEAA 1IYFA 1PJJA 1ZMUA 4XX5A 4LGMA 1YK7A 4YXDB 3PRZA 4K0KM 2KNVA 1PJIA 2DX5B 1XMQM 3O65B 3ZIMA 1C4CA 1L0YB 2KEBA 1L1TA 4FW9A 1YZBA 5EZSA 1NDDA 2J42A 5CHTA 3A4RA 4GDLB 1BUIC 2JX5A 4KGSA 3PSEA 4JX1C 2IGDA 2CU3A 2IDYA 3BPMA 4M00A 2FCQA 2C9OA 4DR2M 4X57B 2UUBM 2C9CA 7CATA 4P1BC 2BDLA 2KLGA 4JE3B 3SAVA 4BZAA 2MEKA 3OG5A 2BTEA 1NQCA 3T1YM 1QZEA 4LNIA 1KLVA 2INCC 3Q69A 2GBKA 4JLCA 1SEBD 3V6CB 3EFUA 3FAHA 1YX5B 3BCNA 3KS4A 4AJWA 4X6HA 3CH3X 5E6PA 2LTUA 2EELA 1U9VA 4W4UA 1QKZA 4WAAA 4XZ4A 3MK6A 2L4FA 4IP3A 3KFQA 3UK6A 2QMTA 4DR5M 3T3NA 4PT5A 1TKYA 5C1BA 1EFUB 4DV0M 4G0NB 2OJRA 5AUIA 5FTKA 3GRUA 1IN8A 4HCPB 3RFWA 4KX6B 1PE6A 4X62M 3CSTA 5JZEA 2K6BA 2LGXA 2J4XA 1WGHA 3TWKA 2WNMA 2AVWA 1E9MA 3FRIA 1L1ZA 2R65A 1SF0A 3AKZA 2J7OA 3K9PA 2IGGA 1XLNA 2LD9A 3V62A 1BP4A 5J18A 2LWPA 4ICUA 5AZHA 4LRTA 4A20A 4BOSC 1RYJA 4OVZA 3ETRA 3JYUA 1WXSA 2AS8A 4NAMA 2NS5A 4ZRKA 3RN9C 1EO6A 1PFDA 1UWXA 3ZW3A 2WXHA 4K3CA 1ZE3D 3N1ZC 4PS3A 3A9JA 2M17A 1NL6A 4JYAM 2HD5B 2VDBB 3H7PA 4KZ0A 1F1HA 4MJSB 1TS5A 4NRWA 2J5YA 4AZFA 3GLFE 1I7HA 2BS3B 2L7RA 1I4QA 3KWLA 4PP1A 3K2LA 4YT0B 3GPYA 1C1KA 4HEOA 2L0FA 4RGTA 1MHWA 3ZUAA 5IWAM 4N6EB 1C4PA 4G4OA 1J09A 1IBXA 4KDLB 4W9JA 2QENA 4YSZB 1AU4A 2H1RA 4JGHB 1LV7A 1VJVA 1ESFA 2Z8LA 3UGBB 4QBBA 3KDSE 3GPUA 1TU6A 3NS1A 2Z0EB 4BKSA 1U9WA 2ATOA 4JQWC 5BR8M 4AG5A 4EE2A 1M94A 3KWVA 2XEPA 4KLNA 1OQRA 2CJNA 3U6CA 1E7VA 3OJ4B 3U30A 3LQQA 3AULA 4NJCA 5CVNB 2FO5A 3AOEC 1PGAA 4BLCA 3NWLA 3JVZX 4LJ6A 1E8YA 2D3GA 5ITXE 4IBDA 2CU1A 2IPKD 3SR6A 3AJIB 5BMHA 1S1QB 4X65M 5HFYA 4BKSD 4ZUXU 3FE3A 4BPVA 4A5UA 4P16A 3QT4A 4DXFA 1JQ4A 3FILB 1DOXA 1THEA 1NI2A 2L4EA 2IO0B 4WURA 1QXPA 1E32A 4URKA 2XK5B 4RCOA 4MEMA 2M19A 3DOAA 3VAWA 3QIJA 3Q14C 3P2BA 4ZHOA 2CIOA 4NSOB 1BGOA 2G45B 4OX9M 1ZW7A 2MJ3A 3T3OA 2WU2B 2DWZB 4JI1M 1I35A 4UN2B 1N63A 1GCBA 1V1PA 2EKIA 1HQRD 5EXPA 2KJHB 2QSDA 1FCLA 2G7YA 2QQ8A 1Q10A 3AXCA 2Y5BB 1PGBA 2KC1A 3NG0A 1OTRB 3U61A 1GVNA 1XT9B 2DC8A 4KDIC 1QYRA 4IBJA 3ZRCA 3AE6B 2KC2A 3N3GA 4QRXA 1LFDA 1CVZA 2OPFA 3RMKC 4QHSA 4DR7M 2N1WA 1YVBA 3PHWA 1KLGD 2RR9A 1PM5A 2K0PA 4A8XC 2KX0A 5A2QS 1I4HA 2V1CA 3I5JC 3U7DA 2DZLA 3HIZA 3PLVA 5BO4B 1C77A 3I51A 1MPEA 4HXDB 2JA2A 2KX3A 2KMCA 4GC9A 2UXCM 2ZPNA 2N35A 4LRSA 4I4LA 1NO1A 2MA9B 3NUHB 1IN5A 1QANA 4E74A 2JY6A 2KDIA 1R4MB 1I4GA 2R61A 4HLQA 4G4RA 3SATA 1V92A 3V3XA 3OWEB 2BTWA 1A5RA 1PYWD 3USVA 4TQ1A 1UNSA 4IKGA 2G8EA 1FH0A 3JAMS 4GRIA 2OOBA 1WSPA 3JSVB 4BS6A 5CX3A 1VZ6A 1T0RC 4PP2E 2W55A 2Y5PA 3B0AA 3U60A 1WR1A 5GMVA 3DA1A 2IO2B 1ROEA 1Q02A 1FXAA 2KDLA 4W9IA 1E9SA 4CDDB 3LVWA 2Z8YM 1FM0D 5IO9A 4K7SA 3FD9A 2HE7A 2JZPA 1NB5A 1IXSB 4IW0A 1EF1A 3ZDMC 3PW3A 5DNYA 2LRWA 1DGGA 2XFSA 2N0SB 3UF8A 4C4VB 1N61A 2JTCA 1GNUA 3P4PB 2ZW1A 2W54A 5LMUM 1ZDXA 2CHQA 2KMMA 2MP2A 1NSFA 2KZUA 2DVWB 4L78A 1I94M 1NYQA 1SXJA 2PE6B 3DBLB 3H8HA 3NZUA 3W5VB 4F1SA 4LZJA 1K52A 3QQ8B 2PJHA 3ZJVA 3H4JA 2ZNVB 1UZXB 4M8NA 1AN8A 2DYBA 4DR1M 2AU1A 1WXQA 2NTTA 3HHXA 5EXTA 3IXSA 1L2NA 3PV1A 1V34A 4C56C 3N30A 2L09A 2VH1A 3N9YC 1AW7A 3C0RB 1MX0A 4QRVA 4DHZE 2G3QA 1CZPA 3URYA 3ZNGC 2GMIC 3MP2A 2CP8A 2AEHA 1DGBA 1NLJA 3T15A 2D7GA 3QSDA 2YJBA 1ME4A 3AEBB 2L00B 3MJWA 3R8FA 1L6VA 6PADA 3IG5A 3BY4B 2LXEA 3M99A 3AEFB 3GLIA 4KGRA 3AE2B 2FAZA 4W9EA 1R6BX 1C4AA 2W3SA 2TSSA 4US9A 2KW0A 2KDBA 1I4PA 4F8CB 3QJZA 1F4IA 2JY7A 5E6JA 4JI3M 3V6EA 2PLPA 5DPTA 3SMSA 4MI7A 5KQDA 4JI5M 3GLHE 1FNUA 3K9OB 3W1SC 5D94A 2G4SA 3CBJA 1MJGM 3UQAA 5KHOA 2QJLA 1QF6A 3MTNA 1DOYA 1IXRC 2BPSA 1C76A 1SB3C 2CHWA 4IG7B 1HJPA 2RGFA 1IN6A 2BYTA 4TSSA 3B7NA 2N9XA 3Q3OC 4NSRA 1AIMA 2IYDB 3QJ3A 1BVSA 4GIVA 2E03A 2KJ6A 4BKGA 2QBYB 3NVVA 2CV1A 1KH0A 1MG8A 3WIMA 1VDDA 1P98A 2DCCA 1IN4A 4HDOA 3BB7A 1JRPA 1WR6E 1QOGA 3FTFA 1N75A 1HNXM 4NZLB 1OIPA 5JHAA 3PRPB 2BWEA 3FTCA 3SDLC 4Q2JA 3U6OA 2Z0DB 1VDLA 2GHUA 1BQIA 1IY2A 2H7JA 2MLBA 4ZHPA 2UXDM 3ZC7B 1FPYA 2SAKA 3FILA 3T6PA 3AE9B 3KS8A 1UF0A 4OZBA 1NY5A 2LUEA 2FBWB 5KPRA 3TSSA 1QVRA 4RH6A 3SAUA 5BYSA 1QQWA 3PVLA 1KFXL 5KPTA 5LXHA 4MJSA 3SYKA 1QOBA 4NPNA 3SYLA 3B79A 4RM9A 2ACTA 3OQCA 1HQCA 4E3CA 2RGOA 1F2RC 2DWLA 3AB5A 4NQLB 2XU1A 1NENB 4WJNA 4M0DA 4X6JA 3PHXA 1OQQA 5CHVA 2CV0A 1Z2MA 2LUMA 3N32A 4F1IA 1KYIA 2FH0A 2Z7JA 3I04M 1MI0A 4AWJA 2P7UA 3RVVA 4IDIA 4H2AA 2ON8A 1VCBA 4WJOA 1WJ6A 3S3RA 1MN3A 4FVMA 2WXFA 1IQPA 3ZNHA 4S12A 1XC8A 3KW6A 3R9XB 1MEMA 4LCDE 3AH7A 3BY4A 4W5CA 3PDFA 3I57A 5C18A 4KLBA 4RKUF 5HG2A 3ILKA 2GB1A 1NJFA 3ALBA 4JI6M 2YR0A 5CTRC 2LHDA 5CHWA 1V81A 1STFE 1U5IA 3KUDB 1FXTB 3R8BA 3ML8A 2YJ8A 4LNOA 3H8BA 3BXWA 4M0WB 1JCKB 2Y21A 4WP2A 4JI7M 2BKFA 3VR9B 1Q6KA 1JR3A 1ENFA 4CDEB 1E8WA 3U6DA 1G59A 1WIAA 4MM3B 2XH9A 2BQQA 2ZTDA 3H7DA 3B7ZA 3IAS1 4C7ZA 4NC6A 3GZNB 1LQBA 1SP4B 1Z5BA 3J7AS 4DV2M 4TKNA 4AG6A 4DV7M 1WX7A 3Q8FA 2LVOC 4LGYA 3Q8BA 1IM2A 3U6SA 1T6OA 1WRDB 2KKCA 3Q8AA 4D80A 1TTEA 1NVID 4IBGA 3O1GA 2AYOB 4II3B 2X4AA 3L13A 3FUWA 1XF5L 5H8YE 5ITXA 4GGQA 4GIPA 1TJEA 2JY8A 2W82A 3GE3C 1WGNA 2IZVB 5E26A 4ANUA 5CHFA 2WX0A 1MJDA 2EMTA 5C23A 3EUB2 4YYRA 2CEAA 2XK5A 2BF8B 2M1MA 1E9RA 2KDMA 1T3TA 1QOAA 3U6QA 1XXHB 2O2VB 1I4WA 2HWJA 2E01A 4HPMB 1FIQA 3AOGA 2KDFB 2KQ4X 2BS2B 1EWYC 3DBSA 2WU5B 4FHKA 4YSXB 1D5MC 2XU4A 3W1SA 2KXJA 4HDQA 3L28A 2YJ2A 1TZOA 4I6NB 1SE2A 2QSFX 1UGJA 2CHGA 4CQNA 3HM3A 4FWHA 4OVVA 4A55A 3P63A 1MEGA 3EIEA 2D7HA 4JXJA 5DPSA 4EKUA 3GS2A 2DHZA 1G41A 4CO7A 3K9PB 3PHWB 1OFIA 1HT1E 2L83A 3NBXX 2KNBA 2QILA 3L29A 1DV0A 2N9PC 2KRUA 3NS8A 3KP0E 4L1BA 4RKXA 3S3QA 2BBCA 5LNK1 3ZGZA 3TEWA 1ZV1A 4IBFA 4ARIA 3J2PB 4D81A 2UU7A 2XN9C 1K3WA 3PT2B 4DV3M 2FRAA 1ZXHA 4LFAM 4YTPB 2NQ8C 2H89B 4M0WA 3H6NA 3T9LA 1GC7A 3U8EA 3AECB 3WA0A 2ZNVC 1KLUD 4O1NA 3A9KB 3FTEA 1N33M 3SASA 1MU5A 1V6EA 3PO0A 3PZ7A 1R7SA 2WXNA 3RNFC 2UXBM 4GHAA 2CWBA 1YQBA 2B76B 2XGNA 5ITTA 2FYEA 2M0XA 2KANA 4AJYB 5DPRA 3ERVA 2DI0A 2JT4B 2WXIA 3IFWB 1M6DA 1E7PB 3U6LA 1SBBB 3AE1B 2IY0B 1UM8A 1WGLA 5HKHA 5G5HA 2DOSA 4W5BA 3WXEA 1GJZA 4W9HA 1UH6A 4MH0E 1PGYA 3U61B 2K9DA 1BY8A 2NTSA 2KVRA 3PS6A 2LHCA 4GXBA 3VTUA 3H89A 4II7A 4FA6A 1CJLA 3E56A 2GRIA 1TY0A 3QYEA 4PDGA 5FTNA 3KP1E 3VK8A 2AWTA 3Q8GA 4FCVA 4ICVA 2P5TA 1F2RI 3E21A 3AM9A 1TR8A 4W9FA 5E6NA 1CPJA 3IOQA 1PCIA 4G3XB 2JRIB 1YT7A 3VRBB 2RGHA 3W9CB 5F3WA 5EP2A 2AIMA 2NBVB 1HZ5A 4XDDA 2RSUA 4P6GA 4DV6M 4XWTA 1MFWA 3NOBA 4GITA 4AQYM 2LFIA 2OHFA 1EWOA 5EP4A 3HHYA 1EWLA 4M9SA 3R7QA 4DR4M 1AU0A 1DKIA 1GUAB 4RMAA 1ZGUB 3KFUG 4QRGA 2V6ZM 2WGSA 1D6EC 1YJJA 3WALA 1TT5B 4M9ZA 4GDLA 3RZWC 3GQ4A 3HWSA 3I4YA 1V49A 2HH5A 1JW9D 2BB5A 1PPNA 3APFA 1F9JA 2J0MA 2KACA 1WJ7A 5ITYA 1QDQA 1YOVB 2XU5A 1EF5A 1N5XA 2C98A 3ZCBB 3RUIB 4IBCA 3ENEA 1PADA 4E71A 5IP4D 3PPAA 2KD0A 2ZTCA 4I07A 1D2NA 2QC8A 2KFKA 2DAGA 4FCTA 5G55A 2YQZA 3PZ8A 2BJVA 3VUYA 3GLFA 5BMIA 1DEUA 1P7FA 1GECE 4XE0A 3UINB 4CDFB 1WZ3A 1XEEA 2FIFA 3AEAB 3GCBA 2E5LM 3KLSX 1WI0A 3SAWA 3CGWA 4B3SM 3L10B 4K7UA 1HTOA 5EXXA 3APCA 1J7CA 4ITKA 3HGIA 4M01A 2G4DB 2DZIA 3DBHI 3AI5A 4L8RC 3LJ3A 1WXMA 2KXEA 4CIZA 3O65A 1IBKM 2WXOA 3PZDA 4LJPB 4DK5A 1ISNA 2YNMD 2I2YA 4XDCA 2R9CA 4P6VF 1LTMA 1Q1OA 1VD2A 3C19A 2BB6A 2G3QB 1ZUD2 1IY1A 5EJCA 2M5ZA 3W68A 4NL4H 2K6DB 3TL4X 2DENB 4GU2A 5H92C 2KWVB 1NHWC 2BW2A 1JR3D 4AOFA 3OF8A 3K92A 1YD8U 4LF8M 2OOAA 2JWZA 2JXXA 3AOEA 1L2DA 1SG9A 2HD5A 1RAXA 4BBNC 3Q8XA 1K50A 2WYQA 4GLSC 1YIWA 3EECA 4N9F4 3SFEB 1K51A 2XSZA 4B08A 3PVSA 2QIEB 3P4SB 4HWIB 4I04A 1KXRA 2JVCA 4EUTA 4L16A 1SIJA 1EUVB 1VZ8A 3WXGA 2HJ8A 1N36M 2ZCCA 2LVNC 4CGYB 2BVCA 3PRMB 3RNEC 1MIRA 4KKIA 4FWGA 3FUVA 1WZ0A 3HU2A 1Z59A 5AUKA 1L8QA 2L7HA 1WJNA 1EWMA 4JWSC 3EIHA 1N6ZA 1H6UA 2MR9A 1AWDA 2X49A 2LI5A 3R2TA 5EGWA 1NI3A 3VFDA 5IKCM 3U6EA 5I4DA 2ACZB 2Y20A 2O6VA 1KFVA 3AEDB 3D8LA 4GN1A 1V5OA 3ZJUA 2G6DA 3HWNA 4QOZC 1C78A 2JRHA 2LHEA 4MT5A 4K1RB 1F2BA 3ZNID 1U4AA 2RPQA 3L17A 3AU5A 4JI2M 4HVBA 5LMNM 3C9EA 2JZ0A 2MHJA 2J7QA 1VR9A 2MP2B 3LCUA 2R2OA 4PYUA 1R7RA 2YEPF 2A4ZA 4HEA1 5D3DA 1L0XB 3NVZA 3HM6X 2NPTB 2DAMA 3T8MA 2YFQA 2QNJA 1DGHA 4YVAA 2EKKA 1MHXA 2W3RA 2CHXA 2F5PA 1QDRA 1WHCA 1VRAB 3QK0A 3PREA 3N3KB 2HXZA 2MX2A 4N4ZA 2L7IA 1P3QQ 2HKJA 2HWKA 4DBGA 1SXJE 2V3SA 3LYYA 3P1MA 1TF0B 2AHMA 9PAPA 3Q3NC 4D8IA 2Z3XA 1PDXA 2DKLA 4W9CA 2GBRA 3A42A 3PXGA 2AX5A 5C2TB 4CDCB 2QPAA 1TIFA 2ZCBA 4XBOA 3FKEA 2DWMA 3AV8A 3RNVA 3B89A 2JZ3B 4DV5M 2R9NA 1IUEA 4MM3A 4NOOB 2J0JA 3Q2AC 3EA6A 2IBIA 3DBHB 1WGRA 2PNSA 1Q5WB 2B1NA 2R9MA 1ICFA 2LVQA 4IBBA 4DR3M 1CS8A 4WQOB 2XSZD 4RFBA 3B21A 3HJ8A 5ITUA 2N1VA 2ARYA 5FPWA 1PJQA 3ABVB 3L4PA 4WJQA 2AYOA 4LG2A 1TGZB 1AU3A 5J2RA 1JQPA 2N9LA 3HU3A 1HE8A 5D6JB 2DAIA 2ZM6M 1SE4A 3PNRA 2LXCA 3UIPB 4DDGD 1WH3A 3D8BA 1TZ1A 2MBEA 1T3QA 2L0TA 3IUTA 3K9OA 2WXJA 4KSKC 4KO8A 5AZFA 3KSJA 4RF1A 1TH4A 2VZKB 1B9RA 5IAAC 1G6JA 1NB3A 2G1EA 2BU3A 1KSFX 2LH0A 2HHNA 1NV8A 1L2CA 3DQVA 2C96A 1V8CA 2O5RA 1NEKB 3DDCB 3I01M 1TLOA 4D8EA 4IIWA 4NY0A 4X64M 1NHGC 1D5XC 1QUTA 1OEYJ 1GB1A 4IWQA 4ZYSA 5K16A 4ASWC 3MHSD 4NJ7A 3TE6A 2FUG1 3OLMD 3VH3B 4FJCA 3J80S 5KO3A 1K3XA 3HX3A 3KOXE 4IM2A 2WWZA 1H4RA 4I6LB 3FRHA 4DV4M 3JW0X 4JIOU 5DPWA 4DMYA 1WGKA 2JY5A 2J53A 4B0MA 4HKZE 3RFZB 3FUTA 4EZJA 4LLGM 2BJWA 1WJUA 3W0FA 4ZYNA 3DF0A 2M56B 4ITQA 3KW5B 3GPXA 3MORA 2Y5CA 4G3OA 3NZ3A 1R2YA 2KA6B 3TJPA 2QZ4A 2BGFA 2L32A 1SE9A 2MRPA 1G4AE 2YJCA 3W2DA 1YN3A 3LQRA 1WGDA 4DDID 2KDEB 3F5VA 4MSQB 4FCWA 2B1MA 3GP1A 1WY8A 2CRUA 1ZAEA 4HCNB 4FK5A 2OJWA 3GPPA 1XCTL 4I81A 2WXPA 5MPOA 2YJ9A 3HJQA 4FJYA 2GFOA 3VHTC 1TGUA 1WGGA 1RFKA 3EGRA 3C0RA 1T6BX 5JXVA 3MFGA 3O0UA 4HWYA 5L8RF 4K7WA 3KYCD 4W9KA 1PXVA 3DFZA 5F02A 2WHIA 4L15A 1D4BA 2DJFB 4MGHA 1L2BA 3PLUA 1E8ZA 1OKSA 1W5TA 4M9XA 3RVWA 2LHGA 4A3VB 2BYVE 1XXGA 2RKOA 5HHDG 3RNAC 1YJIA 2LVQD 3QAQA 4M8MA 1EIJA 4LNNA 1HNZM 4Z8XA 4FN2A 1E0ZA 4Z6YA 1WX9A 1RRBA 3BK2A 3KKUA 3NY5A 3PGEA 1HUCB 4DXAB 4WH4A 4G4QA 3U2SC 2PVOD 3RPFC 4FJVB 4OW0A 1IWDA 3A4SC 1Y4HA 4LJ9A 4KIKA 1YX6B 3OVZA 4MGYE 1R4GA 4GOCA 2RRUA 1OIZA 1TTNA 3AEEB 1P0RA 1PQSA 2EA0A 2K5PA 3MHSA 2XLJA 5TSSA 1QAQA 3VTWA 1EU3A 3W0LB 2K25A 2MH8A 2HJ1A 3L2AA 2LVAA 2MH7A 3CMMB 5ITQA 2VQEM 3ZJTA 1SJHD 3OVXA 2FNAA 1WF9A 2RMMA 3TRKA 2R18A 3PRPA 2ERCA 1PJSA 4ZDVA 3PSEB 2DNAA 2DCDA 5BMGA 2KQSA 4ANXA 3A9JB 4RF0A 4HK2A 2CFOA 1NJGA 4IWPA 3N3KA 3DZDA 2MJ5B 4P1CC 1N78A 1QMYA 1FMAD 3RNBC 2L6OA 2DYOA 2MJDA 1CK1A 4PADA 2WDTB 4IM0A 2JY6B 4DHZB 1ZIVA 4XZXA 3B1LX 1XD3B 1A5TA 3NVYA 1HXYD 3GE8C 4RGOS 4CJ6A 4R71A 3DVGX 2EKFA 3PNVA 3B2FA 5FK9C 3APDA 4B3TM 3UJNA 1RM6C 4MSXA 2DWQA 3HKPA 4GMQA 3PBHA 2DZOB 4ZOHC 1AYUA 1GO5A 2ZW0A 2K8HA 2MGWA 4Q8GA 3DCGA 1WM3A 2QCUA 2JWSA 2KYWA 2R44A 3E46A 3QX1A 2INDC 4LTUA 3OISA 1X37A 3EHVA 1GKIA 4BBAA 2A5UA 5T8IA 4GDKB 3GQ5A 3MC0B 4A3PA 3P5WA 2HL7A 3M62B 3BYYB 2F1GA 4ZRQA 1GL6A 5FTLA 1KM7A 2UUAM 1GLOA 4JWUC 1YN5A 2IO3B 2ZAOA 4CZWA 3HY5A 1FXIA 5FLXS 2WXGA 5GKNA 1QOLA 1E90A 1S4VA 1FEHA 3I3TA 3GRYA 3BBAA 1E8XA 2LASA 2DZZA 2DC7A 3TEYA 2IJ0A 2NQIA 1F0ZA 2APLA 1WJ4A 1VQ1A 2PTLA 3UMMA 3LW5F 1EE8A 1LGRA 4KHPM 3VRAB 4RY2A 1MDWA 2LWXA 2MBHA 4X66M 2KNZA 1KFUL 5IT9S 3IV2A 2C5LC 2DLBA 4BS5A 3KYDD 4LJ5A 1MS6A 1UD7A 4QAYA 2DAFA 1Q39A 3BWUD 2A5YB 4NXNM 3PNYA 3L16A 1WX8A 2LJ5A 4I6PA 1KTKA 1UELA 1J8CA 4Y28F 1VEJA 2VZKD 3M63B 1GB4A 1G3IA 5ITRA 4BBNF 2C7MB 3KVWA 3DVNU 3ZXRA 4XR7A 3O13A 2KJRA 3TEZA 5JI3E 4ZPXA 5BYRA 2JQRB 2VHFA 3SHGB 3GLGE 2WXRA 1GABA 3H4MA 2DZMA 3VLFB 2LVPC 2F5SA 1Y56A 1E6EB 1DF0A 3GLFB 2DBYA 4OEMA 1L6UA 2LVOA 4DHJB 2N7EA 1N34M 1R4MI 1ZKHA 1Y8RC 3AFHA 1V1OA 2WXKA 2V1UA 4LF9M 1WXAA 2IY1B 4PS8A 3L26A 4LJAA 1TH2A 1AUAA 5LXIB 4W5WA 3R7RA 1MVKA 4LF4M 1WMHB 3V6EB 2DWNA 3E1ZB 5EZQA 3VKHA 3IECA 4Q8HA 3VUWA 4B6WA 3VVWB 1BT0A 1Y08A 1F2AA 2AUXA 2AL3A 5DYIA 4LF5M 4AI6A 4BOQA 2D07B 4G54A 3A33B 4LDTD 4AXMA 2O01F 4QNRA 3I63C 4FXCA 1D0MA 2MWSB 3LMMA 5D2MB 1G71A 2NBWB 1HQYE 3KSXA 2DC6A 1CTEA 3IEJA 2L3ZA 2PW9A 1XLPA 2NMQA 3GO8A 1SJED 3TCAA 1E5WA 3V6CA 5DFLA 3VTVA 4GKJM 4USAA 4CHTB 2Y0TA 2L1AA 2FOIC 3L54A 1YMHE 1OQYA 2XF3A 8CATA 1F77A 1N32M 3HHMA 3U5ZB 3TBLD 8PCHA 1JWUD 2BWFA 4YYUA 4HLEA 3MHHA 2CS4A 1QAMA 2KK8A 3SMPA 3P4RB 3MHZA 3MC8A 1V33A 5KQ8A 1ZDVA 3UIOB 2LNHC 3CIRB 4JI8M 3VUXA 3WXFA 3IVFA 3NHEA 2LGYA 4ACFA 4HKQA 1NV9A 4C7YA 2JXTA 1AECA 1Q0WB 4MGKE 4GH9A 2KO3A 3P5VA 2QHOB 1DGHB 2PVGC 2NPTA 1L7YA 3LFYA 3VK7A 4TUWA 4C00A 3FC4A 4J3OD 3GP7A 2M4NA 1UBQA 2PE9A 2PADA 4OELA 5AEKB 1G8PA 2KZRA 4NXMM 2G9HD 2JRIA 2KRKA 3LXFA 3D32A 4N58A 3CF6E 4KV2A 1HT2E 1D5ZC 3HRDD 1TS3A 2WXLA 2NVUI 2NQAA 4A3OA 3R2IA 3GLGB 2BS4B 2E3TA 4MZSA 4PDIA 2DAEA 1GC6A 1X9YA 3SHQA 3DOWA 1STEA 5JA7A 1WGYA 3RD2A 4AXLA 3AU4A 2REXA 2GI9A 2INPE 3IG8A 4TV3A 2AUZA 3RULA 2CB5A 2YVCA 3NZSA 4LF7M 2CV2A 1YJ1A 2UU9M 4KSLC 4TUUA 2X8AA 1YLAA 2GBMA 1T5XD 1XCQL 2MQJA 2CJOA 2C7NB 3KXEC 4JI4M 3FUUA 2BYFA 2LZ6A 1MHHE 3V61A 4IUMB 1WYGA 4LDTB 2ZANA 5JI2E 1ATKA 4QHTA 2N7JA 2WDRB 3BYTB 3MTVA 1Z5SB 3AE4B 5H37D 2I7NA 5EQTA 3BOWA 4IM3A 4MGZE 1KRHA 4YYVA 3I06A 2WZJA 1QZMA 3K8UA 3RZFA 3BWKA 1NVMA 4NJ6A 3FKYA 2HTME 2FS1A 4HL4A 3UGJA 4FULA 2DAKA 4GHLA 3ZUNA 3V05A 4LNKA 1DO2A 3U7ZA 1FCCC 5IA7A 1HR0M 5LLIA 3E9SA 3VKGA 1GJTA 3IHPA 2LGSA 1OAOC 2Y0QA 1N5WA 2K8CA 1D0KA 4GC5A 3Q3JA 1PPPA 3AE3B 2FUHB 3PHUA 4LJ8A 3NVWA 3BVGA 5D7GA 3CF2A 4HPLB 3NJTA 4MSMB 1DO0A 1WE6A 3AI8A 1ACCA 4CYEA 2R45A 3Q3FA 1JWBD 3OJ3A 1RFAA 2GOWA 1L4ZB 4PS7A 2JUOA 2IBIB 1P3QU 3HUIA 4A6QA 1SIFA 2JXNA 1IXSA 4BOZA 2V4LA 2K39A 1XWIA 3TWMA 3VDUA 4IBKA 2OO9A 4I05A 2GLSA 5KHQA 4P17A 4BVUC 1CMXB 1J5EM 1KHQA 2UUCM 2BYEA 1OFHA 4DUZM 2HTHA 3ZTCA 4IC7B 4DXGA 2ASQA 4MZOA 4XGAB 2XU3A 4YTMB 3SD5A 1M4VA 2D3BA 1TYGB 3IG3A 1FRDA 4W9GA 4BOSA 3GLHB 1UGMA 2NR2A 1E10A 2MBOA 4C80A 4IBEA 4C4VA 5G2NA 3TEXA 3BVZA 1XB2B 3ZKJC 2AYNA 2R4EA 2F4VM 2D3AA 3J7BA 3RNCC 1XNQM 1A70A 3R3MA 4WAFA 4ARCA 2WP9B 2L2DA 4K81A 4HRSA 2M60A 3GOEA 3FYDA 5C3JB 1YALA 2K22A 3K9MA 1BMLC 4PK1A 1V86A 4LFCM 1TS4A 2AGAA 3DBRI 1JWAD 3M0EA 1IY0A 2BNKA 1CUKA 1VSNA 5TR5A 3SARA 1QQRA 2R4JA 5IN7A 3HD3A 4XC2A 1VJKA 4I5SA 2KFJA 3M95A 2MCNB 3I4VA 3RI7C 2UZJA 3KOYE 4FBJB 1TH3A 1K3BB 2WQYB 4G6ZA 1X1MA 2I1KA 1EF7A 1K53A 2EJSA 4LY6A 2UWQA 2WSCF 4YYSA 2RDBC 2N7DA 3EFCA 3EC8A 4GB9A 2GNOA 5DCNA 4N59A 3ML9A 3ZRFA 1CSBB 2ZVOA 4EZLA 3CF0A 1IGCA 5EE0A 1OFFA 3N20C 4P6EA 1Q3CA 4G11A 2H88B 2V3PA 2OULA 3TQSA 3KOWE 3RGPA 3AV0A 2XNAC 1EM7A 5EE3A 4QH6A 1I42A 2X38A 3GB1A 1OJLA 4ZRJA 1KFYB 1YQ3B 2G8JA 4CISA 1FRRA 2ZBKB 3QWLA 3IAM1 2Z4SA 2SEBD 5FR6A 1GAQB 3LB8C 1PRBA 2ZAMA 1ZMVA 1XLOA 2HAKA 2R6NA 3RVXA 3RE8A 1Y8GA 4DHJD 2PPHA 2LJIA 3V60A 4S0RA 1AU2A 1J0GA 1QT9A 2VIIA 3W31A 3C3EA 2KN4A 1R2ZA 1WIVA 3GZNI 3M3JA 3VH4B 2BDZA 2VH2A 3KSEA 4HJGE 3LDZE 1GOZA 2UYZB 1CQVA 1B1ZA 4Q7JA 4X6IA 4AP4C 3CSFA 3KUZA 5EXSA 2VHSA 2HDEA 3IBEA 1PGXA 3D6SA 3J81S 1WWTA 3QHTA 4FADA 3TPZA 1D0LA 3ZDTA 4KGTA 3NBIA 3E4RA 3ZNZB 1PBHA 3I9V1 1T0YA 1WE7A 3F75A 2VQFM 4KT0F 4AKHA 4EOYA 1N77A 2BWES 2WDVB 3AN1A 4HROA 2DAJA 4AUQC 3P5UA 3RCZA 2FUDA 1WM2A 2KLCA 4JV5M 1F2CA 1J19A 1MG4A 2K0BX 2JSVX 2LEKA 2XEWA 2KHHA 3TMPA 1NBFC 3KH0A 2GBNA 2IPPB 2EUCA 4P7IA 2NCNA 3W30A 5FR3A 4QNMA 2C5RA 3ZO5B 3DHHC 1SXJD 1L5PA 2G8LA 4GDKA 3HU1A 2KHWB 4EEWA 4JPSA 1YNTE 4LFBM 4S17A 3UI3A 1U9XA 1FNWA 1IGDA 2LXAA 2CHZA 1V80A 2Z4RA 3RNGC 3SU8X 1J7AA 2K9XA 2FFJA 3SEBA 4L4UA 1PVJA 1GPXA 4KZCA 2BTWB 3IHPC 1L4DB 2WDQB 1ZXIA 1CV8A 2B3AA 3JR5A 3HHAA 2F5OA 2LMCA 2YEPB 3L25A 1FFUA 4I8OA 1IBXB 2FCMA 2O25A 1ZP0B 1C3TA 2KWDA 2D10A 3LVVA 3HHZA 4M02A 1POPA 1T43A 1V1PB 3W5UB 3HZJA 3ZVVA 1C7YA 3HHWA 3K8ZA 4OZCA 4HXDA 1AYWA 2KTFA 2C9WB 3CBKA 1FD6A 1I4XA 3N1XC 1TY2A 1ZOYB 3GLIB 1JALA 3LXSA 4LK0M 2AQ1B 3R66C 1SXJC 5E6OA 1VEKA 3GRRA 2XBBC 2DHRA 3FYCA 1V97A 2Z84A 3DVGY 1VDVA 2LGDA 2HCBA 3I3TB 3QA8A 2JQGR 2DZNB 1HEZE 3MHVC 1QLBB 2KWCA 1QILA 3TUOA 5PADA 2F5NA 2R62A 1YK8A 1I4RA 3TL5A 1Z5CA 3C58A 4GSWA 1E7UA 3THGA 3WHLA 3MTNB 2J7NA 2Q2EB 1R4NB 5J94A 2MROB 4DQOC 1PUTA 5EP1A 1Q3BA 3AE5B 4DBGB 1P9DU 1F29A 1AIPC 4D8BA 4JN6A 1YN4A 1UFZA 4AKIA 3AE8B 1PPDA 4BOPA 3B9PA 1OAIA 3VFKA 3WAMA 1XQQA 1ME3A 1VLBA 2R2QA 1JROA 2PMVA 2LBCA 1S3SA 4B3MM 4BOUA 3CTWB 4L23A 5DYGA 1K82A 1XXHA 4RNAA 2OOBB 1YSYA 1DGFA 4N8WA 3M7GA 3U52E 2FE8A 2JZ1A 2H5XA 1KHPA 1NYRA 2K1FA 3SC3A 3BZDB 5EDSA 2WBFX 2DZKA 4WQMA 4FHJA 4F7ZA 3BPFA 3DHGC 4PI3A 4WWOA 2J7QB 5JZEB 3Q3MC 3ONSA 5AZGA 1XMOM 2JP7A 1N60A 3Q6BA 3C3DA 3QYBA 4QOSA 4PYZA 1C9FA 1Z6TA 5EE9A 3DVNV 4FD2A 1JWSD 2C60A 3QWZB 1ZQ9A 2JU6X 4OZAA 2B3TA 3N1YC 2KNAA 3VR8B 1KF6B 2FCNA 2QDFA 3VDZA 2W9NA 4DUYM 3CH2X 3U8ZA 2I1JA 2NQDB 1TKGA 1TDZA 1DGJA 2YLMA 4HPPA 4DV1M 3DPDA 2L52A 3ZQ4A 1OTRA 2DXIA 1QOFA 1R5LA 2ZPYA 2MSED 4B7FA 1TDHA 4IBIA 4WWNA 1WXVA 2DCBA 3HVZA 2VF7A 1GG3A 2Q5WD 2RDGA 1PPOA 1OGWA 4GMVA 4MB7A 3Q8CA 3SFZA 4LCBA 2CE7A 2F5QA 1ET6A 3Q8EA 1IN7A 2N9EB 2LGIA 4XWWA 1D3ZA 2M0AA 2PBHA 2I38A 3VXWA 3WAOA 3P5XA 2C99A 4IUMA 1F52A 1RU3A 3B7QA 1FNNA 1WR1B 3U60B 4CHKA 3DBLI 4KKJA 2V0GA 3KX1A 2ICIA 2V9HA 5IOIA 2G5GX 1JRUA 3N4CA 2DENA 2J0KA 1SSNA 1WYWB 1Z5AA 4B7GA 4PCZA 1WFYA 5JH3A 3ECIA 2OEDA 1ITOA 3X23A 4YTNB 2V1YA 1K8RB 1DOIA 2I7PA 5IZ7D 1IP9A 2WLBA 4YHHM 1KJTA 4YYQA 2FTDA 5JHBA 1CQDA 4WA6A 3BVMA 2XFTA 4R3DA 3GLHA 3PTFC 2OP3A 2QEJC 4TQ0A 2KN5A 2DCAA 4OVUA 1VEGA 3MJ5A 3HJSA 1GJSA 4DWFA 1ZCMA 3A98B 3P42A 1C1YB 1KOTA 2WXQA 3ZXVA 1LXDA 3PFIA 1SE3A 4MDKE 2WSEF 4RGMA 4EIWA 2KMAA 2ONQA 2HHHM 4LJ4A 4J6IA 3A45A 5L83A 2P86A 4RGNA 4ANWA 1NNJA 5G5GA 4LJ7A 1R4NI 4BFRA 3DHIC 3RYTA 3BBZA 4N79A 1XO3A 4XYCA 3FUXA 3OF9A 4YYWA 2OQ4A 3QCAA 3VDPA 2DZYA 2MW5A 3OAWA 4BOZB 1QUSA 1WRIA 1P1AA 3BC3A 2D11A 4FIPA 3V76A 4XUIA 3NHEB 1FFVA 3L0WB 3VQIA 2JZZA 4B9KA 5JH5C 2Y5BA 2R46A 3H7PB 2Y3AA 3A1QA 4EZKA 2BWBA 3KQ4A 4UDUC 3IT4B 1YE9A 4GKKM 3K1JA 4ZRIA 3WHKA 3ZTDA 1NY6A 4WJPA 1ORYB 3U5ZA 4D2KA 1UUPA 1RLFA 4RM8A 3ZLZA 1EWCA 2C0YA 3BOSA 4LF6M
chains in the Genus database with same CATH topology
1FNVA 1XNRM 1CJEA 1HA5A 1C79A 1HNWM 4XGIA 4L2YA 5FSWA 1XHBA 4REZA 1GLNA 2JYTA 4A90A 4B3RM 1W5SA 5FTJA 2N9KA 3DWGC 1IXZA 4MACA 4FWDA 5GXGB 1DYQA 5IREB 4YY3M 3NRZA 1VZ7A 1NNUC 4WIPA 4B0EA 3GQ3A 2KZSA 4OHJA 1IBMM 1UKFA 3AL0C 4NRVA 2V3NA 3KOZE 3T38A 1XLQA 4DR6M 1BXTA 4ZRPA 4YSYB 3U4EG 3SHFA 4D82A 4BB9A 4R7GA 1N62A 4B7HA 3QAUA 1L0VB 3B9JA 1SXJB 3UZUA 4NAWB 2K47A 5EP3A 3IT6B 3J27B 2DYMA 2INNE 4PD2A 4LZZA 2JYEA 4MH8A 3AMZA 2WXMA 1JMLA 1IBLM 3HVDA 2EO2A 1J7KA 1GL7A 4WW0A 2D7EA 4AW4A 3U6PA 1YUBA 1E94E 3IFUA 1ET9A 4US8A 4JI0M 1ZPSA 2PIAA 4A9AA 3AE7B 3DWMA 2JWUA 3FTDA 3BK1A 4TMAB 5BPVA 1FJGM 3U6MA 2KAJA 1JWMD 4IJFA 3J9CA 2WS3B 4KODA 4AQ7A 4AS1A 5HI1A 2K3UA 2QBYA 3OTOM 3PT2A 1QAOA 4MGIE 2D5GA 1JQJC 1TS2A 2BT6A 1SXTA 4YWGG 5BYQA 3JR4A 1FO4A 1LO5D 1P7EA 1TKEA 5D3IB 5EE1A 2J7QC 3P4QB 4WWMA 4IOIE 2J52A 3L27A 3RGSA 3SFDB 3ZH9B 2AQ3B 2XZUA 2XZFA 2E6XA 4OVZB 2QP9X 3CWIA 5FKAC 4OU7A 3AEGB 3A46A 3T1HM 2AQ2B 1AYFA 5FTMA 3PRMA 3C8YA 1UWMA 3BIID 3ZYYX 2IGHA 1J7BA 2CHVA 3WCQA 4AKGA 4G4NA 3GLGA 1EU4A 3B2GA 3MP9A 1RWSA 1YQ4B 3GRVA 2V4IB 4ZTBA 2CUZA 4IJEA 3M6AA 2RDHA 5KPZA 4GUAA 2PKOA 3TWLA 1HZ6A 3SBJA 2MJEA 1PJJA 4LGMA 4YXDB 4K0KM 1PJIA 1XMQM 1C4CA 1L0YB 2KEBA 1L1TA 4FW9A 1YZBA 5EZSA 2J42A 4GDLB 4KGSA 1BUIC 2JX5A 3PSEA 4JX1C 2IGDA 2CU3A 2IDYA 2C9OA 4DR2M 2UUBM 2C9CA 7CATA 4JE3B 3SAVA 2MEKA 2BTEA 3T1YM 3Q69A 1SEBD 3FAHA 3KS4A 2EELA 1QKZA 3MK6A 4IP3A 3UK6A 2QMTA 4DR5M 3T3NA 4PT5A 1TKYA 5C1BA 4DV0M 5AUIA 5FTKA 3GRUA 1IN8A 3RFWA 4KX6B 4X62M 5JZEA 2J4XA 3TWKA 2WNMA 1E9MA 2IGGA 2R65A 1L1ZA 3AKZA 2J7OA 1SF0A 1XLNA 4LRTA 1RYJA 4OVZA 3ETRA 4NAMA 1PFDA 1UWXA 2WXHA 1ZE3D 4JYAM 1TS5A 4NRWA 4AZFA 1I7HA 3KWLA 2BS3B 1I4QA 3K2LA 4YT0B 3GPYA 1C1KA 4RGTA 5IWAM 4N6EB 1C4PA 4G4OA 1J09A 1IBXA 2QENA 4YSZB 2H1RA 1LV7A 1ESFA 2Z8LA 3KDSE 3GPUA 3NS1A 5BR8M 4AG5A 4EE2A 3KWVA 2XEPA 4KLNA 1OQRA 2CJNA 3U6CA 3LQQA 4NJCA 3AOEC 1PGAA 4BLCA 3NWLA 4LJ6A 5ITXE 4IBDA 2IPKD 3SR6A 3AJIB 5BMHA 4X65M 5HFYA 4A5UA 4P16A 4DXFA 1JQ4A 3FILB 1DOXA 4WURA 1E32A 4RCOA 2M19A 3DOAA 4ZHOA 4NSOB 4OX9M 2MJ3A 3T3OA 2WU2B 2DWZB 4JI1M 1N63A 1V1PA 2EKIA 1HQRD 5EXPA 2QSDA 1FCLA 1Q10A 1PGBA 3U61A 1GVNA 1QYRA 4IBJA 3AE6B 2OPFA 4QHSA 4DR7M 3PHWA 1KLGD 1PM5A 2K0PA 4A8XC 5A2QS 1I4HA 2V1CA 1C77A 3I51A 1MPEA 4HXDB 2JA2A 4GC9A 2UXCM 4LRSA 4I4LA 3NUHB 1IN5A 1QANA 1I4GA 2R61A 4HLQA 4G4RA 3SATA 3V3XA 3OWEB 2BTWA 1PYWD 4TQ1A 1UNSA 4IKGA 3JAMS 4GRIA 1WSPA 1VZ6A 2W55A 2Y5PA 3U60A 3DA1A 1ROEA 1FXAA 1E9SA 3LVWA 1FM0D 3FD9A 2JZPA 1IXSB 5DNYA 1DGGA 2XFSA 2N0SB 1N61A 2JTCA 3P4PB 2ZW1A 2W54A 5LMUM 1ZDXA 2CHQA 2KMMA 1NSFA 2KZUA 2DVWB 4L78A 1I94M 1NYQA 1SXJA 3W5VB 3H8HA 4LZJA 1K52A 3ZJVA 1AN8A 4DR1M 1WXQA 2NTTA 3HHXA 5EXTA 3IXSA 4C56C 2L09A 3N9YC 1AW7A 1MX0A 3URYA 1CZPA 3MP2A 1DGBA 3T15A 2D7GA 3AEBB 3R8FA 1L6VA 3IG5A 2LXEA 3AEFB 3GLIA 4KGRA 3AE2B 1R6BX 1C4AA 2W3SA 2TSSA 4US9A 2KW0A 1I4PA 5E6JA 4JI3M 2PLPA 3SMSA 4MI7A 5KQDA 4JI5M 1FNUA 2QJLA 1QF6A 1DOYA 1IXRC 1C76A 1SB3C 1IN6A 2BYTA 4TSSA 4NSRA 2QBYB 3NVVA 2CV1A 1KH0A 3BB7A 1VDDA 1IN4A 1JRPA 1QOGA 3FTFA 1N75A 1HNXM 4NZLB 3FTCA 4Q2JA 3U6OA 1IY2A 4ZHPA 2UXDM 3ZC7B 2SAKA 3FILA 3AE9B 3KS8A 4OZBA 1NY5A 2FBWB 5KPRA 3TSSA 1QVRA 4RH6A 3SAUA 5BYSA 1QQWA 5KPTA 3SYKA 1QOBA 3SYLA 3OQCA 1HQCA 2RGOA 1F2RC 2DWLA 3AB5A 1NENB 4M0DA 3PHXA 1OQQA 2CV0A 2LUMA 1KYIA 2Z7JA 1MI0A 4IDIA 4H2AA 2ON8A 4FVMA 2WXFA 3ZNHA 1IQPA 4S12A 1XC8A 3KW6A 3R9XB 3AH7A 3BY4A 3I57A 5C18A 5HG2A 3ILKA 2GB1A 1NJFA 4JI6M 2YR0A 2LHDA 3R8BA 1JCKB 2Y21A 4JI7M 3VR9B 1JR3A 1ENFA 3U6DA 1G59A 4MM3B 2XH9A 3IAS1 4C7ZA 1Z5BA 3J7AS 4DV2M 4AG6A 4DV7M 3Q8FA 4LGYA 3Q8BA 1IM2A 3U6SA 3Q8AA 4D80A 1NVID 4IBGA 2X4AA 3FUWA 1XF5L 5H8YE 5ITXA 4GIPA 1TJEA 2W82A 5E26A 3EUB2 2CEAA 1E9RA 2KDMA 1T3TA 1QOAA 3U6QA 1XXHB 1I4WA 1FIQA 3AOGA 2KQ4X 2BS2B 1EWYC 2WU5B 4YSXB 1D5MC 3W1SA 3L28A 1TZOA 1SE2A 1UGJA 2CHGA 4CQNA 4FWHA 4A55A 3P63A 3EIEA 2D7HA 4JXJA 3GS2A 1G41A 1OFIA 1HT1E 2L83A 2QILA 4L1BA 3L29A 4RKXA 2KRUA 3KP0E 2BBCA 5LNK1 3ZGZA 3TEWA 4IBFA 4ARIA 3J2PB 4D81A 2XN9C 1K3WA 4DV3M 1ZXHA 4LFAM 4YTPB 2NQ8C 2H89B 4M0WA 3AECB 1KLUD 4O1NA 3FTEA 1N33M 3SASA 1MU5A 3PO0A 3PZ7A 1R7SA 2WXNA 2UXBM 4GHAA 2B76B 2XGNA 5ITTA 4LF6M 2WXIA 1E7PB 3U6LA 1SBBB 3AE1B 1UM8A 5G5HA 2DOSA 3U61B 4MH0E 2NTSA 4II7A 3E56A 2GRIA 1TY0A 4PDGA 5FTNA 3KP1E 3VK8A 4FCVA 2P5TA 1F2RI 3AM9A 3VRBB 2RGHA 3W9CB 5F3WA 5EP2A 1HZ5A 4XDDA 4DV6M 4XWTA 4GITA 4AQYM 2LFIA 2OHFA 5EP4A 3HHYA 4M9SA 4DR4M 1DKIA 3KFUG 2V6ZM 1D6EC 1YJJA 4M9ZA 3GQ4A 3HWSA 3I4YA 1JW9D 2BB5A 2KACA 5ITYA 1N5XA 2C98A 3ZCBB 4IBCA 1D2NA 4FCTA 2YQZA 3PZ8A 2BJVA 3GLFA 5BMIA 1P7FA 4XE0A 1XEEA 3AEAB 2E5LM 3KLSX 3SAWA 4B3SM 5EXXA 4ITKA 1J7CA 3HGIA 4L8RC 2KXEA 3O65A 1IBKM 2WXOA 2YNMD 2I2YA 4XDCA 4P6VF 2BB6A 1ZUD2 1IY1A 5EJCA 2M5ZA 4NL4H 3TL4X 5H92C 1NHWC 2BW2A 1JR3D 3K92A 4LF8M 3AOEA 1L2DA 3Q8XA 1K50A 4GLSC 3SFEB 1K51A 2XSZA 4B08A 3PVSA 2QIEB 3P4SB 4L16A 1SIJA 1VZ8A 1N36M 4CGYB 4KKIA 4FWGA 3FUVA 3HU2A 1Z59A 5AUKA 1L8QA 2L7HA 4JWSC 3EIHA 1H6UA 1AWDA 2X49A 3R2TA 1NI3A 3VFDA 3U6EA 5I4DA 2ACZB 3AEDB 2Y20A 1KFVA 3ZJUA 3D8LA 4QOZC 1C78A 2LHEA 4MT5A 4JI2M 5LMNM 2J7QA 1VR9A 1R7RA 2YEPF 4HEA1 5D3DA 1L0XB 3NVZA 2YFQA 1DGHA 1MHXA 2W3RA 2F5PA 1VRAB 2L7IA 2HKJA 2HWKA 1SXJE 3LYYA 3P1MA 2AHMA 4D8IA 2Z3XA 1PDXA 3A42A 3PXGA 2AX5A 5C2TB 2QPAA 4XBOA 3FKEA 2DWMA 3AV8A 3RNVA 4DV5M 1IUEA 4NOOB 3EA6A 4IBBA 4DR3M 2XSZD 4RFBA 3B21A 3HJ8A 5ITUA 3ABVB 3L4PA 4LG2A 2N9LA 3HU3A 2ZM6M 1SE4A 3D8BA 1T3QA 2WXJA 4KO8A 3KSJA 4RF1A 1TH4A 2VZKB 1B9RA 2BU3A 2G1EA 1KSFX 2LH0A 1L2CA 2C96A 1V8CA 2O5RA 1NEKB 4D8EA 4IIWA 4X64M 1NHGC 1D5XC 1GB1A 4ZYSA 3TE6A 2FUG1 3J80S 5KO3A 1K3XA 3KOXE 4DV4M 1WGKA 2J53A 4B0MA 4HKZE 3RFZB 3FUTA 4LLGM 2BJWA 3W0FA 2M56B 4ITQA 3GPXA 2Y5CA 3NZ3A 1R2YA 2KA6B 2QZ4A 2L32A 1G4AE 3W2DA 1YN3A 3LQRA 4FCWA 3GP1A 1ZAEA 3GPPA 1XCTL 4I81A 2WXPA 5MPOA 3HJQA 1TGUA 3EGRA 1RFKA 3C0RA 1T6BX 5JXVA 3MFGA 3DFZA 4L15A 1D4BA 4MGHA 1L2BA 1W5TA 4M9XA 4A3VB 1XXGA 2RKOA 5HHDG 1YJIA 1HNZM 4Z8XA 1E0ZA 4Z6YA 3BK2A 4WH4A 4G4QA 3U2SC 2PVOD 3RPFC 4OW0A 4LJ9A 4MGYE 3AEEB 2EA0A 2K5PA 2XLJA 5TSSA 1QAQA 1EU3A 3W0LB 2MH7A 3L2AA 5ITQA 2VQEM 3ZJTA 1SJHD 2FNAA 2RMMA 3TRKA 2R18A 3PRPA 2ERCA 5BMGA 4RF0A 2CFOA 1NJGA 3DZDA 1N78A 1FMAD 2L6OA 2DYOA 2MJDA 1CK1A 4XZXA 3NVYA 1HXYD 4RGOS 3PNVA 3B2FA 5FK9C 4B3TM 3UJNA 1RM6C 2DWQA 3HKPA 4GMQA 2DZOB 4ZOHC 2ZW0A 2QCUA 4LTUA 1X37A 1GKIA 4BBAA 5T8IA 4GDKB 3GQ5A 3MC0B 2HL7A 3BYYB 4ZRQA 1GL6A 5FTLA 2UUAM 4JWUC 1YN5A 2ZAOA 1FXIA 5FLXS 2WXGA 5GKNA 1FEHA 3GRYA 3BBAA 3TEYA 2IJ0A 1F0ZA 2PTLA 3UMMA 1EE8A 3VRAB 4KHPM 2LWXA 4X66M 5IT9S 2DLBA 4LJ5A 1Q39A 3BWUD 2A5YB 4NXNM 3PNYA 1KTKA 2VZKD 1GB4A 1G3IA 5ITRA 3KVWA 3O13A 3TEZA 5JI3E 4ZPXA 5BYRA 2JQRB 3SHGB 2WXRA 3H4MA 3VLFB 1Y56A 2F5SA 1E6EB 3GLFB 2DBYA 1L6UA 1N34M 3AFHA 1V1OA 2WXKA 2V1UA 4LF9M 3L26A 4LJAA 1TH2A 4W5WA 1MVKA 4LF4M 2DWNA 5EZQA 3VKHA 5DYIA 4LF5M 4AI6A 4BOQA 4QNRA 4FXCA 3LMMA 1HQYE 3KSXA 2PW9A 1XLPA 2NMQA 3GO8A 1SJED 4GKJM 4USAA 4CHTB 2Y0TA 2L1AA 2FOIC 1YMHE 2XF3A 8CATA 1F77A 1N32M 3U5ZB 1JWUD 1QAMA 3SMPA 3P4RB 3MHZA 5KQ8A 1ZDVA 2LNHC 3CIRB 4JI8M 4HKQA 4C7YA 2JXTA 4MGKE 4GH9A 1DGHB 2PVGC 3VK7A 4TUWA 3FC4A 4J3OD 3GP7A 1G8PA 4NXMM 2G9HD 2JRIA 2KRKA 3LXFA 4N58A 3CF6E 1HT2E 1D5ZC 3HRDD 1TS3A 2WXLA 3R2IA 3GLGB 2BS4B 2E3TA 4PDIA 1STEA 2GI9A 2INPE 3IG8A 4LF7M 2CV2A 2UU9M 2X8AA 1T5XD 1XCQL 2CJOA 3KXEC 4JI4M 3FUUA 1MHHE 1WYGA 2ZANA 5JI2E 4QHTA 2N7JA 2WDRB 3BYTB 3MTVA 3AE4B 5H37D 2I7NA 5EQTA 4MGZE 1KRHA 1QZMA 1NVMA 2HTME 4HL4A 3UGJA 4GHLA 3V05A 1DO2A 3U7ZA 1FCCC 1HR0M 3E9SA 3VKGA 2Y0QA 1N5WA 4GC5A 3AE3B 3PHUA 4LJ8A 3NVWA 3BVGA 5D7GA 3CF2A 1DO0A 1ACCA 2R45A 1JWBD 1L4ZB 3HUIA 4A6QA 4BOZA 1XWIA 3TWMA 3VDUA 4IBKA 1J5EM 2UUCM 1OFHA 4DUZM 4DXGA 4YTMB 1M4VA 1TYGB 1FRDA 4BOSA 3GLHB 1E10A 4C80A 4IBEA 3TEXA 3BVZA 2R4EA 2F4VM 3J7BA 1XNQM 1A70A 4WAFA 4ARCA 2WP9B 4HRSA 2M60A 3FYDA 5C3JB 2K22A 1BMLC 4LFCM 1TS4A 2AGAA 3M0EA 1IY0A 2BNKA 1JWAD 3SARA 1QQRA 2R4JA 1VJKA 4I5SA 2UZJA 3I4VA 3KOYE 1TH3A 2WQYB 4G6ZA 1K53A 4LY6A 4N59A 3CF0A 1IGCA 5EE0A 1OFFA 1Q3CA 2H88B 2V3PA 3TQSA 3KOWE 3RGPA 3AV0A 2XNAC 1EM7A 5EE3A 2X38A 3GB1A 1OJLA 1KFYB 1YQ3B 4CISA 1FRRA 2ZBKB 3QWLA 3IAM1 2Z4SA 2SEBD 1GAQB 3LB8C 2ZAMA 1XLOA 3RE8A 2LJIA 3W31A 1QT9A 2VIIA 2KN4A 1R2ZA 4HJGE 1GOZA 1CQVA 1B1ZA 5EXSA 2HDEA 1PGXA 3J81S 1WWTA 3TPZA 4KGTA 3NBIA 3E4RA 3I9V1 2VQFM 4AKHA 1N77A 2WDVB 3AN1A 4HROA 4JV5M 2JSVX 2LEKA 3TMPA 2EUCA 3W30A 5FR3A 4QNMA 2C5RA 1SXJD 1L5PA 2G8LA 3HU1A 4JPSA 1YNTE 4LFBM 3UI3A 1FNWA 1IGDA 2Z4RA 1J7AA 2K9XA 2FFJA 3SEBA 4L4UA 1PVJA 1GPXA 2BTWB 1L4DB 2WDQB 1ZXIA 3JR5A 2F5OA 2LMCA 2YEPB 3L25A 1FFUA 4I8OA 1IBXB 1ZP0B 2KWDA 3LVVA 3HHZA 1V1PB 3W5UB 3HHWA 3K8ZA 4OZCA 1FD6A 1I4XA 1TY2A 1ZOYB 3GLIB 1JALA 4LK0M 2AQ1B 1SXJC 3GRRA 2DHRA 3FYCA 1V97A 2Z84A 1VDVA 2HCBA 2DZNB 1HEZE 3MHVC 1QLBB 1QILA 3TUOA 2F5NA 2R62A 1I4RA 1Z5CA 3C58A 3THGA 3WHLA 2J7NA 2Q2EB 4DQOC 1PUTA 5EP1A 1Q3BA 3AE5B 4D8BA 4JN6A 1YN4A 4AKIA 3AE8B 4BOPA 3B9PA 1VLBA 1JROA 2PMVA 1S3SA 4B3MM 4BOUA 3CTWB 4L23A 5DYGA 1K82A 1XXHA 4RNAA 1YSYA 1DGFA 3M7GA 3U52E 2FE8A 1NYRA 3SC3A 3BZDB 4WQMA 1XMOM 1N60A 4QOSA 1C9FA 1Z6TA 5EE9A 4FD2A 1JWSD 1ZQ9A 2JU6X 4OZAA 3VR8B 1KF6B 4DUYM 1TKGA 1TDZA 1DGJA 4DV1M 2L52A 3ZQ4A 2DXIA 1QOFA 4B7FA 1TDHA 4IBIA 3HVZA 2Q5WD 2RDGA 4MB7A 3Q8CA 3SFZA 4LCBA 2CE7A 2F5QA 1ET6A 3Q8EA 1IN7A 2LGIA 4XWWA 2M0AA 2I38A 2C99A 4IUMA 1FNNA 3U60B 4KKJA 2V0GA 2ICIA 2G5GX 1SSNA 1Z5AA 4B7GA 4PCZA 2OEDA 4YTNB 1DOIA 2I7PA 5IZ7D 2WLBA 4YHHM 3BVMA 2XFTA 4R3DA 3GLHA 2QEJC 4TQ0A 3MJ5A 3HJSA 3A98B 3P42A 2WXQA 4RGMA 3PFIA 1SE3A 4EIWA 2ONQA 2HHHM 4LJ4A 3A45A 4RGNA 1NNJA 5G5GA 4LJ7A 1XO3A 3FUXA 2OQ4A 3VDPA 1WRIA 1FFVA 3VQIA 2R46A 2Y3AA 3KQ4A 4UDUC 3IT4B 1YE9A 4GKKM 3K1JA 3WHKA 1NY6A 1ORYB 3U5ZA 4D2KA 1UUPA 1EWCA 3BOSA 2RPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  4RF1 A;  4REZ A;  4PT5 A;  2FE8 A;  4P16 A;  4R3D A;  3MP2 A;  4RF0 A;  4OW0 A;  4OVZ B;  4WUR A;  3E9S A;  4MM3 B;  4M0W A;  5KO3 A;  4OVZ A;  5E6J A;  4RNA A; 
#chains in the Genus database with same CATH topology
 2EMS A;  4YL8 A;  1FNV A;  1XNR M;  1NPZ A;  2MBQ A;  1CJE A;  4NQK E;  3HHI A;  1HA5 A;  2KFK B;  4DMX A;  2DZJ A;  3LCV B;  2JQF R;  1C79 A;  1HNW M;  4XGI A;  3W67 A;  4L2Y A;  1TL9 A;  2BKR B;  2QHO A;  2ZEQ A;  5FSW A;  1XHB A;  1XXH E;  2Z59 B;  4REZ A;  1GLN A;  2JYT A;  4A90 A;  4B3R M;  2ZZP B;  1W5S A;  5FTJ A;  2JNH A;  2CR5 A;  2N9K A;  2EKE C;  2DC9 A;  4NNJ B;  1VG5 A;  3DWG C;  3ZNH B;  1IXZ A;  3X0W A;  4MAC A;  2GQF A;  4FWD A;  4LJO B;  5GXG B;  4KIK B;  1DYQ A;  5IRE B;  2KVZ A;  4YY3 M;  4F2L A;  3NRZ A;  5CVO B;  1VZ7 A;  1NNU C;  1T0S C;  4WIP A;  4B0E A;  1AYV A;  3MC9 A;  3GQ3 A;  4IWO A;  2L76 A;  2Y6E A;  2KZS A;  4OHJ A;  3UQB A;  4XK8 F;  5EF4 A;  2P0R A;  1IBM M;  3B08 A;  1A6R A;  1TBE A;  1V5T A;  1UKF A;  3H1U A;  3AL0 C;  3H9D A;  4NRV A;  7PCK A;  2V3N A;  3KOZ E;  3T38 A;  1XLQ A;  4DR6 M;  1BXT A;  4ZRP A;  4YSY B;  3U4E G;  3SHF A;  4D82 A;  2RPV A;  3TNX A;  5CHV C;  4BB9 A;  3HK0 A;  4R7G A;  1N62 A;  4II2 B;  4B7H A;  1UBI A;  3QAU A;  1L0V B;  3A9K A;  4B95 A;  3B9J A;  5C1Z A;  1SXJ B;  2N4F A;  3DBR B;  4BSQ A;  3UZU A;  3S2A A;  4NAW B;  4EFO A;  2O6V B;  4K3B A;  2WX1 A;  1EWP A;  2K47 A;  1PJT A;  5EP3 A;  3IT6 B;  3J27 B;  2DYM A;  3KVF B;  2VF8 A;  2INN E;  2R9F A;  4PD2 A;  2DHY A;  4LZZ A;  2JYE A;  2M8S A;  4MH8 A;  1ZMW A;  3AMZ A;  2WXM A;  1JML A;  1IBL M;  1JB0 F;  3HVD A;  2EO2 A;  4YV8 A;  1J7K A;  2FQ9 A;  2K6Q A;  1GL7 A;  4WW0 A;  2D7E A;  4AW4 A;  5L95 C;  2MBB B;  3H8C A;  3U6P A;  1YUB A;  3PHX B;  2GBJ A;  3L08 A;  1E94 E;  3IFU A;  2LVP A;  1ET9 A;  4US8 A;  4JI0 M;  1H8C A;  1PIP A;  1OEY A;  3H7S A;  1ZPS A;  4G50 A;  2PIA A;  2L05 A;  4A9A A;  3AE7 B;  3DWM A;  3IMA A;  2X8X X;  2JWU A;  2KQ7 A;  3FTD A;  3BK1 A;  4GEW A;  4TMA B;  4ANV A;  5BPV A;  1FJG M;  3TMP B;  3H6S A;  3KUC B;  4K7C A;  1LM8 B;  3TIX A;  3U6M A;  2KAJ A;  1V2Y A;  4FLH A;  5CVM A;  1JWM D;  2QCZ A;  4IJF A;  3J9C A;  1JR3 E;  2WS3 B;  4KOD A;  2LRU A;  2KTR B;  1QDT A;  4AQ7 A;  4FJZ A;  4AS1 A;  5HI1 A;  5J17 A;  2K3U A;  2O6V D;  2QBY A;  3OTO M;  2NQG A;  2L8J A;  3PT2 A;  1QAO A;  4MGI E;  2D5G A;  1JQJ C;  1TS2 A;  1IFY A;  1V9J A;  1SXT A;  2BT6 A;  3A1Q B;  3JSV A;  2R6F A;  4YWG G;  3MMP A;  5BYQ A;  3JR4 A;  1FO4 A;  1LO5 D;  1P7E A;  1TKE A;  5D3I B;  3C9P A;  2E00 A;  1SNK A;  2NBU A;  1U9Q X;  2O2V A;  2ZJD A;  5EE1 A;  2J7Q C;  1T0Q C;  2D2Q A;  4W9D A;  3P4Q B;  3QC8 B;  4WWM A;  4IOI E;  2J52 A;  4NAW A;  2K8B A;  3L27 A;  3RGS A;  2FT2 A;  3KWB X;  3SFD B;  3K24 A;  3ZH9 B;  1AAR A;  4W9L A;  2AQ3 B;  2XZU A;  2XZF A;  2E6X A;  4OVZ B;  2CKH B;  1S3S G;  2QP9 X;  2O6X A;  2KWU B;  3CWI A;  2JPH A;  5FKA C;  4L6V 6;  4OU7 A;  1WMH A;  3AEG B;  3A46 A;  3T1H M;  2C7H A;  4WWP A;  4BAX A;  2AQ2 B;  4BKT A;  3WAP A;  2D3C A;  2OZ2 A;  3WAN A;  2KT7 A;  3ZQJ A;  5FTM A;  1AYF A;  1O0E A;  2FNJ B;  3PRM A;  2KOX A;  3C8Y A;  2JF5 A;  2IO1 B;  1UWM A;  3BII D;  1HTQ A;  2AL6 A;  2R0I A;  4BQV A;  4JL9 A;  5A24 A;  3ZYY X;  2F7D A;  3KWZ A;  3BIN A;  2ZVN A;  3QAR A;  2KTR A;  3KW9 A;  2IGH A;  1J7B A;  3GLI E;  4KVG B;  2CHV A;  3WCQ A;  2RD0 A;  2FID A;  3RT3 B;  4AKG A;  4G4N A;  3GLG A;  1EU4 A;  2DJG B;  3B74 A;  3B2G A;  1XKG A;  3MP9 A;  2PRE A;  2R9O A;  2JUJ A;  1RWS A;  1SGH A;  4HJK A;  1GMY A;  2VRR B;  1YQ4 B;  3F92 A;  4MEL A;  2DNF A;  3GRV A;  2V4I B;  4ZTB A;  2CUZ A;  4IJE A;  4LNF A;  3M6A A;  4ANR A;  2FRQ A;  3W1Y A;  2WSF F;  2FCS A;  2E02 A;  2RDH A;  1CB5 A;  5KPZ A;  4GUA A;  2PKO A;  3TWL A;  1HZ6 A;  3SBJ A;  2MJE A;  1IPG A;  2PEA A;  1IYF A;  1PJJ A;  1ZMU A;  4XX5 A;  4LGM A;  1YK7 A;  4YXD B;  3PRZ A;  4K0K M;  2KNV A;  1PJI A;  2DX5 B;  1XMQ M;  3O65 B;  3ZIM A;  1C4C A;  1L0Y B;  2KEB A;  1L1T A;  4FW9 A;  1YZB A;  5EZS A;  1NDD A;  2J42 A;  5CHT A;  3A4R A;  4GDL B;  1BUI C;  2JX5 A;  4KGS A;  3PSE A;  4JX1 C;  2IGD A;  2CU3 A;  2IDY A;  3BPM A;  4M00 A;  2FCQ A;  2C9O A;  4DR2 M;  4X57 B;  2UUB M;  2C9C A;  7CAT A;  4P1B C;  2BDL A;  2KLG A;  4JE3 B;  3SAV A;  4BZA A;  2MEK A;  3OG5 A;  2BTE A;  1NQC A;  3T1Y M;  1QZE A;  4LNI A;  1KLV A;  2INC C;  3Q69 A;  2GBK A;  4JLC A;  1SEB D;  3V6C B;  3EFU A;  3FAH A;  1YX5 B;  3BCN A;  3KS4 A;  4AJW A;  4X6H A;  3CH3 X;  5E6P A;  2LTU A;  2EEL A;  1U9V A;  4W4U A;  1QKZ A;  4WAA A;  4XZ4 A;  3MK6 A;  2L4F A;  4IP3 A;  3KFQ A;  3UK6 A;  2QMT A;  4DR5 M;  3T3N A;  4PT5 A;  1TKY A;  5C1B A;  1EFU B;  4DV0 M;  4G0N B;  2OJR A;  5AUI A;  5FTK A;  3GRU A;  1IN8 A;  4HCP B;  3RFW A;  4KX6 B;  1PE6 A;  4X62 M;  3CST A;  5JZE A;  2K6B A;  2LGX A;  2J4X A;  1WGH A;  3TWK A;  2WNM A;  2AVW A;  1E9M A;  3FRI A;  1L1Z A;  2R65 A;  1SF0 A;  3AKZ A;  2J7O A;  3K9P A;  2IGG A;  1XLN A;  2LD9 A;  3V62 A;  1BP4 A;  5J18 A;  2LWP A;  4ICU A;  5AZH A;  4LRT A;  4A20 A;  4BOS C;  1RYJ A;  4OVZ A;  3ETR A;  3JYU A;  1WXS A;  2AS8 A;  4NAM A;  2NS5 A;  4ZRK A;  3RN9 C;  1EO6 A;  1PFD A;  1UWX A;  3ZW3 A;  2WXH A;  4K3C A;  1ZE3 D;  3N1Z C;  4PS3 A;  3A9J A;  2M17 A;  1NL6 A;  4JYA M;  2HD5 B;  2VDB B;  3H7P A;  4KZ0 A;  1F1H A;  4MJS B;  1TS5 A;  4NRW A;  2J5Y A;  4AZF A;  3GLF E;  1I7H A;  2BS3 B;  2L7R A;  1I4Q A;  3KWL A;  4PP1 A;  3K2L A;  4YT0 B;  3GPY A;  1C1K A;  4HEO A;  2L0F A;  4RGT A;  1MHW A;  3ZUA A;  5IWA M;  4N6E B;  1C4P A;  4G4O A;  1J09 A;  1IBX A;  4KDL B;  4W9J A;  2QEN A;  4YSZ B;  1AU4 A;  2H1R A;  4JGH B;  1LV7 A;  1VJV A;  1ESF A;  2Z8L A;  3UGB B;  4QBB A;  3KDS E;  3GPU A;  1TU6 A;  3NS1 A;  2Z0E B;  4BKS A;  1U9W A;  2ATO A;  4JQW C;  5BR8 M;  4AG5 A;  4EE2 A;  1M94 A;  3KWV A;  2XEP A;  4KLN A;  1OQR A;  2CJN A;  3U6C A;  1E7V A;  3OJ4 B;  3U30 A;  3LQQ A;  3AUL A;  4NJC A;  5CVN B;  2FO5 A;  3AOE C;  1PGA A;  4BLC A;  3NWL A;  3JVZ X;  4LJ6 A;  1E8Y A;  2D3G A;  5ITX E;  4IBD A;  2CU1 A;  2IPK D;  3SR6 A;  3AJI B;  5BMH A;  1S1Q B;  4X65 M;  5HFY A;  4BKS D;  4ZUX U;  3FE3 A;  4BPV A;  4A5U A;  4P16 A;  3QT4 A;  4DXF A;  1JQ4 A;  3FIL B;  1DOX A;  1THE A;  1NI2 A;  2L4E A;  2IO0 B;  4WUR A;  1QXP A;  1E32 A;  4URK A;  2XK5 B;  4RCO A;  4MEM A;  2M19 A;  3DOA A;  3VAW A;  3QIJ A;  3Q14 C;  3P2B A;  4ZHO A;  2CIO A;  4NSO B;  1BGO A;  2G45 B;  4OX9 M;  1ZW7 A;  2MJ3 A;  3T3O A;  2WU2 B;  2DWZ B;  4JI1 M;  1I35 A;  4UN2 B;  1N63 A;  1GCB A;  1V1P A;  2EKI A;  1HQR D;  5EXP A;  2KJH B;  2QSD A;  1FCL A;  2G7Y A;  2QQ8 A;  1Q10 A;  3AXC A;  2Y5B B;  1PGB A;  2KC1 A;  3NG0 A;  1OTR B;  3U61 A;  1GVN A;  1XT9 B;  2DC8 A;  4KDI C;  1QYR A;  4IBJ A;  3ZRC A;  3AE6 B;  2KC2 A;  3N3G A;  4QRX A;  1LFD A;  1CVZ A;  2OPF A;  3RMK C;  4QHS A;  4DR7 M;  2N1W A;  1YVB A;  3PHW A;  1KLG D;  2RR9 A;  1PM5 A;  2K0P A;  4A8X C;  2KX0 A;  5A2Q S;  1I4H A;  2V1C A;  3I5J C;  3U7D A;  2DZL A;  3HIZ A;  3PLV A;  5BO4 B;  1C77 A;  3I51 A;  1MPE A;  4HXD B;  2JA2 A;  2KX3 A;  2KMC A;  4GC9 A;  2UXC M;  2ZPN A;  2N35 A;  4LRS A;  4I4L A;  1NO1 A;  2MA9 B;  3NUH B;  1IN5 A;  1QAN A;  4E74 A;  2JY6 A;  2KDI A;  1R4M B;  1I4G A;  2R61 A;  4HLQ A;  4G4R A;  3SAT A;  1V92 A;  3V3X A;  3OWE B;  2BTW A;  1A5R A;  1PYW D;  3USV A;  4TQ1 A;  1UNS A;  4IKG A;  2G8E A;  1FH0 A;  3JAM S;  4GRI A;  2OOB A;  1WSP A;  3JSV B;  4BS6 A;  5CX3 A;  1VZ6 A;  1T0R C;  4PP2 E;  2W55 A;  2Y5P A;  3B0A A;  3U60 A;  1WR1 A;  5GMV A;  3DA1 A;  2IO2 B;  1ROE A;  1Q02 A;  1FXA A;  2KDL A;  4W9I A;  1E9S A;  4CDD B;  3LVW A;  2Z8Y M;  1FM0 D;  5IO9 A;  4K7S A;  3FD9 A;  2HE7 A;  2JZP A;  1NB5 A;  1IXS B;  4IW0 A;  1EF1 A;  3ZDM C;  3PW3 A;  5DNY A;  2LRW A;  1DGG A;  2XFS A;  2N0S B;  3UF8 A;  4C4V B;  1N61 A;  2JTC A;  1GNU A;  3P4P B;  2ZW1 A;  2W54 A;  5LMU M;  1ZDX A;  2CHQ A;  2KMM A;  2MP2 A;  1NSF A;  2KZU A;  2DVW B;  4L78 A;  1I94 M;  1NYQ A;  1SXJ A;  2PE6 B;  3DBL B;  3H8H A;  3NZU A;  3W5V B;  4F1S A;  4LZJ A;  1K52 A;  3QQ8 B;  2PJH A;  3ZJV A;  3H4J A;  2ZNV B;  1UZX B;  4M8N A;  1AN8 A;  2DYB A;  4DR1 M;  2AU1 A;  1WXQ A;  2NTT A;  3HHX A;  5EXT A;  3IXS A;  1L2N A;  3PV1 A;  1V34 A;  4C56 C;  3N30 A;  2L09 A;  2VH1 A;  3N9Y C;  1AW7 A;  3C0R B;  1MX0 A;  4QRV A;  4DHZ E;  2G3Q A;  1CZP A;  3URY A;  3ZNG C;  2GMI C;  3MP2 A;  2CP8 A;  2AEH A;  1DGB A;  1NLJ A;  3T15 A;  2D7G A;  3QSD A;  2YJB A;  1ME4 A;  3AEB B;  2L00 B;  3MJW A;  3R8F A;  1L6V A;  6PAD A;  3IG5 A;  3BY4 B;  2LXE A;  3M99 A;  3AEF B;  3GLI A;  4KGR A;  3AE2 B;  2FAZ A;  4W9E A;  1R6B X;  1C4A A;  2W3S A;  2TSS A;  4US9 A;  2KW0 A;  2KDB A;  1I4P A;  4F8C B;  3QJZ A;  1F4I A;  2JY7 A;  5E6J A;  4JI3 M;  3V6E A;  2PLP A;  5DPT A;  3SMS A;  4MI7 A;  5KQD A;  4JI5 M;  3GLH E;  1FNU A;  3K9O B;  3W1S C;  5D94 A;  2G4S A;  3CBJ A;  1MJG M;  3UQA A;  5KHO A;  2QJL A;  1QF6 A;  3MTN A;  1DOY A;  1IXR C;  2BPS A;  1C76 A;  1SB3 C;  2CHW A;  4IG7 B;  1HJP A;  2RGF A;  1IN6 A;  2BYT A;  4TSS A;  3B7N A;  2N9X A;  3Q3O C;  4NSR A;  1AIM A;  2IYD B;  3QJ3 A;  1BVS A;  4GIV A;  2E03 A;  2KJ6 A;  4BKG A;  2QBY B;  3NVV A;  2CV1 A;  1KH0 A;  1MG8 A;  3WIM A;  1VDD A;  1P98 A;  2DCC A;  1IN4 A;  4HDO A;  3BB7 A;  1JRP A;  1WR6 E;  1QOG A;  3FTF A;  1N75 A;  1HNX M;  4NZL B;  1OIP A;  5JHA A;  3PRP B;  2BWE A;  3FTC A;  3SDL C;  4Q2J A;  3U6O A;  2Z0D B;  1VDL A;  2GHU A;  1BQI A;  1IY2 A;  2H7J A;  2MLB A;  4ZHP A;  2UXD M;  3ZC7 B;  1FPY A;  2SAK A;  3FIL A;  3T6P A;  3AE9 B;  3KS8 A;  1UF0 A;  4OZB A;  1NY5 A;  2LUE A;  2FBW B;  5KPR A;  3TSS A;  1QVR A;  4RH6 A;  3SAU A;  5BYS A;  1QQW A;  3PVL A;  1KFX L;  5KPT A;  5LXH A;  4MJS A;  3SYK A;  1QOB A;  4NPN A;  3SYL A;  3B79 A;  4RM9 A;  2ACT A;  3OQC A;  1HQC A;  4E3C A;  2RGO A;  1F2R C;  2DWL A;  3AB5 A;  4NQL B;  2XU1 A;  1NEN B;  4WJN A;  4M0D A;  4X6J A;  3PHX A;  1OQQ A;  5CHV A;  2CV0 A;  1Z2M A;  2LUM A;  3N32 A;  4F1I A;  1KYI A;  2FH0 A;  2Z7J A;  3I04 M;  1MI0 A;  4AWJ A;  2P7U A;  3RVV A;  4IDI A;  4H2A A;  2ON8 A;  1VCB A;  4WJO A;  1WJ6 A;  3S3R A;  1MN3 A;  4FVM A;  2WXF A;  1IQP A;  3ZNH A;  4S12 A;  1XC8 A;  3KW6 A;  3R9X B;  1MEM A;  4LCD E;  3AH7 A;  3BY4 A;  4W5C A;  3PDF A;  3I57 A;  5C18 A;  4KLB A;  4RKU F;  5HG2 A;  3ILK A;  2GB1 A;  1NJF A;  3ALB A;  4JI6 M;  2YR0 A;  5CTR C;  2LHD A;  5CHW A;  1V81 A;  1STF E;  1U5I A;  3KUD B;  1FXT B;  3R8B A;  3ML8 A;  2YJ8 A;  4LNO A;  3H8B A;  3BXW A;  4M0W B;  1JCK B;  2Y21 A;  4WP2 A;  4JI7 M;  2BKF A;  3VR9 B;  1Q6K A;  1JR3 A;  1ENF A;  4CDE B;  1E8W A;  3U6D A;  1G59 A;  1WIA A;  4MM3 B;  2XH9 A;  2BQQ A;  2ZTD A;  3H7D A;  3B7Z A;  3IAS 1;  4C7Z A;  4NC6 A;  3GZN B;  1LQB A;  1SP4 B;  1Z5B A;  3J7A S;  4DV2 M;  4TKN A;  4AG6 A;  4DV7 M;  1WX7 A;  3Q8F A;  2LVO C;  4LGY A;  3Q8B A;  1IM2 A;  3U6S A;  1T6O A;  1WRD B;  2KKC A;  3Q8A A;  4D80 A;  1TTE A;  1NVI D;  4IBG A;  3O1G A;  2AYO B;  4II3 B;  2X4A A;  3L13 A;  3FUW A;  1XF5 L;  5H8Y E;  5ITX A;  4GGQ A;  4GIP A;  1TJE A;  2JY8 A;  2W82 A;  3GE3 C;  1WGN A;  2IZV B;  5E26 A;  4ANU A;  5CHF A;  2WX0 A;  1MJD A;  2EMT A;  5C23 A;  3EUB 2;  4YYR A;  2CEA A;  2XK5 A;  2BF8 B;  2M1M A;  1E9R A;  2KDM A;  1T3T A;  1QOA A;  3U6Q A;  1XXH B;  2O2V B;  1I4W A;  2HWJ A;  2E01 A;  4HPM B;  1FIQ A;  3AOG A;  2KDF B;  2KQ4 X;  2BS2 B;  1EWY C;  3DBS A;  2WU5 B;  4FHK A;  4YSX B;  1D5M C;  2XU4 A;  3W1S A;  2KXJ A;  4HDQ A;  3L28 A;  2YJ2 A;  1TZO A;  4I6N B;  1SE2 A;  2QSF X;  1UGJ A;  2CHG A;  4CQN A;  3HM3 A;  4FWH A;  4OVV A;  4A55 A;  3P63 A;  1MEG A;  3EIE A;  2D7H A;  4JXJ A;  5DPS A;  4EKU A;  3GS2 A;  2DHZ A;  1G41 A;  4CO7 A;  3K9P B;  3PHW B;  1OFI A;  1HT1 E;  2L83 A;  3NBX X;  2KNB A;  2QIL A;  3L29 A;  1DV0 A;  2N9P C;  2KRU A;  3NS8 A;  3KP0 E;  4L1B A;  4RKX A;  3S3Q A;  2BBC A;  5LNK 1;  3ZGZ A;  3TEW A;  1ZV1 A;  4IBF A;  4ARI A;  3J2P B;  4D81 A;  2UU7 A;  2XN9 C;  1K3W A;  3PT2 B;  4DV3 M;  2FRA A;  1ZXH A;  4LFA M;  4YTP B;  2NQ8 C;  2H89 B;  4M0W A;  3H6N A;  3T9L A;  1GC7 A;  3U8E A;  3AEC B;  3WA0 A;  2ZNV C;  1KLU D;  4O1N A;  3A9K B;  3FTE A;  1N33 M;  3SAS A;  1MU5 A;  1V6E A;  3PO0 A;  3PZ7 A;  1R7S A;  2WXN A;  3RNF C;  2UXB M;  4GHA A;  2CWB A;  1YQB A;  2B76 B;  2XGN A;  5ITT A;  2FYE A;  2M0X A;  2KAN A;  4AJY B;  5DPR A;  3ERV A;  2DI0 A;  2JT4 B;  2WXI A;  3IFW B;  1M6D A;  1E7P B;  3U6L A;  1SBB B;  3AE1 B;  2IY0 B;  1UM8 A;  1WGL A;  5HKH A;  5G5H A;  2DOS A;  4W5B A;  3WXE A;  1GJZ A;  4W9H A;  1UH6 A;  4MH0 E;  1PGY A;  3U61 B;  2K9D A;  1BY8 A;  2NTS A;  2KVR A;  3PS6 A;  2LHC A;  4GXB A;  3VTU A;  3H89 A;  4II7 A;  4FA6 A;  1CJL A;  3E56 A;  2GRI A;  1TY0 A;  3QYE A;  4PDG A;  5FTN A;  3KP1 E;  3VK8 A;  2AWT A;  3Q8G A;  4FCV A;  4ICV A;  2P5T A;  1F2R I;  3E21 A;  3AM9 A;  1TR8 A;  4W9F A;  5E6N A;  1CPJ A;  3IOQ A;  1PCI A;  4G3X B;  2JRI B;  1YT7 A;  3VRB B;  2RGH A;  3W9C B;  5F3W A;  5EP2 A;  2AIM A;  2NBV B;  1HZ5 A;  4XDD A;  2RSU A;  4P6G A;  4DV6 M;  4XWT A;  1MFW A;  3NOB A;  4GIT A;  4AQY M;  2LFI A;  2OHF A;  1EWO A;  5EP4 A;  3HHY A;  1EWL A;  4M9S A;  3R7Q A;  4DR4 M;  1AU0 A;  1DKI A;  1GUA B;  4RMA A;  1ZGU B;  3KFU G;  4QRG A;  2V6Z M;  2WGS A;  1D6E C;  1YJJ A;  3WAL A;  1TT5 B;  4M9Z A;  4GDL A;  3RZW C;  3GQ4 A;  3HWS A;  3I4Y A;  1V49 A;  2HH5 A;  1JW9 D;  2BB5 A;  1PPN A;  3APF A;  1F9J A;  2J0M A;  2KAC A;  1WJ7 A;  5ITY A;  1QDQ A;  1YOV B;  2XU5 A;  1EF5 A;  1N5X A;  2C98 A;  3ZCB B;  3RUI B;  4IBC A;  3ENE A;  1PAD A;  4E71 A;  5IP4 D;  3PPA A;  2KD0 A;  2ZTC A;  4I07 A;  1D2N A;  2QC8 A;  2KFK A;  2DAG A;  4FCT A;  5G55 A;  2YQZ A;  3PZ8 A;  2BJV A;  3VUY A;  3GLF A;  5BMI A;  1DEU A;  1P7F A;  1GEC E;  4XE0 A;  3UIN B;  4CDF B;  1WZ3 A;  1XEE A;  2FIF A;  3AEA B;  3GCB A;  2E5L M;  3KLS X;  1WI0 A;  3SAW A;  3CGW A;  4B3S M;  3L10 B;  4K7U A;  1HTO A;  5EXX A;  3APC A;  1J7C A;  4ITK A;  3HGI A;  4M01 A;  2G4D B;  2DZI A;  3DBH I;  3AI5 A;  4L8R C;  3LJ3 A;  1WXM A;  2KXE A;  4CIZ A;  3O65 A;  1IBK M;  2WXO A;  3PZD A;  4LJP B;  4DK5 A;  1ISN A;  2YNM D;  2I2Y A;  4XDC A;  2R9C A;  4P6V F;  1LTM A;  1Q1O A;  1VD2 A;  3C19 A;  2BB6 A;  2G3Q B;  1ZUD 2;  1IY1 A;  5EJC A;  2M5Z A;  3W68 A;  4NL4 H;  2K6D B;  3TL4 X;  2DEN B;  4GU2 A;  5H92 C;  2KWV B;  1NHW C;  2BW2 A;  1JR3 D;  4AOF A;  3OF8 A;  3K92 A;  1YD8 U;  4LF8 M;  2OOA A;  2JWZ A;  2JXX A;  3AOE A;  1L2D A;  1SG9 A;  2HD5 A;  1RAX A;  4BBN C;  3Q8X A;  1K50 A;  2WYQ A;  4GLS C;  1YIW A;  3EEC A;  4N9F 4;  3SFE B;  1K51 A;  2XSZ A;  4B08 A;  3PVS A;  2QIE B;  3P4S B;  4HWI B;  4I04 A;  1KXR A;  2JVC A;  4EUT A;  4L16 A;  1SIJ A;  1EUV B;  1VZ8 A;  3WXG A;  2HJ8 A;  1N36 M;  2ZCC A;  2LVN C;  4CGY B;  2BVC A;  3PRM B;  3RNE C;  1MIR A;  4KKI A;  4FWG A;  3FUV A;  1WZ0 A;  3HU2 A;  1Z59 A;  5AUK A;  1L8Q A;  2L7H A;  1WJN A;  1EWM A;  4JWS C;  3EIH A;  1N6Z A;  1H6U A;  2MR9 A;  1AWD A;  2X49 A;  2LI5 A;  3R2T A;  5EGW A;  1NI3 A;  3VFD A;  5IKC M;  3U6E A;  5I4D A;  2ACZ B;  2Y20 A;  2O6V A;  1KFV A;  3AED B;  3D8L A;  4GN1 A;  1V5O A;  3ZJU A;  2G6D A;  3HWN A;  4QOZ C;  1C78 A;  2JRH A;  2LHE A;  4MT5 A;  4K1R B;  1F2B A;  3ZNI D;  1U4A A;  2RPQ A;  3L17 A;  3AU5 A;  4JI2 M;  4HVB A;  5LMN M;  3C9E A;  2JZ0 A;  2MHJ A;  2J7Q A;  1VR9 A;  2MP2 B;  3LCU A;  2R2O A;  4PYU A;  1R7R A;  2YEP F;  2A4Z A;  4HEA 1;  5D3D A;  1L0X B;  3NVZ A;  3HM6 X;  2NPT B;  2DAM A;  3T8M A;  2YFQ A;  2QNJ A;  1DGH A;  4YVA A;  2EKK A;  1MHX A;  2W3R A;  2CHX A;  2F5P A;  1QDR A;  1WHC A;  1VRA B;  3QK0 A;  3PRE A;  3N3K B;  2HXZ A;  2MX2 A;  4N4Z A;  2L7I A;  1P3Q Q;  2HKJ A;  2HWK A;  4DBG A;  1SXJ E;  2V3S A;  3LYY A;  3P1M A;  1TF0 B;  2AHM A;  9PAP A;  3Q3N C;  4D8I A;  2Z3X A;  1PDX A;  2DKL A;  4W9C A;  2GBR A;  3A42 A;  3PXG A;  2AX5 A;  5C2T B;  4CDC B;  2QPA A;  1TIF A;  2ZCB A;  4XBO A;  3FKE A;  2DWM A;  3AV8 A;  3RNV A;  3B89 A;  2JZ3 B;  4DV5 M;  2R9N A;  1IUE A;  4MM3 A;  4NOO B;  2J0J A;  3Q2A C;  3EA6 A;  2IBI A;  3DBH B;  1WGR A;  2PNS A;  1Q5W B;  2B1N A;  2R9M A;  1ICF A;  2LVQ A;  4IBB A;  4DR3 M;  1CS8 A;  4WQO B;  2XSZ D;  4RFB A;  3B21 A;  3HJ8 A;  5ITU A;  2N1V A;  2ARY A;  5FPW A;  1PJQ A;  3ABV B;  3L4P A;  4WJQ A;  2AYO A;  4LG2 A;  1TGZ B;  1AU3 A;  5J2R A;  1JQP A;  2N9L A;  3HU3 A;  1HE8 A;  5D6J B;  2DAI A;  2ZM6 M;  1SE4 A;  3PNR A;  2LXC A;  3UIP B;  4DDG D;  1WH3 A;  3D8B A;  1TZ1 A;  2MBE A;  1T3Q A;  2L0T A;  3IUT A;  3K9O A;  2WXJ A;  4KSK C;  4KO8 A;  5AZF A;  3KSJ A;  4RF1 A;  1TH4 A;  2VZK B;  1B9R A;  5IAA C;  1G6J A;  1NB3 A;  2G1E A;  2BU3 A;  1KSF X;  2LH0 A;  2HHN A;  1NV8 A;  1L2C A;  3DQV A;  2C96 A;  1V8C A;  2O5R A;  1NEK B;  3DDC B;  3I01 M;  1TLO A;  4D8E A;  4IIW A;  4NY0 A;  4X64 M;  1NHG C;  1D5X C;  1QUT A;  1OEY J;  1GB1 A;  4IWQ A;  4ZYS A;  5K16 A;  4ASW C;  3MHS D;  4NJ7 A;  3TE6 A;  2FUG 1;  3OLM D;  3VH3 B;  4FJC A;  3J80 S;  5KO3 A;  1K3X A;  3HX3 A;  3KOX E;  4IM2 A;  2WWZ A;  1H4R A;  4I6L B;  3FRH A;  4DV4 M;  3JW0 X;  4JIO U;  5DPW A;  4DMY A;  1WGK A;  2JY5 A;  2J53 A;  4B0M A;  4HKZ E;  3RFZ B;  3FUT A;  4EZJ A;  4LLG M;  2BJW A;  1WJU A;  3W0F A;  4ZYN A;  3DF0 A;  2M56 B;  4ITQ A;  3KW5 B;  3GPX A;  3MOR A;  2Y5C A;  4G3O A;  3NZ3 A;  1R2Y A;  2KA6 B;  3TJP A;  2QZ4 A;  2BGF A;  2L32 A;  1SE9 A;  2MRP A;  1G4A E;  2YJC A;  3W2D A;  1YN3 A;  3LQR A;  1WGD A;  4DDI D;  2KDE B;  3F5V A;  4MSQ B;  4FCW A;  2B1M A;  3GP1 A;  1WY8 A;  2CRU A;  1ZAE A;  4HCN B;  4FK5 A;  2OJW A;  3GPP A;  1XCT L;  4I81 A;  2WXP A;  5MPO A;  2YJ9 A;  3HJQ A;  4FJY A;  2GFO A;  3VHT C;  1TGU A;  1WGG A;  1RFK A;  3EGR A;  3C0R A;  1T6B X;  5JXV A;  3MFG A;  3O0U A;  4HWY A;  5L8R F;  4K7W A;  3KYC D;  4W9K A;  1PXV A;  3DFZ A;  5F02 A;  2WHI A;  4L15 A;  1D4B A;  2DJF B;  4MGH A;  1L2B A;  3PLU A;  1E8Z A;  1OKS A;  1W5T A;  4M9X A;  3RVW A;  2LHG A;  4A3V B;  2BYV E;  1XXG A;  2RKO A;  5HHD G;  3RNA C;  1YJI A;  2LVQ D;  3QAQ A;  4M8M A;  1EIJ A;  4LNN A;  1HNZ M;  4Z8X A;  4FN2 A;  1E0Z A;  4Z6Y A;  1WX9 A;  1RRB A;  3BK2 A;  3KKU A;  3NY5 A;  3PGE A;  1HUC B;  4DXA B;  4WH4 A;  4G4Q A;  3U2S C;  2PVO D;  3RPF C;  4FJV B;  4OW0 A;  1IWD A;  3A4S C;  1Y4H A;  4LJ9 A;  4KIK A;  1YX6 B;  3OVZ A;  4MGY E;  1R4G A;  4GOC A;  2RRU A;  1OIZ A;  1TTN A;  3AEE B;  1P0R A;  1PQS A;  2EA0 A;  2K5P A;  3MHS A;  2XLJ A;  5TSS A;  1QAQ A;  3VTW A;  1EU3 A;  3W0L B;  2K25 A;  2MH8 A;  2HJ1 A;  3L2A A;  2LVA A;  2MH7 A;  3CMM B;  5ITQ A;  2VQE M;  3ZJT A;  1SJH D;  3OVX A;  2FNA A;  1WF9 A;  2RMM A;  3TRK A;  2R18 A;  3PRP A;  2ERC A;  1PJS A;  4ZDV A;  3PSE B;  2DNA A;  2DCD A;  5BMG A;  2KQS A;  4ANX A;  3A9J B;  4RF0 A;  4HK2 A;  2CFO A;  1NJG A;  4IWP A;  3N3K A;  3DZD A;  2MJ5 B;  4P1C C;  1N78 A;  1QMY A;  1FMA D;  3RNB C;  2L6O A;  2DYO A;  2MJD A;  1CK1 A;  4PAD A;  2WDT B;  4IM0 A;  2JY6 B;  4DHZ B;  1ZIV A;  4XZX A;  3B1L X;  1XD3 B;  1A5T A;  3NVY A;  1HXY D;  3GE8 C;  4RGO S;  4CJ6 A;  4R71 A;  3DVG X;  2EKF A;  3PNV A;  3B2F A;  5FK9 C;  3APD A;  4B3T M;  3UJN A;  1RM6 C;  4MSX A;  2DWQ A;  3HKP A;  4GMQ A;  3PBH A;  2DZO B;  4ZOH C;  1AYU A;  1GO5 A;  2ZW0 A;  2K8H A;  2MGW A;  4Q8G A;  3DCG A;  1WM3 A;  2QCU A;  2JWS A;  2KYW A;  2R44 A;  3E46 A;  3QX1 A;  2IND C;  4LTU A;  3OIS A;  1X37 A;  3EHV A;  1GKI A;  4BBA A;  2A5U A;  5T8I A;  4GDK B;  3GQ5 A;  3MC0 B;  4A3P A;  3P5W A;  2HL7 A;  3M62 B;  3BYY B;  2F1G A;  4ZRQ A;  1GL6 A;  5FTL A;  1KM7 A;  2UUA M;  1GLO A;  4JWU C;  1YN5 A;  2IO3 B;  2ZAO A;  4CZW A;  3HY5 A;  1FXI A;  5FLX S;  2WXG A;  5GKN A;  1QOL A;  1E90 A;  1S4V A;  1FEH A;  3I3T A;  3GRY A;  3BBA A;  1E8X A;  2LAS A;  2DZZ A;  2DC7 A;  3TEY A;  2IJ0 A;  2NQI A;  1F0Z A;  2APL A;  1WJ4 A;  1VQ1 A;  2PTL A;  3UMM A;  3LW5 F;  1EE8 A;  1LGR A;  4KHP M;  3VRA B;  4RY2 A;  1MDW A;  2LWX A;  2MBH A;  4X66 M;  2KNZ A;  1KFU L;  5IT9 S;  3IV2 A;  2C5L C;  2DLB A;  4BS5 A;  3KYD D;  4LJ5 A;  1MS6 A;  1UD7 A;  4QAY A;  2DAF A;  1Q39 A;  3BWU D;  2A5Y B;  4NXN M;  3PNY A;  3L16 A;  1WX8 A;  2LJ5 A;  4I6P A;  1KTK A;  1UEL A;  1J8C A;  4Y28 F;  1VEJ A;  2VZK D;  3M63 B;  1GB4 A;  1G3I A;  5ITR A;  4BBN F;  2C7M B;  3KVW A;  3DVN U;  3ZXR A;  4XR7 A;  3O13 A;  2KJR A;  3TEZ A;  5JI3 E;  4ZPX A;  5BYR A;  2JQR B;  2VHF A;  3SHG B;  3GLG E;  2WXR A;  1GAB A;  3H4M A;  2DZM A;  3VLF B;  2LVP C;  2F5S A;  1Y56 A;  1E6E B;  1DF0 A;  3GLF B;  2DBY A;  4OEM A;  1L6U A;  2LVO A;  4DHJ B;  2N7E A;  1N34 M;  1R4M I;  1ZKH A;  1Y8R C;  3AFH A;  1V1O A;  2WXK A;  2V1U A;  4LF9 M;  1WXA A;  2IY1 B;  4PS8 A;  3L26 A;  4LJA A;  1TH2 A;  1AUA A;  5LXI B;  4W5W A;  3R7R A;  1MVK A;  4LF4 M;  1WMH B;  3V6E B;  2DWN A;  3E1Z B;  5EZQ A;  3VKH A;  3IEC A;  4Q8H A;  3VUW A;  4B6W A;  3VVW B;  1BT0 A;  1Y08 A;  1F2A A;  2AUX A;  2AL3 A;  5DYI A;  4LF5 M;  4AI6 A;  4BOQ A;  2D07 B;  4G54 A;  3A33 B;  4LDT D;  4AXM A;  2O01 F;  4QNR A;  3I63 C;  4FXC A;  1D0M A;  2MWS B;  3LMM A;  5D2M B;  1G71 A;  2NBW B;  1HQY E;  3KSX A;  2DC6 A;  1CTE A;  3IEJ A;  2L3Z A;  2PW9 A;  1XLP A;  2NMQ A;  3GO8 A;  1SJE D;  3TCA A;  1E5W A;  3V6C A;  5DFL A;  3VTV A;  4GKJ M;  4USA A;  4CHT B;  2Y0T A;  2L1A A;  2FOI C;  3L54 A;  1YMH E;  1OQY A;  2XF3 A;  8CAT A;  1F77 A;  1N32 M;  3HHM A;  3U5Z B;  3TBL D;  8PCH A;  1JWU D;  2BWF A;  4YYU A;  4HLE A;  3MHH A;  2CS4 A;  1QAM A;  2KK8 A;  3SMP A;  3P4R B;  3MHZ A;  3MC8 A;  1V33 A;  5KQ8 A;  1ZDV A;  3UIO B;  2LNH C;  3CIR B;  4JI8 M;  3VUX A;  3WXF A;  3IVF A;  3NHE A;  2LGY A;  4ACF A;  4HKQ A;  1NV9 A;  4C7Y A;  2JXT A;  1AEC A;  1Q0W B;  4MGK E;  4GH9 A;  2KO3 A;  3P5V A;  2QHO B;  1DGH B;  2PVG C;  2NPT A;  1L7Y A;  3LFY A;  3VK7 A;  4TUW A;  4C00 A;  3FC4 A;  4J3O D;  3GP7 A;  2M4N A;  1UBQ A;  2PE9 A;  2PAD A;  4OEL A;  5AEK B;  1G8P A;  2KZR A;  4NXM M;  2G9H D;  2JRI A;  2KRK A;  3LXF A;  3D32 A;  4N58 A;  3CF6 E;  4KV2 A;  1HT2 E;  1D5Z C;  3HRD D;  1TS3 A;  2WXL A;  2NVU I;  2NQA A;  4A3O A;  3R2I A;  3GLG B;  2BS4 B;  2E3T A;  4MZS A;  4PDI A;  2DAE A;  1GC6 A;  1X9Y A;  3SHQ A;  3DOW A;  1STE A;  5JA7 A;  1WGY A;  3RD2 A;  4AXL A;  3AU4 A;  2REX A;  2GI9 A;  2INP E;  3IG8 A;  4TV3 A;  2AUZ A;  3RUL A;  2CB5 A;  2YVC A;  3NZS A;  4LF7 M;  2CV2 A;  1YJ1 A;  2UU9 M;  4KSL C;  4TUU A;  2X8A A;  1YLA A;  2GBM A;  1T5X D;  1XCQ L;  2MQJ A;  2CJO A;  2C7N B;  3KXE C;  4JI4 M;  3FUU A;  2BYF A;  2LZ6 A;  1MHH E;  3V61 A;  4IUM B;  1WYG A;  4LDT B;  2ZAN A;  5JI2 E;  1ATK A;  4QHT A;  2N7J A;  2WDR B;  3BYT B;  3MTV A;  1Z5S B;  3AE4 B;  5H37 D;  2I7N A;  5EQT A;  3BOW A;  4IM3 A;  4MGZ E;  1KRH A;  4YYV A;  3I06 A;  2WZJ A;  1QZM A;  3K8U A;  3RZF A;  3BWK A;  1NVM A;  4NJ6 A;  3FKY A;  2HTM E;  2FS1 A;  4HL4 A;  3UGJ A;  4FUL A;  2DAK A;  4GHL A;  3ZUN A;  3V05 A;  4LNK A;  1DO2 A;  3U7Z A;  1FCC C;  5IA7 A;  1HR0 M;  5LLI A;  3E9S A;  3VKG A;  1GJT A;  3IHP A;  2LGS A;  1OAO C;  2Y0Q A;  1N5W A;  2K8C A;  1D0K A;  4GC5 A;  3Q3J A;  1PPP A;  3AE3 B;  2FUH B;  3PHU A;  4LJ8 A;  3NVW A;  3BVG A;  5D7G A;  3CF2 A;  4HPL B;  3NJT A;  4MSM B;  1DO0 A;  1WE6 A;  3AI8 A;  1ACC A;  4CYE A;  2R45 A;  3Q3F A;  1JWB D;  3OJ3 A;  1RFA A;  2GOW A;  1L4Z B;  4PS7 A;  2JUO A;  2IBI B;  1P3Q U;  3HUI A;  4A6Q A;  1SIF A;  2JXN A;  1IXS A;  4BOZ A;  2V4L A;  2K39 A;  1XWI A;  3TWM A;  3VDU A;  4IBK A;  2OO9 A;  4I05 A;  2GLS A;  5KHQ A;  4P17 A;  4BVU C;  1CMX B;  1J5E M;  1KHQ A;  2UUC M;  2BYE A;  1OFH A;  4DUZ M;  2HTH A;  3ZTC A;  4IC7 B;  4DXG A;  2ASQ A;  4MZO A;  4XGA B;  2XU3 A;  4YTM B;  3SD5 A;  1M4V A;  2D3B A;  1TYG B;  3IG3 A;  1FRD A;  4W9G A;  4BOS A;  3GLH B;  1UGM A;  2NR2 A;  1E10 A;  2MBO A;  4C80 A;  4IBE A;  4C4V A;  5G2N A;  3TEX A;  3BVZ A;  1XB2 B;  3ZKJ C;  2AYN A;  2R4E A;  2F4V M;  2D3A A;  3J7B A;  3RNC C;  1XNQ M;  1A70 A;  3R3M A;  4WAF A;  4ARC A;  2WP9 B;  2L2D A;  4K81 A;  4HRS A;  2M60 A;  3GOE A;  3FYD A;  5C3J B;  1YAL A;  2K22 A;  3K9M A;  1BML C;  4PK1 A;  1V86 A;  4LFC M;  1TS4 A;  2AGA A;  3DBR I;  1JWA D;  3M0E A;  1IY0 A;  2BNK A;  1CUK A;  1VSN A;  5TR5 A;  3SAR A;  1QQR A;  2R4J A;  5IN7 A;  3HD3 A;  4XC2 A;  1VJK A;  4I5S A;  2KFJ A;  3M95 A;  2MCN B;  3I4V A;  3RI7 C;  2UZJ A;  3KOY E;  4FBJ B;  1TH3 A;  1K3B B;  2WQY B;  4G6Z A;  1X1M A;  2I1K A;  1EF7 A;  1K53 A;  2EJS A;  4LY6 A;  2UWQ A;  2WSC F;  4YYS A;  2RDB C;  2N7D A;  3EFC A;  3EC8 A;  4GB9 A;  2GNO A;  5DCN A;  4N59 A;  3ML9 A;  3ZRF A;  1CSB B;  2ZVO A;  4EZL A;  3CF0 A;  1IGC A;  5EE0 A;  1OFF A;  3N20 C;  4P6E A;  1Q3C A;  4G11 A;  2H88 B;  2V3P A;  2OUL A;  3TQS A;  3KOW E;  3RGP A;  3AV0 A;  2XNA C;  1EM7 A;  5EE3 A;  4QH6 A;  1I42 A;  2X38 A;  3GB1 A;  1OJL A;  4ZRJ A;  1KFY B;  1YQ3 B;  2G8J A;  4CIS A;  1FRR A;  2ZBK B;  3QWL A;  3IAM 1;  2Z4S A;  2SEB D;  5FR6 A;  1GAQ B;  3LB8 C;  1PRB A;  2ZAM A;  1ZMV A;  1XLO A;  2HAK A;  2R6N A;  3RVX A;  3RE8 A;  1Y8G A;  4DHJ D;  2PPH A;  2LJI A;  3V60 A;  4S0R A;  1AU2 A;  1J0G A;  1QT9 A;  2VII A;  3W31 A;  3C3E A;  2KN4 A;  1R2Z A;  1WIV A;  3GZN I;  3M3J A;  3VH4 B;  2BDZ A;  2VH2 A;  3KSE A;  4HJG E;  3LDZ E;  1GOZ A;  2UYZ B;  1CQV A;  1B1Z A;  4Q7J A;  4X6I A;  4AP4 C;  3CSF A;  3KUZ A;  5EXS A;  2VHS A;  2HDE A;  3IBE A;  1PGX A;  3D6S A;  3J81 S;  1WWT A;  3QHT A;  4FAD A;  3TPZ A;  1D0L A;  3ZDT A;  4KGT A;  3NBI A;  3E4R A;  3ZNZ B;  1PBH A;  3I9V 1;  1T0Y A;  1WE7 A;  3F75 A;  2VQF M;  4KT0 F;  4AKH A;  4EOY A;  1N77 A;  2BWE S;  2WDV B;  3AN1 A;  4HRO A;  2DAJ A;  4AUQ C;  3P5U A;  3RCZ A;  2FUD A;  1WM2 A;  2KLC A;  4JV5 M;  1F2C A;  1J19 A;  1MG4 A;  2K0B X;  2JSV X;  2LEK A;  2XEW A;  2KHH A;  3TMP A;  1NBF C;  3KH0 A;  2GBN A;  2IPP B;  2EUC A;  4P7I A;  2NCN A;  3W30 A;  5FR3 A;  4QNM A;  2C5R A;  3ZO5 B;  3DHH C;  1SXJ D;  1L5P A;  2G8L A;  4GDK A;  3HU1 A;  2KHW B;  4EEW A;  4JPS A;  1YNT E;  4LFB M;  4S17 A;  3UI3 A;  1U9X A;  1FNW A;  1IGD A;  2LXA A;  2CHZ A;  1V80 A;  2Z4R A;  3RNG C;  3SU8 X;  1J7A A;  2K9X A;  2FFJ A;  3SEB A;  4L4U A;  1PVJ A;  1GPX A;  4KZC A;  2BTW B;  3IHP C;  1L4D B;  2WDQ B;  1ZXI A;  1CV8 A;  2B3A A;  3JR5 A;  3HHA A;  2F5O A;  2LMC A;  2YEP B;  3L25 A;  1FFU A;  4I8O A;  1IBX B;  2FCM A;  2O25 A;  1ZP0 B;  1C3T A;  2KWD A;  2D10 A;  3LVV A;  3HHZ A;  4M02 A;  1POP A;  1T43 A;  1V1P B;  3W5U B;  3HZJ A;  3ZVV A;  1C7Y A;  3HHW A;  3K8Z A;  4OZC A;  4HXD A;  1AYW A;  2KTF A;  2C9W B;  3CBK A;  1FD6 A;  1I4X A;  3N1X C;  1TY2 A;  1ZOY B;  3GLI B;  1JAL A;  3LXS A;  4LK0 M;  2AQ1 B;  3R66 C;  1SXJ C;  5E6O A;  1VEK A;  3GRR A;  2XBB C;  2DHR A;  3FYC A;  1V97 A;  2Z84 A;  3DVG Y;  1VDV A;  2LGD A;  2HCB A;  3I3T B;  3QA8 A;  2JQG R;  2DZN B;  1HEZ E;  3MHV C;  1QLB B;  2KWC A;  1QIL A;  3TUO A;  5PAD A;  2F5N A;  2R62 A;  1YK8 A;  1I4R A;  3TL5 A;  1Z5C A;  3C58 A;  4GSW A;  1E7U A;  3THG A;  3WHL A;  3MTN B;  2J7N A;  2Q2E B;  1R4N B;  5J94 A;  2MRO B;  4DQO C;  1PUT A;  5EP1 A;  1Q3B A;  3AE5 B;  4DBG B;  1P9D U;  1F29 A;  1AIP C;  4D8B A;  4JN6 A;  1YN4 A;  1UFZ A;  4AKI A;  3AE8 B;  1PPD A;  4BOP A;  3B9P A;  1OAI A;  3VFK A;  3WAM A;  1XQQ A;  1ME3 A;  1VLB A;  2R2Q A;  1JRO A;  2PMV A;  2LBC A;  1S3S A;  4B3M M;  4BOU A;  3CTW B;  4L23 A;  5DYG A;  1K82 A;  1XXH A;  4RNA A;  2OOB B;  1YSY A;  1DGF A;  4N8W A;  3M7G A;  3U52 E;  2FE8 A;  2JZ1 A;  2H5X A;  1KHP A;  1NYR A;  2K1F A;  3SC3 A;  3BZD B;  5EDS A;  2WBF X;  2DZK A;  4WQM A;  4FHJ A;  4F7Z A;  3BPF A;  3DHG C;  4PI3 A;  4WWO A;  2J7Q B;  5JZE B;  3Q3M C;  3ONS A;  5AZG A;  1XMO M;  2JP7 A;  1N60 A;  3Q6B A;  3C3D A;  3QYB A;  4QOS A;  4PYZ A;  1C9F A;  1Z6T A;  5EE9 A;  3DVN V;  4FD2 A;  1JWS D;  2C60 A;  3QWZ B;  1ZQ9 A;  2JU6 X;  4OZA A;  2B3T A;  3N1Y C;  2KNA A;  3VR8 B;  1KF6 B;  2FCN A;  2QDF A;  3VDZ A;  2W9N A;  4DUY M;  3CH2 X;  3U8Z A;  2I1J A;  2NQD B;  1TKG A;  1TDZ A;  1DGJ A;  2YLM A;  4HPP A;  4DV1 M;  3DPD A;  2L52 A;  3ZQ4 A;  1OTR A;  2DXI A;  1QOF A;  1R5L A;  2ZPY A;  2MSE D;  4B7F A;  1TDH A;  4IBI A;  4WWN A;  1WXV A;  2DCB A;  3HVZ A;  2VF7 A;  1GG3 A;  2Q5W D;  2RDG A;  1PPO A;  1OGW A;  4GMV A;  4MB7 A;  3Q8C A;  3SFZ A;  4LCB A;  2CE7 A;  2F5Q A;  1ET6 A;  3Q8E A;  1IN7 A;  2N9E B;  2LGI A;  4XWW A;  1D3Z A;  2M0A A;  2PBH A;  2I38 A;  3VXW A;  3WAO A;  3P5X A;  2C99 A;  4IUM A;  1F52 A;  1RU3 A;  3B7Q A;  1FNN A;  1WR1 B;  3U60 B;  4CHK A;  3DBL I;  4KKJ A;  2V0G A;  3KX1 A;  2ICI A;  2V9H A;  5IOI A;  2G5G X;  1JRU A;  3N4C A;  2DEN A;  2J0K A;  1SSN A;  1WYW B;  1Z5A A;  4B7G A;  4PCZ A;  1WFY A;  5JH3 A;  3ECI A;  2OED A;  1ITO A;  3X23 A;  4YTN B;  2V1Y A;  1K8R B;  1DOI A;  2I7P A;  5IZ7 D;  1IP9 A;  2WLB A;  4YHH M;  1KJT A;  4YYQ A;  2FTD A;  5JHB A;  1CQD A;  4WA6 A;  3BVM A;  2XFT A;  4R3D A;  3GLH A;  3PTF C;  2OP3 A;  2QEJ C;  4TQ0 A;  2KN5 A;  2DCA A;  4OVU A;  1VEG A;  3MJ5 A;  3HJS A;  1GJS A;  4DWF A;  1ZCM A;  3A98 B;  3P42 A;  1C1Y B;  1KOT A;  2WXQ A;  3ZXV A;  1LXD A;  3PFI A;  1SE3 A;  4MDK E;  2WSE F;  4RGM A;  4EIW A;  2KMA A;  2ONQ A;  2HHH M;  4LJ4 A;  4J6I A;  3A45 A;  5L83 A;  2P86 A;  4RGN A;  4ANW A;  1NNJ A;  5G5G A;  4LJ7 A;  1R4N I;  4BFR A;  3DHI C;  3RYT A;  3BBZ A;  4N79 A;  1XO3 A;  4XYC A;  3FUX A;  3OF9 A;  4YYW A;  2OQ4 A;  3QCA A;  3VDP A;  2DZY A;  2MW5 A;  3OAW A;  4BOZ B;  1QUS A;  1WRI A;  1P1A A;  3BC3 A;  2D11 A;  4FIP A;  3V76 A;  4XUI A;  3NHE B;  1FFV A;  3L0W B;  3VQI A;  2JZZ A;  4B9K A;  5JH5 C;  2Y5B A;  2R46 A;  3H7P B;  2Y3A A;  3A1Q A;  4EZK A;  2BWB A;  3KQ4 A;  4UDU C;  3IT4 B;  1YE9 A;  4GKK M;  3K1J A;  4ZRI A;  3WHK A;  3ZTD A;  1NY6 A;  4WJP A;  1ORY B;  3U5Z A;  4D2K A;  1UUP A;  1RLF A;  4RM8 A;  3ZLZ A;  1EWC A;  2C0Y A;  3BOS A;  4LF6 M; 
#chains in the Genus database with same CATH homology
 1FNV A;  1XNR M;  1CJE A;  1HA5 A;  1C79 A;  1HNW M;  4XGI A;  4L2Y A;  5FSW A;  1XHB A;  4REZ A;  1GLN A;  2JYT A;  4A90 A;  4B3R M;  1W5S A;  5FTJ A;  2N9K A;  3DWG C;  1IXZ A;  4MAC A;  4FWD A;  5GXG B;  1DYQ A;  5IRE B;  4YY3 M;  3NRZ A;  1VZ7 A;  1NNU C;  4WIP A;  4B0E A;  3GQ3 A;  2KZS A;  4OHJ A;  1IBM M;  1UKF A;  3AL0 C;  4NRV A;  2V3N A;  3KOZ E;  3T38 A;  1XLQ A;  4DR6 M;  1BXT A;  4ZRP A;  4YSY B;  3U4E G;  3SHF A;  4D82 A;  4BB9 A;  4R7G A;  1N62 A;  4B7H A;  3QAU A;  1L0V B;  3B9J A;  1SXJ B;  3UZU A;  4NAW B;  2K47 A;  5EP3 A;  3IT6 B;  3J27 B;  2DYM A;  2INN E;  4PD2 A;  4LZZ A;  2JYE A;  4MH8 A;  3AMZ A;  2WXM A;  1JML A;  1IBL M;  3HVD A;  2EO2 A;  1J7K A;  1GL7 A;  4WW0 A;  2D7E A;  4AW4 A;  3U6P A;  1YUB A;  1E94 E;  3IFU A;  1ET9 A;  4US8 A;  4JI0 M;  1ZPS A;  2PIA A;  4A9A A;  3AE7 B;  3DWM A;  2JWU A;  3FTD A;  3BK1 A;  4TMA B;  5BPV A;  1FJG M;  3U6M A;  2KAJ A;  1JWM D;  4IJF A;  3J9C A;  2WS3 B;  4KOD A;  4AQ7 A;  4AS1 A;  5HI1 A;  2K3U A;  2QBY A;  3OTO M;  3PT2 A;  1QAO A;  4MGI E;  2D5G A;  1JQJ C;  1TS2 A;  2BT6 A;  1SXT A;  4YWG G;  5BYQ A;  3JR4 A;  1FO4 A;  1LO5 D;  1P7E A;  1TKE A;  5D3I B;  5EE1 A;  2J7Q C;  3P4Q B;  4WWM A;  4IOI E;  2J52 A;  3L27 A;  3RGS A;  3SFD B;  3ZH9 B;  2AQ3 B;  2XZU A;  2XZF A;  2E6X A;  4OVZ B;  2QP9 X;  3CWI A;  5FKA C;  4OU7 A;  3AEG B;  3A46 A;  3T1H M;  2AQ2 B;  1AYF A;  5FTM A;  3PRM A;  3C8Y A;  1UWM A;  3BII D;  3ZYY X;  2IGH A;  1J7B A;  2CHV A;  3WCQ A;  4AKG A;  4G4N A;  3GLG A;  1EU4 A;  3B2G A;  3MP9 A;  1RWS A;  1YQ4 B;  3GRV A;  2V4I B;  4ZTB A;  2CUZ A;  4IJE A;  3M6A A;  2RDH A;  5KPZ A;  4GUA A;  2PKO A;  3TWL A;  1HZ6 A;  3SBJ A;  2MJE A;  1PJJ A;  4LGM A;  4YXD B;  4K0K M;  1PJI A;  1XMQ M;  1C4C A;  1L0Y B;  2KEB A;  1L1T A;  4FW9 A;  1YZB A;  5EZS A;  2J42 A;  4GDL B;  4KGS A;  1BUI C;  2JX5 A;  3PSE A;  4JX1 C;  2IGD A;  2CU3 A;  2IDY A;  2C9O A;  4DR2 M;  2UUB M;  2C9C A;  7CAT A;  4JE3 B;  3SAV A;  2MEK A;  2BTE A;  3T1Y M;  3Q69 A;  1SEB D;  3FAH A;  3KS4 A;  2EEL A;  1QKZ A;  3MK6 A;  4IP3 A;  3UK6 A;  2QMT A;  4DR5 M;  3T3N A;  4PT5 A;  1TKY A;  5C1B A;  4DV0 M;  5AUI A;  5FTK A;  3GRU A;  1IN8 A;  3RFW A;  4KX6 B;  4X62 M;  5JZE A;  2J4X A;  3TWK A;  2WNM A;  1E9M A;  2IGG A;  2R65 A;  1L1Z A;  3AKZ A;  2J7O A;  1SF0 A;  1XLN A;  4LRT A;  1RYJ A;  4OVZ A;  3ETR A;  4NAM A;  1PFD A;  1UWX A;  2WXH A;  1ZE3 D;  4JYA M;  1TS5 A;  4NRW A;  4AZF A;  1I7H A;  3KWL A;  2BS3 B;  1I4Q A;  3K2L A;  4YT0 B;  3GPY A;  1C1K A;  4RGT A;  5IWA M;  4N6E B;  1C4P A;  4G4O A;  1J09 A;  1IBX A;  2QEN A;  4YSZ B;  2H1R A;  1LV7 A;  1ESF A;  2Z8L A;  3KDS E;  3GPU A;  3NS1 A;  5BR8 M;  4AG5 A;  4EE2 A;  3KWV A;  2XEP A;  4KLN A;  1OQR A;  2CJN A;  3U6C A;  3LQQ A;  4NJC A;  3AOE C;  1PGA A;  4BLC A;  3NWL A;  4LJ6 A;  5ITX E;  4IBD A;  2IPK D;  3SR6 A;  3AJI B;  5BMH A;  4X65 M;  5HFY A;  4A5U A;  4P16 A;  4DXF A;  1JQ4 A;  3FIL B;  1DOX A;  4WUR A;  1E32 A;  4RCO A;  2M19 A;  3DOA A;  4ZHO A;  4NSO B;  4OX9 M;  2MJ3 A;  3T3O A;  2WU2 B;  2DWZ B;  4JI1 M;  1N63 A;  1V1P A;  2EKI A;  1HQR D;  5EXP A;  2QSD A;  1FCL A;  1Q10 A;  1PGB A;  3U61 A;  1GVN A;  1QYR A;  4IBJ A;  3AE6 B;  2OPF A;  4QHS A;  4DR7 M;  3PHW A;  1KLG D;  1PM5 A;  2K0P A;  4A8X C;  5A2Q S;  1I4H A;  2V1C A;  1C77 A;  3I51 A;  1MPE A;  4HXD B;  2JA2 A;  4GC9 A;  2UXC M;  4LRS A;  4I4L A;  3NUH B;  1IN5 A;  1QAN A;  1I4G A;  2R61 A;  4HLQ A;  4G4R A;  3SAT A;  3V3X A;  3OWE B;  2BTW A;  1PYW D;  4TQ1 A;  1UNS A;  4IKG A;  3JAM S;  4GRI A;  1WSP A;  1VZ6 A;  2W55 A;  2Y5P A;  3U60 A;  3DA1 A;  1ROE A;  1FXA A;  1E9S A;  3LVW A;  1FM0 D;  3FD9 A;  2JZP A;  1IXS B;  5DNY A;  1DGG A;  2XFS A;  2N0S B;  1N61 A;  2JTC A;  3P4P B;  2ZW1 A;  2W54 A;  5LMU M;  1ZDX A;  2CHQ A;  2KMM A;  1NSF A;  2KZU A;  2DVW B;  4L78 A;  1I94 M;  1NYQ A;  1SXJ A;  3W5V B;  3H8H A;  4LZJ A;  1K52 A;  3ZJV A;  1AN8 A;  4DR1 M;  1WXQ A;  2NTT A;  3HHX A;  5EXT A;  3IXS A;  4C56 C;  2L09 A;  3N9Y C;  1AW7 A;  1MX0 A;  3URY A;  1CZP A;  3MP2 A;  1DGB A;  3T15 A;  2D7G A;  3AEB B;  3R8F A;  1L6V A;  3IG5 A;  2LXE A;  3AEF B;  3GLI A;  4KGR A;  3AE2 B;  1R6B X;  1C4A A;  2W3S A;  2TSS A;  4US9 A;  2KW0 A;  1I4P A;  5E6J A;  4JI3 M;  2PLP A;  3SMS A;  4MI7 A;  5KQD A;  4JI5 M;  1FNU A;  2QJL A;  1QF6 A;  1DOY A;  1IXR C;  1C76 A;  1SB3 C;  1IN6 A;  2BYT A;  4TSS A;  4NSR A;  2QBY B;  3NVV A;  2CV1 A;  1KH0 A;  3BB7 A;  1VDD A;  1IN4 A;  1JRP A;  1QOG A;  3FTF A;  1N75 A;  1HNX M;  4NZL B;  3FTC A;  4Q2J A;  3U6O A;  1IY2 A;  4ZHP A;  2UXD M;  3ZC7 B;  2SAK A;  3FIL A;  3AE9 B;  3KS8 A;  4OZB A;  1NY5 A;  2FBW B;  5KPR A;  3TSS A;  1QVR A;  4RH6 A;  3SAU A;  5BYS A;  1QQW A;  5KPT A;  3SYK A;  1QOB A;  3SYL A;  3OQC A;  1HQC A;  2RGO A;  1F2R C;  2DWL A;  3AB5 A;  1NEN B;  4M0D A;  3PHX A;  1OQQ A;  2CV0 A;  2LUM A;  1KYI A;  2Z7J A;  1MI0 A;  4IDI A;  4H2A A;  2ON8 A;  4FVM A;  2WXF A;  3ZNH A;  1IQP A;  4S12 A;  1XC8 A;  3KW6 A;  3R9X B;  3AH7 A;  3BY4 A;  3I57 A;  5C18 A;  5HG2 A;  3ILK A;  2GB1 A;  1NJF A;  4JI6 M;  2YR0 A;  2LHD A;  3R8B A;  1JCK B;  2Y21 A;  4JI7 M;  3VR9 B;  1JR3 A;  1ENF A;  3U6D A;  1G59 A;  4MM3 B;  2XH9 A;  3IAS 1;  4C7Z A;  1Z5B A;  3J7A S;  4DV2 M;  4AG6 A;  4DV7 M;  3Q8F A;  4LGY A;  3Q8B A;  1IM2 A;  3U6S A;  3Q8A A;  4D80 A;  1NVI D;  4IBG A;  2X4A A;  3FUW A;  1XF5 L;  5H8Y E;  5ITX A;  4GIP A;  1TJE A;  2W82 A;  5E26 A;  3EUB 2;  2CEA A;  1E9R A;  2KDM A;  1T3T A;  1QOA A;  3U6Q A;  1XXH B;  1I4W A;  1FIQ A;  3AOG A;  2KQ4 X;  2BS2 B;  1EWY C;  2WU5 B;  4YSX B;  1D5M C;  3W1S A;  3L28 A;  1TZO A;  1SE2 A;  1UGJ A;  2CHG A;  4CQN A;  4FWH A;  4A55 A;  3P63 A;  3EIE A;  2D7H A;  4JXJ A;  3GS2 A;  1G41 A;  1OFI A;  1HT1 E;  2L83 A;  2QIL A;  4L1B A;  3L29 A;  4RKX A;  2KRU A;  3KP0 E;  2BBC A;  5LNK 1;  3ZGZ A;  3TEW A;  4IBF A;  4ARI A;  3J2P B;  4D81 A;  2XN9 C;  1K3W A;  4DV3 M;  1ZXH A;  4LFA M;  4YTP B;  2NQ8 C;  2H89 B;  4M0W A;  3AEC B;  1KLU D;  4O1N A;  3FTE A;  1N33 M;  3SAS A;  1MU5 A;  3PO0 A;  3PZ7 A;  1R7S A;  2WXN A;  2UXB M;  4GHA A;  2B76 B;  2XGN A;  5ITT A;  4LF6 M;  2WXI A;  1E7P B;  3U6L A;  1SBB B;  3AE1 B;  1UM8 A;  5G5H A;  2DOS A;  3U61 B;  4MH0 E;  2NTS A;  4II7 A;  3E56 A;  2GRI A;  1TY0 A;  4PDG A;  5FTN A;  3KP1 E;  3VK8 A;  4FCV A;  2P5T A;  1F2R I;  3AM9 A;  3VRB B;  2RGH A;  3W9C B;  5F3W A;  5EP2 A;  1HZ5 A;  4XDD A;  4DV6 M;  4XWT A;  4GIT A;  4AQY M;  2LFI A;  2OHF A;  5EP4 A;  3HHY A;  4M9S A;  4DR4 M;  1DKI A;  3KFU G;  2V6Z M;  1D6E C;  1YJJ A;  4M9Z A;  3GQ4 A;  3HWS A;  3I4Y A;  1JW9 D;  2BB5 A;  2KAC A;  5ITY A;  1N5X A;  2C98 A;  3ZCB B;  4IBC A;  1D2N A;  4FCT A;  2YQZ A;  3PZ8 A;  2BJV A;  3GLF A;  5BMI A;  1P7F A;  4XE0 A;  1XEE A;  3AEA B;  2E5L M;  3KLS X;  3SAW A;  4B3S M;  5EXX A;  4ITK A;  1J7C A;  3HGI A;  4L8R C;  2KXE A;  3O65 A;  1IBK M;  2WXO A;  2YNM D;  2I2Y A;  4XDC A;  4P6V F;  2BB6 A;  1ZUD 2;  1IY1 A;  5EJC A;  2M5Z A;  4NL4 H;  3TL4 X;  5H92 C;  1NHW C;  2BW2 A;  1JR3 D;  3K92 A;  4LF8 M;  3AOE A;  1L2D A;  3Q8X A;  1K50 A;  4GLS C;  3SFE B;  1K51 A;  2XSZ A;  4B08 A;  3PVS A;  2QIE B;  3P4S B;  4L16 A;  1SIJ A;  1VZ8 A;  1N36 M;  4CGY B;  4KKI A;  4FWG A;  3FUV A;  3HU2 A;  1Z59 A;  5AUK A;  1L8Q A;  2L7H A;  4JWS C;  3EIH A;  1H6U A;  1AWD A;  2X49 A;  3R2T A;  1NI3 A;  3VFD A;  3U6E A;  5I4D A;  2ACZ B;  3AED B;  2Y20 A;  1KFV A;  3ZJU A;  3D8L A;  4QOZ C;  1C78 A;  2LHE A;  4MT5 A;  4JI2 M;  5LMN M;  2J7Q A;  1VR9 A;  1R7R A;  2YEP F;  4HEA 1;  5D3D A;  1L0X B;  3NVZ A;  2YFQ A;  1DGH A;  1MHX A;  2W3R A;  2F5P A;  1VRA B;  2L7I A;  2HKJ A;  2HWK A;  1SXJ E;  3LYY A;  3P1M A;  2AHM A;  4D8I A;  2Z3X A;  1PDX A;  3A42 A;  3PXG A;  2AX5 A;  5C2T B;  2QPA A;  4XBO A;  3FKE A;  2DWM A;  3AV8 A;  3RNV A;  4DV5 M;  1IUE A;  4NOO B;  3EA6 A;  4IBB A;  4DR3 M;  2XSZ D;  4RFB A;  3B21 A;  3HJ8 A;  5ITU A;  3ABV B;  3L4P A;  4LG2 A;  2N9L A;  3HU3 A;  2ZM6 M;  1SE4 A;  3D8B A;  1T3Q A;  2WXJ A;  4KO8 A;  3KSJ A;  4RF1 A;  1TH4 A;  2VZK B;  1B9R A;  2BU3 A;  2G1E A;  1KSF X;  2LH0 A;  1L2C A;  2C96 A;  1V8C A;  2O5R A;  1NEK B;  4D8E A;  4IIW A;  4X64 M;  1NHG C;  1D5X C;  1GB1 A;  4ZYS A;  3TE6 A;  2FUG 1;  3J80 S;  5KO3 A;  1K3X A;  3KOX E;  4DV4 M;  1WGK A;  2J53 A;  4B0M A;  4HKZ E;  3RFZ B;  3FUT A;  4LLG M;  2BJW A;  3W0F A;  2M56 B;  4ITQ A;  3GPX A;  2Y5C A;  3NZ3 A;  1R2Y A;  2KA6 B;  2QZ4 A;  2L32 A;  1G4A E;  3W2D A;  1YN3 A;  3LQR A;  4FCW A;  3GP1 A;  1ZAE A;  3GPP A;  1XCT L;  4I81 A;  2WXP A;  5MPO A;  3HJQ A;  1TGU A;  3EGR A;  1RFK A;  3C0R A;  1T6B X;  5JXV A;  3MFG A;  3DFZ A;  4L15 A;  1D4B A;  4MGH A;  1L2B A;  1W5T A;  4M9X A;  4A3V B;  1XXG A;  2RKO A;  5HHD G;  1YJI A;  1HNZ M;  4Z8X A;  1E0Z A;  4Z6Y A;  3BK2 A;  4WH4 A;  4G4Q A;  3U2S C;  2PVO D;  3RPF C;  4OW0 A;  4LJ9 A;  4MGY E;  3AEE B;  2EA0 A;  2K5P A;  2XLJ A;  5TSS A;  1QAQ A;  1EU3 A;  3W0L B;  2MH7 A;  3L2A A;  5ITQ A;  2VQE M;  3ZJT A;  1SJH D;  2FNA A;  2RMM A;  3TRK A;  2R18 A;  3PRP A;  2ERC A;  5BMG A;  4RF0 A;  2CFO A;  1NJG A;  3DZD A;  1N78 A;  1FMA D;  2L6O A;  2DYO A;  2MJD A;  1CK1 A;  4XZX A;  3NVY A;  1HXY D;  4RGO S;  3PNV A;  3B2F A;  5FK9 C;  4B3T M;  3UJN A;  1RM6 C;  2DWQ A;  3HKP A;  4GMQ A;  2DZO B;  4ZOH C;  2ZW0 A;  2QCU A;  4LTU A;  1X37 A;  1GKI A;  4BBA A;  5T8I A;  4GDK B;  3GQ5 A;  3MC0 B;  2HL7 A;  3BYY B;  4ZRQ A;  1GL6 A;  5FTL A;  2UUA M;  4JWU C;  1YN5 A;  2ZAO A;  1FXI A;  5FLX S;  2WXG A;  5GKN A;  1FEH A;  3GRY A;  3BBA A;  3TEY A;  2IJ0 A;  1F0Z A;  2PTL A;  3UMM A;  1EE8 A;  3VRA B;  4KHP M;  2LWX A;  4X66 M;  5IT9 S;  2DLB A;  4LJ5 A;  1Q39 A;  3BWU D;  2A5Y B;  4NXN M;  3PNY A;  1KTK A;  2VZK D;  1GB4 A;  1G3I A;  5ITR A;  3KVW A;  3O13 A;  3TEZ A;  5JI3 E;  4ZPX A;  5BYR A;  2JQR B;  3SHG B;  2WXR A;  3H4M A;  3VLF B;  1Y56 A;  2F5S A;  1E6E B;  3GLF B;  2DBY A;  1L6U A;  1N34 M;  3AFH A;  1V1O A;  2WXK A;  2V1U A;  4LF9 M;  3L26 A;  4LJA A;  1TH2 A;  4W5W A;  1MVK A;  4LF4 M;  2DWN A;  5EZQ A;  3VKH A;  5DYI A;  4LF5 M;  4AI6 A;  4BOQ A;  4QNR A;  4FXC A;  3LMM A;  1HQY E;  3KSX A;  2PW9 A;  1XLP A;  2NMQ A;  3GO8 A;  1SJE D;  4GKJ M;  4USA A;  4CHT B;  2Y0T A;  2L1A A;  2FOI C;  1YMH E;  2XF3 A;  8CAT A;  1F77 A;  1N32 M;  3U5Z B;  1JWU D;  1QAM A;  3SMP A;  3P4R B;  3MHZ A;  5KQ8 A;  1ZDV A;  2LNH C;  3CIR B;  4JI8 M;  4HKQ A;  4C7Y A;  2JXT A;  4MGK E;  4GH9 A;  1DGH B;  2PVG C;  3VK7 A;  4TUW A;  3FC4 A;  4J3O D;  3GP7 A;  1G8P A;  4NXM M;  2G9H D;  2JRI A;  2KRK A;  3LXF A;  4N58 A;  3CF6 E;  1HT2 E;  1D5Z C;  3HRD D;  1TS3 A;  2WXL A;  3R2I A;  3GLG B;  2BS4 B;  2E3T A;  4PDI A;  1STE A;  2GI9 A;  2INP E;  3IG8 A;  4LF7 M;  2CV2 A;  2UU9 M;  2X8A A;  1T5X D;  1XCQ L;  2CJO A;  3KXE C;  4JI4 M;  3FUU A;  1MHH E;  1WYG A;  2ZAN A;  5JI2 E;  4QHT A;  2N7J A;  2WDR B;  3BYT B;  3MTV A;  3AE4 B;  5H37 D;  2I7N A;  5EQT A;  4MGZ E;  1KRH A;  1QZM A;  1NVM A;  2HTM E;  4HL4 A;  3UGJ A;  4GHL A;  3V05 A;  1DO2 A;  3U7Z A;  1FCC C;  1HR0 M;  3E9S A;  3VKG A;  2Y0Q A;  1N5W A;  4GC5 A;  3AE3 B;  3PHU A;  4LJ8 A;  3NVW A;  3BVG A;  5D7G A;  3CF2 A;  1DO0 A;  1ACC A;  2R45 A;  1JWB D;  1L4Z B;  3HUI A;  4A6Q A;  4BOZ A;  1XWI A;  3TWM A;  3VDU A;  4IBK A;  1J5E M;  2UUC M;  1OFH A;  4DUZ M;  4DXG A;  4YTM B;  1M4V A;  1TYG B;  1FRD A;  4BOS A;  3GLH B;  1E10 A;  4C80 A;  4IBE A;  3TEX A;  3BVZ A;  2R4E A;  2F4V M;  3J7B A;  1XNQ M;  1A70 A;  4WAF A;  4ARC A;  2WP9 B;  4HRS A;  2M60 A;  3FYD A;  5C3J B;  2K22 A;  1BML C;  4LFC M;  1TS4 A;  2AGA A;  3M0E A;  1IY0 A;  2BNK A;  1JWA D;  3SAR A;  1QQR A;  2R4J A;  1VJK A;  4I5S A;  2UZJ A;  3I4V A;  3KOY E;  1TH3 A;  2WQY B;  4G6Z A;  1K53 A;  4LY6 A;  4N59 A;  3CF0 A;  1IGC A;  5EE0 A;  1OFF A;  1Q3C A;  2H88 B;  2V3P A;  3TQS A;  3KOW E;  3RGP A;  3AV0 A;  2XNA C;  1EM7 A;  5EE3 A;  2X38 A;  3GB1 A;  1OJL A;  1KFY B;  1YQ3 B;  4CIS A;  1FRR A;  2ZBK B;  3QWL A;  3IAM 1;  2Z4S A;  2SEB D;  1GAQ B;  3LB8 C;  2ZAM A;  1XLO A;  3RE8 A;  2LJI A;  3W31 A;  1QT9 A;  2VII A;  2KN4 A;  1R2Z A;  4HJG E;  1GOZ A;  1CQV A;  1B1Z A;  5EXS A;  2HDE A;  1PGX A;  3J81 S;  1WWT A;  3TPZ A;  4KGT A;  3NBI A;  3E4R A;  3I9V 1;  2VQF M;  4AKH A;  1N77 A;  2WDV B;  3AN1 A;  4HRO A;  4JV5 M;  2JSV X;  2LEK A;  3TMP A;  2EUC A;  3W30 A;  5FR3 A;  4QNM A;  2C5R A;  1SXJ D;  1L5P A;  2G8L A;  3HU1 A;  4JPS A;  1YNT E;  4LFB M;  3UI3 A;  1FNW A;  1IGD A;  2Z4R A;  1J7A A;  2K9X A;  2FFJ A;  3SEB A;  4L4U A;  1PVJ A;  1GPX A;  2BTW B;  1L4D B;  2WDQ B;  1ZXI A;  3JR5 A;  2F5O A;  2LMC A;  2YEP B;  3L25 A;  1FFU A;  4I8O A;  1IBX B;  1ZP0 B;  2KWD A;  3LVV A;  3HHZ A;  1V1P B;  3W5U B;  3HHW A;  3K8Z A;  4OZC A;  1FD6 A;  1I4X A;  1TY2 A;  1ZOY B;  3GLI B;  1JAL A;  4LK0 M;  2AQ1 B;  1SXJ C;  3GRR A;  2DHR A;  3FYC A;  1V97 A;  2Z84 A;  1VDV A;  2HCB A;  2DZN B;  1HEZ E;  3MHV C;  1QLB B;  1QIL A;  3TUO A;  2F5N A;  2R62 A;  1I4R A;  1Z5C A;  3C58 A;  3THG A;  3WHL A;  2J7N A;  2Q2E B;  4DQO C;  1PUT A;  5EP1 A;  1Q3B A;  3AE5 B;  4D8B A;  4JN6 A;  1YN4 A;  4AKI A;  3AE8 B;  4BOP A;  3B9P A;  1VLB A;  1JRO A;  2PMV A;  1S3S A;  4B3M M;  4BOU A;  3CTW B;  4L23 A;  5DYG A;  1K82 A;  1XXH A;  4RNA A;  1YSY A;  1DGF A;  3M7G A;  3U52 E;  2FE8 A;  1NYR A;  3SC3 A;  3BZD B;  4WQM A;  1XMO M;  1N60 A;  4QOS A;  1C9F A;  1Z6T A;  5EE9 A;  4FD2 A;  1JWS D;  1ZQ9 A;  2JU6 X;  4OZA A;  3VR8 B;  1KF6 B;  4DUY M;  1TKG A;  1TDZ A;  1DGJ A;  4DV1 M;  2L52 A;  3ZQ4 A;  2DXI A;  1QOF A;  4B7F A;  1TDH A;  4IBI A;  3HVZ A;  2Q5W D;  2RDG A;  4MB7 A;  3Q8C A;  3SFZ A;  4LCB A;  2CE7 A;  2F5Q A;  1ET6 A;  3Q8E A;  1IN7 A;  2LGI A;  4XWW A;  2M0A A;  2I38 A;  2C99 A;  4IUM A;  1FNN A;  3U60 B;  4KKJ A;  2V0G A;  2ICI A;  2G5G X;  1SSN A;  1Z5A A;  4B7G A;  4PCZ A;  2OED A;  4YTN B;  1DOI A;  2I7P A;  5IZ7 D;  2WLB A;  4YHH M;  3BVM A;  2XFT A;  4R3D A;  3GLH A;  2QEJ C;  4TQ0 A;  3MJ5 A;  3HJS A;  3A98 B;  3P42 A;  2WXQ A;  4RGM A;  3PFI A;  1SE3 A;  4EIW A;  2ONQ A;  2HHH M;  4LJ4 A;  3A45 A;  4RGN A;  1NNJ A;  5G5G A;  4LJ7 A;  1XO3 A;  3FUX A;  2OQ4 A;  3VDP A;  1WRI A;  1FFV A;  3VQI A;  2R46 A;  2Y3A A;  3KQ4 A;  4UDU C;  3IT4 B;  1YE9 A;  4GKK M;  3K1J A;  3WHK A;  1NY6 A;  1ORY B;  3U5Z A;  4D2K A;  1UUP A;  1EWC A;  3BOS A;  2RPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...