4COTA

The importance of the abn2 calcium cluster in the endo-1,5- arabinanase activity from bacillus subtilis
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
443
structure length
443
Chain Sequence
QKPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVDPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGQNSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXTRACELLULAR ENDO-ALPHA-(1->5)-L-ARABINANASE 2
publication title The Importance of the Abn2 Calcium Cluster in the Endo-1,5-Arabinanase Activity from Bacillus Subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 112
structure length 443
sequence length 443
ec nomenclature ec 3.2.1.99: Arabinan endo-1,5-alpha-L-arabinosidase.
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF16369 GH43_C C-terminal lipocalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.10 Mainly Beta Beta Barrel Lipocalin Lipocalin 4cotA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4cotA01
5A7VA 5C0PA 2OXBA 3OM2A 4D47A 3LFIA 1YI7A 4NOVA 3SC7X 3R4YA 3WN1A 4O8PA 3D60A 3BYKA 5FMDA 4N2RA 3VSZA 3C7OA 5JOXA 2QQVA 5JOWA 3AKHA 3C7EA 3VT1A 1Y9GA 3QEFA 4EQVA 1JIWI 1VKDA 3RWKX 4KCBA 1PT2A 1UV4A 1GYDB 4N4BA 1SMPI 5FIXA 3P2NA 1Y4WA 3UGGA 4PVIA 4UDIA 2AEZA 5AYDA 5FKCA 3UGFA 3R67A 2QQWA 5GLOA 5FMBA 3D5YA 4UDKE 2ADEA 1ST8A 2YFRA 4O8OA 5GLPA 4FFGA 2X8FA 3OM4A 2QQUA 3ZXJA 2VDTA 3KF5A 3C7GA 3LDKA 4FFIA 3U14A 3QEEA 2XQRA 4U6DA 3VSSA 3C2UA 5A8CA 5JOZA 4FFHA 3LIHA 1YRZA 3UGHA 3QC2A 5GLLA 3QZ4A 5AYCA 3C7FA 2AC1A 2EXIA 3WMZA 5AYEA 5ANNA 5GLKA 5GLNA 3VT2A 3D61A 3VSRA 3NQHA 4MLGA 5A8DA 3WATA 3ZXLA 4KCAA 3AKIA 3AKGA 3K1UA 3TAWA 2X8SA 2YFSA 1YIFA 5FKBA 4QQSA 4N1IA 2B4WA 4KMIA 3PIJA 2EXJA 3QEDA 1GYEB 1OYGA 3AKFA 2AEYA 3WPZA 3WPYA 2EXKA 4ONZA 5B6SA 4U6BA 1W18A 3LEMA 5FLWA 3KSTA 4O8NA 3D5ZA 3OM7A 3ZXKA 5FMCA 5JOYA 3BYJA 2ADDA 2YFTA 4N2ZA 4UDJA 5FK8A 3VSFA 3LDRA 5FK7A 4KC7A 1Y7BA 4COTA 3KF3A 1UYPA 5B6TA 4UDKA 1Y9MA 1WL7A 3OM6A 5GLQA 3BYNA 3WMYA 4AK6A 2EXHA 4AK5A 3WPVA 3R4ZA 1GYHA 2RN4A 5A7VB 4KC8A 3WPUA 3WASA 3WN0A 3BYLA 3WN2A 4UDGA 5GLRA 3LV4A 4PVAA 3CU9A 5GLMA 3WAUA 4AK7A 3OM5A 3VT0A 3C7HA 3U75A 5AY9A 2X8TA 4FFFA 3LIGA 3LF7A 3PIGA 1W2TA
chains in the Genus database with same CATH superfamily
1BJ7A 1FJ1E 3TGBA 2RTLA 1O1UA 4YFPA 3UEWA 1LIEA 1NQNA 3NQKA 4A1YA 3STNA 3JS1A 3KVNA 4WHIA 1PM1X 2GTLN 3RWXA 4DQ4A 2AEZA 1GGLA 5L8OA 3F6ZB 3B2KA 2FLJA 4ODDA 4MIRA 1EQDA 1DZJA 4BVMA 1SLEB 2L5PA 2OFAA 4JNJA 3CQNA 1Y0GA 2WWPA 1QY2A 4ALBA 3QC2A 3C7FA 5HA0A 5GLKA 4KT5A 1A2DA 1G7NA 3AKIA 4Y0QA 5FQ8E 4IB7A 1RBPA 4HPBA 4ZH9A 1A3YA 4NNTA 1VWQB 2FS6A 3WPZA 1X8OA 1SRFA 3ZXKA 5JOYA 1B56A 4UDJA 3WZOA 4GNWA 2ALLX 1EIIA 1O8VA 1GT3A 5L8IA 3R4ZA 2RQ0A 1VYGA 3PDFA 2N93A 3RZYA 3FENA 3ZWEA 4EQAC 3TF6A 4ES7A 4XMCA 3FMZA 2Q39A 1JYJA 2IFBA 1OEEA 1W2TA 4A60A 5A7VA 3OM2A 1O1VA 3UEUA 4AZNA 3ZZVA 2JN3A 4ZHGA 2RTEB 5H9LA 2JMBA 5JOXA 1LCVA 4MVIA 1SWHA 4O49A 3S60A 5B29A 4AYHA 2AKQA 1TOUA 4GKCA 3C7EA 2OFMX 3MM0A 3L4RA 3AKNA 5FIXA 3P6DA 4WFVA 3BX7A 1ST8A 1LICA 4NW4A 1RXHA 3BS2A 1OSPO 4CPHB 1RXJA 2OY1O 5JOZA 1QG5A 1YRZA 3D95A 5AEOA 3WZNA 5HCCC 4O4XA 4GETA 2HZRA 2BLGA 2JOZA 2L67A 4MISA 2IZBA 3PQSA 4KMIA 1KXOA 1S44A 3VG6A 4O3WA 3KFGA 3JQOA 5IO5A 5FLWA 1XCAA 1G74A 4MEEA 1VWCB 3SZHA 1ICNA 1VWIB 1EUOA 3D96A 1LF7A 1E02A 4UDKA 5GLQA 1LKEA 3S26A 4YVBA 4AK5A 2HNXA 3WPUA 3BYLA 1JMXA 3LV4A 4GZVA 2FKGA 4YKMA 4U8UN 4ZFXA 5L3YA 3MVFA 5KICA 4LKTA 4BCSA 3WJCA 3SC7X 5FQ7E 4QQ1A 2CZUA 3FA6A 5EDBA 1FDQA 3QKGA 4CK4A 3AUMO 3VHIA 2UZ2A 2C4IA 4INNA 5HAEA 3HOLA 1TXLA 2OL6O 4PVIA 2I5ZO 2W2BA 4OMWA 1HXZA 1SWFA 1JJJA 2OYBO 4IMNA 4O4SA 5GLPA 1VWAB 1UYOX 1SWDA 4XMGA 3JSQA 3WYPA 2HZQA 2LBVA 4YCEA 1B4MA 3PP6A 4A8ZA 1VWDB 5GLLA 3T6FA 1OEKA 3VT2A 2AT8X 4YBPA 4EFGA 1CJ5A 1YIFA 5FAZA 1VPRA 1MM9A 1X8NA 3AKFA 2OVAA 5D48A 2AEYA 2PI3O 4XMDA 2LFOA 3TGAA 1ACDA 2QCBA 2WQ9A 1E5PA 1SXWA 3V8UA 2C1SA 2A3FX 1UYPA 3EMMA 1ZNLA 4ZGUA 1GYHA 2RN4A 4AZMA 3RE5A 4HWMA 3NX1A 4TQ2A 2OFBA 2BS5A 1SWCA 1SRIA 1G85A 1YP6A 1MVGA 3MG5A 1BRPA 1SWQA 3R4YA 3VSZA 2ZAIA 2GJ5A 1OBQA 1HMTA 1KGLA 4ZHFA 1CBRA 3RKGA 4OMXA 1WUBA 1IW2A 2CAMA 1LIDA 4HFOA 3NADA 1ZRYA 5LKEA 1Y53X 2X8FA 3OM4A 3HK1A 3KF5A 1FE3A 3DSZA 2Z4IA 2OY7A 2Q9SA 4OEMA 1BLRA 1N43A 2AC1A 4Z28A 1HN2A 1IJ8A 1DZKA 3WATA 3K1UA 1QY1A 4GRJA 5K67A 4QQSA 4ORSA 5HWZA 2G5LA 2EXKA 2Q2PA 4YH0A 3KSTA 2RTIB 3RE6A 3FR5A 2OY5O 1SWEA 2A0AA 3P24A 2AL0X 1JBHA 3WVMA 4Z6JA 4QRLA 4LZUA 3NR3A 1K24A 1KFFA 2BSZA 4RUNA 3C7HA 1ALBA 3U75A 1SWUA 2FTBA 3UEVA 4FFFA 5IRAA 2ACPX 4Y59A 4EDEA 3QQ2A 3K3LA 1FENA 2QQVA 4BJ8A 5B3MO 1Y9GA 5HZ9A 3KFFA 4KIIA 4UDIA 1NP1A 4A1HA 1H91A 4ZHCA 4PSQA 2AT5X 2F01A 2WPUA 1JMZA 1W6FA 4CPIA 5KHPA 1I9HA 1IKJA 1I04A 3VU1A 2RTKA 2ACOA 4ZR2A 2AH7X 3P6CA 3S5XA 1IFCA 2MM3A 1KL5A 2FWVA 5GLNA 3EC5A 5B27A 2AT6X 5H8TA 2B4WA 1GT1A 1K3BA 2KTSA 1QABE 3EW1A 3QEDA 1KT5A 2W2AA 1DF8A 3C77X 1ML7A 2CM9A 3CWKA 4O8NA 3D5ZA 4GD9A 3BYJA 1A18A 1SWGA 4YBUA 2OY8A 3KF3A 2IZIA 2XSTA 2OL7A 4AK6A 3RSWA 2MHDA 2X4MA 4QZUA 4WFUA 1YP7A 2VFCA 2R73A 4YGHA 3SZJA 4BX6B 3EM0A 5B11O 3VHHA 3LF7A 4QYNA 1GT5A 1YI7A 1W4TA 4HPAA 1AELA 4CDDA 1B8EA 3AKHA 1DZMA 2LKKA 1KT6A 3SZIA 1KQXA 3SLTA 1E06A 2A5BA 4NV8A 1DV9A 2IZCB 3RY2A 1SWTA 3FW5A 4B55A 4L3RA 3C7GA 1HMSA 4FFIA 4O4OA 2R74A 2G78A 1KL4A 5HBSA 3QZ4A 5AYCA 3OD9A 4IMOA 5HCEC 1ZNHA 2ASNX 4MLGA 1YIVA 5A8DA 2BS6A 1YWCA 1SWBA 4IABA 4IAXA 4ZHHA 1VWHB 2Y3FA 1BRQA 3PIJA 3OE3A 2UYWA 4YFQA 3TGCA 1SWPA 1U18A 3LEMA 4CPEA 2QO5A 2QM9A 3U9PC 5HA1A 4N2ZA 2DJGA 2WSJA 2A13A 3B2IA 2RD7C 4IRWA 5BYPA 1FELA 4O9SA 4IBAA 2IZJA 4PJ2A 2G79A 3APUA 3CMPA 3P6EA 3VG5A 1I05A 1ZNEA 3CU9A 2FHLA 2GTFX 3NP1A 4ON1A 4LQZA 2A2GA 1VWRB 3WZQA 3PECA 2GTLO 2MO5A 1SWNA 1OEJA 2OF8A 1Y4WA 4TKJA 5AYDA 1VYFA 3R67A 5CE4A 5LKFA 4O4UA 1SA8A 2RTJA 4XMEA 3O2YA 3EW2A 2OVEA 2VDTA 3ELZA 3F9DA 2EXIA 5ANNA 1RLBE 2Z4HA 4JHQA 1SWOA 4NV7A 5FENA 1VWKB 4M7MA 3STKA 5LJKA 1WBIA 2W2FA 2FKJA 5DPQA 1SXXA 1LNMA 4FQBB 1W18A 1JQPA 3T6LA 1TOWA 3VHMA 3S5VA 3HWDA 1NQMA 3WJFA 4D6AA 5HTDA 1Y7BA 1QQSA 2X56A 3OM6A 1SRGA 3UAQA 4KC8A 5BVTA 3PK2A 1EIOA 3CKFA 4D6BA 5GLMA 4MVLA 3OM5A 4GUZA 3VG4A 4I9RA 3P6GA 1JJUA 2NP1A 3DTQA 4GGTA 2FRSA 3ZQ3A 2X45A 1PMPA 1JV4A 4U46A 3D60A 3ZW1B 1VWOB 2QOSC 4IB9A 5F2BA 4MVEA 3BDRA 1ZNGA 3B2LA 3LHNA 5B5GA 4YDAA 5LJCA 5GLOA 5FMBA 3D5YA 3NBXX 5EEDA 1ADLA 1KQWA 4O3ZA 1UZ2X 5B5FA 3KFIA 1T8VA 2P8GA 1VWFB 3U0DA 3WMZA 3BSZE 4Y0SA 2JW1A 4DCBA 3U03A 3D61A 1AVGI 3NQHA 2RTCB 4O3XB 3T1DA 3VGWA 5FQ6E 3NPOA 3BRNA 3BX8A 2G7BA 1LUQA 3WJBA 1NP4A 3ZW0A 1LCZA 1L6MA 3BY0A 1MUPA 2A8GA 4M6SA 4QAEA 1GKAA 3BU9A 2ADDA 4K19A 2FHNX 5FK8A 5JD2A 1KT4A 4BX6A 1WL7A 2GTLM 2RTBB 1MK5A 3T2WA 2RTQB 1KT7A 4ALOA 4Z27A 1IIUA 2BHVA 5K06A 2OZQA 2QMIA 3CKGA 3B2HA 3D4RA 3VT0A 1QFTA 5H9KA 5LJEA 4FBVA 2OXBA 1SLFB 4BX5A 3FA8A 3Q34A 3TZSA 4ZHDA 4OS8A 2RTAA 1VWPB 1N0SA 3H3IA 1JIWI 2AMMX 2GC9A 1PT2A 3UGGA 1PTSA 4YDBA 1HY2A 5CHKA 2I5VO 3SOTA 1FEMA 4Z2VA 3NQ9A 2YG2A 2NNEA 3RDQA 3OBLA 1SREA 2QQUA 3C78X 1JZUA 1I4UA 2OF9A 1GX3A 1TVQA 2Q2MA 3LDKA 1BBPA 5A8CA 2NNDA 1U17A 3FDCA 4XMHA 4CPFA 3BLGA 4ORUA 3IFBA 1OPAA 3FELA 1VYOA 1MX7A 2O62A 5F1EA 1MOYA 3OM7A 3FA9A 5LJHA 5FFHA 3FYFA 5CSEA 5F7GA 1X8UA 3WOVA 3B2JA 3HWFA 4FGIB 4TKBA 5A7VB 1HXLA 3RDOA 1U0XA 4CDCA 5B2AO 4GE1A 1X8PA 4GJSA 4GU8A 5AY9A 1D3SA 3MX7A 3LFIA 3FIDA 2QOMA 5DG4A 2A5CA 3BYKA 3AKMA 5IO6A 4I3CA 3C7OA 5HCDC 1EXSA 3N91A 4RUUA 1EW3A 4KCBA 3P2NA 3FR2A 1SRJA 2QQWA 5IRUA 1LIFA 4UU3A 5D45A 4O8OA 3RDUA 2X55A 3HWEA 5CYBA 1AVDA 1DFVA 5LJDA 5C2MA 1VWNB 2L9CA 3VG7A 4QGWA 4YGGA 2OVSA 1IKEA 4I60A 1I06A 4OELA 1STSB 2OVDA 4CPHA 4U8UM 2YFSA 1FTPA 2K62A 3SAOA 1KOIA 2ZAGA 4ID2A 2JGSA 1STRB 4YCHA 4I6SA 1QY0A 1S7DA 1DC9A 2ANSA 4I95A 3VSFA 4GDAA 3BYNA 1MEPA 3APXA 4UU2A 1KL3A 3WN0A 3KQ0A 3WN2A 1SWRA 4ZCBA 3I0AA 2X46A 5H9AA 4NLIA 1VWLB 3IA8A 4Z2OA 4YGZA 5EDCA 4O3YA 4CSBA 4BX7B 1X89A 3ZW1A 2AT0X 3ZW2A 2OL8O 4Y0RA 4NOVA 2CBRA 5H9NA 3LTWA 3WJDA 4O8PA 4ZH6A 2HLVA 1ERXA 1NDJA 4NLJA 5JOWA 3WZPA 1VKDA 2WEXA 1TL2A 2LBAA 3UGFA 1RSTB 3VE1A 1EI5A 3ELXA 2ZSCA 4JO6A 1LCWA 3WXQA 2GH7A 3EYCA 1IFBA 2L68A 4CV7A 5EEEA 4GDZA 2KT4B 1LPJA 3TAWA 5HZQA 2RTDB 4I9SA 3HWGA 1E00A 3VPJE 3FIQA 4AW8A 1X8QA 4GGRA 3O19A 5FMCA 1GX9A 5HZ6A 3Q6LA 1BWYA 4IB8A 4NNSA 3ZUIA 3ZUOA 1YWBA 2EU7X 2F73A 5JR8A 1HQPA 1AB0A 2OFRX 5LJGA 1D2UA 1LELA 4EEJA 4IAWA 1VWJB 5IXGA 1ICMA 5C0PA 4QZTA 4D47A 1N4JA 3VG3A 1PBOA 3PEDA 1OPBA 1N9MA 3APVA 4N2RA 4ML7B 4ORRA 1GX8A 3VT1A 4EQVA 5AJBA 3RWKX 1SY0A 2Q4NA 4I3BA 3P6HA 1PBYA 1P6PA 4AZQA 2K23A 1QFVA 5D8JA 2HMBA 2MWHA 1SY1A 3RDMA 1Y9TA 2RTRB 3VE2A 3ZXJA 2F09A 2WR6A 5D47A 3WJEA 3NX2A 4U6DA 2IZDB 5F6ZA 1DF3A 1BSQA 2POAA 1DZPA 1CBQA 2KW1A 1Z24A 4Y5DA 2BC3A 3P6FA 1RSUB 1LDQA 4N1IA 3FEPA 2IZFB 2KTDA 1HBQA 3HTYA 2HKDA 4ORXA 4JGLA 5IRWA 5B6SA 4GH7A 2VDFA 4AZRA 3RDXA 2NNQA 3T2XA 4N7DA 4KC7A 4OKAA 1VWEB 2VFBA 4OS3A 3RY1A 1LFOA 3WYQA 5AQ6A 1GT4A 2RTNB 3WAUA 2X8TA 4Y0PA 1X71A 2FS7A 1SLGB 2BT9A 1SLDB 1HQQA 1JJXA 2IZGB 4I3DA 5FMDA 2CZTA 2YMSA 2R56A 3GE2A 1EPAA 3RDSA 5FKCA 1SRHA 3HOEA 3GAQA 2ADEA 2YFRA 2RTPB 1SY2A 1OBPA 1VWGB 1NBXA 3QEEA 4NYQA 3LIHA 3PH5A 1SXYA 2FGSA 3C76X 4MVKA 1QWDA 4NYRA 3STMX 1XKIA 4ARHA 5AYEA 3D9WA 2HYSA 2FR2A 1EPBA 1B0OA 1ERBA 1ZNKA 3OJYC 1BSYA 1OYGA 4IB6A 2A2UA 1NGLA 4BOEA 1A57A 2YFTA 4LZVA 4CDEA 2RCTA 4COTA 1Y9MA 1R0UA 3WMYA 2EXHA 2WEWA 1W5RA 4BX7A 4BBOA 1OBUA 2IZHB 3WBGA 4TKHA 2MJIA 1G5WA 3UEXA 4U8UO 3WN1A 2WUTA 4GK9A 1TW4A 4YKOA 2JU7A 1JYDA 1Y52X 2PY1A 3MBTA 4Z2PA 1SXUA 3I17A 1STPA 5L8NA 1SWJA 1BEBA 3PH6A 3FA7A 5AJCA 2DJFA 3C2UA 3X00A 1EALA 1YWDA 5EPQA 3CBCA 3VSRA 5D4AA 2X32A 2IZKA 1LDOA 4KCAA 1KZXA 2X8SA 5FKBA 2XKLA 2EXJA 2RTFB 1NC9A 1RAVA 4ONZA 5BVQA 3EBWA 1Y55X 3D97A 2CM4A 2QO6A 3LDRA 5B6TA 1KZWA 3WASA 4AZOA 5GLRA 2AF5A 4C5PA 1SWAA 2MF6A 3CR6A 3BU1A 4ZGFA 4AK7A 1SWSA 1SY3A 1VWBB 1CRBA 4ORYA 3PIGA 2E4JA 5F6BA 2LA7A 5EZ2A 2RTOB 2RCQA 1I78A 3SLJA 3P02A 4BGFA 1MX8A 2M4LA 1GYDB 4N4BA 2JU8A 2RA6A 4N7CA 4AZPA 4UDKE 1PEEA 2RTGB 1S2PA 3FLLA 3PQUA 1AQBA 3U14A 4BQUA 3VG2A 4QYPA 3UGHA 1GXAA 2KD2A 4EKVA 3FR4A 2RTMA 4QNIA 4FBOA 3ZXLA 5K68A 1YWAA 3EBKA 3AEHA 5KIDA 1SWLA 2WQAE 2DM5A 4TJZA 3FW4A 1AVEA 1GYEB 1YUPA 3WPYA 2FR3A 2LB6A 4R0BA 1HMRA 2G8CO 5FK7A 4KH8A 3RBYA 1SWKA 1GM6A 4FBRA 1CBIA 1UREA 2CBSA 4PVAA 3FEKA 1RXKA 5BVSA 4L1NA 3LIGA 2QO4A 5LJBA 5HZ5A 4WBKA 4GGZA 1LIBA 4QGVA 1UYNX 3G7XA 5C0NA 2IZLB 2AT3X 1CBSA 2FT9A 3WJGA 3CBSA 1HBPA 3QEFA 4U3QA 3NQ3A 1BSOA 1UV4A 1SMPI 1VWMB 4U9CA 2RTHB 3E3CA 3ZI8A 2IZEB 4OS0A 4FFGA 1N9YA 4ORWA 2Y3EA 2XQRA 4EXZA 4GJVA 5HZ8A 3VSSA 4FFHA 5B10O 4HPCA 3ZW0B 1BM5A 1GKAB 4QGXA 2AVIA 4TNNA 3AKGA 4DQ3A 3SLOA 3KZAA 5HTEA 1MDCA 4DNEA 4YMYA 1N7YA 4TLJA 4U6BA 1T68X 3APWA 4LKPA 1ZNDA 1KT3A 4HPDA 4YFRA 1T0VA 4XMFA 4CDFA 5IO7A 3HPEA 1Y9LA 2X34A 4ZJ0A 3WPVA 3KFHA 4GNYA 2IZAA 3CQRA 3F8AA 4BX5B 4UDGA 2Y32A 5F58A 1E2TA 3PPTA 2C1QA 4NP1A 2JU3A 3O22A
chains in the Genus database with same CATH topology
5H9KA 5LJEA 4FBVA 2OXBA 1X71A 1BJ7A 2FS7A 2BT9A 3TGBA 2ACPX 4EDEA 1JJXA 3FA8A 3K3LA 4I3DA 5FMDA 1O1UA 1FENA 2CZTA 3TZSA 4YFPA 4ZHDA 4OS8A 2QQVA 2YMSA 3UEWA 1LIEA 3NQKA 2R56A 1N0SA 3H3IA 4A1YA 3STNA 3JS1A 1Y9GA 1JIWI 2AMMX 2GC9A 1PM1X 4WHIA 5HZ9A 3KFFA 1PT2A 3UGGA 3GE2A 4KIIA 1EPAA 2GTLN 3RWXA 4UDIA 4DQ4A 2AEZA 5FKCA 1NP1A 1GGLA 4YDBA 4A1HA 3SOTA 3HOEA 5L8OA 1FEMA 3F6ZB 3NQ9A 3B2KA 3GAQA 1H91A 2FLJA 2ADEA 2YFRA 4ZHCA 2YG2A 2AT5X 2NNEA 4MIRA 4ODDA 4PSQA 1EQDA 3OBLA 1DZJA 1SY2A 3C78X 1I4UA 2L5PA 4BVMA 1JZUA 2QQUA 5KHPA 3CQNA 1IKJA 1I04A 1TVQA 2WWPA 4Y0PA 2Q2MA 3VU1A 3LDKA 1OBPA 1BBPA 3QEEA 5A8CA 4NYQA 2ACOA 1QY2A 4ALBA 4ZR2A 2AH7X 3LIHA 2NNDA 3PH5A 3P6CA 3S5XA 1IFCA 3QC2A 1U17A 1SXYA 4XMHA 2MM3A 2FWVA 3C7FA 3C76X 3BLGA 1QWDA 4MVKA 4NYRA 1XKIA 5HA0A 4KT5A 3STMX 4ARHA 5AYEA 5GLKA 5GLNA 2HYSA 4ORUA 2FR2A 3IFBA 1A2DA 1G7NA 3AKIA 4Y0QA 1EPBA 1OPAA 5B27A 5FQ8E 2AT6X 4IB7A 1B0OA 5H8TA 1RBPA 3FELA 1ERBA 1A3YA 1ZNKA 4HPBA 4ZH9A 2B4WA 1GT1A 3OJYC 2KTSA 3QEDA 1QABE 1MX7A 1BSYA 4NNTA 1KT5A 2FS6A 1OYGA 2W2AA 3WPZA 2O62A 3C77X 1ML7A 2CM9A 5F1EA 3CWKA 4IB6A 4O8NA 2A2UA 3D5ZA 1X8OA 3OM7A 3ZXKA 1NGLA 4BOEA 1A57A 3BYJA 1B56A 5JOYA 2YFTA 4UDJA 1A18A 3FA9A 4LZVA 5FFHA 3FYFA 5LJHA 4YBUA 5F7GA 1X8UA 4GNWA 3WOVA 2ALLX 1EIIA 2RCTA 4COTA 1O8VA 3KF3A 1GT3A 1Y9MA 1R0UA 2XSTA 3WMYA 3B2JA 3HWFA 4FGIB 4TKBA 2EXHA 4AK6A 2WEWA 5L8IA 3R4ZA 2RQ0A 3RSWA 5A7VB 2MHDA 1VYGA 4QZUA 4WFUA 1U0XA 1YP7A 2N93A 2R73A 4YGHA 3RZYA 1OBUA 3EM0A 3FENA 3ZWEA 4EQAC 3TF6A 4ES7A 4GE1A 3WBGA 4XMCA 1X8PA 2Q39A 3FMZA 4TKHA 5AY9A 4GU8A 1D3SA 3LF7A 2IFBA 1JYJA 2MJIA 1G5WA 1OEEA 4QYNA 3UEXA 4A60A 1W2TA 3OM2A 5A7VA 1GT5A 3MX7A 1O1VA 3LFIA 1YI7A 4U8UO 3UEUA 5DG4A 4AZNA 4HPAA 3ZZVA 3WN1A 1AELA 2JN3A 4ZHGA 2WUTA 4GK9A 3BYKA 3AKMA 1TW4A 5IO6A 4YKOA 2JMBA 4I3CA 5H9LA 3C7OA 5JOXA 1B8EA 4MVIA 4O49A 5HCDC 1EXSA 2JU7A 3S60A 5B29A 3N91A 2AKQA 4AYHA 1JYDA 1DZMA 1TOUA 2LKKA 4GKCA 2PY1A 4RUUA 3AKHA 3C7EA 3MBTA 2OFMX 1EW3A 1SXUA 4KCBA 3L4RA 3I17A 3AKNA 5FIXA 1KT6A 3P2NA 3FR2A 3P6DA 5L8NA 2QQWA 1KQXA 1E06A 1LIFA 4UU3A 4WFVA 3BX7A 1BEBA 5D45A 1DV9A 3PH6A 1ST8A 1LICA 4O8OA 4NW4A 3BS2A 3FA7A 3HWEA 5AJCA 3FW5A 5CYBA 4L3RA 1DFVA 5LJDA 3C7GA 1HMSA 4FFIA 4O4OA 2R74A 2L9CA 3VG7A 2G78A 3C2UA 5JOZA 1QG5A 4QGWA 4YGGA 1YWDA 1EALA 1YRZA 5EPQA 2OVSA 3D95A 3CBCA 5HBSA 5AEOA 1IKEA 5HCCC 3QZ4A 1I06A 5AYCA 3OD9A 4IMOA 5HCEC 4O4XA 4GETA 3VSRA 1ZNHA 2HZRA 2BLGA 2ASNX 2OVDA 1YIVA 5D4AA 2JOZA 4MLGA 5A8DA 2BS6A 4KCAA 1YWCA 4IABA 1KZXA 2L67A 4IAXA 4MISA 2X8SA 4U8UM 4ZHHA 1BRQA 2XKLA 2YFSA 5FKBA 3PQSA 1FTPA 2K62A 3SAOA 3PIJA 2EXJA 3OE3A 4KMIA 1KXOA 1KOIA 1S44A 2ZAGA 3VG6A 4O3WA 4YFQA 4ID2A 3KFGA 3JQOA 3TGCA 4ONZA 1U18A 5BVQA 4YCHA 5IO5A 3EBWA 3LEMA 1XCAA 5FLWA 1G74A 4I6SA 1QY0A 2QO5A 1S7DA 2QM9A 3U9PC 5HA1A 3D97A 1ICNA 4N2ZA 1EUOA 1DC9A 2CM4A 2QO6A 2ANSA 3D96A 1LF7A 2WSJA 4I95A 3VSFA 3LDRA 5B6TA 2A13A 1E02A 4UDKA 5GLQA 1LKEA 3B2IA 3S26A 3BYNA 2RD7C 3APXA 5BYPA 2HNXA 4AK5A 1FELA 4O9SA 4IBAA 1KZWA 3WPUA 4UU2A 3WASA 3WN0A 4PJ2A 3KQ0A 3BYLA 4AZOA 3WN2A 4ZCBA 2G79A 5GLRA 3LV4A 3APUA 3CMPA 3I0AA 3P6EA 3VG5A 1I05A 1ZNEA 3CR6A 2X46A 3BU1A 4GZVA 3CU9A 4YKMA 4U8UN 5H9AA 4NLIA 4ZGFA 4ZFXA 2GTFX 3IA8A 4AK7A 4YGZA 1SY3A 3NP1A 5EDCA 4O3YA 4ON1A 4CSBA 1X89A 3MVFA 5KICA 1CRBA 3PIGA 4ORYA 3ZW1A 2AT0X 2E4JA 4LKTA 2A2GA 4LQZA 4Y0RA 5F6BA 3WJCA 3ZW2A 4NOVA 2CBRA 5H9NA 3SC7X 2LA7A 5EZ2A 4QQ1A 2CZUA 3PECA 3FA6A 5EDBA 1FDQA 2GTLO 5FQ7E 3WJDA 3QKGA 2RCQA 4O8PA 4CK4A 2MO5A 4ZH6A 2HLVA 1ERXA 3P02A 4NLJA 5JOWA 4INNA 1OEJA 5HAEA 1VKDA 2WEXA 1MX8A 2M4LA 1GYDB 3HOLA 4N4BA 1TXLA 2JU8A 1Y4WA 4TKJA 4PVIA 2RA6A 4N7CA 5AYDA 2LBAA 2W2BA 1VYFA 4OMWA 3R67A 5CE4A 4AZPA 3VE1A 4UDKE 5LKFA 3UGFA 1PEEA 1JJJA 1EI5A 3ELXA 1S2PA 4O4UA 3FLLA 3PQUA 4IMNA 4O4SA 1SA8A 5GLPA 4XMEA 3O2YA 1AQBA 4XMGA 2OVEA 3JSQA 2VDTA 3WXQA 2HZQA 2LBVA 4YCEA 3U14A 4BQUA 1B4MA 3EYCA 1IFBA 3VG2A 4QYPA 3PP6A 3ELZA 2L68A 4A8ZA 4CV7A 3F9DA 5EEEA 3UGHA 1GXAA 5GLLA 2KD2A 4GDZA 1OEKA 3FR4A 2KT4B 2EXIA 5ANNA 3VT2A 4QNIA 1LPJA 2AT8X 4YBPA 1RLBE 4EFGA 2Z4HA 4FBOA 3ZXLA 3TAWA 5HZQA 1CJ5A 1YWAA 3EBKA 4I9SA 1YIFA 3HWGA 1E00A 5FAZA 3VPJE 3FIQA 5FENA 1VPRA 4M7MA 4AW8A 5KIDA 2WQAE 3STKA 1X8NA 2DM5A 4TJZA 5LJKA 3FW4A 1GYEB 2W2FA 2OVAA 5D48A 2AEYA 1X8QA 1SXXA 1YUPA 5DPQA 2FR3A 3AKFA 4XMDA 2LFOA 1LNMA 2LB6A 4FQBB 3TGAA 3WPYA 4R0BA 1HMRA 1W18A 1ACDA 3O19A 5FMCA 1TOWA 1GX9A 3S5VA 5HZ6A 2WQ9A 3Q6LA 1E5PA 1SXWA 3V8UA 3HWDA 1BWYA 3WJFA 4D6AA 5FK7A 5HTDA 2A3FX 1Y7BA 1UYPA 1QQSA 3EMMA 4IB8A 3OM6A 4NNSA 1ZNLA 4KH8A 3RBYA 4ZGUA 3UAQA 2RN4A 1GYHA 4KC8A 3ZUIA 1GM6A 5BVTA 3ZUOA 4AZMA 1YWBA 4FBRA 1CBIA 1EIOA 2EU7X 4HWMA 2F73A 5JR8A 1UREA 3NX1A 2CBSA 4PVAA 1HQPA 3FEKA 4D6BA 5BVSA 1AB0A 4TQ2A 2OFRX 4L1NA 5LJGA 1D2UA 4MVLA 5GLMA 4D47A 3OM5A 3VG4A 4EEJA 4I9RA 3LIGA 3P6GA 4IAWA 2BS5A 2QO4A 1ICMA 5C0PA 5LJBA 1G85A 1YP6A 2NP1A 3DTQA 4QZTA 1MVGA 2FRSA 2X45A 4WBKA 3ZQ3A 5HZ5A 3VG3A 1PBOA 3PEDA 1BRPA 3R4YA 1OPBA 1LIBA 4QGVA 1PMPA 1JV4A 3D60A 3APVA 4N2RA 4ML7B 3VSZA 3G7XA 3ZW1B 5C0NA 2AT3X 2GJ5A 1CBSA 1GX8A 2QOSC 2ZAIA 4IB9A 4ORRA 1OBQA 2FT9A 1HMTA 4MVEA 3WJGA 3CBSA 1KGLA 1HBPA 3VT1A 3BDRA 3QEFA 4ZHFA 4U3QA 5AJBA 3RWKX 3NQ3A 1ZNGA 4EQVA 3B2LA 1SY0A 1CBRA 1BSOA 2Q4NA 4OMXA 3RKGA 1UV4A 1SMPI 4I3BA 3LHNA 3P6HA 4U9CA 3E3CA 1IW2A 3ZI8A 4YDAA 5LJCA 1P6PA 4AZQA 2K23A 5GLOA 5FMBA 3D5YA 1LIDA 3NBXX 1QFVA 5EEDA 4HFOA 1ADLA 2HMBA 2MWHA 3NADA 5D8JA 1KQWA 1SY1A 1ZRYA 4O3ZA 4OS0A 5LKEA 4FFGA 1UZ2X 2X8FA 3OM4A 1Y9TA 3ZXJA 3VE2A 3HK1A 2F09A 3KFIA 2WR6A 5D47A 3KF5A 1FE3A 1T8VA 3DSZA 3WJEA 4ORWA 3NX2A 2Z4IA 2P8GA 2XQRA 4U6DA 4EXZA 5HZ8A 3VSSA 5F6ZA 2Q9SA 1DF3A 4FFHA 4HPCA 1BLRA 1BSQA 3ZW0B 2POAA 1DZPA 1CBQA 1BM5A 3U0DA 2AC1A 3WMZA 3BSZE 4Y0SA 1HN2A 2JW1A 3U03A 3D61A 1AVGI 2KW1A 3NQHA 1GKAB 4O3XB 1DZKA 1Z24A 3T1DA 3WATA 4QGXA 5FQ6E 4TNNA 3AKGA 3K1UA 3NPOA 3BRNA 1QY1A 3BX8A 3P6FA 4DQ3A 4GRJA 2G7BA 4QQSA 3KZAA 4N1IA 3FEPA 5HTEA 4ORSA 3WJBA 1MDCA 1NP4A 3ZW0A 2KTDA 1L6MA 1HBQA 5HWZA 3BY0A 3HTYA 4YMYA 1MUPA 4TLJA 4ORXA 4JGLA 4M6SA 4QAEA 1GKAA 2EXKA 5B6SA 4GH7A 2Q2PA 4AZRA 4YH0A 1T68X 4U6BA 3APWA 3BU9A 1ZNDA 4LKPA 3KSTA 1KT3A 2NNQA 3FR5A 2ADDA 4K19A 4HPDA 4YFRA 5FK8A 1T0VA 4XMFA 4N7DA 2A0AA 5IO7A 1KT4A 3P24A 4KC7A 1Y9LA 1WL7A 2AL0X 2GTLM 1JBHA 4ZJ0A 3WPVA 3KFHA 4OS3A 4GNYA 3CQRA 1LFOA 3WVMA 3F8AA 4UDGA 4QRLA 1KT7A 4ALOA 5F58A 1IIUA 4LZUA 5AQ6A 3NR3A 2BHVA 3PPTA 1GT4A 4NP1A 5K06A 2OZQA 2QMIA 3WAUA 4RUNA 3B2HA 3D4RA 3C7HA 1ALBA 3U75A 3VT0A 2FTBA 2X8TA 3UEVA 4FFFA 2JU3A 3O22A 1QFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7V A;  5C0P A;  2OXB A;  3OM2 A;  4D47 A;  3LFI A;  1YI7 A;  4NOV A;  3SC7 X;  3R4Y A;  3WN1 A;  4O8P A;  3D60 A;  3BYK A;  5FMD A;  4N2R A;  3VSZ A;  3C7O A;  5JOX A;  2QQV A;  5JOW A;  3AKH A;  3C7E A;  3VT1 A;  1Y9G A;  3QEF A;  4EQV A;  1JIW I;  1VKD A;  3RWK X;  4KCB A;  1PT2 A;  1UV4 A;  1GYD B;  4N4B A;  1SMP I;  5FIX A;  3P2N A;  1Y4W A;  3UGG A;  4PVI A;  4UDI A;  2AEZ A;  5AYD A;  5FKC A;  3UGF A;  3R67 A;  2QQW A;  5GLO A;  5FMB A;  3D5Y A;  4UDK E;  2ADE A;  1ST8 A;  2YFR A;  4O8O A;  5GLP A;  4FFG A;  2X8F A;  3OM4 A;  2QQU A;  3ZXJ A;  2VDT A;  3KF5 A;  3C7G A;  3LDK A;  4FFI A;  3U14 A;  3QEE A;  2XQR A;  4U6D A;  3VSS A;  3C2U A;  5A8C A;  5JOZ A;  4FFH A;  3LIH A;  1YRZ A;  3UGH A;  3QC2 A;  5GLL A;  3QZ4 A;  5AYC A;  3C7F A;  2AC1 A;  2EXI A;  3WMZ A;  5AYE A;  5ANN A;  5GLK A;  5GLN A;  3VT2 A;  3D61 A;  3VSR A;  3NQH A;  4MLG A;  5A8D A;  3WAT A;  3ZXL A;  4KCA A;  3AKI A;  3AKG A;  3K1U A;  3TAW A;  2X8S A;  2YFS A;  1YIF A;  5FKB A;  4QQS A;  4N1I A;  2B4W A;  4KMI A;  3PIJ A;  2EXJ A;  3QED A;  1GYE B;  1OYG A;  3AKF A;  2AEY A;  3WPZ A;  3WPY A;  2EXK A;  4ONZ A;  5B6S A;  4U6B A;  1W18 A;  3LEM A;  5FLW A;  3KST A;  4O8N A;  3D5Z A;  3OM7 A;  3ZXK A;  5FMC A;  5JOY A;  3BYJ A;  2ADD A;  2YFT A;  4N2Z A;  4UDJ A;  5FK8 A;  3VSF A;  3LDR A;  5FK7 A;  4KC7 A;  1Y7B A;  4COT A;  3KF3 A;  1UYP A;  5B6T A;  4UDK A;  1Y9M A;  1WL7 A;  3OM6 A;  5GLQ A;  3BYN A;  3WMY A;  4AK6 A;  2EXH A;  4AK5 A;  3WPV A;  3R4Z A;  1GYH A;  2RN4 A;  5A7V B;  4KC8 A;  3WPU A;  3WAS A;  3WN0 A;  3BYL A;  3WN2 A;  4UDG A;  5GLR A;  3LV4 A;  4PVA A;  3CU9 A;  5GLM A;  3WAU A;  4AK7 A;  3OM5 A;  3VT0 A;  3C7H A;  3U75 A;  5AY9 A;  2X8T A;  4FFF A;  3LIG A;  3LF7 A;  3PIG A;  1W2T A; 
#chains in the Genus database with same CATH topology
 1BJ7 A;  1FJ1 E;  3TGB A;  2RTL A;  1O1U A;  4YFP A;  3UEW A;  1LIE A;  1NQN A;  3NQK A;  4A1Y A;  3STN A;  3JS1 A;  3KVN A;  4WHI A;  1PM1 X;  2GTL N;  3RWX A;  4DQ4 A;  2AEZ A;  1GGL A;  5L8O A;  3F6Z B;  3B2K A;  2FLJ A;  4ODD A;  4MIR A;  1EQD A;  1DZJ A;  4BVM A;  1SLE B;  2L5P A;  2OFA A;  4JNJ A;  3CQN A;  1Y0G A;  2WWP A;  1QY2 A;  4ALB A;  3QC2 A;  3C7F A;  5HA0 A;  5GLK A;  4KT5 A;  1A2D A;  1G7N A;  3AKI A;  4Y0Q A;  5FQ8 E;  4IB7 A;  1RBP A;  4HPB A;  4ZH9 A;  1A3Y A;  4NNT A;  1VWQ B;  2FS6 A;  3WPZ A;  1X8O A;  1SRF A;  3ZXK A;  5JOY A;  1B56 A;  4UDJ A;  3WZO A;  4GNW A;  2ALL X;  1EII A;  1O8V A;  1GT3 A;  5L8I A;  3R4Z A;  2RQ0 A;  1VYG A;  3PDF A;  2N93 A;  3RZY A;  3FEN A;  3ZWE A;  4EQA C;  3TF6 A;  4ES7 A;  4XMC A;  3FMZ A;  2Q39 A;  1JYJ A;  2IFB A;  1OEE A;  1W2T A;  4A60 A;  5A7V A;  3OM2 A;  1O1V A;  3UEU A;  4AZN A;  3ZZV A;  2JN3 A;  4ZHG A;  2RTE B;  5H9L A;  2JMB A;  5JOX A;  1LCV A;  4MVI A;  1SWH A;  4O49 A;  3S60 A;  5B29 A;  4AYH A;  2AKQ A;  1TOU A;  4GKC A;  3C7E A;  2OFM X;  3MM0 A;  3L4R A;  3AKN A;  5FIX A;  3P6D A;  4WFV A;  3BX7 A;  1ST8 A;  1LIC A;  4NW4 A;  1RXH A;  3BS2 A;  1OSP O;  4CPH B;  1RXJ A;  2OY1 O;  5JOZ A;  1QG5 A;  1YRZ A;  3D95 A;  5AEO A;  3WZN A;  5HCC C;  4O4X A;  4GET A;  2HZR A;  2BLG A;  2JOZ A;  2L67 A;  4MIS A;  2IZB A;  3PQS A;  4KMI A;  1KXO A;  1S44 A;  3VG6 A;  4O3W A;  3KFG A;  3JQO A;  5IO5 A;  5FLW A;  1XCA A;  1G74 A;  4MEE A;  1VWC B;  3SZH A;  1ICN A;  1VWI B;  1EUO A;  3D96 A;  1LF7 A;  1E02 A;  4UDK A;  5GLQ A;  1LKE A;  3S26 A;  4YVB A;  4AK5 A;  2HNX A;  3WPU A;  3BYL A;  1JMX A;  3LV4 A;  4GZV A;  2FKG A;  4YKM A;  4U8U N;  4ZFX A;  5L3Y A;  3MVF A;  5KIC A;  4LKT A;  4BCS A;  3WJC A;  3SC7 X;  5FQ7 E;  4QQ1 A;  2CZU A;  3FA6 A;  5EDB A;  1FDQ A;  3QKG A;  4CK4 A;  3AUM O;  3VHI A;  2UZ2 A;  2C4I A;  4INN A;  5HAE A;  3HOL A;  1TXL A;  2OL6 O;  4PVI A;  2I5Z O;  2W2B A;  4OMW A;  1HXZ A;  1SWF A;  1JJJ A;  2OYB O;  4IMN A;  4O4S A;  5GLP A;  1VWA B;  1UYO X;  1SWD A;  4XMG A;  3JSQ A;  3WYP A;  2HZQ A;  2LBV A;  4YCE A;  1B4M A;  3PP6 A;  4A8Z A;  1VWD B;  5GLL A;  3T6F A;  1OEK A;  3VT2 A;  2AT8 X;  4YBP A;  4EFG A;  1CJ5 A;  1YIF A;  5FAZ A;  1VPR A;  1MM9 A;  1X8N A;  3AKF A;  2OVA A;  5D48 A;  2AEY A;  2PI3 O;  4XMD A;  2LFO A;  3TGA A;  1ACD A;  2QCB A;  2WQ9 A;  1E5P A;  1SXW A;  3V8U A;  2C1S A;  2A3F X;  1UYP A;  3EMM A;  1ZNL A;  4ZGU A;  1GYH A;  2RN4 A;  4AZM A;  3RE5 A;  4HWM A;  3NX1 A;  4TQ2 A;  2OFB A;  2BS5 A;  1SWC A;  1SRI A;  1G85 A;  1YP6 A;  1MVG A;  3MG5 A;  1BRP A;  1SWQ A;  3R4Y A;  3VSZ A;  2ZAI A;  2GJ5 A;  1OBQ A;  1HMT A;  1KGL A;  4ZHF A;  1CBR A;  3RKG A;  4OMX A;  1WUB A;  1IW2 A;  2CAM A;  1LID A;  4HFO A;  3NAD A;  1ZRY A;  5LKE A;  1Y53 X;  2X8F A;  3OM4 A;  3HK1 A;  3KF5 A;  1FE3 A;  3DSZ A;  2Z4I A;  2OY7 A;  2Q9S A;  4OEM A;  1BLR A;  1N43 A;  2AC1 A;  4Z28 A;  1HN2 A;  1IJ8 A;  1DZK A;  3WAT A;  3K1U A;  1QY1 A;  4GRJ A;  5K67 A;  4QQS A;  4ORS A;  5HWZ A;  2G5L A;  2EXK A;  2Q2P A;  4YH0 A;  3KST A;  2RTI B;  3RE6 A;  3FR5 A;  2OY5 O;  1SWE A;  2A0A A;  3P24 A;  2AL0 X;  1JBH A;  3WVM A;  4Z6J A;  4QRL A;  4LZU A;  3NR3 A;  1K24 A;  1KFF A;  2BSZ A;  4RUN A;  3C7H A;  1ALB A;  3U75 A;  1SWU A;  2FTB A;  3UEV A;  4FFF A;  5IRA A;  2ACP X;  4Y59 A;  4EDE A;  3QQ2 A;  3K3L A;  1FEN A;  2QQV A;  4BJ8 A;  5B3M O;  1Y9G A;  5HZ9 A;  3KFF A;  4KII A;  4UDI A;  1NP1 A;  4A1H A;  1H91 A;  4ZHC A;  4PSQ A;  2AT5 X;  2F01 A;  2WPU A;  1JMZ A;  1W6F A;  4CPI A;  5KHP A;  1I9H A;  1IKJ A;  1I04 A;  3VU1 A;  2RTK A;  2ACO A;  4ZR2 A;  2AH7 X;  3P6C A;  3S5X A;  1IFC A;  2MM3 A;  1KL5 A;  2FWV A;  5GLN A;  3EC5 A;  5B27 A;  2AT6 X;  5H8T A;  2B4W A;  1GT1 A;  1K3B A;  2KTS A;  1QAB E;  3EW1 A;  3QED A;  1KT5 A;  2W2A A;  1DF8 A;  3C77 X;  1ML7 A;  2CM9 A;  3CWK A;  4O8N A;  3D5Z A;  4GD9 A;  3BYJ A;  1A18 A;  1SWG A;  4YBU A;  2OY8 A;  3KF3 A;  2IZI A;  2XST A;  2OL7 A;  4AK6 A;  3RSW A;  2MHD A;  2X4M A;  4QZU A;  4WFU A;  1YP7 A;  2VFC A;  2R73 A;  4YGH A;  3SZJ A;  4BX6 B;  3EM0 A;  5B11 O;  3VHH A;  3LF7 A;  4QYN A;  1GT5 A;  1YI7 A;  1W4T A;  4HPA A;  1AEL A;  4CDD A;  1B8E A;  3AKH A;  1DZM A;  2LKK A;  1KT6 A;  3SZI A;  1KQX A;  3SLT A;  1E06 A;  2A5B A;  4NV8 A;  1DV9 A;  2IZC B;  3RY2 A;  1SWT A;  3FW5 A;  4B55 A;  4L3R A;  3C7G A;  1HMS A;  4FFI A;  4O4O A;  2R74 A;  2G78 A;  1KL4 A;  5HBS A;  3QZ4 A;  5AYC A;  3OD9 A;  4IMO A;  5HCE C;  1ZNH A;  2ASN X;  4MLG A;  1YIV A;  5A8D A;  2BS6 A;  1YWC A;  1SWB A;  4IAB A;  4IAX A;  4ZHH A;  1VWH B;  2Y3F A;  1BRQ A;  3PIJ A;  3OE3 A;  2UYW A;  4YFQ A;  3TGC A;  1SWP A;  1U18 A;  3LEM A;  4CPE A;  2QO5 A;  2QM9 A;  3U9P C;  5HA1 A;  4N2Z A;  2DJG A;  2WSJ A;  2A13 A;  3B2I A;  2RD7 C;  4IRW A;  5BYP A;  1FEL A;  4O9S A;  4IBA A;  2IZJ A;  4PJ2 A;  2G79 A;  3APU A;  3CMP A;  3P6E A;  3VG5 A;  1I05 A;  1ZNE A;  3CU9 A;  2FHL A;  2GTF X;  3NP1 A;  4ON1 A;  4LQZ A;  2A2G A;  1VWR B;  3WZQ A;  3PEC A;  2GTL O;  2MO5 A;  1SWN A;  1OEJ A;  2OF8 A;  1Y4W A;  4TKJ A;  5AYD A;  1VYF A;  3R67 A;  5CE4 A;  5LKF A;  4O4U A;  1SA8 A;  2RTJ A;  4XME A;  3O2Y A;  3EW2 A;  2OVE A;  2VDT A;  3ELZ A;  3F9D A;  2EXI A;  5ANN A;  1RLB E;  2Z4H A;  4JHQ A;  1SWO A;  4NV7 A;  5FEN A;  1VWK B;  4M7M A;  3STK A;  5LJK A;  1WBI A;  2W2F A;  2FKJ A;  5DPQ A;  1SXX A;  1LNM A;  4FQB B;  1W18 A;  1JQP A;  3T6L A;  1TOW A;  3VHM A;  3S5V A;  3HWD A;  1NQM A;  3WJF A;  4D6A A;  5HTD A;  1Y7B A;  1QQS A;  2X56 A;  3OM6 A;  1SRG A;  3UAQ A;  4KC8 A;  5BVT A;  3PK2 A;  1EIO A;  3CKF A;  4D6B A;  5GLM A;  4MVL A;  3OM5 A;  4GUZ A;  3VG4 A;  4I9R A;  3P6G A;  1JJU A;  2NP1 A;  3DTQ A;  4GGT A;  2FRS A;  3ZQ3 A;  2X45 A;  1PMP A;  1JV4 A;  4U46 A;  3D60 A;  3ZW1 B;  1VWO B;  2QOS C;  4IB9 A;  5F2B A;  4MVE A;  3BDR A;  1ZNG A;  3B2L A;  3LHN A;  5B5G A;  4YDA A;  5LJC A;  5GLO A;  5FMB A;  3D5Y A;  3NBX X;  5EED A;  1ADL A;  1KQW A;  4O3Z A;  1UZ2 X;  5B5F A;  3KFI A;  1T8V A;  2P8G A;  1VWF B;  3U0D A;  3WMZ A;  3BSZ E;  4Y0S A;  2JW1 A;  4DCB A;  3U03 A;  3D61 A;  1AVG I;  3NQH A;  2RTC B;  4O3X B;  3T1D A;  3VGW A;  5FQ6 E;  3NPO A;  3BRN A;  3BX8 A;  2G7B A;  1LUQ A;  3WJB A;  1NP4 A;  3ZW0 A;  1LCZ A;  1L6M A;  3BY0 A;  1MUP A;  2A8G A;  4M6S A;  4QAE A;  1GKA A;  3BU9 A;  2ADD A;  4K19 A;  2FHN X;  5FK8 A;  5JD2 A;  1KT4 A;  4BX6 A;  1WL7 A;  2GTL M;  2RTB B;  1MK5 A;  3T2W A;  2RTQ B;  1KT7 A;  4ALO A;  4Z27 A;  1IIU A;  2BHV A;  5K06 A;  2OZQ A;  2QMI A;  3CKG A;  3B2H A;  3D4R A;  3VT0 A;  1QFT A;  5H9K A;  5LJE A;  4FBV A;  2OXB A;  1SLF B;  4BX5 A;  3FA8 A;  3Q34 A;  3TZS A;  4ZHD A;  4OS8 A;  2RTA A;  1VWP B;  1N0S A;  3H3I A;  1JIW I;  2AMM X;  2GC9 A;  1PT2 A;  3UGG A;  1PTS A;  4YDB A;  1HY2 A;  5CHK A;  2I5V O;  3SOT A;  1FEM A;  4Z2V A;  3NQ9 A;  2YG2 A;  2NNE A;  3RDQ A;  3OBL A;  1SRE A;  2QQU A;  3C78 X;  1JZU A;  1I4U A;  2OF9 A;  1GX3 A;  1TVQ A;  2Q2M A;  3LDK A;  1BBP A;  5A8C A;  2NND A;  1U17 A;  3FDC A;  4XMH A;  4CPF A;  3BLG A;  4ORU A;  3IFB A;  1OPA A;  3FEL A;  1VYO A;  1MX7 A;  2O62 A;  5F1E A;  1MOY A;  3OM7 A;  3FA9 A;  5LJH A;  5FFH A;  3FYF A;  5CSE A;  5F7G A;  1X8U A;  3WOV A;  3B2J A;  3HWF A;  4FGI B;  4TKB A;  5A7V B;  1HXL A;  3RDO A;  1U0X A;  4CDC A;  5B2A O;  4GE1 A;  1X8P A;  4GJS A;  4GU8 A;  5AY9 A;  1D3S A;  3MX7 A;  3LFI A;  3FID A;  2QOM A;  5DG4 A;  2A5C A;  3BYK A;  3AKM A;  5IO6 A;  4I3C A;  3C7O A;  5HCD C;  1EXS A;  3N91 A;  4RUU A;  1EW3 A;  4KCB A;  3P2N A;  3FR2 A;  1SRJ A;  2QQW A;  5IRU A;  1LIF A;  4UU3 A;  5D45 A;  4O8O A;  3RDU A;  2X55 A;  3HWE A;  5CYB A;  1AVD A;  1DFV A;  5LJD A;  5C2M A;  1VWN B;  2L9C A;  3VG7 A;  4QGW A;  4YGG A;  2OVS A;  1IKE A;  4I60 A;  1I06 A;  4OEL A;  1STS B;  2OVD A;  4CPH A;  4U8U M;  2YFS A;  1FTP A;  2K62 A;  3SAO A;  1KOI A;  2ZAG A;  4ID2 A;  2JGS A;  1STR B;  4YCH A;  4I6S A;  1QY0 A;  1S7D A;  1DC9 A;  2ANS A;  4I95 A;  3VSF A;  4GDA A;  3BYN A;  1MEP A;  3APX A;  4UU2 A;  1KL3 A;  3WN0 A;  3KQ0 A;  3WN2 A;  1SWR A;  4ZCB A;  3I0A A;  2X46 A;  5H9A A;  4NLI A;  1VWL B;  3IA8 A;  4Z2O A;  4YGZ A;  5EDC A;  4O3Y A;  4CSB A;  4BX7 B;  1X89 A;  3ZW1 A;  2AT0 X;  3ZW2 A;  2OL8 O;  4Y0R A;  4NOV A;  2CBR A;  5H9N A;  3LTW A;  3WJD A;  4O8P A;  4ZH6 A;  2HLV A;  1ERX A;  1NDJ A;  4NLJ A;  5JOW A;  3WZP A;  1VKD A;  2WEX A;  1TL2 A;  2LBA A;  3UGF A;  1RST B;  3VE1 A;  1EI5 A;  3ELX A;  2ZSC A;  4JO6 A;  1LCW A;  3WXQ A;  2GH7 A;  3EYC A;  1IFB A;  2L68 A;  4CV7 A;  5EEE A;  4GDZ A;  2KT4 B;  1LPJ A;  3TAW A;  5HZQ A;  2RTD B;  4I9S A;  3HWG A;  1E00 A;  3VPJ E;  3FIQ A;  4AW8 A;  1X8Q A;  4GGR A;  3O19 A;  5FMC A;  1GX9 A;  5HZ6 A;  3Q6L A;  1BWY A;  4IB8 A;  4NNS A;  3ZUI A;  3ZUO A;  1YWB A;  2EU7 X;  2F73 A;  5JR8 A;  1HQP A;  1AB0 A;  2OFR X;  5LJG A;  1D2U A;  1LEL A;  4EEJ A;  4IAW A;  1VWJ B;  5IXG A;  1ICM A;  5C0P A;  4QZT A;  4D47 A;  1N4J A;  3VG3 A;  1PBO A;  3PED A;  1OPB A;  1N9M A;  3APV A;  4N2R A;  4ML7 B;  4ORR A;  1GX8 A;  3VT1 A;  4EQV A;  5AJB A;  3RWK X;  1SY0 A;  2Q4N A;  4I3B A;  3P6H A;  1PBY A;  1P6P A;  4AZQ A;  2K23 A;  1QFV A;  5D8J A;  2HMB A;  2MWH A;  1SY1 A;  3RDM A;  1Y9T A;  2RTR B;  3VE2 A;  3ZXJ A;  2F09 A;  2WR6 A;  5D47 A;  3WJE A;  3NX2 A;  4U6D A;  2IZD B;  5F6Z A;  1DF3 A;  1BSQ A;  2POA A;  1DZP A;  1CBQ A;  2KW1 A;  1Z24 A;  4Y5D A;  2BC3 A;  3P6F A;  1RSU B;  1LDQ A;  4N1I A;  3FEP A;  2IZF B;  2KTD A;  1HBQ A;  3HTY A;  2HKD A;  4ORX A;  4JGL A;  5IRW A;  5B6S A;  4GH7 A;  2VDF A;  4AZR A;  3RDX A;  2NNQ A;  3T2X A;  4N7D A;  4KC7 A;  4OKA A;  1VWE B;  2VFB A;  4OS3 A;  3RY1 A;  1LFO A;  3WYQ A;  5AQ6 A;  1GT4 A;  2RTN B;  3WAU A;  2X8T A;  4Y0P A;  1X71 A;  2FS7 A;  1SLG B;  2BT9 A;  1SLD B;  1HQQ A;  1JJX A;  2IZG B;  4I3D A;  5FMD A;  2CZT A;  2YMS A;  2R56 A;  3GE2 A;  1EPA A;  3RDS A;  5FKC A;  1SRH A;  3HOE A;  3GAQ A;  2ADE A;  2YFR A;  2RTP B;  1SY2 A;  1OBP A;  1VWG B;  1NBX A;  3QEE A;  4NYQ A;  3LIH A;  3PH5 A;  1SXY A;  2FGS A;  3C76 X;  4MVK A;  1QWD A;  4NYR A;  3STM X;  1XKI A;  4ARH A;  5AYE A;  3D9W A;  2HYS A;  2FR2 A;  1EPB A;  1B0O A;  1ERB A;  1ZNK A;  3OJY C;  1BSY A;  1OYG A;  4IB6 A;  2A2U A;  1NGL A;  4BOE A;  1A57 A;  2YFT A;  4LZV A;  4CDE A;  2RCT A;  4COT A;  1Y9M A;  1R0U A;  3WMY A;  2EXH A;  2WEW A;  1W5R A;  4BX7 A;  4BBO A;  1OBU A;  2IZH B;  3WBG A;  4TKH A;  2MJI A;  1G5W A;  3UEX A;  4U8U O;  3WN1 A;  2WUT A;  4GK9 A;  1TW4 A;  4YKO A;  2JU7 A;  1JYD A;  1Y52 X;  2PY1 A;  3MBT A;  4Z2P A;  1SXU A;  3I17 A;  1STP A;  5L8N A;  1SWJ A;  1BEB A;  3PH6 A;  3FA7 A;  5AJC A;  2DJF A;  3C2U A;  3X00 A;  1EAL A;  1YWD A;  5EPQ A;  3CBC A;  3VSR A;  5D4A A;  2X32 A;  2IZK A;  1LDO A;  4KCA A;  1KZX A;  2X8S A;  5FKB A;  2XKL A;  2EXJ A;  2RTF B;  1NC9 A;  1RAV A;  4ONZ A;  5BVQ A;  3EBW A;  1Y55 X;  3D97 A;  2CM4 A;  2QO6 A;  3LDR A;  5B6T A;  1KZW A;  3WAS A;  4AZO A;  5GLR A;  2AF5 A;  4C5P A;  1SWA A;  2MF6 A;  3CR6 A;  3BU1 A;  4ZGF A;  4AK7 A;  1SWS A;  1SY3 A;  1VWB B;  1CRB A;  4ORY A;  3PIG A;  2E4J A;  5F6B A;  2LA7 A;  5EZ2 A;  2RTO B;  2RCQ A;  1I78 A;  3SLJ A;  3P02 A;  4BGF A;  1MX8 A;  2M4L A;  1GYD B;  4N4B A;  2JU8 A;  2RA6 A;  4N7C A;  4AZP A;  4UDK E;  1PEE A;  2RTG B;  1S2P A;  3FLL A;  3PQU A;  1AQB A;  3U14 A;  4BQU A;  3VG2 A;  4QYP A;  3UGH A;  1GXA A;  2KD2 A;  4EKV A;  3FR4 A;  2RTM A;  4QNI A;  4FBO A;  3ZXL A;  5K68 A;  1YWA A;  3EBK A;  3AEH A;  5KID A;  1SWL A;  2WQA E;  2DM5 A;  4TJZ A;  3FW4 A;  1AVE A;  1GYE B;  1YUP A;  3WPY A;  2FR3 A;  2LB6 A;  4R0B A;  1HMR A;  2G8C O;  5FK7 A;  4KH8 A;  3RBY A;  1SWK A;  1GM6 A;  4FBR A;  1CBI A;  1URE A;  2CBS A;  4PVA A;  3FEK A;  1RXK A;  5BVS A;  4L1N A;  3LIG A;  2QO4 A;  5LJB A;  5HZ5 A;  4WBK A;  4GGZ A;  1LIB A;  4QGV A;  1UYN X;  3G7X A;  5C0N A;  2IZL B;  2AT3 X;  1CBS A;  2FT9 A;  3WJG A;  3CBS A;  1HBP A;  3QEF A;  4U3Q A;  3NQ3 A;  1BSO A;  1UV4 A;  1SMP I;  1VWM B;  4U9C A;  2RTH B;  3E3C A;  3ZI8 A;  2IZE B;  4OS0 A;  4FFG A;  1N9Y A;  4ORW A;  2Y3E A;  2XQR A;  4EXZ A;  4GJV A;  5HZ8 A;  3VSS A;  4FFH A;  5B10 O;  4HPC A;  3ZW0 B;  1BM5 A;  1GKA B;  4QGX A;  2AVI A;  4TNN A;  3AKG A;  4DQ3 A;  3SLO A;  3KZA A;  5HTE A;  1MDC A;  4DNE A;  4YMY A;  1N7Y A;  4TLJ A;  4U6B A;  1T68 X;  3APW A;  4LKP A;  1ZND A;  1KT3 A;  4HPD A;  4YFR A;  1T0V A;  4XMF A;  4CDF A;  5IO7 A;  3HPE A;  1Y9L A;  2X34 A;  4ZJ0 A;  3WPV A;  3KFH A;  4GNY A;  2IZA A;  3CQR A;  3F8A A;  4BX5 B;  4UDG A;  2Y32 A;  5F58 A;  1E2T A;  3PPT A;  2C1Q A;  4NP1 A;  2JU3 A;  3O22 A; 
#chains in the Genus database with same CATH homology
 5H9K A;  5LJE A;  4FBV A;  2OXB A;  1X71 A;  1BJ7 A;  2FS7 A;  2BT9 A;  3TGB A;  2ACP X;  4EDE A;  1JJX A;  3FA8 A;  3K3L A;  4I3D A;  5FMD A;  1O1U A;  1FEN A;  2CZT A;  3TZS A;  4YFP A;  4ZHD A;  4OS8 A;  2QQV A;  2YMS A;  3UEW A;  1LIE A;  3NQK A;  2R56 A;  1N0S A;  3H3I A;  4A1Y A;  3STN A;  3JS1 A;  1Y9G A;  1JIW I;  2AMM X;  2GC9 A;  1PM1 X;  4WHI A;  5HZ9 A;  3KFF A;  1PT2 A;  3UGG A;  3GE2 A;  4KII A;  1EPA A;  2GTL N;  3RWX A;  4UDI A;  4DQ4 A;  2AEZ A;  5FKC A;  1NP1 A;  1GGL A;  4YDB A;  4A1H A;  3SOT A;  3HOE A;  5L8O A;  1FEM A;  3F6Z B;  3NQ9 A;  3B2K A;  3GAQ A;  1H91 A;  2FLJ A;  2ADE A;  2YFR A;  4ZHC A;  2YG2 A;  2AT5 X;  2NNE A;  4MIR A;  4ODD A;  4PSQ A;  1EQD A;  3OBL A;  1DZJ A;  1SY2 A;  3C78 X;  1I4U A;  2L5P A;  4BVM A;  1JZU A;  2QQU A;  5KHP A;  3CQN A;  1IKJ A;  1I04 A;  1TVQ A;  2WWP A;  4Y0P A;  2Q2M A;  3VU1 A;  3LDK A;  1OBP A;  1BBP A;  3QEE A;  5A8C A;  4NYQ A;  2ACO A;  1QY2 A;  4ALB A;  4ZR2 A;  2AH7 X;  3LIH A;  2NND A;  3PH5 A;  3P6C A;  3S5X A;  1IFC A;  3QC2 A;  1U17 A;  1SXY A;  4XMH A;  2MM3 A;  2FWV A;  3C7F A;  3C76 X;  3BLG A;  1QWD A;  4MVK A;  4NYR A;  1XKI A;  5HA0 A;  4KT5 A;  3STM X;  4ARH A;  5AYE A;  5GLK A;  5GLN A;  2HYS A;  4ORU A;  2FR2 A;  3IFB A;  1A2D A;  1G7N A;  3AKI A;  4Y0Q A;  1EPB A;  1OPA A;  5B27 A;  5FQ8 E;  2AT6 X;  4IB7 A;  1B0O A;  5H8T A;  1RBP A;  3FEL A;  1ERB A;  1A3Y A;  1ZNK A;  4HPB A;  4ZH9 A;  2B4W A;  1GT1 A;  3OJY C;  2KTS A;  3QED A;  1QAB E;  1MX7 A;  1BSY A;  4NNT A;  1KT5 A;  2FS6 A;  1OYG A;  2W2A A;  3WPZ A;  2O62 A;  3C77 X;  1ML7 A;  2CM9 A;  5F1E A;  3CWK A;  4IB6 A;  4O8N A;  2A2U A;  3D5Z A;  1X8O A;  3OM7 A;  3ZXK A;  1NGL A;  4BOE A;  1A57 A;  3BYJ A;  1B56 A;  5JOY A;  2YFT A;  4UDJ A;  1A18 A;  3FA9 A;  4LZV A;  5FFH A;  3FYF A;  5LJH A;  4YBU A;  5F7G A;  1X8U A;  4GNW A;  3WOV A;  2ALL X;  1EII A;  2RCT A;  4COT A;  1O8V A;  3KF3 A;  1GT3 A;  1Y9M A;  1R0U A;  2XST A;  3WMY A;  3B2J A;  3HWF A;  4FGI B;  4TKB A;  2EXH A;  4AK6 A;  2WEW A;  5L8I A;  3R4Z A;  2RQ0 A;  3RSW A;  5A7V B;  2MHD A;  1VYG A;  4QZU A;  4WFU A;  1U0X A;  1YP7 A;  2N93 A;  2R73 A;  4YGH A;  3RZY A;  1OBU A;  3EM0 A;  3FEN A;  3ZWE A;  4EQA C;  3TF6 A;  4ES7 A;  4GE1 A;  3WBG A;  4XMC A;  1X8P A;  2Q39 A;  3FMZ A;  4TKH A;  5AY9 A;  4GU8 A;  1D3S A;  3LF7 A;  2IFB A;  1JYJ A;  2MJI A;  1G5W A;  1OEE A;  4QYN A;  3UEX A;  4A60 A;  1W2T A;  3OM2 A;  5A7V A;  1GT5 A;  3MX7 A;  1O1V A;  3LFI A;  1YI7 A;  4U8U O;  3UEU A;  5DG4 A;  4AZN A;  4HPA A;  3ZZV A;  3WN1 A;  1AEL A;  2JN3 A;  4ZHG A;  2WUT A;  4GK9 A;  3BYK A;  3AKM A;  1TW4 A;  5IO6 A;  4YKO A;  2JMB A;  4I3C A;  5H9L A;  3C7O A;  5JOX A;  1B8E A;  4MVI A;  4O49 A;  5HCD C;  1EXS A;  2JU7 A;  3S60 A;  5B29 A;  3N91 A;  2AKQ A;  4AYH A;  1JYD A;  1DZM A;  1TOU A;  2LKK A;  4GKC A;  2PY1 A;  4RUU A;  3AKH A;  3C7E A;  3MBT A;  2OFM X;  1EW3 A;  1SXU A;  4KCB A;  3L4R A;  3I17 A;  3AKN A;  5FIX A;  1KT6 A;  3P2N A;  3FR2 A;  3P6D A;  5L8N A;  2QQW A;  1KQX A;  1E06 A;  1LIF A;  4UU3 A;  4WFV A;  3BX7 A;  1BEB A;  5D45 A;  1DV9 A;  3PH6 A;  1ST8 A;  1LIC A;  4O8O A;  4NW4 A;  3BS2 A;  3FA7 A;  3HWE A;  5AJC A;  3FW5 A;  5CYB A;  4L3R A;  1DFV A;  5LJD A;  3C7G A;  1HMS A;  4FFI A;  4O4O A;  2R74 A;  2L9C A;  3VG7 A;  2G78 A;  3C2U A;  5JOZ A;  1QG5 A;  4QGW A;  4YGG A;  1YWD A;  1EAL A;  1YRZ A;  5EPQ A;  2OVS A;  3D95 A;  3CBC A;  5HBS A;  5AEO A;  1IKE A;  5HCC C;  3QZ4 A;  1I06 A;  5AYC A;  3OD9 A;  4IMO A;  5HCE C;  4O4X A;  4GET A;  3VSR A;  1ZNH A;  2HZR A;  2BLG A;  2ASN X;  2OVD A;  1YIV A;  5D4A A;  2JOZ A;  4MLG A;  5A8D A;  2BS6 A;  4KCA A;  1YWC A;  4IAB A;  1KZX A;  2L67 A;  4IAX A;  4MIS A;  2X8S A;  4U8U M;  4ZHH A;  1BRQ A;  2XKL A;  2YFS A;  5FKB A;  3PQS A;  1FTP A;  2K62 A;  3SAO A;  3PIJ A;  2EXJ A;  3OE3 A;  4KMI A;  1KXO A;  1KOI A;  1S44 A;  2ZAG A;  3VG6 A;  4O3W A;  4YFQ A;  4ID2 A;  3KFG A;  3JQO A;  3TGC A;  4ONZ A;  1U18 A;  5BVQ A;  4YCH A;  5IO5 A;  3EBW A;  3LEM A;  1XCA A;  5FLW A;  1G74 A;  4I6S A;  1QY0 A;  2QO5 A;  1S7D A;  2QM9 A;  3U9P C;  5HA1 A;  3D97 A;  1ICN A;  4N2Z A;  1EUO A;  1DC9 A;  2CM4 A;  2QO6 A;  2ANS A;  3D96 A;  1LF7 A;  2WSJ A;  4I95 A;  3VSF A;  3LDR A;  5B6T A;  2A13 A;  1E02 A;  4UDK A;  5GLQ A;  1LKE A;  3B2I A;  3S26 A;  3BYN A;  2RD7 C;  3APX A;  5BYP A;  2HNX A;  4AK5 A;  1FEL A;  4O9S A;  4IBA A;  1KZW A;  3WPU A;  4UU2 A;  3WAS A;  3WN0 A;  4PJ2 A;  3KQ0 A;  3BYL A;  4AZO A;  3WN2 A;  4ZCB A;  2G79 A;  5GLR A;  3LV4 A;  3APU A;  3CMP A;  3I0A A;  3P6E A;  3VG5 A;  1I05 A;  1ZNE A;  3CR6 A;  2X46 A;  3BU1 A;  4GZV A;  3CU9 A;  4YKM A;  4U8U N;  5H9A A;  4NLI A;  4ZGF A;  4ZFX A;  2GTF X;  3IA8 A;  4AK7 A;  4YGZ A;  1SY3 A;  3NP1 A;  5EDC A;  4O3Y A;  4ON1 A;  4CSB A;  1X89 A;  3MVF A;  5KIC A;  1CRB A;  3PIG A;  4ORY A;  3ZW1 A;  2AT0 X;  2E4J A;  4LKT A;  2A2G A;  4LQZ A;  4Y0R A;  5F6B A;  3WJC A;  3ZW2 A;  4NOV A;  2CBR A;  5H9N A;  3SC7 X;  2LA7 A;  5EZ2 A;  4QQ1 A;  2CZU A;  3PEC A;  3FA6 A;  5EDB A;  1FDQ A;  2GTL O;  5FQ7 E;  3WJD A;  3QKG A;  2RCQ A;  4O8P A;  4CK4 A;  2MO5 A;  4ZH6 A;  2HLV A;  1ERX A;  3P02 A;  4NLJ A;  5JOW A;  4INN A;  1OEJ A;  5HAE A;  1VKD A;  2WEX A;  1MX8 A;  2M4L A;  1GYD B;  3HOL A;  4N4B A;  1TXL A;  2JU8 A;  1Y4W A;  4TKJ A;  4PVI A;  2RA6 A;  4N7C A;  5AYD A;  2LBA A;  2W2B A;  1VYF A;  4OMW A;  3R67 A;  5CE4 A;  4AZP A;  3VE1 A;  4UDK E;  5LKF A;  3UGF A;  1PEE A;  1JJJ A;  1EI5 A;  3ELX A;  1S2P A;  4O4U A;  3FLL A;  3PQU A;  4IMN A;  4O4S A;  1SA8 A;  5GLP A;  4XME A;  3O2Y A;  1AQB A;  4XMG A;  2OVE A;  3JSQ A;  2VDT A;  3WXQ A;  2HZQ A;  2LBV A;  4YCE A;  3U14 A;  4BQU A;  1B4M A;  3EYC A;  1IFB A;  3VG2 A;  4QYP A;  3PP6 A;  3ELZ A;  2L68 A;  4A8Z A;  4CV7 A;  3F9D A;  5EEE A;  3UGH A;  1GXA A;  5GLL A;  2KD2 A;  4GDZ A;  1OEK A;  3FR4 A;  2KT4 B;  2EXI A;  5ANN A;  3VT2 A;  4QNI A;  1LPJ A;  2AT8 X;  4YBP A;  1RLB E;  4EFG A;  2Z4H A;  4FBO A;  3ZXL A;  3TAW A;  5HZQ A;  1CJ5 A;  1YWA A;  3EBK A;  4I9S A;  1YIF A;  3HWG A;  1E00 A;  5FAZ A;  3VPJ E;  3FIQ A;  5FEN A;  1VPR A;  4M7M A;  4AW8 A;  5KID A;  2WQA E;  3STK A;  1X8N A;  2DM5 A;  4TJZ A;  5LJK A;  3FW4 A;  1GYE B;  2W2F A;  2OVA A;  5D48 A;  2AEY A;  1X8Q A;  1SXX A;  1YUP A;  5DPQ A;  2FR3 A;  3AKF A;  4XMD A;  2LFO A;  1LNM A;  2LB6 A;  4FQB B;  3TGA A;  3WPY A;  4R0B A;  1HMR A;  1W18 A;  1ACD A;  3O19 A;  5FMC A;  1TOW A;  1GX9 A;  3S5V A;  5HZ6 A;  2WQ9 A;  3Q6L A;  1E5P A;  1SXW A;  3V8U A;  3HWD A;  1BWY A;  3WJF A;  4D6A A;  5FK7 A;  5HTD A;  2A3F X;  1Y7B A;  1UYP A;  1QQS A;  3EMM A;  4IB8 A;  3OM6 A;  4NNS A;  1ZNL A;  4KH8 A;  3RBY A;  4ZGU A;  3UAQ A;  2RN4 A;  1GYH A;  4KC8 A;  3ZUI A;  1GM6 A;  5BVT A;  3ZUO A;  4AZM A;  1YWB A;  4FBR A;  1CBI A;  1EIO A;  2EU7 X;  4HWM A;  2F73 A;  5JR8 A;  1URE A;  3NX1 A;  2CBS A;  4PVA A;  1HQP A;  3FEK A;  4D6B A;  5BVS A;  1AB0 A;  4TQ2 A;  2OFR X;  4L1N A;  5LJG A;  1D2U A;  4MVL A;  5GLM A;  4D47 A;  3OM5 A;  3VG4 A;  4EEJ A;  4I9R A;  3LIG A;  3P6G A;  4IAW A;  2BS5 A;  2QO4 A;  1ICM A;  5C0P A;  5LJB A;  1G85 A;  1YP6 A;  2NP1 A;  3DTQ A;  4QZT A;  1MVG A;  2FRS A;  2X45 A;  4WBK A;  3ZQ3 A;  5HZ5 A;  3VG3 A;  1PBO A;  3PED A;  1BRP A;  3R4Y A;  1OPB A;  1LIB A;  4QGV A;  1PMP A;  1JV4 A;  3D60 A;  3APV A;  4N2R A;  4ML7 B;  3VSZ A;  3G7X A;  3ZW1 B;  5C0N A;  2AT3 X;  2GJ5 A;  1CBS A;  1GX8 A;  2QOS C;  2ZAI A;  4IB9 A;  4ORR A;  1OBQ A;  2FT9 A;  1HMT A;  4MVE A;  3WJG A;  3CBS A;  1KGL A;  1HBP A;  3VT1 A;  3BDR A;  3QEF A;  4ZHF A;  4U3Q A;  5AJB A;  3RWK X;  3NQ3 A;  1ZNG A;  4EQV A;  3B2L A;  1SY0 A;  1CBR A;  1BSO A;  2Q4N A;  4OMX A;  3RKG A;  1UV4 A;  1SMP I;  4I3B A;  3LHN A;  3P6H A;  4U9C A;  3E3C A;  1IW2 A;  3ZI8 A;  4YDA A;  5LJC A;  1P6P A;  4AZQ A;  2K23 A;  5GLO A;  5FMB A;  3D5Y A;  1LID A;  3NBX X;  1QFV A;  5EED A;  4HFO A;  1ADL A;  2HMB A;  2MWH A;  3NAD A;  5D8J A;  1KQW A;  1SY1 A;  1ZRY A;  4O3Z A;  4OS0 A;  5LKE A;  4FFG A;  1UZ2 X;  2X8F A;  3OM4 A;  1Y9T A;  3ZXJ A;  3VE2 A;  3HK1 A;  2F09 A;  3KFI A;  2WR6 A;  5D47 A;  3KF5 A;  1FE3 A;  1T8V A;  3DSZ A;  3WJE A;  4ORW A;  3NX2 A;  2Z4I A;  2P8G A;  2XQR A;  4U6D A;  4EXZ A;  5HZ8 A;  3VSS A;  5F6Z A;  2Q9S A;  1DF3 A;  4FFH A;  4HPC A;  1BLR A;  1BSQ A;  3ZW0 B;  2POA A;  1DZP A;  1CBQ A;  1BM5 A;  3U0D A;  2AC1 A;  3WMZ A;  3BSZ E;  4Y0S A;  1HN2 A;  2JW1 A;  3U03 A;  3D61 A;  1AVG I;  2KW1 A;  3NQH A;  1GKA B;  4O3X B;  1DZK A;  1Z24 A;  3T1D A;  3WAT A;  4QGX A;  5FQ6 E;  4TNN A;  3AKG A;  3K1U A;  3NPO A;  3BRN A;  1QY1 A;  3BX8 A;  3P6F A;  4DQ3 A;  4GRJ A;  2G7B A;  4QQS A;  3KZA A;  4N1I A;  3FEP A;  5HTE A;  4ORS A;  3WJB A;  1MDC A;  1NP4 A;  3ZW0 A;  2KTD A;  1L6M A;  1HBQ A;  5HWZ A;  3BY0 A;  3HTY A;  4YMY A;  1MUP A;  4TLJ A;  4ORX A;  4JGL A;  4M6S A;  4QAE A;  1GKA A;  2EXK A;  5B6S A;  4GH7 A;  2Q2P A;  4AZR A;  4YH0 A;  1T68 X;  4U6B A;  3APW A;  3BU9 A;  1ZND A;  4LKP A;  3KST A;  1KT3 A;  2NNQ A;  3FR5 A;  2ADD A;  4K19 A;  4HPD A;  4YFR A;  5FK8 A;  1T0V A;  4XMF A;  4N7D A;  2A0A A;  5IO7 A;  1KT4 A;  3P24 A;  4KC7 A;  1Y9L A;  1WL7 A;  2AL0 X;  2GTL M;  1JBH A;  4ZJ0 A;  3WPV A;  3KFH A;  4OS3 A;  4GNY A;  3CQR A;  1LFO A;  3WVM A;  3F8A A;  4UDG A;  4QRL A;  1KT7 A;  4ALO A;  5F58 A;  1IIU A;  4LZU A;  5AQ6 A;  3NR3 A;  2BHV A;  3PPT A;  1GT4 A;  4NP1 A;  5K06 A;  2OZQ A;  2QMI A;  3WAU A;  4RUN A;  3B2H A;  3D4R A;  3C7H A;  1ALB A;  3U75 A;  3VT0 A;  2FTB A;  2X8T A;  3UEV A;  4FFF A;  2JU3 A;  3O22 A;  1QFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...