1IIPA

Bovine cyclophilin 40, tetragonal form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
297
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin 40
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
total genus 102
structure length 297
sequence length 297
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.160 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1iipA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1iipA01
1CWIA 4N1OA 1M9FA 2PHCB 3PMPA 2N0TA 2IGWA 1MZWA 1H0PA 4YUIA 2ZP2A 2WFJA 1AK4A 3RDAX 1CLHA 4HY7A 5KV4A 1RMHA 4YUOA 2GW2A 2CFEA 1XWNA 4N1MA 3RDCA 5KV6A 3RFYA 1CWJA 1OCAA 1M9CA 4JCPA 1QNHA 2WFIA 3CYSA 1AWVA 4TOTA 2X2CK 2X83B 4N1RA 3BO7A 3RDDA 3K0QA 4DGEA 3O7TA 3BKPA 3R59A 3RCKX 1AWQA 4YUMA 1LOPA 5CYHA 1FGLA 1M9DA 2MC9A 5KUUA 5LUDA 1VBSA 2POYA 2K7NA 4R3FA 4J5EX 2BITX 5KURA 1ZKCA 2MVZA 1CWCA 1XQ7A 5KULA 5CCNA 3OREA 3MMLB 2RS4A 5A0EA 1A33A 3EOVA 2XGYB 3ICIA 5KV2A 2A2NA 3JB9d 5KUSA 1DYWA 2PLUA 2RMCA 4J5DX 5KV0A 2RMAA 5JHEA 5CBWA 4EYVA 2Z6WA 2ALFA 3R49A 2RMBA 4CYHA 4N1SA 2R99A 2FU0A 1AWTA 3BT8A 3K2CA 1ZMFA 1C5FA 4YUGA 4LQWA 3UCHA 4J5CX 2X7KA 2X2AA 5KUWA 2MZUA 3RD9X 5KUOA 2CYHA 2HQ6A 3ODIA 1QOIA 3RCFA 2QERA 2HE9A 5KUVA 3T1UA 4ZSCA 4O8HA 3ICHA 4R3EA 2B71A 2C3BA 1W8VA 5KV3A 4N1PA 1AWSA 1ISTA 3CYHA 1QNGA 4YUKA 1CWAA 2ESLA 1VAIA 3RCIX 1W74A 3MMLA 3ODLA 3K0PA 3S6MA 1Z81A 1AWRA 4DGDA 2OK3A 1X7FA 3R4GA 5KV1A 1V9TA 5KUZA 2CMTA 1W8MA 4YUHA 5KUNA 1AWUA 5CBUA 2CK1A 2CPLA 3OEPA 1M9EA 1CWKA 2P0OA 5DUDA 5F66A 4S1EA 2NULA 3RCGA 5CCQA 3K0MA 1MIKA 1ZKFA 4FRVA 1CWHA 3R54A 4YUJA 1CWBA 5KUQA 1M9XA 1IIPA 1VDNA 2BIUX 5KV5A 4YUPA 1NMKA 4DGCA 5KV7A 2HAQA 4S1JA 2X25B 4YULA 1CWOA 3R56A 5CCSX 1CWMA 3OPFA 4DGBA 4N1QA 1IHGA 1XO7A 1YNDA 4JJMA 1BCKA 1XYHA 5CBTA 2WLWA 4IPZA 1CYNA 1W8LA 2HQJA 4J58A 3RDBA 3VA7A 3K0OA 1A58A 3R57A 1CWLA 4J59A 4J5AX 4YUNA 5CCRA 1VBTA 4J5BA 4N1NA 4ZSDA 1E8KA 1CWFA 2X2DB 3RCLA 2OJUA 4XNCA 3QYUA 1M9YA 2IGVA 4O8IA 2OSEA 2POEA 1MF8C 5CBVA 4E1QA 1J2AA 3K0NA 4I9YA 3K0RA 2MS4A 1M63C 1E3BA 4FRUA 4DGAA
chains in the Genus database with same CATH superfamily
2RDIA 5KFQA 3FYHA 3NGDA 4F5NA 2PI4A 2ESEA 3IRUA 3RFYA 4USAA 1ZQIA 4F50A 2X2CK 4GXIA 3MC1A 4QZ9A 3O7TA 3RCKX 3PY8A 3QEAZ 1LOPA 1RM6C 2MC9A 5ALYA 1XS9D 4PZNA 4Y2PA 2N1RA 5HNKA 3C2KA 1HJPA 2BITX 1JXEA 1SKSA 2K8AA 3UM9A 3GU3A 4DF4A 4B9LA 1FIQA 3AUOA 4HAIA 2V9WA 2OWOA 2XGYB 1N5WA 3E0FA 3QEBZ 1ZETA 4EYVA 5T14A 2KFZA 2RMBA 4BUGA 3K4GA 4YMMA 3KOPA 2DWQA 1ZMFA 2JEIA 1C20A 3N4MB 4F5QA 1NZBA 4J9KA 2D3DA 3ED5A 1Z4OA 1S10A 1A0PA 1N5XA 2YB1A 2J6UA 3T3FA 3NUQA 8ICTA 2K4PA 2ASDA 4DGDA 5AI6A 4M04A 3RJHA 3WKBA 4KLIA 1KEJA 3M8SA 3WK6A 3UXPA 1M9EA 4UQGA 2H3ZA 4I27A 1F44A 3LVWA 4J9RA 1J97A 3UMCA 2KZZA 1IIPA 5AKYA 4YCXA 4J9MA 2H3FA 1NK7A 5KAFU 3EPIA 2XI9A 2OHFA 3KTQA 5DBAA 2K4IA 1XO7A 1YNDA 2HBKA 4IQTA 3K1ZA 5DLFA 2KFNA 1BPEA 1RQLA 2Y0SF 4DQSA 4MFAA 5AKEA 5AI5A 2F76X 3R9KA 5KT3A 2OJUA 2JR5A 4HYKA 3IG5A 3RJIA 4FS2A 3PSPA 1M63C 1KKXA 1DOQA 2BCUA 2OYYA 3CW2C 4ED8A 3PO4A 4FZNA 2PKEA 3RDAX 8ICUA 1Q3VA 4QZGA 2EAMA 2NO4A 4B6JA 4JCPA 1K1SA 2C2RA 4Q8FA 3HPOA 4N1RA 4YFKA 4EEKA 3ONNA 4Q43A 2NYVA 2R8KA 4RQMA 3KZXA 2WHEA 2GH1A 3OGUA 3BJYA 4P0PA 4WJ3B 4DWIA 3G6VA 2F77X 1L5UA 3ICIA 3QU5A 4YD2A 5ALSA 1NJZA 3IG8A 2HOFA 4N1SA 7ICRA 4XA5A 7ICFA 4UARA 4KLFA 1SKRA 4P0QA 2EZZA 2CN1A 3ODIA 1A77A 1K5OA 1TV9A 4C4SA 4DLEA 1AWSA 4BWMA 2QB0A 3WK5A 5AKGA 3C23A 2OK3A 2VANA 5KFYA 9ICSA 3RAQA 3MR2A 5J2BA 3H40A 4ED3A 3THVA 4YUJA 1ZQUA 9ICXA 3JPQA 3C21A 4DGCA 3OHBA 3ISDA 5AK5A 2WFAA 2EQYA 2KNJA 5KFGA 8ICJA 1CWMA 4QWAA 3FM9A 1IHGA 3HKZF 1SGGA 4QZFA 3PSFA 3G6YA 4XUSA 4UBBA 2PMZC 4DOBA 2EZXA 3F2CA 1NKBA 1CWLA 4J59A 4NM1A 4RQ3A 2YMPA 4I2DA 4KITB 2X2DB 2I1QA 4DL7A 4UB4A 2POEA 3RH6A 2R18A 1T8EA 3WK9A 2H3VA 4BX9C 1FO4A 2YMQA 3VCBA 2YMLA 5FP0A 4YR2A 2NO5A 2G08A 1S5LU 4P0PB 3GV5B 5KFVA 2GLEA 4ELVA 1CLHA 2ES6A 2F1IA 5KFWA 4DQPA 2GW2A 3ZD9A 3RB6A 5BOLA 2A1JB 2DUYA 4UW9A 3SYZA 5KFEA 2C2EA 1KN5A 2OXOA 7ICMA 4P0QB 4ECXA 4QZDA 4B9NA 2ZUDA 4MFFA 3IV6A 2IA6A 4BDPA 3SR6A 4J9OA 2K7NA 3L5KA 1NOMA 3DV9A 1AQ6A 2W54A 1CWCA 2BDUA 2QB0B 3SAGA 4CF4A 4R64A 5HHIA 1DYWA 3QNMA 4TUQA 2K89A 1L3SA 4DCCA 3BT8A 3E58A 3ZDEA 4QWEA 4O3SA 2FPMA 3RCFA 2XCAA 5DG7A 4QWBA 4F4ZA 3ZDAA 1OUQA 4GC6A 3T1UA 3M6ZA 2KZMA 2MU2A 1N2XA 1CWAA 2HVHA 2RDJA 2HMXA 4QZIA 2NRWA 1TVAA 4C4RA 3UQ2A 2J6SA 3H8MA 1L3VA 1UT8A 2CXYA 5JTIA 3RCGA 2FMSA 2ZTEA 1JROA 1O03A 5JU5A 3X27A 1D8BA 2QKQA 3AU2A 3V7LA 1B4FA 4M9JA 3MR3A 2W9AA 3MGVA 3R56A 5KFOA 3VC8A 4DSLA 1Z00A 4J9SA 1SV0C 2WB1F 3QXGA 1RXVA 5KFSA 4IPZA 3PMNA 3C2LA 2NV3A 3ZDCA 5G5GA 4J5BA 4IR9A 3U26A 2BPGA 1DGJA 4YXMA 4Z6EA 5L1LA 1MN8A 2PFQA 2BHNA 1TK8A 1ZQSA 1AROP 1KW4A 1UCVA 2HHTA 4I29A 3NRWA 4P2HA 1MZWA 5CEHA 4RNOA 1SXEA 2W04A 5ALJA 5KFTA 2JXJA 3QE9Y 1H38A 4Y2JA 1COKA 2ZUCA 3RBDA 4ZH4A 3ETLA 2POYA 1ZOLA 3C28A 3RB4A 1A6SA 2MVZA 2CPRA 4DFDA 3WU2U 4DQQA 1DK2A 2XC9A 3WKCA 5KUSA 1Q3UA 7ICUA 5CBWA 4DFJA 4DO9A 3GIJA 4RNMA 8ICOA 2NRVA 7ICTA 2EDUA 5J2FA 2VA2A 4F93B 1SL0A 1L7PA 2I5HA 1BNPA 1Y88A 2YB4A 4PZOA 3NTUA 4Y2QA 4ZOHC 4YD1A 5ALMA 3BQTA 9ICOA 4F4WA 2D6FC 1VAIA 4CNQA 3CRXA 4YMNA 5AM5A 4Y2TA 1UQVA 2KHQA 1D8LA 3JPNA 3BDPA 2EAOA 4I28A 5CB1A 2E1EA 1ZKFA 3V7KA 3PW4A 5KG0A 3R54A 1ZQDA 7ICJA 5KL1B 2EH9A 4GFJA 3SV4A 2LBOA 4RQ7A 2AGOA 1BVSA 4RQNA 3EYZA 3RR7A 2W9CB 2BQ3A 9ICIA 5DGBA 3JPOA 3SV3A 4BJQA 1M9YA 2KICA 4DEZA 2WF6A 4NL9A 3HT3A 1QQ7A 3PW0A 3SAHA 3QUTA 5J0YA 5J2AA 4YMOA 1OXJA 2KSOA 4FBUA 4EZ6A 2N0TA 4O3RA 4DSEA 4GC7A 2AQ4A 5CJ7A 4KX3A 1JI7A 2HBMA 2X83B 2Y1JA 3JPSA 3N7RC 2R8IA 3QYPA 1U45A 4YG2A 4O3PA 3HRDD 1IM4A 2PFPA 3RR8A 5CCNA 2XO7A 2UVWA 2FJ6A 3JB9d 2QLTA 2ZJ8A 1KDHA 1OW5A 8ICWA 4YUGA 4OJ5A 3UCHA 3QU2A 2RP5A 3H0RB 3QZ8A 5KUWA 1VJ5A 4QZAA 1N63A 5KUVA 3N28A 4ZSCA 2HVIA 4R3EA 1W8VA 4ELTA 5KV3A 5CRXA 4F5RA 3RCIX 1W74A 5ALXA 3S6MA 7ICKA 9ICBA 2L5YA 4XRHA 3PW7A 4DL6A 5KG4A 4KMUA 2Y9UA 2JMGA 3SD7A 5HR6A 2KK0A 1D8YA 4AP9A 4FRVA 3IM1A 5KFZA 1LV5A 3WKDA 1CI4A 3JPPA 1X9SA 1S0VA 1NI3A 3MR6A 2PFOA 2KSOB 1ZQFA 4NLNA 3OPFA 1T94A 2WF9A 1N60A 3TFRA 5CBTA 5EWFA 3LWLA 2DKZA 4M0AA 3OHAA 1A58A 1T4GA 2VIXA 2K60A 1VBTA 3H8WA 1CUKA 5J2JA 4N1NA 3SZ2A 3M8RA 1TE2A 4RQ0A 3FC4A 4YVZA 2IGVA 5J2HA 2FLPA 4B9MA 4NLKA 3MFHA 1PK3A 2UVUA 3PV8A 5KUNA 2G5IB 2BCSA 4PHDA 5CR0A 2WTFA 2VA3A 4OJLA 3TADA 1H0PA 5L1MA 3RB0A 1PVPA 2R8JA 2RHFA 4Y2RA 3LK9A 3M9NB 3ZDBA 4I2BA 8ICQA 4I2FA 3RDDA 2BCVA 3JPTA 3R59A 4A8EA 1ECWA 4UAYA 2BDPA 5LUDA 3GIMA 3A0BU 2QARB 2KP7A 3H8JA 1ZRMA 2VA8A 4ECUA 5DQIA 4Y2UA 1IV8A 1V97A 2LYAA 4QW9A 5A0EA 2K8CB 1ZD2P 3ETRA 5EWGA 3GV8B 1L6NA 2XICA 3PO5A 4JB3A 2Z7JA 4C80A 2I9GA 2R99A 3KKAA 1XC9A 2OEHA 4J5CX 5IILA 4NWIA 3SEIA 3PSIA 3Q8RB 4O8HA 2WAQC 2ZJ5A 4JWNA 2P6UA 1QQ6A 9ICMA 1ZQMA 1WUDA 1QSSA 4I2CA 4IQUA 2XCPA 3IDWA 3MFIA 1S77D 4NLBA 7ICOA 4DSKA 9ICTA 5DKWA 1NMKA 4YUPA 1RDFA 2E8NA 2E1FA 1JX4A 4LZDA 4F4YA 2F8LA 9ICEA 1ZXIA 2F2AB 4OD0A 5DDMA 1SZHA 1L7MA 3I76A 2KEYA 4U6PA 4QZBA 3RJJA 4PL1A 3AMZA 5CCRA 3AM9A 4IQVA 4PGYA 5J0OA 2FMPA 4DQIA 4K4GA 3K1RB 1CWFA 1D9DA 2YN4A 4YP3A 1X42A 1V85A 4CF3A 1ZQOA 5ALLA 1SB3C 2ZTDA 2HDOA 5BPCA 5HP4A 1AK4A 5KFLA 2CFEA 4N1MA 5CP2A 5J0TA 4M9LA 1TK5A 3WKEA 1OCAA 3CYSA 2ASLA 2UVRA 2KJ5A 2HOQA 7ICIA 2W7OA 3BKPA 1Q8KA 3B0XA 1XO1A 8ICKA 4DS4A 2K8BB 2JEJA 4NV0A 4KLOA 1X40A 5J8YC 4TUPA 2JH7A 2LYBA 4DSFA 4F3OA 1ZQRA 5AKKA 4C7YA 1N61A 3O0FA 2HCFA 3EW9A 4YR0A 1MQ3A 2F3NA 4GXJA 3OSPA 5KG6A 2XY5A 4UB1A 3DEEA 5EWEA 2KN7A 3K75D 3TAPA 4RU9A 1WWUA 3RD9X 4QWCA 8ICGA 4J9NA 4MF2A 2YTUA 4US8A 4B9UA 3ICHA 2DF4B 3ZD8A 5J2KA 2OCEA 1EXNA 4YUKA 3ISBA 2IBKA 3IN5A 3HWTA 2AH5A 4CF5A 2C2DA 2A19A 5KFNA 5AKXA 5F9NA 5H2FU 1ZQ1C 2MSNA 5DUDA 5F66A 2A1JA 2W03A 5J2EA 1QH9A 4E0DA 5KFUA 3PX6A 3D6JA 3BQ1A 5IIKA 5DG9A 2PMZF 1UT5A 1NNLA 3NVZA 4YULA 4ECTA 4KLHA 5CCSX 2VKQA 1ZJMA 3N97B 3KOOA 4J9LA 2NRZA 5J0SA 2DQNB 5KFDA 3R57A 1KLNA 5L1JA 4CGZA 1HIWA 3QYUA 4XNCA 1ZQWA 4PL2A 1T3QA 1E3BA 4LVSA 4MF8A 4IL6U 5AKHA 2C28A 9ICLA 4J9QA 2ZP2A 4DFPA 3AQEA 1RMHA 4YUOA 3PZPA 5IIIA 3RDCA 1TK0A 2RLTA 4QIWC 2ZXHA 5KT4A 4KLTA 4JV0A 4ED0A 2Y1IA 1KSPA 4YR3A 1M9DA 5KT6A 2JEGA 2YMMA 4I2IA 3HJEA 4R3FA 1DK3A 3PNCA 3BS5A 1L3UA 1PK1A 4NLGA 1XQ7A 5KL8B 2YX8A 4EYIB 2VJ4A 5J0QA 4Y2YA 1U4BA 3EOVA 2B21A 3ALRA 1NK9A 1ZQNA 4F72A 4F5PA 2FU0A 3M9MB 5KFAA 3Q8QB 4QZ8A 4US9A 2X2AA 2HQ6A 5IIJA 2B0CA 2AGPA 2FDRA 5J2DA 3C5FA 4RZRA 3V6HA 2OM6A 4B9TA 4C8LA 5KFBA 1B22A 5ALEA 3RTVA 3MMLA 3K0PA 5DQGA 4UAZA 4DFMA 2P0OA 2WF7A 4KLSA 2NULA 3RB3A 5J2GA 5ALHA 4AYBC 2IOFK 3N7PD 4FZLA 2NRXA 2IOFA 4IRDA 5KV5A 1HUOA 2X25B 4K4HA 3NS1A 4DGBA 4F5OA 2HBJA 5KG1A 3H4DA 1W8LA 3TFSA 1NJXA 3MDCA 1S0MA 4NJ8A 2BCQA 5AK6A 2ZTCA 5HMLA 5EOZA 2F1HA 5CBVA 4NM2A 1KRPA 2BPCA 1NK4A 7ICVA 4I9YA 3BS5B 3H0LB 3RF9A 2W8KA 3UMBA 1PK1B 2HOIA 4ECRA 5AK4A 5F3XB 2KJ8A 1Z1BA 4I2HA 4OJOA 1ZQVA 4FE3A 2KVSA 4DOAA 1UA1A 1LKYA 3LVVA 5AIAA 4Y2SA 5D49A 3K0QA 2KE7A 4DGEA 3NRZA 4DL2A 2DGZA 4DL3A 1FGLA 1B43A 5ALWA 3H0MB 1SL2A 4O0IA 2KJ9A 2XVTA 5EE3A 4QZHA 2RS4A 3MMLB 1A33A 2G06A 2PLUA 2LHTA 8ICPA 3A0HU 3RRGA 3KBBA 1ZQQA 2EAPA 5ALIA 1AWTA 3K2CA 4KN4A 3MR5A 2W9CA 7ICQA 1C5FA 2LM1A 1N48A 1WG8A 4C8MA 4EYHB 1QOIA 3LYSA 1ZQXA 4IQWA 4F4KA 1BPDA 5J0RA 5KAIU 3WK7A 4ACOA 4N1PA 5KG7A 4M2YA 1ZQJA 5EE1A 4O5KA 4KLEA 2K4EA 4ED1A 1ZD4A 4UB3A 3OPXA 4EX7A 5KFPA 5KUZA 5KFFA 4FS1A 2DFLA 4RPZA 5ALRA 1CWKA 3BQ7A 9ICVA 3LWMA 2A3VA 3WK4A 1CWHA 2JV3A 3PW5A 4C8NA 5ALZA 4RQ2A 4IRKA 3C29A 8ICFA 3RAXA 4KLMA 4MFCA 4TQRA 2W11A 5HR7A 2IHNA 1XU4A 4RPYA 2HHXA 3PSTA 2WF8A 3V6KA 4FBTA 2BPFA 4J58A 4ED6A 5AKIA 1RQNA 4LJXA 2W7PA 4EELA 3ZDDA 3KHHA 1BPBA 5GTIU 5J0UA 1LKYB 2KG5A 4UB6U 4PJ0U 2B6GA 2HSZA 1S76D 1MF8C 4NXZA 4DFKA 2W55A 2E8OA 1RPLA 3MBYA 1JRPA 1QQ5A 3TAQA 4PGQA 1TKDA 2FLNA 2UVVA 3GV7B 4DSJA 5J0WA 3HW8A 5KFJA 4JMUA 4LZGA 4QJFB 3WK8A 4EBEA 1KFTA 4PGXA 1NKEA 3SAFA 2XIDA 4EBCA 1VBSA 5C5JA 1RYSA 8ICVA 4EENA 8ICNA 5J2IA 2R8HA 5DGAA 4QWDA 3KFUF 5ALKA 5KV2A 2A2NA 2HW3A 1KBUA 4F91B 9ICJA 5B5EU 3RJGA 2W8LA 2E5SA 4UAWA 2OH2A 5ALNA 5ALDA 3PW2A 3TANA 1MA7A 4P4PA 3F2DA 2KIVA 1NK6A 4BGDA 2DPJA 1ISTA 2ALZA 4KLGA 3CYHA 1S9FA 3RJFA 3IHQB 2BR0A 1U49A 3OJSA 2XGQA 4GXKA 1U48A 1V9TA 2CMTA 1ZQLA 4RQ1A 5L1KA 4YUHA 1ZQZA 4FZMA 2CPLA 2CRXA 5B66U 4QZCA 5AM0A 2O6KA 8ICCA 3RJKA 3FDSA 1CWBA 2WF5A 1WCLA 1X9MA 3RH5A 5KV7A 2QARA 4CDGA 8ICIA 2G0AA 1NZPA 2I6XA 1L7NA 1XSPA 2JHDA 2ODGA 2ZUBA 3K0OA 1KQQA 4J5AX 5KG5A 3FAHA 9ICGA 5KG2A 1NK5A 1UPHA 3RCLA 4GIBA 3UXNA 3F5EA 1DGSA 1ZQYA 1QCKA 2YY6A 4J03A 3K0RA 4UAUA 9ICHA 5DBBA 2KD1A 2ZIVA 2Q4TA 1WWVA 1COOA 3KD3A 2AGQA 9ICRA 5HHHA 2KA0A 2HHVA 1N62A 4RQ6A 5AM3A 3BO7A 3NVWA 5D46A 1DRGA 2MAXA 2PFNA 2V4QA 2W9BB 1SWVA 3M7DA 4IR1A 7ICLA 1JALA 3BZKA 4JV1A 7ICSA 2F44A 4NLCA 5AK3A 5ALPA 1JIHA 4Q45A 4QW8A 1U9LA 5KFXA 3V72A 1ZJNA 1CEZA 2GO7A 3WKAA 2RMAA 3QU9A 4C4TA 7ICHA 3EZ5A 2PI5A 2WAQF 1Z3EB 8ICAA 2VJ5A 4F8RA 2KVCA 2QERA 2HE9A 2B71A 2C3BA 4UASA 1F5SA 2ISPA 5ALOA 1QNGA 3AQFA 3ICXA 4Y2VA 5GTHU 3TADC 4F2SA 8ICMA 1TAUA 3GQCA 1AWRA 1NJYA 4PH5A 3R4GA 3QUQA 2BKEA 1J2MA 2LMRA 5ALVA 1W8MA 4ICAA 1AWUA 2CK1A 4P4OA 2W43A 2D8CA 3RBEA 2GOLA 5KUQA 4KLJA 4ECYA 4DSIA 1Z4NA 5ALTA 9ICPA 4ECVA 2ZIVB 4ELUA 3D2QA 1ZQCA 9ICWA 1BPYA 3KKAC 2JZBA 4EZ9A 4YUNA 3T79A 1D9FA 4XQ8A 5HMMA 3GDXA 1RYUA 3CYMA 3B9JA 5AI4A 1M9FA 4N1OA 3PMPA 3ISCA 3RRHA 4YUIA 4F71A 1C7YA 5KV4A 1Z19A 3AU6A 4C8KA 2IHMA 3BS7A 4Q44A 1ZD5A 4F92B 2LI6A 1L8LA 1VLBA 2IMWP 1BGXT 5CYHA 4MHVA 2XY7A 1X6JA 1T7PA 2G5HB 1ZKCA 4C0ZA 3Q8KA 1V38A 4M9HA 5TISU 2FPLA 2HBLA 4TURA 1RZTA 1BPZA 5IIMA 2Z6WA 5J2CA 4R65A 2ALFA 3R49A 5L9XA 2W3SA 4R63A 3EUB2 3TQ1A 2M0NA 5KUOA 4O3MA 1KFDA 4MEXA 3TACB 2DBYA 5J29A 5J8YA 1JMSA 2Y9TA 5KG3A 2AXTU 5KFKA 2MA1A 1X9XA 4UATA 2P6RA 2KOBA 4PPXA 1MC8A 4EBDA 2ZG6A 5CBUA 1PVRA 2JZBB 4O3OA 5AKJA 2KV2A 2M9NA 5CCQA 3K0MA 3RH4A 2HHUA 1NJWA 2ZIXA 2ZIWA 1VDNA 1ZD3A 2FPKA 1NK8A 4I2EA 4RT3A 3T5LA 3OJUA 2AHOB 2PXIA 5DB7A 2WLWA 4G3IA 7ICGA 2FLLA 4DQRA 4OJ6A 1SWWA 1P7DA 1SKWA 4DOCA 1E8KA 3V6JA 2OSEA 4J9PA 2DL0A 2Y0SC 5CWRA 5AKZA 5AIBA 1CRXA 3K0NA 2MS4A 3QU4A 4QNLA 4DF8A 5KTQA 4I2JA 1CWIA 2FI1A 1HEKA 4QIWF 5IIOA 1FFVA 2EZYA 1KTQA 1M9CA 3SENA 5TZVA 4G9BA 4ECQA 2J6TA 4X5VA 3NVVA 3UXOA 3AL0B 8ICYA 2JGAA 3L3FX 5KURA 1S0OA 1ZX8A 4CE6A 5A0LA 1KFSA 2BGWA 3CNHA 1QSYA 8ICEA 2Q0ZX 4KMOB 4UBCA 4YN4A 4RNNA 1TFRA 1QSLA 4LQWA 2MZUA 2CYHA 4I2GA 2ZIXB 4M6WA 4K4IA 2ZIWB 2KHVA 3ORYA 3T5KA 8ICRA 2KKVA 9ICUA 3OSNA 1BPXA 4PHAA 4IRCA 2ESLA 4JUZA 3HX0A 3E2EA 1Z81A 2LM4A 4AYBF 1X7FA 5KV1A 5ALUA 1U47A 4F4XA 1NK0A 9ICFA 3EPGA 1TAMA 2W9MA 1S0NA 2MRLA 1QLNA 3QUBA 4ED7A 1IG6A 4R8UA 1CWOA 2ZIUA 3H7IA 1RG6A 5AI8A 4O5EA 2A1AA 5L1IA 2ATLA 3TARA 5AI9A 2JEFA 3JPRA 2XGPA 3I28A 1UHUA 3PX0A 2AQ0A 5DLGA 4O5CA 1SV4A 5G5HA 1Q46A 2HHWA 3HKZC 1IXRA 4KLDA 3B0YA 2NNZA 4GLXA 3GILA 5C0YA 1ED1A 2KKPA 1JUDA 3I1YA 1X6IA 3G6XA 3UPQA 1LB2B 1TAQA 1PUZA 4NLZA 4C8OA 4B9SA 1O08A 2WFJA 3KHGA 1YT3A 7ICNA 3AEVA 5KV6A 2XY6A 1AWVA 1ZRNA 1SL1A 4MEYA 5KT7A 2ZXIA 1SXDA 4M6WB 3UQ0A 1SZPA 2V4RA 4KLQA 4DS5A 2BQRA 5AM2A 5DG8A 4NY8A 3C1YA 1XNSA 3HILA 3ZI4A 4Y2XA 5ALQA 3PR4A 4ECWA 4M9NA 1SV0A 2RMCA 2LKYA 5JHEA 1K1QA 1WYGA 5KNIA 3Q8MA 5BOMA 1PZNA 4CYHA 5CHGA 5AM4A 3Q8PB 2X7KA 1QTMA 2ZJAA 3RJEA 5DBCA 3QU7A 4PHPA 1KL9A 8ICXA 4R8UB 5AICA 3D2SA 2ZIUB 5J0PA 4KX5A 5J0XA 5D4BA 5DB9A 2H3QA 3AN1A 4ECZA 4M9GA 3C5GA 1BNOA 3MGIA 1LVHA 4OCZA 3OEPA 4S1EA 1V9PA 5ALFA 3BQ0A 9ICQA 4M47A 4KTQA 2NRTA 4Z6CA 2G07A 1M9XA 2BIUX 1WCNA 1N56A 3LDAA 3M1YA 1L8OA 5KFCA 3M6KA 3QZ7A 4UB8U 3H4BA 3GIIA 5KFRA 4O3QA 1CYNA 2BQUA 5AKLA 1ZQTA 3RDBA 3VA7A 4YQWA 2HI0A 4YXJA 2RRDA 2WB1C 1S97A 1ZQPA 3N7SC 3UMGA 4O8IA 5DQHA 4ECSA 1X66A 3BQ2A 3GZFA 1Z1VA 5KFIA 5DB6A 4O9MA 8ICHA 3RFAA 4FRUA 4O3NA 3T5JA 1ZYQA 2YQEA 2HHSA 3SI8A 4OO1J 1VDVA 4HY7A 5AI0A 3KHRA 1XWNA 3PVXA 3PX4A 2C22A 4CCHA 1QNHA 3QUCA 4P4MA 5DDYA 1ZQGA 2F1JA 4RUCA 5KUUA 5KT2A 7ICEA 3NASA 3DDHA 3D2NA 2R8GA 4IS7A 4BWJA 1Z00B 4ED2A 4CRXA 7ICPA 3OREA 2FE9A 4Z6DA 2JRZA 3C2MA 4J5DX 5KV0A 2EANA 1L3TA 1XSNA 4R66A 2KIWA 4KN7A 5KFMA 5AM1A 2HHQA 4KLUA 5ALGA 1YZ6A 3MABA 9ICKA 4RQ8A 1RXWA 3ODLA 2G09A 2E8MA 3C1ZA 9ICAA 3T5HA 3KZIU 2F8KA 2DPIA 5E79U 1T3NA 1X2IA 2RQ5A 2LYHA 5CA7A 1JXLA 4RT2A 1MIKA 2KMDA 5F9LA 5EE0A 3BZCA 4DL5A 2W9BA 4NL9C 1S8OA 4C7ZA 4DLGA 9ICCA 9ICNA 4S1JA 4UB2A 4RQ4A 4FFDA 1UA0A 2E3TA 2W3RA 4JJMA 5K4LA 4Q8EA 1XYHA 1NKCA 2BZFA 2ISOA 4BXOA 4JWMA 2K4HA 1DXSA 1ZQHA 1A76A 2H5XA 4TQSA 2MUTA 4PHEA 4ZSDA 2AJQA 2BCRA 1J2NA 1L7OA 4QZEA 4DGAA 3OTQA 3TKAA 2PHCB 2IGWA 4RQ5A 4EX6A 3SQIA 1F0MA 1CWJA 4UB5A 2KTQA 2WFIA 4TOTA 2ASJA 3H8SA 4FO6A 2DKXA 4I2AA 1AWQA 1MSWD 4YUMA 3MDAA 3HP6A 3GFKB 1FEZA 2P35A 1SIJA 4J5EX 5KULA 5JUMA 1JN3A 4OJPA 3IP4B 3Q8SB 3SMVA 1PVQA 4IC9A 1YZ7A 4JV2A 3KHLA 5KT5A 3PR5B 3MGHA 1X9WA 3CP8A 1XSLA 3NVYA 3F53A 5DB8A 2LPEA 2E8PA 1URJA 1XWLA 4RUAA 3GIKA 1HUZA 4B9VA 4F2RA 4TUSA 3F2BA 4U7CA 2FMQA 2GWSA 1ZQAA 3M9OB 4BXOB 1XO0A 1RYRA 1ZQKA 8ICSA 3EWAA 1GO3F 2MUTB 1M6YA 4DL4A 1ZQBA 2P66A 2HAQA 3Q8LA 2H3IA 2AU0A 1B0XA 3F5AA 4Z6FA 4N1QA 1BCKA 3PMLA 3TI0A 2JH1A 4EEYA 2HQJA 4UAVA 8ICLA 5AHXA 3S6JA 2IOHA 4RPXA 3V7JA 2QB1A 3QX7A 4JK1A 3L4PA 8ICBA 3J81j 5IINA 5EE9A 1ZQEA 4E1QA 2KZ3A 5JRTA 1FFUA 4KLLA 1J2AA 5KFHA 1MQ2A 8ICZA
chains in the Genus database with same CATH topology
1CWIA 1HEKA 4QIWF 2HOIA 2N0TA 2KJ8A 1Z1BA 4OJOA 4KX3A 4FE3A 3RFYA 1M9CA 2HBMA 2X2CK 2X83B 3LVVA 4DGEA 3K0QA 3O7TA 3RCKX 3N7RC 1LOPA 2DGZA 1FGLA 2MC9A 2N1RA 3H0MB 3AL0B 2JGAA 2BITX 3L3FX 5KURA 2K8AA 2KJ9A 2XVTA 3GU3A 5A0LA 5CCNA 3MMLB 2RS4A 1A33A 2XGYB 3JB9d 2G06A 2PLUA 2LHTA 3E0FA 4KMOB 4EYVA 5T14A 2RMBA 4BUGA 1AWTA 3K2CA 1ZMFA 1C5FA 4YUGA 4OJ5A 4LQWA 3UCHA 2RP5A 3H0RB 1NZBA 5KUWA 2MZUA 2CYHA 2ZIXB 1QOIA 3LYSA 2ZIWB 2KHVA 5KUVA 2KKVA 4ZSCA 4R3EA 1W8VA 4ACOA 5KV3A 4N1PA 5CRXA 1A0PA 2YB1A 2ESLA 3RCIX 1W74A 2K4EA 3NUQA 3S6MA 1Z81A 4DGDA 4AYBF 1X7FA 5KV1A 3OPXA 5KUZA 2JMGA 5HR6A 1M9EA 1CWKA 2H3ZA 1F44A 1TAMA 3LVWA 2A3VA 4FRVA 1CWHA 1IIPA 2MRLA 3C29A 2H3FA 1CWOA 2ZIUA 5HR7A 2XI9A 3OPFA 2K4IA 1XO7A 1YNDA 2HBKA 3PSTA 1T94A 3K1ZA 5CBTA 4J58A 2Y0SF 1A58A 2VIXA 2W7PA 1VBTA 4N1NA 3HKZC 2F76X 5C0YA 2OJUA 2IGVA 1ED1A 1MF8C 3IG5A 2KKPA 3PSPA 1M63C 5KUNA 2G5IB 2OYYA 4FZNA 1H0PA 4OJLA 2WFJA 3RDAX 1PVPA 1Q3VA 2RHFA 1YT3A 5KV6A 4JMUA 4QJFB 4JCPA 1AWVA 4N1RA 3RDDA 3ONNA 3R59A 4A8EA 3SAFA 2XIDA 1ECWA 3KZXA 5LUDA 2ZXIA 1VBSA 2GH1A 1XNSA 3KFUF 4P0PA 2LYAA 4WJ3B 5A0EA 2K8CB 2F77X 5KV2A 3ICIA 2A2NA 2RMCA 1KBUA 2LKYA 1L6NA 5JHEA 2XICA 3IG8A 2HOFA 2Z7JA 4CYHA 4N1SA 2R99A 2E5SA 2OH2A 4P0QA 4J5CX 2X7KA 2CN1A 4NWIA 3ODIA 1MA7A 3PSIA 3F2DA 4O8HA 2WAQC 1AWSA 1ISTA 3CYHA 3D2SA 2ZIUB 1WUDA 4KX5A 2OK3A 2H3QA 1V9TA 2CMTA 4YUHA 4FZMA 2CPLA 3OEPA 2CRXA 4S1EA 4YUJA 4NLBA 1CWBA 2G07A 1M9XA 2BIUX 4YUPA 1NMKA 4DGCA 5KV7A 4CDGA 2G0AA 3M6KA 2KNJA 2E1FA 1CWMA 2F8LA 1IHGA 3HKZF 2JHDA 3PSFA 2F2AB 1CYNA 2PMZC 3RDBA 3VA7A 3K0OA 1SZHA 3F2CA 1CWLA 2KEYA 4U6PA 4J59A 4J5AX 4PL1A 5CCRA 2RRDA 2WB1C 1UPHA 1CWFA 3N7SC 2X2DB 3RCLA 4O8IA 2POEA 3F5EA 2R18A 3GZFA 2H3VA 3K0RA 4BX9C 3VCBA 3RFAA 4FRUA 2KD1A 2G08A 2ZIVA 2Q4TA 4P0PB 4OO1J 1AK4A 1CLHA 4HY7A 2GW2A 2CFEA 1XWNA 4N1MA 1OCAA 1QNHA 3CYSA 2KJ5A 2HOQA 2W7OA 3BO7A 2OXOA 3BKPA 4P0QB 1DRGA 5KUUA 3M7DA 2K8BB 4NV0A 2K7NA 2JH7A 2LYBA 4NLCA 1CWCA 2BDUA 3D2NA 3SAGA 3OREA 4CRXA 3O0FA 1DYWA 4J5DX 5KV0A 2RMAA 2K89A 3DEEA 2WAQF 3BT8A 2KIWA 2VJ5A 3RD9X 2KVCA 3RCFA 2QERA 2HE9A 1OUQA 3T1UA 3ICHA 2B71A 2C3BA 3M6ZA 2DF4B 1QNGA 4YUKA 1CWAA 3AQFA 3IN5A 3ICXA 3ODLA 2HMXA 2G09A 1AWRA 3R4GA 1W8MA 4ICAA 1ZQ1C 1AWUA 2CK1A 5DUDA 5F66A 3RCGA 2W03A 1MIKA 2GOLA 5KUQA 1D8BA 2PMZF 4S1JA 4YULA 3MGVA 3R56A 5CCSX 2VKQA 3VC8A 2ZIVB 2WB1F 4JJMA 1XYHA 3D2QA 4IPZA 2DQNB 2K4HA 2NV3A 3R57A 4YUNA 4J5BA 3T79A 4ZSDA 4CGZA 1HIWA 3QYUA 4XNCA 4PL2A 1E3BA 3CYMA 4DGAA 4N1OA 1M9FA 2PHCB 3PMPA 2IGWA 3NRWA 1MZWA 4YUIA 2ZP2A 3AQEA 2W04A 5KV4A 1RMHA 3SQIA 4YUOA 3PZPA 1Z19A 3RDCA 1CWJA 2WFIA 4TOTA 4QIWC 2ZXHA 1AWQA 4YUMA 5CYHA 1M9DA 2POYA 4R3FA 2G5HB 4J5EX 3C28A 1A6SA 1ZKCA 2MVZA 2CPRA 4C0ZA 1XQ7A 5KULA 5KL8B 2YX8A 2VJ4A 4OJPA 3IP4B 3EOVA 2HBLA 5KUSA 3ALRA 3SMVA 1Q3UA 1PVQA 5CBWA 4IC9A 2Z6WA 2ALFA 3R49A 2FU0A 3CP8A 2M0NA 3F53A 2X2AA 5KUOA 4O3MA 2HQ6A 2YB4A 2OM6A 1URJA 2MA1A 2D6FC 1VAIA 3MMLA 3K0PA 3CRXA 3F2BA 2KOBA 2KHQA 4U7CA 2ZG6A 1XO0A 5CBUA 2P0OA 1PVRA 1GO3F 2NULA 2E1EA 2KV2A 5CCQA 3K0MA 1ZKFA 4AYBC 3R54A 2ZIXA 3N7PD 4FZLA 2ZIWA 1VDNA 5KL1B 5KV5A 4GFJA 2HAQA 2X25B 2LBOA 2H3IA 3F5AA 4DGBA 4N1QA 2HBJA 1BCKA 2JH1A 2WLWA 1W8LA 2HQJA 4OJ6A 1P7DA 1E8KA 4BJQA 1M9YA 2KICA 2OSEA 2Y0SC 5CBVA 4E1QA 1J2AA 1CRXA 3K0NA 4I9YA 2MS4A 3SAHA 3H0LB 4QNLA 3RF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CWI A;  4N1O A;  1M9F A;  2PHC B;  3PMP A;  2N0T A;  2IGW A;  1MZW A;  1H0P A;  4YUI A;  2ZP2 A;  2WFJ A;  1AK4 A;  3RDA X;  1CLH A;  4HY7 A;  5KV4 A;  1RMH A;  4YUO A;  2GW2 A;  2CFE A;  1XWN A;  4N1M A;  3RDC A;  5KV6 A;  3RFY A;  1CWJ A;  1OCA A;  1M9C A;  4JCP A;  1QNH A;  2WFI A;  3CYS A;  1AWV A;  4TOT A;  2X2C K;  2X83 B;  4N1R A;  3BO7 A;  3RDD A;  3K0Q A;  4DGE A;  3O7T A;  3BKP A;  3R59 A;  3RCK X;  1AWQ A;  4YUM A;  1LOP A;  5CYH A;  1FGL A;  1M9D A;  2MC9 A;  5KUU A;  5LUD A;  1VBS A;  2POY A;  2K7N A;  4R3F A;  4J5E X;  2BIT X;  5KUR A;  1ZKC A;  2MVZ A;  1CWC A;  1XQ7 A;  5KUL A;  5CCN A;  3ORE A;  3MML B;  2RS4 A;  5A0E A;  1A33 A;  3EOV A;  2XGY B;  3ICI A;  5KV2 A;  2A2N A;  3JB9 d;  5KUS A;  1DYW A;  2PLU A;  2RMC A;  4J5D X;  5KV0 A;  2RMA A;  5JHE A;  5CBW A;  4EYV A;  2Z6W A;  2ALF A;  3R49 A;  2RMB A;  4CYH A;  4N1S A;  2R99 A;  2FU0 A;  1AWT A;  3BT8 A;  3K2C A;  1ZMF A;  1C5F A;  4YUG A;  4LQW A;  3UCH A;  4J5C X;  2X7K A;  2X2A A;  5KUW A;  2MZU A;  3RD9 X;  5KUO A;  2CYH A;  2HQ6 A;  3ODI A;  1QOI A;  3RCF A;  2QER A;  2HE9 A;  5KUV A;  3T1U A;  4ZSC A;  4O8H A;  3ICH A;  4R3E A;  2B71 A;  2C3B A;  1W8V A;  5KV3 A;  4N1P A;  1AWS A;  1IST A;  3CYH A;  1QNG A;  4YUK A;  1CWA A;  2ESL A;  1VAI A;  3RCI X;  1W74 A;  3MML A;  3ODL A;  3K0P A;  3S6M A;  1Z81 A;  1AWR A;  4DGD A;  2OK3 A;  1X7F A;  3R4G A;  5KV1 A;  1V9T A;  5KUZ A;  2CMT A;  1W8M A;  4YUH A;  5KUN A;  1AWU A;  5CBU A;  2CK1 A;  2CPL A;  3OEP A;  1M9E A;  1CWK A;  2P0O A;  5DUD A;  5F66 A;  4S1E A;  2NUL A;  3RCG A;  5CCQ A;  3K0M A;  1MIK A;  1ZKF A;  4FRV A;  1CWH A;  3R54 A;  4YUJ A;  1CWB A;  5KUQ A;  1M9X A;  1IIP A;  1VDN A;  2BIU X;  5KV5 A;  4YUP A;  1NMK A;  4DGC A;  5KV7 A;  2HAQ A;  4S1J A;  2X25 B;  4YUL A;  1CWO A;  3R56 A;  5CCS X;  1CWM A;  3OPF A;  4DGB A;  4N1Q A;  1IHG A;  1XO7 A;  1YND A;  4JJM A;  1BCK A;  1XYH A;  5CBT A;  2WLW A;  4IPZ A;  1CYN A;  1W8L A;  2HQJ A;  4J58 A;  3RDB A;  3VA7 A;  3K0O A;  1A58 A;  3R57 A;  1CWL A;  4J59 A;  4J5A X;  4YUN A;  5CCR A;  1VBT A;  4J5B A;  4N1N A;  4ZSD A;  1E8K A;  1CWF A;  2X2D B;  3RCL A;  2OJU A;  4XNC A;  3QYU A;  1M9Y A;  2IGV A;  4O8I A;  2OSE A;  2POE A;  1MF8 C;  5CBV A;  4E1Q A;  1J2A A;  3K0N A;  4I9Y A;  3K0R A;  2MS4 A;  1M63 C;  1E3B A;  4FRU A;  4DGA A; 
#chains in the Genus database with same CATH topology
 2RDI A;  5KFQ A;  3FYH A;  3NGD A;  4F5N A;  2PI4 A;  2ESE A;  3IRU A;  3RFY A;  4USA A;  1ZQI A;  4F50 A;  2X2C K;  4GXI A;  3MC1 A;  4QZ9 A;  3O7T A;  3RCK X;  3PY8 A;  3QEA Z;  1LOP A;  1RM6 C;  2MC9 A;  5ALY A;  1XS9 D;  4PZN A;  4Y2P A;  2N1R A;  5HNK A;  3C2K A;  1HJP A;  2BIT X;  1JXE A;  1SKS A;  2K8A A;  3UM9 A;  3GU3 A;  4DF4 A;  4B9L A;  1FIQ A;  3AUO A;  4HAI A;  2V9W A;  2OWO A;  2XGY B;  1N5W A;  3E0F A;  3QEB Z;  1ZET A;  4EYV A;  5T14 A;  2KFZ A;  2RMB A;  4BUG A;  3K4G A;  4YMM A;  3KOP A;  2DWQ A;  1ZMF A;  2JEI A;  1C20 A;  3N4M B;  4F5Q A;  1NZB A;  4J9K A;  2D3D A;  3ED5 A;  1Z4O A;  1S10 A;  1A0P A;  1N5X A;  2YB1 A;  2J6U A;  3T3F A;  3NUQ A;  8ICT A;  2K4P A;  2ASD A;  4DGD A;  5AI6 A;  4M04 A;  3RJH A;  3WKB A;  4KLI A;  1KEJ A;  3M8S A;  3WK6 A;  3UXP A;  1M9E A;  4UQG A;  2H3Z A;  4I27 A;  1F44 A;  3LVW A;  4J9R A;  1J97 A;  3UMC A;  2KZZ A;  1IIP A;  5AKY A;  4YCX A;  4J9M A;  2H3F A;  1NK7 A;  5KAF U;  3EPI A;  2XI9 A;  2OHF A;  3KTQ A;  5DBA A;  2K4I A;  1XO7 A;  1YND A;  2HBK A;  4IQT A;  3K1Z A;  5DLF A;  2KFN A;  1BPE A;  1RQL A;  2Y0S F;  4DQS A;  4MFA A;  5AKE A;  5AI5 A;  2F76 X;  3R9K A;  5KT3 A;  2OJU A;  2JR5 A;  4HYK A;  3IG5 A;  3RJI A;  4FS2 A;  3PSP A;  1M63 C;  1KKX A;  1DOQ A;  2BCU A;  2OYY A;  3CW2 C;  4ED8 A;  3PO4 A;  4FZN A;  2PKE A;  3RDA X;  8ICU A;  1Q3V A;  4QZG A;  2EAM A;  2NO4 A;  4B6J A;  4JCP A;  1K1S A;  2C2R A;  4Q8F A;  3HPO A;  4N1R A;  4YFK A;  4EEK A;  3ONN A;  4Q43 A;  2NYV A;  2R8K A;  4RQM A;  3KZX A;  2WHE A;  2GH1 A;  3OGU A;  3BJY A;  4P0P A;  4WJ3 B;  4DWI A;  3G6V A;  2F77 X;  1L5U A;  3ICI A;  3QU5 A;  4YD2 A;  5ALS A;  1NJZ A;  3IG8 A;  2HOF A;  4N1S A;  7ICR A;  4XA5 A;  7ICF A;  4UAR A;  4KLF A;  1SKR A;  4P0Q A;  2EZZ A;  2CN1 A;  3ODI A;  1A77 A;  1K5O A;  1TV9 A;  4C4S A;  4DLE A;  1AWS A;  4BWM A;  2QB0 A;  3WK5 A;  5AKG A;  3C23 A;  2OK3 A;  2VAN A;  5KFY A;  9ICS A;  3RAQ A;  3MR2 A;  5J2B A;  3H40 A;  4ED3 A;  3THV A;  4YUJ A;  1ZQU A;  9ICX A;  3JPQ A;  3C21 A;  4DGC A;  3OHB A;  3ISD A;  5AK5 A;  2WFA A;  2EQY A;  2KNJ A;  5KFG A;  8ICJ A;  1CWM A;  4QWA A;  3FM9 A;  1IHG A;  3HKZ F;  1SGG A;  4QZF A;  3PSF A;  3G6Y A;  4XUS A;  4UBB A;  2PMZ C;  4DOB A;  2EZX A;  3F2C A;  1NKB A;  1CWL A;  4J59 A;  4NM1 A;  4RQ3 A;  2YMP A;  4I2D A;  4KIT B;  2X2D B;  2I1Q A;  4DL7 A;  4UB4 A;  2POE A;  3RH6 A;  2R18 A;  1T8E A;  3WK9 A;  2H3V A;  4BX9 C;  1FO4 A;  2YMQ A;  3VCB A;  2YML A;  5FP0 A;  4YR2 A;  2NO5 A;  2G08 A;  1S5L U;  4P0P B;  3GV5 B;  5KFV A;  2GLE A;  4ELV A;  1CLH A;  2ES6 A;  2F1I A;  5KFW A;  4DQP A;  2GW2 A;  3ZD9 A;  3RB6 A;  5BOL A;  2A1J B;  2DUY A;  4UW9 A;  3SYZ A;  5KFE A;  2C2E A;  1KN5 A;  2OXO A;  7ICM A;  4P0Q B;  4ECX A;  4QZD A;  4B9N A;  2ZUD A;  4MFF A;  3IV6 A;  2IA6 A;  4BDP A;  3SR6 A;  4J9O A;  2K7N A;  3L5K A;  1NOM A;  3DV9 A;  1AQ6 A;  2W54 A;  1CWC A;  2BDU A;  2QB0 B;  3SAG A;  4CF4 A;  4R64 A;  5HHI A;  1DYW A;  3QNM A;  4TUQ A;  2K89 A;  1L3S A;  4DCC A;  3BT8 A;  3E58 A;  3ZDE A;  4QWE A;  4O3S A;  2FPM A;  3RCF A;  2XCA A;  5DG7 A;  4QWB A;  4F4Z A;  3ZDA A;  1OUQ A;  4GC6 A;  3T1U A;  3M6Z A;  2KZM A;  2MU2 A;  1N2X A;  1CWA A;  2HVH A;  2RDJ A;  2HMX A;  4QZI A;  2NRW A;  1TVA A;  4C4R A;  3UQ2 A;  2J6S A;  3H8M A;  1L3V A;  1UT8 A;  2CXY A;  5JTI A;  3RCG A;  2FMS A;  2ZTE A;  1JRO A;  1O03 A;  5JU5 A;  3X27 A;  1D8B A;  2QKQ A;  3AU2 A;  3V7L A;  1B4F A;  4M9J A;  3MR3 A;  2W9A A;  3MGV A;  3R56 A;  5KFO A;  3VC8 A;  4DSL A;  1Z00 A;  4J9S A;  1SV0 C;  2WB1 F;  3QXG A;  1RXV A;  5KFS A;  4IPZ A;  3PMN A;  3C2L A;  2NV3 A;  3ZDC A;  5G5G A;  4J5B A;  4IR9 A;  3U26 A;  2BPG A;  1DGJ A;  4YXM A;  4Z6E A;  5L1L A;  1MN8 A;  2PFQ A;  2BHN A;  1TK8 A;  1ZQS A;  1ARO P;  1KW4 A;  1UCV A;  2HHT A;  4I29 A;  3NRW A;  4P2H A;  1MZW A;  5CEH A;  4RNO A;  1SXE A;  2W04 A;  5ALJ A;  5KFT A;  2JXJ A;  3QE9 Y;  1H38 A;  4Y2J A;  1COK A;  2ZUC A;  3RBD A;  4ZH4 A;  3ETL A;  2POY A;  1ZOL A;  3C28 A;  3RB4 A;  1A6S A;  2MVZ A;  2CPR A;  4DFD A;  3WU2 U;  4DQQ A;  1DK2 A;  2XC9 A;  3WKC A;  5KUS A;  1Q3U A;  7ICU A;  5CBW A;  4DFJ A;  4DO9 A;  3GIJ A;  4RNM A;  8ICO A;  2NRV A;  7ICT A;  2EDU A;  5J2F A;  2VA2 A;  4F93 B;  1SL0 A;  1L7P A;  2I5H A;  1BNP A;  1Y88 A;  2YB4 A;  4PZO A;  3NTU A;  4Y2Q A;  4ZOH C;  4YD1 A;  5ALM A;  3BQT A;  9ICO A;  4F4W A;  2D6F C;  1VAI A;  4CNQ A;  3CRX A;  4YMN A;  5AM5 A;  4Y2T A;  1UQV A;  2KHQ A;  1D8L A;  3JPN A;  3BDP A;  2EAO A;  4I28 A;  5CB1 A;  2E1E A;  1ZKF A;  3V7K A;  3PW4 A;  5KG0 A;  3R54 A;  1ZQD A;  7ICJ A;  5KL1 B;  2EH9 A;  4GFJ A;  3SV4 A;  2LBO A;  4RQ7 A;  2AGO A;  1BVS A;  4RQN A;  3EYZ A;  3RR7 A;  2W9C B;  2BQ3 A;  9ICI A;  5DGB A;  3JPO A;  3SV3 A;  4BJQ A;  1M9Y A;  2KIC A;  4DEZ A;  2WF6 A;  4NL9 A;  3HT3 A;  1QQ7 A;  3PW0 A;  3SAH A;  3QUT A;  5J0Y A;  5J2A A;  4YMO A;  1OXJ A;  2KSO A;  4FBU A;  4EZ6 A;  2N0T A;  4O3R A;  4DSE A;  4GC7 A;  2AQ4 A;  5CJ7 A;  4KX3 A;  1JI7 A;  2HBM A;  2X83 B;  2Y1J A;  3JPS A;  3N7R C;  2R8I A;  3QYP A;  1U45 A;  4YG2 A;  4O3P A;  3HRD D;  1IM4 A;  2PFP A;  3RR8 A;  5CCN A;  2XO7 A;  2UVW A;  2FJ6 A;  3JB9 d;  2QLT A;  2ZJ8 A;  1KDH A;  1OW5 A;  8ICW A;  4YUG A;  4OJ5 A;  3UCH A;  3QU2 A;  2RP5 A;  3H0R B;  3QZ8 A;  5KUW A;  1VJ5 A;  4QZA A;  1N63 A;  5KUV A;  3N28 A;  4ZSC A;  2HVI A;  4R3E A;  1W8V A;  4ELT A;  5KV3 A;  5CRX A;  4F5R A;  3RCI X;  1W74 A;  5ALX A;  3S6M A;  7ICK A;  9ICB A;  2L5Y A;  4XRH A;  3PW7 A;  4DL6 A;  5KG4 A;  4KMU A;  2Y9U A;  2JMG A;  3SD7 A;  5HR6 A;  2KK0 A;  1D8Y A;  4AP9 A;  4FRV A;  3IM1 A;  5KFZ A;  1LV5 A;  3WKD A;  1CI4 A;  3JPP A;  1X9S A;  1S0V A;  1NI3 A;  3MR6 A;  2PFO A;  2KSO B;  1ZQF A;  4NLN A;  3OPF A;  1T94 A;  2WF9 A;  1N60 A;  3TFR A;  5CBT A;  5EWF A;  3LWL A;  2DKZ A;  4M0A A;  3OHA A;  1A58 A;  1T4G A;  2VIX A;  2K60 A;  1VBT A;  3H8W A;  1CUK A;  5J2J A;  4N1N A;  3SZ2 A;  3M8R A;  1TE2 A;  4RQ0 A;  3FC4 A;  4YVZ A;  2IGV A;  5J2H A;  2FLP A;  4B9M A;  4NLK A;  3MFH A;  1PK3 A;  2UVU A;  3PV8 A;  5KUN A;  2G5I B;  2BCS A;  4PHD A;  5CR0 A;  2WTF A;  2VA3 A;  4OJL A;  3TAD A;  1H0P A;  5L1M A;  3RB0 A;  1PVP A;  2R8J A;  2RHF A;  4Y2R A;  3LK9 A;  3M9N B;  3ZDB A;  4I2B A;  8ICQ A;  4I2F A;  3RDD A;  2BCV A;  3JPT A;  3R59 A;  4A8E A;  1ECW A;  4UAY A;  2BDP A;  5LUD A;  3GIM A;  3A0B U;  2QAR B;  2KP7 A;  3H8J A;  1ZRM A;  2VA8 A;  4ECU A;  5DQI A;  4Y2U A;  1IV8 A;  1V97 A;  2LYA A;  4QW9 A;  5A0E A;  2K8C B;  1ZD2 P;  3ETR A;  5EWG A;  3GV8 B;  1L6N A;  2XIC A;  3PO5 A;  4JB3 A;  2Z7J A;  4C80 A;  2I9G A;  2R99 A;  3KKA A;  1XC9 A;  2OEH A;  4J5C X;  5IIL A;  4NWI A;  3SEI A;  3PSI A;  3Q8R B;  4O8H A;  2WAQ C;  2ZJ5 A;  4JWN A;  2P6U A;  1QQ6 A;  9ICM A;  1ZQM A;  1WUD A;  1QSS A;  4I2C A;  4IQU A;  2XCP A;  3IDW A;  3MFI A;  1S77 D;  4NLB A;  7ICO A;  4DSK A;  9ICT A;  5DKW A;  1NMK A;  4YUP A;  1RDF A;  2E8N A;  2E1F A;  1JX4 A;  4LZD A;  4F4Y A;  2F8L A;  9ICE A;  1ZXI A;  2F2A B;  4OD0 A;  5DDM A;  1SZH A;  1L7M A;  3I76 A;  2KEY A;  4U6P A;  4QZB A;  3RJJ A;  4PL1 A;  3AMZ A;  5CCR A;  3AM9 A;  4IQV A;  4PGY A;  5J0O A;  2FMP A;  4DQI A;  4K4G A;  3K1R B;  1CWF A;  1D9D A;  2YN4 A;  4YP3 A;  1X42 A;  1V85 A;  4CF3 A;  1ZQO A;  5ALL A;  1SB3 C;  2ZTD A;  2HDO A;  5BPC A;  5HP4 A;  1AK4 A;  5KFL A;  2CFE A;  4N1M A;  5CP2 A;  5J0T A;  4M9L A;  1TK5 A;  3WKE A;  1OCA A;  3CYS A;  2ASL A;  2UVR A;  2KJ5 A;  2HOQ A;  7ICI A;  2W7O A;  3BKP A;  1Q8K A;  3B0X A;  1XO1 A;  8ICK A;  4DS4 A;  2K8B B;  2JEJ A;  4NV0 A;  4KLO A;  1X40 A;  5J8Y C;  4TUP A;  2JH7 A;  2LYB A;  4DSF A;  4F3O A;  1ZQR A;  5AKK A;  4C7Y A;  1N61 A;  3O0F A;  2HCF A;  3EW9 A;  4YR0 A;  1MQ3 A;  2F3N A;  4GXJ A;  3OSP A;  5KG6 A;  2XY5 A;  4UB1 A;  3DEE A;  5EWE A;  2KN7 A;  3K75 D;  3TAP A;  4RU9 A;  1WWU A;  3RD9 X;  4QWC A;  8ICG A;  4J9N A;  4MF2 A;  2YTU A;  4US8 A;  4B9U A;  3ICH A;  2DF4 B;  3ZD8 A;  5J2K A;  2OCE A;  1EXN A;  4YUK A;  3ISB A;  2IBK A;  3IN5 A;  3HWT A;  2AH5 A;  4CF5 A;  2C2D A;  2A19 A;  5KFN A;  5AKX A;  5F9N A;  5H2F U;  1ZQ1 C;  2MSN A;  5DUD A;  5F66 A;  2A1J A;  2W03 A;  5J2E A;  1QH9 A;  4E0D A;  5KFU A;  3PX6 A;  3D6J A;  3BQ1 A;  5IIK A;  5DG9 A;  2PMZ F;  1UT5 A;  1NNL A;  3NVZ A;  4YUL A;  4ECT A;  4KLH A;  5CCS X;  2VKQ A;  1ZJM A;  3N97 B;  3KOO A;  4J9L A;  2NRZ A;  5J0S A;  2DQN B;  5KFD A;  3R57 A;  1KLN A;  5L1J A;  4CGZ A;  1HIW A;  3QYU A;  4XNC A;  1ZQW A;  4PL2 A;  1T3Q A;  1E3B A;  4LVS A;  4MF8 A;  4IL6 U;  5AKH A;  2C28 A;  9ICL A;  4J9Q A;  2ZP2 A;  4DFP A;  3AQE A;  1RMH A;  4YUO A;  3PZP A;  5III A;  3RDC A;  1TK0 A;  2RLT A;  4QIW C;  2ZXH A;  5KT4 A;  4KLT A;  4JV0 A;  4ED0 A;  2Y1I A;  1KSP A;  4YR3 A;  1M9D A;  5KT6 A;  2JEG A;  2YMM A;  4I2I A;  3HJE A;  4R3F A;  1DK3 A;  3PNC A;  3BS5 A;  1L3U A;  1PK1 A;  4NLG A;  1XQ7 A;  5KL8 B;  2YX8 A;  4EYI B;  2VJ4 A;  5J0Q A;  4Y2Y A;  1U4B A;  3EOV A;  2B21 A;  3ALR A;  1NK9 A;  1ZQN A;  4F72 A;  4F5P A;  2FU0 A;  3M9M B;  5KFA A;  3Q8Q B;  4QZ8 A;  4US9 A;  2X2A A;  2HQ6 A;  5IIJ A;  2B0C A;  2AGP A;  2FDR A;  5J2D A;  3C5F A;  4RZR A;  3V6H A;  2OM6 A;  4B9T A;  4C8L A;  5KFB A;  1B22 A;  5ALE A;  3RTV A;  3MML A;  3K0P A;  5DQG A;  4UAZ A;  4DFM A;  2P0O A;  2WF7 A;  4KLS A;  2NUL A;  3RB3 A;  5J2G A;  5ALH A;  4AYB C;  2IOF K;  3N7P D;  4FZL A;  2NRX A;  2IOF A;  4IRD A;  5KV5 A;  1HUO A;  2X25 B;  4K4H A;  3NS1 A;  4DGB A;  4F5O A;  2HBJ A;  5KG1 A;  3H4D A;  1W8L A;  3TFS A;  1NJX A;  3MDC A;  1S0M A;  4NJ8 A;  2BCQ A;  5AK6 A;  2ZTC A;  5HML A;  5EOZ A;  2F1H A;  5CBV A;  4NM2 A;  1KRP A;  2BPC A;  1NK4 A;  7ICV A;  4I9Y A;  3BS5 B;  3H0L B;  3RF9 A;  2W8K A;  3UMB A;  1PK1 B;  2HOI A;  4ECR A;  5AK4 A;  5F3X B;  2KJ8 A;  1Z1B A;  4I2H A;  4OJO A;  1ZQV A;  4FE3 A;  2KVS A;  4DOA A;  1UA1 A;  1LKY A;  3LVV A;  5AIA A;  4Y2S A;  5D49 A;  3K0Q A;  2KE7 A;  4DGE A;  3NRZ A;  4DL2 A;  2DGZ A;  4DL3 A;  1FGL A;  1B43 A;  5ALW A;  3H0M B;  1SL2 A;  4O0I A;  2KJ9 A;  2XVT A;  5EE3 A;  4QZH A;  2RS4 A;  3MML B;  1A33 A;  2G06 A;  2PLU A;  2LHT A;  8ICP A;  3A0H U;  3RRG A;  3KBB A;  1ZQQ A;  2EAP A;  5ALI A;  1AWT A;  3K2C A;  4KN4 A;  3MR5 A;  2W9C A;  7ICQ A;  1C5F A;  2LM1 A;  1N48 A;  1WG8 A;  4C8M A;  4EYH B;  1QOI A;  3LYS A;  1ZQX A;  4IQW A;  4F4K A;  1BPD A;  5J0R A;  5KAI U;  3WK7 A;  4ACO A;  4N1P A;  5KG7 A;  4M2Y A;  1ZQJ A;  5EE1 A;  4O5K A;  4KLE A;  2K4E A;  4ED1 A;  1ZD4 A;  4UB3 A;  3OPX A;  4EX7 A;  5KFP A;  5KUZ A;  5KFF A;  4FS1 A;  2DFL A;  4RPZ A;  5ALR A;  1CWK A;  3BQ7 A;  9ICV A;  3LWM A;  2A3V A;  3WK4 A;  1CWH A;  2JV3 A;  3PW5 A;  4C8N A;  5ALZ A;  4RQ2 A;  4IRK A;  3C29 A;  8ICF A;  3RAX A;  4KLM A;  4MFC A;  4TQR A;  2W11 A;  5HR7 A;  2IHN A;  1XU4 A;  4RPY A;  2HHX A;  3PST A;  2WF8 A;  3V6K A;  4FBT A;  2BPF A;  4J58 A;  4ED6 A;  5AKI A;  1RQN A;  4LJX A;  2W7P A;  4EEL A;  3ZDD A;  3KHH A;  1BPB A;  5GTI U;  5J0U A;  1LKY B;  2KG5 A;  4UB6 U;  4PJ0 U;  2B6G A;  2HSZ A;  1S76 D;  1MF8 C;  4NXZ A;  4DFK A;  2W55 A;  2E8O A;  1RPL A;  3MBY A;  1JRP A;  1QQ5 A;  3TAQ A;  4PGQ A;  1TKD A;  2FLN A;  2UVV A;  3GV7 B;  4DSJ A;  5J0W A;  3HW8 A;  5KFJ A;  4JMU A;  4LZG A;  4QJF B;  3WK8 A;  4EBE A;  1KFT A;  4PGX A;  1NKE A;  3SAF A;  2XID A;  4EBC A;  1VBS A;  5C5J A;  1RYS A;  8ICV A;  4EEN A;  8ICN A;  5J2I A;  2R8H A;  5DGA A;  4QWD A;  3KFU F;  5ALK A;  5KV2 A;  2A2N A;  2HW3 A;  1KBU A;  4F91 B;  9ICJ A;  5B5E U;  3RJG A;  2W8L A;  2E5S A;  4UAW A;  2OH2 A;  5ALN A;  5ALD A;  3PW2 A;  3TAN A;  1MA7 A;  4P4P A;  3F2D A;  2KIV A;  1NK6 A;  4BGD A;  2DPJ A;  1IST A;  2ALZ A;  4KLG A;  3CYH A;  1S9F A;  3RJF A;  3IHQ B;  2BR0 A;  1U49 A;  3OJS A;  2XGQ A;  4GXK A;  1U48 A;  1V9T A;  2CMT A;  1ZQL A;  4RQ1 A;  5L1K A;  4YUH A;  1ZQZ A;  4FZM A;  2CPL A;  2CRX A;  5B66 U;  4QZC A;  5AM0 A;  2O6K A;  8ICC A;  3RJK A;  3FDS A;  1CWB A;  2WF5 A;  1WCL A;  1X9M A;  3RH5 A;  5KV7 A;  2QAR A;  4CDG A;  8ICI A;  2G0A A;  1NZP A;  2I6X A;  1L7N A;  1XSP A;  2JHD A;  2ODG A;  2ZUB A;  3K0O A;  1KQQ A;  4J5A X;  5KG5 A;  3FAH A;  9ICG A;  5KG2 A;  1NK5 A;  1UPH A;  3RCL A;  4GIB A;  3UXN A;  3F5E A;  1DGS A;  1ZQY A;  1QCK A;  2YY6 A;  4J03 A;  3K0R A;  4UAU A;  9ICH A;  5DBB A;  2KD1 A;  2ZIV A;  2Q4T A;  1WWV A;  1COO A;  3KD3 A;  2AGQ A;  9ICR A;  5HHH A;  2KA0 A;  2HHV A;  1N62 A;  4RQ6 A;  5AM3 A;  3BO7 A;  3NVW A;  5D46 A;  1DRG A;  2MAX A;  2PFN A;  2V4Q A;  2W9B B;  1SWV A;  3M7D A;  4IR1 A;  7ICL A;  1JAL A;  3BZK A;  4JV1 A;  7ICS A;  2F44 A;  4NLC A;  5AK3 A;  5ALP A;  1JIH A;  4Q45 A;  4QW8 A;  1U9L A;  5KFX A;  3V72 A;  1ZJN A;  1CEZ A;  2GO7 A;  3WKA A;  2RMA A;  3QU9 A;  4C4T A;  7ICH A;  3EZ5 A;  2PI5 A;  2WAQ F;  1Z3E B;  8ICA A;  2VJ5 A;  4F8R A;  2KVC A;  2QER A;  2HE9 A;  2B71 A;  2C3B A;  4UAS A;  1F5S A;  2ISP A;  5ALO A;  1QNG A;  3AQF A;  3ICX A;  4Y2V A;  5GTH U;  3TAD C;  4F2S A;  8ICM A;  1TAU A;  3GQC A;  1AWR A;  1NJY A;  4PH5 A;  3R4G A;  3QUQ A;  2BKE A;  1J2M A;  2LMR A;  5ALV A;  1W8M A;  4ICA A;  1AWU A;  2CK1 A;  4P4O A;  2W43 A;  2D8C A;  3RBE A;  2GOL A;  5KUQ A;  4KLJ A;  4ECY A;  4DSI A;  1Z4N A;  5ALT A;  9ICP A;  4ECV A;  2ZIV B;  4ELU A;  3D2Q A;  1ZQC A;  9ICW A;  1BPY A;  3KKA C;  2JZB A;  4EZ9 A;  4YUN A;  3T79 A;  1D9F A;  4XQ8 A;  5HMM A;  3GDX A;  1RYU A;  3CYM A;  3B9J A;  5AI4 A;  1M9F A;  4N1O A;  3PMP A;  3ISC A;  3RRH A;  4YUI A;  4F71 A;  1C7Y A;  5KV4 A;  1Z19 A;  3AU6 A;  4C8K A;  2IHM A;  3BS7 A;  4Q44 A;  1ZD5 A;  4F92 B;  2LI6 A;  1L8L A;  1VLB A;  2IMW P;  1BGX T;  5CYH A;  4MHV A;  2XY7 A;  1X6J A;  1T7P A;  2G5H B;  1ZKC A;  4C0Z A;  3Q8K A;  1V38 A;  4M9H A;  5TIS U;  2FPL A;  2HBL A;  4TUR A;  1RZT A;  1BPZ A;  5IIM A;  2Z6W A;  5J2C A;  4R65 A;  2ALF A;  3R49 A;  5L9X A;  2W3S A;  4R63 A;  3EUB 2;  3TQ1 A;  2M0N A;  5KUO A;  4O3M A;  1KFD A;  4MEX A;  3TAC B;  2DBY A;  5J29 A;  5J8Y A;  1JMS A;  2Y9T A;  5KG3 A;  2AXT U;  5KFK A;  2MA1 A;  1X9X A;  4UAT A;  2P6R A;  2KOB A;  4PPX A;  1MC8 A;  4EBD A;  2ZG6 A;  5CBU A;  1PVR A;  2JZB B;  4O3O A;  5AKJ A;  2KV2 A;  2M9N A;  5CCQ A;  3K0M A;  3RH4 A;  2HHU A;  1NJW A;  2ZIX A;  2ZIW A;  1VDN A;  1ZD3 A;  2FPK A;  1NK8 A;  4I2E A;  4RT3 A;  3T5L A;  3OJU A;  2AHO B;  2PXI A;  5DB7 A;  2WLW A;  4G3I A;  7ICG A;  2FLL A;  4DQR A;  4OJ6 A;  1SWW A;  1P7D A;  1SKW A;  4DOC A;  1E8K A;  3V6J A;  2OSE A;  4J9P A;  2DL0 A;  2Y0S C;  5CWR A;  5AKZ A;  5AIB A;  1CRX A;  3K0N A;  2MS4 A;  3QU4 A;  4QNL A;  4DF8 A;  5KTQ A;  4I2J A;  1CWI A;  2FI1 A;  1HEK A;  4QIW F;  5IIO A;  1FFV A;  2EZY A;  1KTQ A;  1M9C A;  3SEN A;  5TZV A;  4G9B A;  4ECQ A;  2J6T A;  4X5V A;  3NVV A;  3UXO A;  3AL0 B;  8ICY A;  2JGA A;  3L3F X;  5KUR A;  1S0O A;  1ZX8 A;  4CE6 A;  5A0L A;  1KFS A;  2BGW A;  3CNH A;  1QSY A;  8ICE A;  2Q0Z X;  4KMO B;  4UBC A;  4YN4 A;  4RNN A;  1TFR A;  1QSL A;  4LQW A;  2MZU A;  2CYH A;  4I2G A;  2ZIX B;  4M6W A;  4K4I A;  2ZIW B;  2KHV A;  3ORY A;  3T5K A;  8ICR A;  2KKV A;  9ICU A;  3OSN A;  1BPX A;  4PHA A;  4IRC A;  2ESL A;  4JUZ A;  3HX0 A;  3E2E A;  1Z81 A;  2LM4 A;  4AYB F;  1X7F A;  5KV1 A;  5ALU A;  1U47 A;  4F4X A;  1NK0 A;  9ICF A;  3EPG A;  1TAM A;  2W9M A;  1S0N A;  2MRL A;  1QLN A;  3QUB A;  4ED7 A;  1IG6 A;  4R8U A;  1CWO A;  2ZIU A;  3H7I A;  1RG6 A;  5AI8 A;  4O5E A;  2A1A A;  5L1I A;  2ATL A;  3TAR A;  5AI9 A;  2JEF A;  3JPR A;  2XGP A;  3I28 A;  1UHU A;  3PX0 A;  2AQ0 A;  5DLG A;  4O5C A;  1SV4 A;  5G5H A;  1Q46 A;  2HHW A;  3HKZ C;  1IXR A;  4KLD A;  3B0Y A;  2NNZ A;  4GLX A;  3GIL A;  5C0Y A;  1ED1 A;  2KKP A;  1JUD A;  3I1Y A;  1X6I A;  3G6X A;  3UPQ A;  1LB2 B;  1TAQ A;  1PUZ A;  4NLZ A;  4C8O A;  4B9S A;  1O08 A;  2WFJ A;  3KHG A;  1YT3 A;  7ICN A;  3AEV A;  5KV6 A;  2XY6 A;  1AWV A;  1ZRN A;  1SL1 A;  4MEY A;  5KT7 A;  2ZXI A;  1SXD A;  4M6W B;  3UQ0 A;  1SZP A;  2V4R A;  4KLQ A;  4DS5 A;  2BQR A;  5AM2 A;  5DG8 A;  4NY8 A;  3C1Y A;  1XNS A;  3HIL A;  3ZI4 A;  4Y2X A;  5ALQ A;  3PR4 A;  4ECW A;  4M9N A;  1SV0 A;  2RMC A;  2LKY A;  5JHE A;  1K1Q A;  1WYG A;  5KNI A;  3Q8M A;  5BOM A;  1PZN A;  4CYH A;  5CHG A;  5AM4 A;  3Q8P B;  2X7K A;  1QTM A;  2ZJA A;  3RJE A;  5DBC A;  3QU7 A;  4PHP A;  1KL9 A;  8ICX A;  4R8U B;  5AIC A;  3D2S A;  2ZIU B;  5J0P A;  4KX5 A;  5J0X A;  5D4B A;  5DB9 A;  2H3Q A;  3AN1 A;  4ECZ A;  4M9G A;  3C5G A;  1BNO A;  3MGI A;  1LVH A;  4OCZ A;  3OEP A;  4S1E A;  1V9P A;  5ALF A;  3BQ0 A;  9ICQ A;  4M47 A;  4KTQ A;  2NRT A;  4Z6C A;  2G07 A;  1M9X A;  2BIU X;  1WCN A;  1N56 A;  3LDA A;  3M1Y A;  1L8O A;  5KFC A;  3M6K A;  3QZ7 A;  4UB8 U;  3H4B A;  3GII A;  5KFR A;  4O3Q A;  1CYN A;  2BQU A;  5AKL A;  1ZQT A;  3RDB A;  3VA7 A;  4YQW A;  2HI0 A;  4YXJ A;  2RRD A;  2WB1 C;  1S97 A;  1ZQP A;  3N7S C;  3UMG A;  4O8I A;  5DQH A;  4ECS A;  1X66 A;  3BQ2 A;  3GZF A;  1Z1V A;  5KFI A;  5DB6 A;  4O9M A;  8ICH A;  3RFA A;  4FRU A;  4O3N A;  3T5J A;  1ZYQ A;  2YQE A;  2HHS A;  3SI8 A;  4OO1 J;  1VDV A;  4HY7 A;  5AI0 A;  3KHR A;  1XWN A;  3PVX A;  3PX4 A;  2C22 A;  4CCH A;  1QNH A;  3QUC A;  4P4M A;  5DDY A;  1ZQG A;  2F1J A;  4RUC A;  5KUU A;  5KT2 A;  7ICE A;  3NAS A;  3DDH A;  3D2N A;  2R8G A;  4IS7 A;  4BWJ A;  1Z00 B;  4ED2 A;  4CRX A;  7ICP A;  3ORE A;  2FE9 A;  4Z6D A;  2JRZ A;  3C2M A;  4J5D X;  5KV0 A;  2EAN A;  1L3T A;  1XSN A;  4R66 A;  2KIW A;  4KN7 A;  5KFM A;  5AM1 A;  2HHQ A;  4KLU A;  5ALG A;  1YZ6 A;  3MAB A;  9ICK A;  4RQ8 A;  1RXW A;  3ODL A;  2G09 A;  2E8M A;  3C1Z A;  9ICA A;  3T5H A;  3KZI U;  2F8K A;  2DPI A;  5E79 U;  1T3N A;  1X2I A;  2RQ5 A;  2LYH A;  5CA7 A;  1JXL A;  4RT2 A;  1MIK A;  2KMD A;  5F9L A;  5EE0 A;  3BZC A;  4DL5 A;  2W9B A;  4NL9 C;  1S8O A;  4C7Z A;  4DLG A;  9ICC A;  9ICN A;  4S1J A;  4UB2 A;  4RQ4 A;  4FFD A;  1UA0 A;  2E3T A;  2W3R A;  4JJM A;  5K4L A;  4Q8E A;  1XYH A;  1NKC A;  2BZF A;  2ISO A;  4BXO A;  4JWM A;  2K4H A;  1DXS A;  1ZQH A;  1A76 A;  2H5X A;  4TQS A;  2MUT A;  4PHE A;  4ZSD A;  2AJQ A;  2BCR A;  1J2N A;  1L7O A;  4QZE A;  4DGA A;  3OTQ A;  3TKA A;  2PHC B;  2IGW A;  4RQ5 A;  4EX6 A;  3SQI A;  1F0M A;  1CWJ A;  4UB5 A;  2KTQ A;  2WFI A;  4TOT A;  2ASJ A;  3H8S A;  4FO6 A;  2DKX A;  4I2A A;  1AWQ A;  1MSW D;  4YUM A;  3MDA A;  3HP6 A;  3GFK B;  1FEZ A;  2P35 A;  1SIJ A;  4J5E X;  5KUL A;  5JUM A;  1JN3 A;  4OJP A;  3IP4 B;  3Q8S B;  3SMV A;  1PVQ A;  4IC9 A;  1YZ7 A;  4JV2 A;  3KHL A;  5KT5 A;  3PR5 B;  3MGH A;  1X9W A;  3CP8 A;  1XSL A;  3NVY A;  3F53 A;  5DB8 A;  2LPE A;  2E8P A;  1URJ A;  1XWL A;  4RUA A;  3GIK A;  1HUZ A;  4B9V A;  4F2R A;  4TUS A;  3F2B A;  4U7C A;  2FMQ A;  2GWS A;  1ZQA A;  3M9O B;  4BXO B;  1XO0 A;  1RYR A;  1ZQK A;  8ICS A;  3EWA A;  1GO3 F;  2MUT B;  1M6Y A;  4DL4 A;  1ZQB A;  2P66 A;  2HAQ A;  3Q8L A;  2H3I A;  2AU0 A;  1B0X A;  3F5A A;  4Z6F A;  4N1Q A;  1BCK A;  3PML A;  3TI0 A;  2JH1 A;  4EEY A;  2HQJ A;  4UAV A;  8ICL A;  5AHX A;  3S6J A;  2IOH A;  4RPX A;  3V7J A;  2QB1 A;  3QX7 A;  4JK1 A;  3L4P A;  8ICB A;  3J81 j;  5IIN A;  5EE9 A;  1ZQE A;  4E1Q A;  2KZ3 A;  5JRT A;  1FFU A;  4KLL A;  1J2A A;  5KFH A;  1MQ2 A;  8ICZ A; 
#chains in the Genus database with same CATH homology
 1CWI A;  1HEK A;  4QIW F;  2HOI A;  2N0T A;  2KJ8 A;  1Z1B A;  4OJO A;  4KX3 A;  4FE3 A;  3RFY A;  1M9C A;  2HBM A;  2X2C K;  2X83 B;  3LVV A;  4DGE A;  3K0Q A;  3O7T A;  3RCK X;  3N7R C;  1LOP A;  2DGZ A;  1FGL A;  2MC9 A;  2N1R A;  3H0M B;  3AL0 B;  2JGA A;  2BIT X;  3L3F X;  5KUR A;  2K8A A;  2KJ9 A;  2XVT A;  3GU3 A;  5A0L A;  5CCN A;  3MML B;  2RS4 A;  1A33 A;  2XGY B;  3JB9 d;  2G06 A;  2PLU A;  2LHT A;  3E0F A;  4KMO B;  4EYV A;  5T14 A;  2RMB A;  4BUG A;  1AWT A;  3K2C A;  1ZMF A;  1C5F A;  4YUG A;  4OJ5 A;  4LQW A;  3UCH A;  2RP5 A;  3H0R B;  1NZB A;  5KUW A;  2MZU A;  2CYH A;  2ZIX B;  1QOI A;  3LYS A;  2ZIW B;  2KHV A;  5KUV A;  2KKV A;  4ZSC A;  4R3E A;  1W8V A;  4ACO A;  5KV3 A;  4N1P A;  5CRX A;  1A0P A;  2YB1 A;  2ESL A;  3RCI X;  1W74 A;  2K4E A;  3NUQ A;  3S6M A;  1Z81 A;  4DGD A;  4AYB F;  1X7F A;  5KV1 A;  3OPX A;  5KUZ A;  2JMG A;  5HR6 A;  1M9E A;  1CWK A;  2H3Z A;  1F44 A;  1TAM A;  3LVW A;  2A3V A;  4FRV A;  1CWH A;  1IIP A;  2MRL A;  3C29 A;  2H3F A;  1CWO A;  2ZIU A;  5HR7 A;  2XI9 A;  3OPF A;  2K4I A;  1XO7 A;  1YND A;  2HBK A;  3PST A;  1T94 A;  3K1Z A;  5CBT A;  4J58 A;  2Y0S F;  1A58 A;  2VIX A;  2W7P A;  1VBT A;  4N1N A;  3HKZ C;  2F76 X;  5C0Y A;  2OJU A;  2IGV A;  1ED1 A;  1MF8 C;  3IG5 A;  2KKP A;  3PSP A;  1M63 C;  5KUN A;  2G5I B;  2OYY A;  4FZN A;  1H0P A;  4OJL A;  2WFJ A;  3RDA X;  1PVP A;  1Q3V A;  2RHF A;  1YT3 A;  5KV6 A;  4JMU A;  4QJF B;  4JCP A;  1AWV A;  4N1R A;  3RDD A;  3ONN A;  3R59 A;  4A8E A;  3SAF A;  2XID A;  1ECW A;  3KZX A;  5LUD A;  2ZXI A;  1VBS A;  2GH1 A;  1XNS A;  3KFU F;  4P0P A;  2LYA A;  4WJ3 B;  5A0E A;  2K8C B;  2F77 X;  5KV2 A;  3ICI A;  2A2N A;  2RMC A;  1KBU A;  2LKY A;  1L6N A;  5JHE A;  2XIC A;  3IG8 A;  2HOF A;  2Z7J A;  4CYH A;  4N1S A;  2R99 A;  2E5S A;  2OH2 A;  4P0Q A;  4J5C X;  2X7K A;  2CN1 A;  4NWI A;  3ODI A;  1MA7 A;  3PSI A;  3F2D A;  4O8H A;  2WAQ C;  1AWS A;  1IST A;  3CYH A;  3D2S A;  2ZIU B;  1WUD A;  4KX5 A;  2OK3 A;  2H3Q A;  1V9T A;  2CMT A;  4YUH A;  4FZM A;  2CPL A;  3OEP A;  2CRX A;  4S1E A;  4YUJ A;  4NLB A;  1CWB A;  2G07 A;  1M9X A;  2BIU X;  4YUP A;  1NMK A;  4DGC A;  5KV7 A;  4CDG A;  2G0A A;  3M6K A;  2KNJ A;  2E1F A;  1CWM A;  2F8L A;  1IHG A;  3HKZ F;  2JHD A;  3PSF A;  2F2A B;  1CYN A;  2PMZ C;  3RDB A;  3VA7 A;  3K0O A;  1SZH A;  3F2C A;  1CWL A;  2KEY A;  4U6P A;  4J59 A;  4J5A X;  4PL1 A;  5CCR A;  2RRD A;  2WB1 C;  1UPH A;  1CWF A;  3N7S C;  2X2D B;  3RCL A;  4O8I A;  2POE A;  3F5E A;  2R18 A;  3GZF A;  2H3V A;  3K0R A;  4BX9 C;  3VCB A;  3RFA A;  4FRU A;  2KD1 A;  2G08 A;  2ZIV A;  2Q4T A;  4P0P B;  4OO1 J;  1AK4 A;  1CLH A;  4HY7 A;  2GW2 A;  2CFE A;  1XWN A;  4N1M A;  1OCA A;  1QNH A;  3CYS A;  2KJ5 A;  2HOQ A;  2W7O A;  3BO7 A;  2OXO A;  3BKP A;  4P0Q B;  1DRG A;  5KUU A;  3M7D A;  2K8B B;  4NV0 A;  2K7N A;  2JH7 A;  2LYB A;  4NLC A;  1CWC A;  2BDU A;  3D2N A;  3SAG A;  3ORE A;  4CRX A;  3O0F A;  1DYW A;  4J5D X;  5KV0 A;  2RMA A;  2K89 A;  3DEE A;  2WAQ F;  3BT8 A;  2KIW A;  2VJ5 A;  3RD9 X;  2KVC A;  3RCF A;  2QER A;  2HE9 A;  1OUQ A;  3T1U A;  3ICH A;  2B71 A;  2C3B A;  3M6Z A;  2DF4 B;  1QNG A;  4YUK A;  1CWA A;  3AQF A;  3IN5 A;  3ICX A;  3ODL A;  2HMX A;  2G09 A;  1AWR A;  3R4G A;  1W8M A;  4ICA A;  1ZQ1 C;  1AWU A;  2CK1 A;  5DUD A;  5F66 A;  3RCG A;  2W03 A;  1MIK A;  2GOL A;  5KUQ A;  1D8B A;  2PMZ F;  4S1J A;  4YUL A;  3MGV A;  3R56 A;  5CCS X;  2VKQ A;  3VC8 A;  2ZIV B;  2WB1 F;  4JJM A;  1XYH A;  3D2Q A;  4IPZ A;  2DQN B;  2K4H A;  2NV3 A;  3R57 A;  4YUN A;  4J5B A;  3T79 A;  4ZSD A;  4CGZ A;  1HIW A;  3QYU A;  4XNC A;  4PL2 A;  1E3B A;  3CYM A;  4DGA A;  4N1O A;  1M9F A;  2PHC B;  3PMP A;  2IGW A;  3NRW A;  1MZW A;  4YUI A;  2ZP2 A;  3AQE A;  2W04 A;  5KV4 A;  1RMH A;  3SQI A;  4YUO A;  3PZP A;  1Z19 A;  3RDC A;  1CWJ A;  2WFI A;  4TOT A;  4QIW C;  2ZXH A;  1AWQ A;  4YUM A;  5CYH A;  1M9D A;  2POY A;  4R3F A;  2G5H B;  4J5E X;  3C28 A;  1A6S A;  1ZKC A;  2MVZ A;  2CPR A;  4C0Z A;  1XQ7 A;  5KUL A;  5KL8 B;  2YX8 A;  2VJ4 A;  4OJP A;  3IP4 B;  3EOV A;  2HBL A;  5KUS A;  3ALR A;  3SMV A;  1Q3U A;  1PVQ A;  5CBW A;  4IC9 A;  2Z6W A;  2ALF A;  3R49 A;  2FU0 A;  3CP8 A;  2M0N A;  3F53 A;  2X2A A;  5KUO A;  4O3M A;  2HQ6 A;  2YB4 A;  2OM6 A;  1URJ A;  2MA1 A;  2D6F C;  1VAI A;  3MML A;  3K0P A;  3CRX A;  3F2B A;  2KOB A;  2KHQ A;  4U7C A;  2ZG6 A;  1XO0 A;  5CBU A;  2P0O A;  1PVR A;  1GO3 F;  2NUL A;  2E1E A;  2KV2 A;  5CCQ A;  3K0M A;  1ZKF A;  4AYB C;  3R54 A;  2ZIX A;  3N7P D;  4FZL A;  2ZIW A;  1VDN A;  5KL1 B;  5KV5 A;  4GFJ A;  2HAQ A;  2X25 B;  2LBO A;  2H3I A;  3F5A A;  4DGB A;  4N1Q A;  2HBJ A;  1BCK A;  2JH1 A;  2WLW A;  1W8L A;  2HQJ A;  4OJ6 A;  1P7D A;  1E8K A;  4BJQ A;  1M9Y A;  2KIC A;  2OSE A;  2Y0S C;  5CBV A;  4E1Q A;  1J2A A;  1CRX A;  3K0N A;  4I9Y A;  2MS4 A;  3SAH A;  3H0L B;  4QNL A;  3RF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...