1IIPA

Bovine cyclophilin 40, tetragonal form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
297
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
molecule keywords Cyclophilin 40
total genus 102
structure length 297
sequence length 297
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.160 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1iipA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1iipA01
5CCNA 1OCAA 4YUOA 4N1NA 1VDNA 2BIUX 4N1OA 4N1MA 2RMBA 1VBTA 3ICIA 2XGYB 3ODIA 1XYHA 4O8IA 1Z81A 1CYNA 4DGAA 5DUDA 3R57A 2POYA 2IGWA 2NULA 1CWJA 4FRUA 4J5BA 2Z6WA 5KULA 2X2AA 1VBSA 5F66A 4R3FA 2CYHA 4YUPA 2X25B 4JCPA 5KV2A 2CMTA 2MVZA 3R59A 1W74A 4S1EA 3RFYA 5KV6A 1RMHA 4N1RA 1AWUA 3BT8A 1CWAA 4EYVA 3S6MA 1AWSA 3QYUA 1XWNA 4R3EA 1CWOA 2IGVA 5KV0A 3K2CA 1X7FA 3K0NA 1C5FA 1M63C 4IPZA 3RDCA 3T1UA 2POEA 1CWLA 5KUSA 5CYHA 2ZP2A 1CWHA 3VA7A 2MZUA 1XQ7A 1M9YA 2HQ6A 1ISTA 1J2AA 2CPLA 3CYHA 5CCRA 1E8KA 5CBUA 3UCHA 2N0TA 5KV4A 1XO7A 3CYSA 3K0OA 1YNDA 1W8MA 2X2DB 3K0PA 1A58A 1W8LA 2P0OA 4XNCA 2B71A 2QERA 5KV1A 5LUDA 2MS4A 5CBVA 3BO7A 1CWFA 1CLHA 4J5DX 4TOTA 1CWIA 1BCKA 1H0PA 1QOIA 2A2NA 2MC9A 3RD9X 2X83B 5CBTA 1VAIA 3R56A 5KUOA 2OK3A 2C3BA 2WFIA 5A0EA 1CWBA 4YUKA 3RCKX 3MMLA 3OPFA 4ZSCA 2X2CK 1A33A 3JB9d 1AK4A 1MIKA 3K0MA 1E3BA 4DGDA 1QNGA 5CCSX 5KV5A 5KUWA 2RS4A 5JHEA 2ALFA 4YUNA 5KUNA 4N1SA 5KUQA 5KURA 4HY7A 2RMCA 4E1QA 1ZKFA 2WFJA 4J5AX 5KUZA 2X7KA 1M9CA 4J59A 4YUMA 2HQJA 1IIPA 1CWKA 1M9FA 3OEPA 2WLWA 3RCIX 1IHGA 4JJMA 4YULA 3RCLA 4YUHA 1AWVA 1DYWA 1V9TA 4DGEA 1AWTA 4DGBA 4FRVA 1AWQA 3R54A 4I9YA 5CBWA 2FU0A 2CFEA 1CWMA 1CWCA 1NMKA 5CCQA 3BKPA 3RDBA 5KUVA 5KV3A 2HE9A 3K0RA 4CYHA 3R4GA 3RDDA 1MF8C 1ZKCA 2BITX 2PHCB 2PLUA 3O7TA 2ESLA 3ODLA 3PMPA 1LOPA 3ICHA 3OREA 4N1PA 1MZWA 2CK1A 1ZMFA 3R49A 4N1QA 2R99A 4O8HA 3RCFA 3RCGA 2RMAA 3MMLB 4J5CX 3RDAX 4YUGA 4YUJA 4J5EX 2OSEA 3EOVA 4J58A 1M9XA 4S1JA 4DGCA 5KUUA 4LQWA 1W8VA 2K7NA 2HAQA 1AWRA 2OJUA 4YUIA 1M9DA 5KV7A 1M9EA 3K0QA 1QNHA 4ZSDA 1FGLA 2GW2A
chains in the Genus database with same CATH superfamily
3PNCA 5CCNA 2AQ0A 2BDUA 1SL1A 2E8OA 2JGAA 4QZEA 9ICIA 4DSEA 5CRXA 3NS1A 5ALWA 3AEVA 2XC9A 2W9CA 3E58A 4TQRA 3NTUA 4EBDA 1U48A 2IOFK 4IRCA 1AWUA 2LKYA 5DLGA 5DG8A 3MGIA 2FE9A 2IBKA 4DL2A 4J03A 5AK6A 4OJ6A 3WK5A 5EE9A 1X7FA 3M9MB 2NRTA 3WK6A 4ECYA 7ICGA 1QH9A 2XICA 1SV0A 3KKAA 1NJXA 4NXZA 4B9VA 2KIVA 3T5KA 1ISTA 5J2EA 3KHGA 1F0MA 4NL9C 3V72A 1XO0A 2WAQF 5AKXA 5ALMA 4GFJA 2UVRA 4M9JA 1TKDA 4KLEA 4NJ8A 1XS9D 2DUYA 1MA7A 3RCKX 2WF9A 1A0PA 4ECUA 2ISPA 1RM6C 5KG6A 3K0MA 4FS2A 3RH6A 4YG2A 4FFDA 4F5QA 2NYVA 2EZXA 1ZJMA 3V6KA 5AKYA 2IOFA 1CWKA 4JJMA 3TADA 1LKYB 1L6NA 4I9YA 5CCQA 5KG5A 2HSZA 2KNJA 4DS4A 3IN5A 3ODLA 8ICQA 8ICEA 2KMDA 3RCGA 4TQSA 1HIWA 4M6WA 1QQ7A 4PZOA 4LZGA 2EAMA 1SL0A 2VA2A 5KUUA 3C5FA 4LQWA 3AU2A 3G6XA 4I27A 2E8PA 4I2IA 3K0QA 3NVYA 5KFFA 4UB3A 2HHTA 1VJ5A 2H3ZA 3RB4A 1L3SA 2IHMA 1N60A 4CGZA 4DS5A 2XCAA 3C2LA 3PY8A 3OTQA 1LVHA 2ZIXA 1JIHA 2X25B 3JPQA 2OH2A 5KV2A 2CMTA 2W8LA 1J2MA 1Q3UA 3D6JA 1UA1A 5KV6A 3WK8A 3QUBA 2P66A 3TFSA 1K5OA 2KA0A 3GIKA 2WF8A 4KLQA 1QTMA 4YXJA 3QU2A 2Y1IA 1PK1B 3H8WA 5KUSA 3IV6A 1RQNA 1NOMA 2GWSA 1Z19A 5CCRA 4KLHA 3L4PA 3CYSA 3K0OA 5FP0A 1ZQMA 1W8MA 3TKAA 3EPIA 2X2DB 2LPEA 5KL1B 5KV1A 7ICNA 1TVAA 2XGQA 3MFHA 1CWIA 1BPEA 4ED0A 2V9WA 4QIWC 3AN1A 2WFIA 1L3TA 4DQPA 4B9SA 3IRUA 2X2CK 1SL2A 4DF8A 4I2HA 1Q8KA 1DXSA 2BKEA 2EDUA 2JV3A 2KN7A 1E3BA 4DGDA 1QNGA 5A0LA 1M6YA 2XGPA 4DFJA 4RQ8A 1KEJA 8ICMA 5KG3A 2QB0A 3UQ2A 5DB8A 3JPRA 3QXGA 1IHGA 1DYWA 3EUB2 4K4HA 3HWTA 2I5HA 7ICOA 4CNQA 8ICKA 1D8LA 4FS1A 1SB3C 2HE9A 3GFKB 4TUPA 1UA0A 1IG6A 5G5GA 3KBBA 1ZMFA 1ZD2P 1AROP 5IILA 2P6RA 1XSLA 1KBUA 5J0XA 4O3SA 1UPHA 5J29A 2AXTU 4ECQA 1M9EA 2LM1A 1FGLA 4RQMA 1UT5A 4I2CA 9ICAA 2KV2A 3SAGA 1DRGA 3AQFA 3FAHA 4QZBA 1F5SA 2W9BB 1ZD4A 5AKKA 4J5BA 1ZQJA 3PX4A 3C29A 1CRXA 1T3QA 3RJEA 3I28A 3KHLA 3TARA 1QSSA 3RJKA 1ZRMA 3X27A 4RT3A 4JK1A 1JRPA 1KFSA 5KG0A 4Q8EA 2IGVA 3QU4A 5ALLA 1DK3A 4QZFA 4DSKA 2KSOA 2Q4TA 5KT3A 1PVPA 3SAFA 1X6JA 4YXMA 1NK4A 5EWGA 3OHBA 5G5HA 1ZQYA 4B6JA 1DOQA 3HP6A 4GXIA 3ALRA 2LHTA 1SV0C 1L3VA 2W03A 4F5NA 2KZ3A 4QZ9A 4C4SA 4YMMA 1Q46A 3BO7A 5KFNA 3SZ2A 1BCKA 1QOIA 3C1YA 2BQ3A 2ZIUB 2A3VA 1PK1A 1WUDA 4UQGA 3BQ0A 3DDHA 4DO9A 4EYHB 7ICTA 2HDOA 2ZIUA 3KHRA 1FEZA 2IMWP 3ZD9A 2FPMA 3KZIU 4YFKA 4DCCA 5KUWA 3PW5A 5KUNA 1T8EA 3QUQA 1P7DA 4ECXA 3RJGA 5CA7A 1ZQPA 2GLEA 4BJQA 1NK0A 4EELA 4YULA 5HP4A 4QZAA 1AWVA 1V9TA 2HBJA 5AI6A 3RB3A 4PHDA 1AQ6A 4YCXA 3Q8RB 3BJYA 2KFZA 5J2AA 3RDDA 2NNZA 2RRDA 4Y2VA 3V7JA 4ECRA 3RCFA 5CBTA 1JUDA 3OPXA 5KFOA 4NLBA 2CN1A 4ECVA 1M9XA 4KLIA 4ED1A 2HI0A 3G6VA 1M9DA 3PO4A 4B9UA 4YUOA 4US9A 5KT7A 2BIUX 4MFCA 2QKQA 9ICFA 4O8IA 2JHDA 2ZJAA 9ICGA 3BZKA 2WF5A 5D4BA 3R57A 4OO1J 1RDFA 2G06A 3H0MB 5EE1A 5DQGA 3JPSA 5KG2A 5ALVA 1V97A 1COOA 3KHHA 3R59A 2MA1A 5AKEA 3UQ0A 1RMHA 4DOCA 4J9RA 2HHQA 2W9AA 1ZETA 2DGZA 4IS7A 5KFBA 2E1EA 2PI4A 3ZDEA 2HBLA 4X5VA 4UAUA 1S5LU 3L3FX 2ESEA 1IM4A 3JPOA 4RQ3A 5J0OA 3VA7A 5EE0A 8ICJA 4DL7A 5CBUA 4HAIA 2N0TA 3H0RB 3ISBA 4EEYA 3CP8A 4KX3A 3UXPA 3VC8A 2OHFA 4M9HA 3N7RC 5KFJA 5D46A 3T5LA 2FMPA 4F4XA 1BPYA 3RD9X 4DLEA 2X83B 3R56A 3V7LA 3B9JA 1XWLA 2HVIA 1U9LA 2EZYA 1KRPA 2BR0A 5CHGA 2DKXA 1BPDA 1Z1BA 1CEZA 4BWJA 5KUQA 2Z7JA 5J0SA 2BGWA 4YN4A 4Y2YA 3BS7A 4RZRA 2JXJA 2NRVA 1TFRA 2KK0A 3UMGA 3T79A 4YUHA 1FO4A 2N1RA 4PHAA 4QWCA 3T3FA 2IA6A 4DGBA 4MHVA 3RDBA 2RLTA 2PMZF 4KN7A 2BITX 3R49A 5EE3A 1ZQGA 2RMAA 3MMLB 3D2QA 2NRZA 5AI9A 5KFVA 3GV8B 5KV7A 5J2IA 3HILA 3TAQA 1OCAA 1S0NA 5KFLA 1OXJA 4K4GA 3ZI4A 4R8UA 1S0MA 5KFKA 3ISDA 2JR5A 3K1ZA 4J9NA 4NLNA 7ICMA 1S0VA 1NNLA 5GTIU 3O0FA 7ICSA 2CYHA 1ZX8A 4Q43A 2RDJA 4QWDA 4EYVA 2W9MA 1B22A 2ZG6A 3SQIA 2K4HA 3MGVA 1ZD5A 4DSFA 5AK5A 2H5XA 1JX4A 2JEGA 3SD7A 3RDCA 2W9BA 3N97B 2MAXA 4PHPA 2Q0ZX 1XQ7A 3NVWA 4LZDA 2ISOA 1ZQUA 7ICIA 2H3QA 3UCHA 3AMZA 1ZQIA 4BXOA 4IQTA 4EX7A 1TAUA 1WYGA 1HJPA 1WWUA 4Y2RA 5KG1A 4Q45A 1LKYA 2O6KA 3MDAA 4BXOB 1Z00B 2XI9A 3EZ5A 1URJA 4M9NA 5J0PA 1A6SA 2C3BA 3QU9A 4YUKA 5HMMA 4C7ZA 4ZSCA 4CRXA 2BZFA 4K4IA 3MR6A 1V9PA 4PH5A 2VKQA 3E0FA 2KKVA 2ALFA 1SXEA 1JMSA 5JRTA 2BHNA 1PUZA 2DPIA 1BNOA 3C1ZA 4UASA 2K60A 2R18A 1ZQZA 8ICUA 3A0HU 4KLDA 4N1PA 5ALNA 4DQRA 4EBEA 2JZBB 4J58A 1OW5A 5ALDA 3SAHA 2AH5A 1MN8A 3KTQA 3PW4A 3BQ1A 3T5JA 2GW2A 1N63A 4UARA 4N1OA 4OJ5A 2EANA 3H4DA 4I2FA 5L1LA 4CCHA 3PW2A 1L7OA 2JH1A 3WU2U 1VBSA 1X40A 4JWNA 3M1YA 5AIAA 4UAYA 4ECSA 1ZQFA 2MVZA 1L8OA 1UQVA 2B0CA 3QYUA 5ALEA 4ED8A 4R3EA 1CWOA 5AI0A 2YB4A 9ICRA 1ZQCA 7ICHA 1C5FA 3N4MB 2JEIA 5HHIA 4PHEA 4RT2A 1SWVA 2KIWA 3M6ZA 5DDYA 5J8YC 5C5JA 4UAZA 4WJ3B 4DL4A 1CI4A 3KOOA 2BQUA 3MGHA 4NY8A 9ICPA 2YQEA 3KZXA 4YMOA 2B71A 3IDWA 3UXOA 2UVVA 2KJ5A 4TOTA 4J9OA 2BCUA 1ZQQA 1VLBA 2ZTDA 1X9XA 5A0EA 2BCRA 7ICJA 2XO7A 3RH4A 1C7YA 3HJEA 2PFPA 4J9QA 8ICHA 1TAMA 1NJYA 5F9LA 2KICA 5J2FA 4FE3A 2DQNB 4KLTA 2DKZA 4Y2SA 2K8AA 4JV2A 5DBAA 4KMOB 1LV5A 2DL0A 4JWMA 1SXDA 1ZRNA 1KFTA 4RNMA 2HOFA 2OYYA 4YD2A 1LOPA 1ZQLA 1MZWA 2AHOB 2BCVA 3RDAX 4F71A 4CF5A 1V85A 5EWFA 5CEHA 4S1JA 4P4MA 4TURA 4PZNA 1W8VA 4YUIA 5D49A 9ICLA 1LB2B 4UAWA 2KHQA 3PX0A 4JCPA 4RQ5A 1VDNA 7ICEA 4M9GA 5ALQA 4A8EA 4RQ0A 2YMPA 2ZXHA 5J2JA 2JMGA 2I1QA 4M9LA 1TK5A 5F66A 3L5KA 1DK2A 9ICKA 1JXEA 2YTUA 1UCVA 3BS5A 4PL1A 4UB1A 3RBEA 4DFKA 2FMQA 4OCZA 2HHWA 1O08A 2YX8A 1Q3VA 5KFWA 3R9KA 4MEYA 3SR6A 2W3RA 1T7PA 1S76D 3SV3A 1T4GA 5KFMA 5DG7A 4F2SA 3RRHA 4DQIA 2NRWA 9ICQA 3N7SC 3RR7A 5IIIA 3SENA 5DGBA 4F50A 5AI5A 7ICRA 4RQ2A 4CDGA 2W55A 3MABA 4PGQA 2GOLA 1K1SA 3IG5A 2XY7A 2DWQA 3OPFA 4KLGA 3JB9d 4C80A 4ECZA 3K1RB 5J0WA 5AKHA 1U49A 2BDPA 4XQ8A 2HVHA 1RYUA 2K89A 9ICJA 5KUZA 5JUMA 1ZQSA 3GILA 5KAIU 3LWLA 3OEPA 3EWAA 4O3NA 3I76A 3SMVA 4PPXA 5L1JA 1H38A 2VJ4A 1NMKA 1S9FA 3CW2C 5AK4A 5KUVA 4CYHA 5DB6A 2AQ4A 1MF8C 4BWMA 3ETLA 3O7TA 3LK9A 1TK0A 2P35A 3C21A 4UBCA 4GXJA 2RQ5A 1JI7A 3HRDD 1RXWA 1ZQVA 5DKWA 3EOVA 1Z00A 4F3OA 3MDCA 1NZBA 4GIBA 5HR6A 4YR0A 2LMRA 2H3FA 2KJ9A 4YMNA 4QW9A 1N5WA 4DF4A 1XNSA 3I1YA 2EH9A 1FFUA 3ZDAA 2H3VA 4Y2TA 1RYSA 2NULA 2HHSA 2M9NA 2PFQA 4YR3A 1N2XA 4R3FA 3K75D 4UB2A 4YUPA 1SGGA 4S1EA 4N1RA 5IIOA 3BT8A 2QB1A 2KFNA 3GIMA 4O3QA 3LWMA 2HCFA 1DGSA 5L1KA 1U47A 3VCBA 2BPCA 4JB3A 1COKA 4J9MA 5HHHA 1ZQEA 1M63C 3T1UA 2JZBA 4TUQA 3M9NB 2HQ6A 5KT6A 2KEYA 4Z6CA 2E1FA 5KT5A 5KTQA 4DSIA 1YNDA 1VDVA 1PK3A 4GC6A 5CP2A 3WK7A 4KLFA 5DLFA 3HPOA 5AIBA 2MS4A 2E3TA 1FIQA 1CWFA 4EZ9A 4C8KA 2HMXA 1F44A 4M2YA 2VA8A 1L7NA 5J0RA 4UB4A 2W43A 2PI5A 5E79U 2HBKA 2ZJ8A 3MFIA 4NLZA 1Z3EB 1RZTA 1ZQXA 5KFSA 3ZDCA 5KURA 4XA5A 4OJLA 4BDPA 4ICAA 5J2HA 2ZUBA 5CWRA 4O3PA 4O5KA 1KDHA 2VA3A 1Z1VA 2FU0A 1K1QA 3BKPA 4NLKA 2KTQA 2PHCB 4ZH4A 3RAQA 4IQUA 3H7IA 3ICHA 4N1QA 4J5CX 4YUGA 1ED1A 3C2KA 4J5EX 2LM4A 4DL5A 4CF4A 8ICCA 1XSNA 3NRZA 4FZLA 3PR5B 4PGYA 3U26A 4EX6A 2W8KA 5AM2A 4RU9A 3BZCA 5B5EU 4FO6A 4PJ0U 2KD1A 2KG5A 1D9DA 4KN4A 5AHXA 4MF8A 3KFUF 3FM9A 3S6JA 5ALGA 3C5GA 3MR2A 2PXIA 4F5PA 1MSWD 2Y1JA 5H2FU 2J6TA 5KFXA 5KFHA 2K4IA 4J9SA 4J9PA 4RQ6A 3ZDBA 3JPNA 3N28A 3K0NA 4KLLA 3CRXA 4M47A 1ZXIA 3T5HA 4DL3A 1S0OA 2KSOB 1M9YA 1C20A 2OM6A 1E8KA 2F3NA 1L5UA 1XO7A 4M04A 1CUKA 5BOLA 1W8LA 3RF9A 2BCQA 2E8NA 1SZHA 4QZGA 1ZQHA 2D8CA 2HBMA 1B43A 2W7OA 4F4WA 2K8BB 4N1SA 3F2BA 1X2IA 4I2GA 5TISU 3QZ7A 3H4BA 2WLWA 3NASA 8ICGA 8ICFA 3DV9A 2CFEA 2Y9UA 2FDRA 4P2HA 4JMUA 3R4GA 2KP7A 2HOQA 4Y2PA 3ICXA 3MBYA 2WFAA 2KVCA 3GU3A 4YP3A 2K7NA 2ASLA 2FLLA 5HNKA 4O9MA 3Q8KA 1HUZA 1QQ6A 4ZSDA 5J2BA 4Y2QA 5AKLA 3EYZA 3JPPA 3PSFA 4F2RA 2RMBA 3ICIA 7ICPA 1XYHA 5AKZA 1ECWA 3M9OB 4DGAA 5DUDA 2AGOA 5J0YA 2MSNA 1JN3A 2XVTA 5DBBA 2HW3A 1S8OA 7ICUA 2F77X 4J9LA 4B9LA 1OUQA 2DBYA 3DEEA 1WCNA 3KD3A 1BPBA 1ZQAA 2W7PA 4I2DA 4ED6A 1CWLA 5J0UA 2XY6A 2ES6A 3WKCA 1QLNA 5CYHA 4DSLA 1ZD3A 1ZQWA 4O5EA 3K0PA 1QQ5A 4IR9A 2YY6A 1A58A 4XNCA 4DFMA 2PFNA 4C8MA 4F93B 2Y0SF 1PZNA 1RPLA 5J2DA 4J5DX 4RQ1A 3ORYA 4GC7A 1RYRA 1CWBA 4RUAA 2Y0SC 1SKSA 1MIKA 1NI3A 2UVUA 3GDXA 5J8YA 5CCSX 1S10A 4I28A 8ICIA 3OJUA 4KMUA 4HYKA 2ZIWB 3QE9Y 4NLCA 4QJFB 1ZQNA 2WFJA 3RH5A 1X9WA 1SZPA 3ISCA 3OJSA 2ZIWA 2C2DA 1WG8A 4FRVA 3BQ7A 5ALOA 3RRGA 5KFPA 3QYPA 5KL8B 3RB6A 5DGAA 5JU5A 2WAQC 4R8UB 1KKXA 3M6KA 4DSJA 1O03A 5KFRA 5J0QA 1XO1A 2EAOA 5C0YA 4KLSA 4OJPA 5KG7A 3B0XA 1Y88A 4N1MA 1X66A 1ZOLA 4UB8U 3RR8A 2C28A 3F2CA 3V7KA 2RP5A 4RPYA 2IGWA 2LBOA 1NK6A 2FLPA 3K4GA 1CWJA 2KZZA 2VJ5A 1SKRA 8ICRA 1ZQ1C 5ALJA 4P0QA 2ZUCA 2YN4A 4MEXA 1TE2A 5AM5A 1T3NA 3D2SA 3RBDA 5IIJA 1J2NA 4KLUA 3HW8A 4QWEA 4Q44A 8ICTA 3H8JA 4OJOA 4DWIA 4KLOA 2G09A 3H40A 4LJXA 4M6WB 2MZUA 2F1IA 3THVA 2CPLA 5DG9A 1JROA 1YT3A 5EWEA 3MR3A 4KTQA 2E5SA 1H0PA 2A19A 4I2EA 2WTFA 1TK8A 4ED7A 1JALA 3MR5A 1NKCA 2R8KA 3FYHA 1D8BA 5KFGA 5L9XA 3B0YA 1A33A 5KT2A 3WK9A 2KVSA 4C8OA 4XRHA 4DLGA 4ELVA 4U6PA 2C2EA 3NVVA 1ZKFA 4TUSA 1ZQBA 1HUOA 3PW7A 4YUMA 1M9FA 3RB0A 1B0XA 4DGEA 1SKWA 2ZTEA 1CWMA 5IINA 2F44A 4NV0A 4P4PA 4JV1A 5KFQA 3J81j 2G5IB 2H3IA 3H8SA 4Q8FA 3SEIA 3QZ8A 4NL9A 2ZTCA 2R99A 2W11A 3SYZA 4YUJA 1T94A 4BUGA 5ALUA 2M0NA 1S77D 1ZQKA 2ZXIA 1ZQRA 1N48A 1BPZA 5CJ7A 4F5RA 4UB5A 3RJFA 2R8IA 5DQHA 2J6SA 2YMLA 3TQ1A 1YZ7A 1NJZA 2YMQA 3TACB 3RFYA 2RDIA 5ALFA 5GTHU 4C8NA 1CWAA 3NUQA 3S6MA 2KOBA 2JH7A 3BS5B 2FI1A 3ONNA 4I2JA 2ZIVA 5KFEA 1KN5A 4FZNA 4DOAA 1Z4OA 2QARA 1U45A 2G0AA 3A0BU 1A77A 2WB1F 3CYHA 3WK4A 1NK9A 4NM2A 3QNMA 4RQ4A 4F8RA 2F76X 4F91B 4RUCA 1IXRA 5HR7A 2AU0A 3KKAC 2NO5A 2K8CB 2MRLA 3NVZA 3FDSA 8ICVA 5AKGA 2QLTA 5ALPA 2F1JA 3OGUA 4ED2A 2BPGA 2DPJA 3NRWA 2JRZA 1NK8A 1QSLA 1BPXA 3AUOA 1AK4A 4LVSA 4Z6DA 2AGQA 2UVWA 5JHEA 4KX5A 3HKZC 5KFUA 1XSPA 3PMLA 5K4LA 5KFIA 8ICNA 4IRDA 4KLJA 3RCIX 3RCLA 3TANA 4XUSA 4QZ8A 3BQTA 3RAXA 1ZQOA 4DQQA 3F5AA 2R8HA 1SWWA 4C4TA 4O8HA 1SV4A 3QU7A 3OSPA 2F1HA 3CYMA 4GXKA 2OJUA 1WCLA 3V6HA 5DDMA 5ALHA 4YR2A 1N56A 2KE7A 4RNOA 4USAA 4YVZA 1KLNA 2ZUDA 2MU2A 1VBTA 1A76A 2XGYB 1SIJA 3BQ2A 4UATA 2C22A 1Z81A 3AQEA 2MUTB 3QEBZ 2V4RA 1TAQA 1X6IA 3F5EA 5KFDA 4EYIB 2RHFA 5F9NA 4FBUA 3NGDA 1L3UA 1KSPA 1W74A 4G9BA 1QCKA 4PGXA 2ATLA 3ETRA 8ICYA 5EOZA 3ZD8A 2ZIXB 2GO7A 4I2AA 2POEA 4IQVA 1QSYA 5ALSA 4F72A 2FJ6A 2C2RA 3QUTA 4O3MA 4CE6A 4AYBC 3V6JA 5ALKA 2G5HB 3HX0A 2F8KA 9ICTA 4Y2UA 2KZMA 3SV4A 5AI8A 2I9GA 2P0OA 2QERA 3GZFA 4QNLA 3IG8A 2A2NA 2MC9A 4ZOHC 5KUOA 4US8A 3N7PD 2QARB 1YZ6A 2ZJ5A 3LYSA 3UMBA 3PZPA 1NKBA 4P0PB 4RNNA 4QWBA 3RFAA 2RS4A 4M0AA 1MC8A 4YUNA 1RXVA 4O3RA 5KG4A 3Q8QB 5CR0A 4J59A 4ACOA 4G3IA 4QZIA 2ALZA 3G6YA 3R54A 2A1JB 5CBWA 4U7CA 3TADC 4NWIA 2HOIA 9ICVA 1PVRA 5IIMA 3K0RA 3F2DA 5J2GA 1B4FA 1X42A 2A1JA 2ESLA 4QZDA 4JV0A 9ICSA 3M7DA 3GV7B 3M8RA 3PSTA 3RJHA 9ICWA 4BGDA 3GIJA 3PX6A 1MQ2A 4R64A 2NV3A 4EENA 3GQCA 5IIKA 4FZMA 2Y9TA 4N1NA 2XIDA 8ICZA 2GH1A 4RPZA 3ODIA 2K4PA 1EXNA 5AI4A 2POYA 4QIWF 3PMNA 3QEAZ 2LYAA 4JUZA 9ICXA 2QB0B 5DBCA 4B9NA 1UT8A 4IQWA 3KOPA 1ZQTA 3LDAA 3QX7A 1KTQA 4ELTA 2IOHA 2NRXA 1XWNA 4F5OA 3WKBA 5KT4A 5KV0A 2OXOA 7ICQA 4IPZA 4IR1A 4EZ6A 1CWHA 2W3SA 4O0IA 1J2AA 4MFAA 4ECTA 3UPQA 4GLXA 4I2BA 2JEFA 4AYBF 4R63A 4QWAA 1J97A 5AM1A 5LUDA 1BGXT 3UXNA 3PO5A 1X9SA 1ZQDA 4C8LA 2R8JA 4P0PA 9ICHA 8ICXA 1KFDA 4DOBA 9ICCA 2OK3A 5BOMA 4UW9A 2I6XA 2F8LA 3MMLA 1L7PA 3EPGA 1NKEA 3PV8A 2K4EA 1RQLA 1NZPA 9ICNA 1NK7A 2L5YA 2KKPA 3PR4A 3LVVA 3PSPA 4IC9A 1Z4NA 5ALZA 2RMCA 4EEKA 5BPCA 4HY7A 4E1QA 1UHUA 2X7KA 2V4QA 2D6FC 2HQJA 1IIPA 4ECWA 4O5CA 2XCPA 1NK5A 4Y2XA 8ICBA 3PVXA 5AKJA 3AU6A 2D3DA 5CB1A 1U4BA 1MQ3A 9ICBA 5JTIA 1RG6A 1ZKCA 2PLUA 3PMPA 3OREA 3ZDDA 2CK1A 2OCEA 2P6UA 3C23A 3PW0A 9ICEA 5KFYA 3GIIA 4UBBA 3E2EA 3LVWA 8ICSA 2VANA 2J6UA 3TAPA 3F53A 5KNIA 5KFCA 4RPXA 3Q8SB 1PVQA 4J9KA 2OWOA 5HMLA 1N61A 2BCSA 2F2AB 5L1IA 4NLGA 3WKDA 4FRUA 4F92B 4B9MA 4YD1A 3C28A 2R8GA 3OHAA 4R66A 4BX9C 1IV8A 3HT3A 2JEJA 1N5XA 1XC9A 3C2MA 2E8MA 1KQQA 4YQWA 2ZP2A 7ICLA 4QZCA 2VIXA 5AK3A 3RJIA 4RQ7A 3Q8PB 2DF4B 2KJ8A 9ICUA 5CBVA 5ALYA 2YB1A 4MFFA 4OD0A 3RJJA 4P4OA 2W04A 4MF2A 1VAIA 4F4ZA 2W54A 4UB6U 3WKEA 4RQNA 2KHVA 4Z6FA 4F4KA 4DEZA 2BPFA 3UM9A 7ICVA 2HHUA 2LI6A 2A1AA 4O3OA 3TFRA 2FPKA 1V38A 3HKZF 2ASJA 5KFTA 3QUCA 2AGPA 4J5AX 2WF6A 1M9CA 3TI0A 1N62A 4C7YA 4C4RA 1JXLA 2W9CB 2EAPA 3D2NA 5ALXA 3EW9A 4DFPA 2ODGA 3ED5A 2B6GA 1S97A 2WF7A 9ICOA 2MUTA 4EBCA 2LYHA 4IRKA 1HEKA 5F3XB 1X9MA 2ASDA 4IL6U 4NM1A 7ICFA 3H8MA 5ALTA 9ICMA 4E0DA 4DGCA 2PKEA 2EQYA 1AWRA 2HAQA 2WB1C 2ZIVB 2FMSA 2LYBA 4ED3A 1L8LA 5DQIA 4ELUA 3JPTA 4DQSA 1GO3F 5J2CA 3Q8LA 3WKAA 1WWVA 1CYNA 1L7MA 2EZZA 3CNHA 8ICPA 2Z6WA 4AP9A 3GV5B 2X2AA 5KULA 4F4YA 5AM4A 2G08A 1KW4A 3Q8MA 3QU5A 4PL2A 4QW8A 2WHEA 1AWSA 2PMZC 5ALIA 4P0QB 5T14A 4UAVA 2CPRA 3RTVA 3K2CA 2HHVA 3IHQB 4QZHA 2G07A 4I29A 5KAFU 2BQRA 1BVSA 2NO4A 2PFOA 1ZJNA 1D9FA 5KV4A 1XU4A 2OEHA 1BNPA 8ICLA 2XY5A 3IM1A 5AKIA 1ZYQA 1KL9A 4Z6EA 2FPLA 1CLHA 2IHNA 3IP4B 2AJQA 8ICOA 4DFDA 4B9TA 4CF3A 4R65A 3MC1A 1DGJA 3PSIA 5KV5A 3BDPA 2CRXA 5AICA 5AM0A 5TZVA 4FBTA 1FFVA 3AM9A 3UMCA 5DB7A 2CXYA 5DB9A 4DL6A 1TV9A 3AL0B 1AWTA 5J2KA 5J0TA 4KLMA 1AWQA 3FC4A 2B21A 5KFAA 1CWCA 5L1MA 3M8SA 1D8YA 5KV3A 8ICWA 1NJWA 4Y2JA 5AM3A 2FLNA 7ICKA 2HHXA 2DFLA 4KITB 3SI8A 8ICAA 3H0LB 2OSEA 4C0ZA 2YMMA 5B66U 3OSNA 5ALRA 5KFZA 1QNHA
chains in the Genus database with same CATH topology
5CCNA 1OCAA 2BDUA 1VBTA 2XGYB 1Z81A 3AQEA 2JGAA 3K1ZA 5CRXA 2KD1A 3F5EA 3O0FA 3KFUF 2CYHA 2RHFA 1W74A 1AWUA 2LKYA 4EYVA 2ZG6A 3SQIA 2K4HA 3MGVA 2K4IA 4OJ6A 1X7FA 3K0NA 3RDCA 2ZIXB 3CRXA 2POEA 2XICA 1XQ7A 1M9YA 2OM6A 1ISTA 2H3QA 1E8KA 3UCHA 4O3MA 1XO7A 4AYBC 2G5HB 1XO0A 1W8LA 2WAQF 2P0OA 2QERA 3RF9A 3GZFA 4QNLA 3IG8A 4GFJA 2XI9A 2A2NA 2MC9A 5KUOA 1SZHA 1URJA 1MA7A 1A6SA 3N7PD 2C3BA 4YUKA 3LYSA 3RCKX 1A0PA 2HBMA 3PZPA 4ZSCA 4CRXA 4P0PB 2W7OA 3RFAA 3K0MA 2K8BB 2VKQA 2RS4A 3E0FA 2KKVA 2ALFA 4YUNA 4N1SA 3F2BA 4J59A 4ACOA 1CWKA 2WLWA 4JJMA 2R18A 1L6NA 4I9YA 3R54A 5CBWA 4U7CA 2CFEA 5CCQA 4NWIA 2HOIA 1PVRA 4JMUA 3K0RA 3F2DA 3R4GA 2KNJA 3IN5A 2ESLA 3ODLA 2HOQA 4N1PA 3RCGA 3M7DA 1HIWA 3ICXA 3PSTA 2KVCA 4J58A 5KUUA 4LQWA 3GU3A 2K7NA 3SAHA 3K0QA 4ZSDA 2NV3A 2GW2A 4FZMA 3PSFA 4N1NA 2XIDA 4N1OA 2H3ZA 2RMBA 3ICIA 4OJ5A 2GH1A 1XYHA 3ODIA 1ECWA 4DGAA 5DUDA 4CGZA 2POYA 4QIWF 2JH1A 2LYAA 2XVTA 1VBSA 2ZIXA 2X25B 2OH2A 2F77X 2CMTA 5KV2A 2MVZA 1OUQA 1Q3UA 5KV6A 3DEEA 3QYUA 1XWNA 4R3EA 1CWOA 2YB4A 2W7PA 5KV0A 2OXOA 1C5FA 4IPZA 1CWLA 5KUSA 5CYHA 1CWHA 2KIWA 3M6ZA 1J2AA 1Z19A 5CCRA 4WJ3B 3CYSA 3K0OA 1W8MA 4AYBF 2X2DB 3K0PA 5KL1B 1A58A 3KZXA 4XNCA 5KV1A 2B71A 5LUDA 2KJ5A 2Y0SF 4J5DX 4TOTA 1CWIA 4P0PA 4QIWC 2OK3A 2WFIA 5A0EA 1CWBA 2F8LA 3MMLA 2Y0SC 2K4EA 2X2CK 1MIKA 1TAMA 1E3BA 4DGDA 1QNGA 5CCSX 2KKPA 2KICA 5A0LA 3LVVA 4FE3A 3PSPA 4IC9A 2DQNB 4HY7A 2RMCA 4E1QA 2ZIWB 4NLCA 2K8AA 4QJFB 2WFJA 2X7KA 2D6FC 2HQJA 1IIPA 4KMOB 1IHGA 2ZIWA 1DYWA 4FRVA 2HOFA 2OYYA 5KL8B 2HE9A 1ZKCA 2PLUA 3PMPA 2WAQC 1LOPA 3OREA 1MZWA 2CK1A 1ZMFA 3M6KA 3RDAX 1KBUA 4S1JA 1W8VA 4YUIA 1UPHA 1M9EA 5C0YA 1FGLA 2KHQA 4JCPA 4OJPA 3LVWA 1VDNA 2KV2A 3SAGA 4N1MA 1DRGA 3F53A 3AQFA 1PVQA 4A8EA 2F2AB 3F2CA 2ZXHA 2RP5A 2IGWA 2JMGA 2LBOA 1CWJA 4FRUA 4J5BA 2VJ5A 5F66A 3C28A 3C29A 1CRXA 1ZQ1C 4PL1A 4P0QA 4BX9C 3D2SA 2YX8A 1Q3VA 2IGVA 4OJOA 2G09A 2Q4TA 1PVPA 3SAFA 2ZP2A 2MZUA 2CPLA 2VIXA 3ALRA 2DF4B 1YT3A 2LHTA 3N7SC 2W03A 2KJ8A 5CBVA 2E5SA 2YB1A 3BO7A 1BCKA 1H0PA 1QOIA 4CDGA 2ZIUB 2W04A 1VAIA 2GOLA 2A3VA 1WUDA 3IG5A 3OPFA 2KHVA 1D8BA 2ZIUA 1A33A 3JB9d 5KUWA 4U6PA 3HKZF 5KUNA 2K89A 1P7DA 1ZKFA 4J5AX 5KUZA 1M9CA 4YUMA 4BJQA 1M9FA 3OEPA 4YULA 3D2NA 1AWVA 1V9TA 4DGEA 2HBJA 3SMVA 2VJ4A 1CWMA 1NMKA 4NV0A 5KUVA 1HEKA 4CYHA 3RDDA 1MF8C 2G5IB 2H3IA 3O7TA 2RRDA 5CBTA 3RCFA 2R99A 3OPXA 4NLBA 4YUJA 1T94A 4BUGA 2CN1A 3EOVA 1M9XA 4DGCA 1AWRA 2HAQA 2M0NA 2WB1C 1NZBA 1M9DA 2ZIVB 2ZXIA 5HR6A 2H3FA 2LYBA 4YUOA 2KJ9A 2BIUX 1GO3F 1XNSA 4O8IA 2JHDA 1CYNA 2H3VA 3R57A 4OO1J 2NULA 2Z6WA 5KULA 2G06A 3H0MB 2X2AA 4R3FA 4YUPA 2G08A 3R59A 4S1EA 3RFYA 2MA1A 4PL2A 1RMHA 4N1RA 3BT8A 1CWAA 3NUQA 3S6MA 1AWSA 2KOBA 2JH7A 2PMZC 4P0QB 2DGZA 5T14A 3ONNA 2CPRA 2ZIVA 2E1EA 3VCBA 3K2CA 2HBLA 4FZNA 1M63C 3T1UA 3L3FX 2G07A 2G0AA 3VA7A 2WB1F 2HQ6A 3CYHA 2KEYA 5CBUA 2E1FA 3H0RB 2N0TA 5KV4A 3CP8A 4KX3A 1YNDA 3VC8A 2F76X 3N7RC 5HR7A 2MS4A 1CWFA 2K8CB 1CLHA 2MRLA 2HMXA 3RD9X 2X83B 3R56A 1F44A 3IP4B 3NRWA 1AK4A 3PSIA 2HBKA 5KV5A 1Z1BA 2CRXA 4KX5A 5JHEA 3HKZC 5KUQA 5KURA 2Z7JA 4OJLA 4ICAA 3RCIX 3RCLA 3T79A 4YUHA 2N1RA 3AL0B 1AWTA 4DGBA 1AWQA 2FU0A 1CWCA 3BKPA 3RDBA 5KV3A 2PMZF 3F5AA 2BITX 2PHCB 3ICHA 4O8HA 3R49A 4N1QA 2RMAA 3MMLB 3D2QA 1ED1A 4J5CX 4YUGA 4J5EX 3H0LB 2OSEA 4C0ZA 3CYMA 2OJUA 5KV7A 1QNHA 4FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCN A;  1OCA A;  4YUO A;  4N1N A;  1VDN A;  2BIU X;  4N1O A;  4N1M A;  2RMB A;  1VBT A;  3ICI A;  2XGY B;  3ODI A;  1XYH A;  4O8I A;  1Z81 A;  1CYN A;  4DGA A;  5DUD A;  3R57 A;  2POY A;  2IGW A;  2NUL A;  1CWJ A;  4FRU A;  4J5B A;  2Z6W A;  5KUL A;  2X2A A;  1VBS A;  5F66 A;  4R3F A;  2CYH A;  4YUP A;  2X25 B;  4JCP A;  5KV2 A;  2CMT A;  2MVZ A;  3R59 A;  1W74 A;  4S1E A;  3RFY A;  5KV6 A;  1RMH A;  4N1R A;  1AWU A;  3BT8 A;  1CWA A;  4EYV A;  3S6M A;  1AWS A;  3QYU A;  1XWN A;  4R3E A;  1CWO A;  2IGV A;  5KV0 A;  3K2C A;  1X7F A;  3K0N A;  1C5F A;  1M63 C;  4IPZ A;  3RDC A;  3T1U A;  2POE A;  1CWL A;  5KUS A;  5CYH A;  2ZP2 A;  1CWH A;  3VA7 A;  2MZU A;  1XQ7 A;  1M9Y A;  2HQ6 A;  1IST A;  1J2A A;  2CPL A;  3CYH A;  5CCR A;  1E8K A;  5CBU A;  3UCH A;  2N0T A;  5KV4 A;  1XO7 A;  3CYS A;  3K0O A;  1YND A;  1W8M A;  2X2D B;  3K0P A;  1A58 A;  1W8L A;  2P0O A;  4XNC A;  2B71 A;  2QER A;  5KV1 A;  5LUD A;  2MS4 A;  5CBV A;  3BO7 A;  1CWF A;  1CLH A;  4J5D X;  4TOT A;  1CWI A;  1BCK A;  1H0P A;  1QOI A;  2A2N A;  2MC9 A;  3RD9 X;  2X83 B;  5CBT A;  1VAI A;  3R56 A;  5KUO A;  2OK3 A;  2C3B A;  2WFI A;  5A0E A;  1CWB A;  4YUK A;  3RCK X;  3MML A;  3OPF A;  4ZSC A;  2X2C K;  1A33 A;  3JB9 d;  1AK4 A;  1MIK A;  3K0M A;  1E3B A;  4DGD A;  1QNG A;  5CCS X;  5KV5 A;  5KUW A;  2RS4 A;  5JHE A;  2ALF A;  4YUN A;  5KUN A;  4N1S A;  5KUQ A;  5KUR A;  4HY7 A;  2RMC A;  4E1Q A;  1ZKF A;  2WFJ A;  4J5A X;  5KUZ A;  2X7K A;  1M9C A;  4J59 A;  4YUM A;  2HQJ A;  1IIP A;  1CWK A;  1M9F A;  3OEP A;  2WLW A;  3RCI X;  1IHG A;  4JJM A;  4YUL A;  3RCL A;  4YUH A;  1AWV A;  1DYW A;  1V9T A;  4DGE A;  1AWT A;  4DGB A;  4FRV A;  1AWQ A;  3R54 A;  4I9Y A;  5CBW A;  2FU0 A;  2CFE A;  1CWM A;  1CWC A;  1NMK A;  5CCQ A;  3BKP A;  3RDB A;  5KUV A;  5KV3 A;  2HE9 A;  3K0R A;  4CYH A;  3R4G A;  3RDD A;  1MF8 C;  1ZKC A;  2BIT X;  2PHC B;  2PLU A;  3O7T A;  2ESL A;  3ODL A;  3PMP A;  1LOP A;  3ICH A;  3ORE A;  4N1P A;  1MZW A;  2CK1 A;  1ZMF A;  3R49 A;  4N1Q A;  2R99 A;  4O8H A;  3RCF A;  3RCG A;  2RMA A;  3MML B;  4J5C X;  3RDA X;  4YUG A;  4YUJ A;  4J5E X;  2OSE A;  3EOV A;  4J58 A;  1M9X A;  4S1J A;  4DGC A;  5KUU A;  4LQW A;  1W8V A;  2K7N A;  2HAQ A;  1AWR A;  2OJU A;  4YUI A;  1M9D A;  5KV7 A;  1M9E A;  3K0Q A;  1QNH A;  4ZSD A;  1FGL A;  2GW2 A; 
#chains in the Genus database with same CATH topology
 3PNC A;  5CCN A;  2AQ0 A;  2BDU A;  1SL1 A;  2E8O A;  2JGA A;  4QZE A;  9ICI A;  4DSE A;  5CRX A;  3NS1 A;  5ALW A;  3AEV A;  2XC9 A;  2W9C A;  3E58 A;  4TQR A;  3NTU A;  4EBD A;  1U48 A;  2IOF K;  4IRC A;  1AWU A;  2LKY A;  5DLG A;  5DG8 A;  3MGI A;  2FE9 A;  2IBK A;  4DL2 A;  4J03 A;  5AK6 A;  4OJ6 A;  3WK5 A;  5EE9 A;  1X7F A;  3M9M B;  2NRT A;  3WK6 A;  4ECY A;  7ICG A;  1QH9 A;  2XIC A;  1SV0 A;  3KKA A;  1NJX A;  4NXZ A;  4B9V A;  2KIV A;  3T5K A;  1IST A;  5J2E A;  3KHG A;  1F0M A;  4NL9 C;  3V72 A;  1XO0 A;  2WAQ F;  5AKX A;  5ALM A;  4GFJ A;  2UVR A;  4M9J A;  1TKD A;  4KLE A;  4NJ8 A;  1XS9 D;  2DUY A;  1MA7 A;  3RCK X;  2WF9 A;  1A0P A;  4ECU A;  2ISP A;  1RM6 C;  5KG6 A;  3K0M A;  4FS2 A;  3RH6 A;  4YG2 A;  4FFD A;  4F5Q A;  2NYV A;  2EZX A;  1ZJM A;  3V6K A;  5AKY A;  2IOF A;  1CWK A;  4JJM A;  3TAD A;  1LKY B;  1L6N A;  4I9Y A;  5CCQ A;  5KG5 A;  2HSZ A;  2KNJ A;  4DS4 A;  3IN5 A;  3ODL A;  8ICQ A;  8ICE A;  2KMD A;  3RCG A;  4TQS A;  1HIW A;  4M6W A;  1QQ7 A;  4PZO A;  4LZG A;  2EAM A;  1SL0 A;  2VA2 A;  5KUU A;  3C5F A;  4LQW A;  3AU2 A;  3G6X A;  4I27 A;  2E8P A;  4I2I A;  3K0Q A;  3NVY A;  5KFF A;  4UB3 A;  2HHT A;  1VJ5 A;  2H3Z A;  3RB4 A;  1L3S A;  2IHM A;  1N60 A;  4CGZ A;  4DS5 A;  2XCA A;  3C2L A;  3PY8 A;  3OTQ A;  1LVH A;  2ZIX A;  1JIH A;  2X25 B;  3JPQ A;  2OH2 A;  5KV2 A;  2CMT A;  2W8L A;  1J2M A;  1Q3U A;  3D6J A;  1UA1 A;  5KV6 A;  3WK8 A;  3QUB A;  2P66 A;  3TFS A;  1K5O A;  2KA0 A;  3GIK A;  2WF8 A;  4KLQ A;  1QTM A;  4YXJ A;  3QU2 A;  2Y1I A;  1PK1 B;  3H8W A;  5KUS A;  3IV6 A;  1RQN A;  1NOM A;  2GWS A;  1Z19 A;  5CCR A;  4KLH A;  3L4P A;  3CYS A;  3K0O A;  5FP0 A;  1ZQM A;  1W8M A;  3TKA A;  3EPI A;  2X2D B;  2LPE A;  5KL1 B;  5KV1 A;  7ICN A;  1TVA A;  2XGQ A;  3MFH A;  1CWI A;  1BPE A;  4ED0 A;  2V9W A;  4QIW C;  3AN1 A;  2WFI A;  1L3T A;  4DQP A;  4B9S A;  3IRU A;  2X2C K;  1SL2 A;  4DF8 A;  4I2H A;  1Q8K A;  1DXS A;  2BKE A;  2EDU A;  2JV3 A;  2KN7 A;  1E3B A;  4DGD A;  1QNG A;  5A0L A;  1M6Y A;  2XGP A;  4DFJ A;  4RQ8 A;  1KEJ A;  8ICM A;  5KG3 A;  2QB0 A;  3UQ2 A;  5DB8 A;  3JPR A;  3QXG A;  1IHG A;  1DYW A;  3EUB 2;  4K4H A;  3HWT A;  2I5H A;  7ICO A;  4CNQ A;  8ICK A;  1D8L A;  4FS1 A;  1SB3 C;  2HE9 A;  3GFK B;  4TUP A;  1UA0 A;  1IG6 A;  5G5G A;  3KBB A;  1ZMF A;  1ZD2 P;  1ARO P;  5IIL A;  2P6R A;  1XSL A;  1KBU A;  5J0X A;  4O3S A;  1UPH A;  5J29 A;  2AXT U;  4ECQ A;  1M9E A;  2LM1 A;  1FGL A;  4RQM A;  1UT5 A;  4I2C A;  9ICA A;  2KV2 A;  3SAG A;  1DRG A;  3AQF A;  3FAH A;  4QZB A;  1F5S A;  2W9B B;  1ZD4 A;  5AKK A;  4J5B A;  1ZQJ A;  3PX4 A;  3C29 A;  1CRX A;  1T3Q A;  3RJE A;  3I28 A;  3KHL A;  3TAR A;  1QSS A;  3RJK A;  1ZRM A;  3X27 A;  4RT3 A;  4JK1 A;  1JRP A;  1KFS A;  5KG0 A;  4Q8E A;  2IGV A;  3QU4 A;  5ALL A;  1DK3 A;  4QZF A;  4DSK A;  2KSO A;  2Q4T A;  5KT3 A;  1PVP A;  3SAF A;  1X6J A;  4YXM A;  1NK4 A;  5EWG A;  3OHB A;  5G5H A;  1ZQY A;  4B6J A;  1DOQ A;  3HP6 A;  4GXI A;  3ALR A;  2LHT A;  1SV0 C;  1L3V A;  2W03 A;  4F5N A;  2KZ3 A;  4QZ9 A;  4C4S A;  4YMM A;  1Q46 A;  3BO7 A;  5KFN A;  3SZ2 A;  1BCK A;  1QOI A;  3C1Y A;  2BQ3 A;  2ZIU B;  2A3V A;  1PK1 A;  1WUD A;  4UQG A;  3BQ0 A;  3DDH A;  4DO9 A;  4EYH B;  7ICT A;  2HDO A;  2ZIU A;  3KHR A;  1FEZ A;  2IMW P;  3ZD9 A;  2FPM A;  3KZI U;  4YFK A;  4DCC A;  5KUW A;  3PW5 A;  5KUN A;  1T8E A;  3QUQ A;  1P7D A;  4ECX A;  3RJG A;  5CA7 A;  1ZQP A;  2GLE A;  4BJQ A;  1NK0 A;  4EEL A;  4YUL A;  5HP4 A;  4QZA A;  1AWV A;  1V9T A;  2HBJ A;  5AI6 A;  3RB3 A;  4PHD A;  1AQ6 A;  4YCX A;  3Q8R B;  3BJY A;  2KFZ A;  5J2A A;  3RDD A;  2NNZ A;  2RRD A;  4Y2V A;  3V7J A;  4ECR A;  3RCF A;  5CBT A;  1JUD A;  3OPX A;  5KFO A;  4NLB A;  2CN1 A;  4ECV A;  1M9X A;  4KLI A;  4ED1 A;  2HI0 A;  3G6V A;  1M9D A;  3PO4 A;  4B9U A;  4YUO A;  4US9 A;  5KT7 A;  2BIU X;  4MFC A;  2QKQ A;  9ICF A;  4O8I A;  2JHD A;  2ZJA A;  9ICG A;  3BZK A;  2WF5 A;  5D4B A;  3R57 A;  4OO1 J;  1RDF A;  2G06 A;  3H0M B;  5EE1 A;  5DQG A;  3JPS A;  5KG2 A;  5ALV A;  1V97 A;  1COO A;  3KHH A;  3R59 A;  2MA1 A;  5AKE A;  3UQ0 A;  1RMH A;  4DOC A;  4J9R A;  2HHQ A;  2W9A A;  1ZET A;  2DGZ A;  4IS7 A;  5KFB A;  2E1E A;  2PI4 A;  3ZDE A;  2HBL A;  4X5V A;  4UAU A;  1S5L U;  3L3F X;  2ESE A;  1IM4 A;  3JPO A;  4RQ3 A;  5J0O A;  3VA7 A;  5EE0 A;  8ICJ A;  4DL7 A;  5CBU A;  4HAI A;  2N0T A;  3H0R B;  3ISB A;  4EEY A;  3CP8 A;  4KX3 A;  3UXP A;  3VC8 A;  2OHF A;  4M9H A;  3N7R C;  5KFJ A;  5D46 A;  3T5L A;  2FMP A;  4F4X A;  1BPY A;  3RD9 X;  4DLE A;  2X83 B;  3R56 A;  3V7L A;  3B9J A;  1XWL A;  2HVI A;  1U9L A;  2EZY A;  1KRP A;  2BR0 A;  5CHG A;  2DKX A;  1BPD A;  1Z1B A;  1CEZ A;  4BWJ A;  5KUQ A;  2Z7J A;  5J0S A;  2BGW A;  4YN4 A;  4Y2Y A;  3BS7 A;  4RZR A;  2JXJ A;  2NRV A;  1TFR A;  2KK0 A;  3UMG A;  3T79 A;  4YUH A;  1FO4 A;  2N1R A;  4PHA A;  4QWC A;  3T3F A;  2IA6 A;  4DGB A;  4MHV A;  3RDB A;  2RLT A;  2PMZ F;  4KN7 A;  2BIT X;  3R49 A;  5EE3 A;  1ZQG A;  2RMA A;  3MML B;  3D2Q A;  2NRZ A;  5AI9 A;  5KFV A;  3GV8 B;  5KV7 A;  5J2I A;  3HIL A;  3TAQ A;  1OCA A;  1S0N A;  5KFL A;  1OXJ A;  4K4G A;  3ZI4 A;  4R8U A;  1S0M A;  5KFK A;  3ISD A;  2JR5 A;  3K1Z A;  4J9N A;  4NLN A;  7ICM A;  1S0V A;  1NNL A;  5GTI U;  3O0F A;  7ICS A;  2CYH A;  1ZX8 A;  4Q43 A;  2RDJ A;  4QWD A;  4EYV A;  2W9M A;  1B22 A;  2ZG6 A;  3SQI A;  2K4H A;  3MGV A;  1ZD5 A;  4DSF A;  5AK5 A;  2H5X A;  1JX4 A;  2JEG A;  3SD7 A;  3RDC A;  2W9B A;  3N97 B;  2MAX A;  4PHP A;  2Q0Z X;  1XQ7 A;  3NVW A;  4LZD A;  2ISO A;  1ZQU A;  7ICI A;  2H3Q A;  3UCH A;  3AMZ A;  1ZQI A;  4BXO A;  4IQT A;  4EX7 A;  1TAU A;  1WYG A;  1HJP A;  1WWU A;  4Y2R A;  5KG1 A;  4Q45 A;  1LKY A;  2O6K A;  3MDA A;  4BXO B;  1Z00 B;  2XI9 A;  3EZ5 A;  1URJ A;  4M9N A;  5J0P A;  1A6S A;  2C3B A;  3QU9 A;  4YUK A;  5HMM A;  4C7Z A;  4ZSC A;  4CRX A;  2BZF A;  4K4I A;  3MR6 A;  1V9P A;  4PH5 A;  2VKQ A;  3E0F A;  2KKV A;  2ALF A;  1SXE A;  1JMS A;  5JRT A;  2BHN A;  1PUZ A;  2DPI A;  1BNO A;  3C1Z A;  4UAS A;  2K60 A;  2R18 A;  1ZQZ A;  8ICU A;  3A0H U;  4KLD A;  4N1P A;  5ALN A;  4DQR A;  4EBE A;  2JZB B;  4J58 A;  1OW5 A;  5ALD A;  3SAH A;  2AH5 A;  1MN8 A;  3KTQ A;  3PW4 A;  3BQ1 A;  3T5J A;  2GW2 A;  1N63 A;  4UAR A;  4N1O A;  4OJ5 A;  2EAN A;  3H4D A;  4I2F A;  5L1L A;  4CCH A;  3PW2 A;  1L7O A;  2JH1 A;  3WU2 U;  1VBS A;  1X40 A;  4JWN A;  3M1Y A;  5AIA A;  4UAY A;  4ECS A;  1ZQF A;  2MVZ A;  1L8O A;  1UQV A;  2B0C A;  3QYU A;  5ALE A;  4ED8 A;  4R3E A;  1CWO A;  5AI0 A;  2YB4 A;  9ICR A;  1ZQC A;  7ICH A;  1C5F A;  3N4M B;  2JEI A;  5HHI A;  4PHE A;  4RT2 A;  1SWV A;  2KIW A;  3M6Z A;  5DDY A;  5J8Y C;  5C5J A;  4UAZ A;  4WJ3 B;  4DL4 A;  1CI4 A;  3KOO A;  2BQU A;  3MGH A;  4NY8 A;  9ICP A;  2YQE A;  3KZX A;  4YMO A;  2B71 A;  3IDW A;  3UXO A;  2UVV A;  2KJ5 A;  4TOT A;  4J9O A;  2BCU A;  1ZQQ A;  1VLB A;  2ZTD A;  1X9X A;  5A0E A;  2BCR A;  7ICJ A;  2XO7 A;  3RH4 A;  1C7Y A;  3HJE A;  2PFP A;  4J9Q A;  8ICH A;  1TAM A;  1NJY A;  5F9L A;  2KIC A;  5J2F A;  4FE3 A;  2DQN B;  4KLT A;  2DKZ A;  4Y2S A;  2K8A A;  4JV2 A;  5DBA A;  4KMO B;  1LV5 A;  2DL0 A;  4JWM A;  1SXD A;  1ZRN A;  1KFT A;  4RNM A;  2HOF A;  2OYY A;  4YD2 A;  1LOP A;  1ZQL A;  1MZW A;  2AHO B;  2BCV A;  3RDA X;  4F71 A;  4CF5 A;  1V85 A;  5EWF A;  5CEH A;  4S1J A;  4P4M A;  4TUR A;  4PZN A;  1W8V A;  4YUI A;  5D49 A;  9ICL A;  1LB2 B;  4UAW A;  2KHQ A;  3PX0 A;  4JCP A;  4RQ5 A;  1VDN A;  7ICE A;  4M9G A;  5ALQ A;  4A8E A;  4RQ0 A;  2YMP A;  2ZXH A;  5J2J A;  2JMG A;  2I1Q A;  4M9L A;  1TK5 A;  5F66 A;  3L5K A;  1DK2 A;  9ICK A;  1JXE A;  2YTU A;  1UCV A;  3BS5 A;  4PL1 A;  4UB1 A;  3RBE A;  4DFK A;  2FMQ A;  4OCZ A;  2HHW A;  1O08 A;  2YX8 A;  1Q3V A;  5KFW A;  3R9K A;  4MEY A;  3SR6 A;  2W3R A;  1T7P A;  1S76 D;  3SV3 A;  1T4G A;  5KFM A;  5DG7 A;  4F2S A;  3RRH A;  4DQI A;  2NRW A;  9ICQ A;  3N7S C;  3RR7 A;  5III A;  3SEN A;  5DGB A;  4F50 A;  5AI5 A;  7ICR A;  4RQ2 A;  4CDG A;  2W55 A;  3MAB A;  4PGQ A;  2GOL A;  1K1S A;  3IG5 A;  2XY7 A;  2DWQ A;  3OPF A;  4KLG A;  3JB9 d;  4C80 A;  4ECZ A;  3K1R B;  5J0W A;  5AKH A;  1U49 A;  2BDP A;  4XQ8 A;  2HVH A;  1RYU A;  2K89 A;  9ICJ A;  5KUZ A;  5JUM A;  1ZQS A;  3GIL A;  5KAI U;  3LWL A;  3OEP A;  3EWA A;  4O3N A;  3I76 A;  3SMV A;  4PPX A;  5L1J A;  1H38 A;  2VJ4 A;  1NMK A;  1S9F A;  3CW2 C;  5AK4 A;  5KUV A;  4CYH A;  5DB6 A;  2AQ4 A;  1MF8 C;  4BWM A;  3ETL A;  3O7T A;  3LK9 A;  1TK0 A;  2P35 A;  3C21 A;  4UBC A;  4GXJ A;  2RQ5 A;  1JI7 A;  3HRD D;  1RXW A;  1ZQV A;  5DKW A;  3EOV A;  1Z00 A;  4F3O A;  3MDC A;  1NZB A;  4GIB A;  5HR6 A;  4YR0 A;  2LMR A;  2H3F A;  2KJ9 A;  4YMN A;  4QW9 A;  1N5W A;  4DF4 A;  1XNS A;  3I1Y A;  2EH9 A;  1FFU A;  3ZDA A;  2H3V A;  4Y2T A;  1RYS A;  2NUL A;  2HHS A;  2M9N A;  2PFQ A;  4YR3 A;  1N2X A;  4R3F A;  3K75 D;  4UB2 A;  4YUP A;  1SGG A;  4S1E A;  4N1R A;  5IIO A;  3BT8 A;  2QB1 A;  2KFN A;  3GIM A;  4O3Q A;  3LWM A;  2HCF A;  1DGS A;  5L1K A;  1U47 A;  3VCB A;  2BPC A;  4JB3 A;  1COK A;  4J9M A;  5HHH A;  1ZQE A;  1M63 C;  3T1U A;  2JZB A;  4TUQ A;  3M9N B;  2HQ6 A;  5KT6 A;  2KEY A;  4Z6C A;  2E1F A;  5KT5 A;  5KTQ A;  4DSI A;  1YND A;  1VDV A;  1PK3 A;  4GC6 A;  5CP2 A;  3WK7 A;  4KLF A;  5DLF A;  3HPO A;  5AIB A;  2MS4 A;  2E3T A;  1FIQ A;  1CWF A;  4EZ9 A;  4C8K A;  2HMX A;  1F44 A;  4M2Y A;  2VA8 A;  1L7N A;  5J0R A;  4UB4 A;  2W43 A;  2PI5 A;  5E79 U;  2HBK A;  2ZJ8 A;  3MFI A;  4NLZ A;  1Z3E B;  1RZT A;  1ZQX A;  5KFS A;  3ZDC A;  5KUR A;  4XA5 A;  4OJL A;  4BDP A;  4ICA A;  5J2H A;  2ZUB A;  5CWR A;  4O3P A;  4O5K A;  1KDH A;  2VA3 A;  1Z1V A;  2FU0 A;  1K1Q A;  3BKP A;  4NLK A;  2KTQ A;  2PHC B;  4ZH4 A;  3RAQ A;  4IQU A;  3H7I A;  3ICH A;  4N1Q A;  4J5C X;  4YUG A;  1ED1 A;  3C2K A;  4J5E X;  2LM4 A;  4DL5 A;  4CF4 A;  8ICC A;  1XSN A;  3NRZ A;  4FZL A;  3PR5 B;  4PGY A;  3U26 A;  4EX6 A;  2W8K A;  5AM2 A;  4RU9 A;  3BZC A;  5B5E U;  4FO6 A;  4PJ0 U;  2KD1 A;  2KG5 A;  1D9D A;  4KN4 A;  5AHX A;  4MF8 A;  3KFU F;  3FM9 A;  3S6J A;  5ALG A;  3C5G A;  3MR2 A;  2PXI A;  4F5P A;  1MSW D;  2Y1J A;  5H2F U;  2J6T A;  5KFX A;  5KFH A;  2K4I A;  4J9S A;  4J9P A;  4RQ6 A;  3ZDB A;  3JPN A;  3N28 A;  3K0N A;  4KLL A;  3CRX A;  4M47 A;  1ZXI A;  3T5H A;  4DL3 A;  1S0O A;  2KSO B;  1M9Y A;  1C20 A;  2OM6 A;  1E8K A;  2F3N A;  1L5U A;  1XO7 A;  4M04 A;  1CUK A;  5BOL A;  1W8L A;  3RF9 A;  2BCQ A;  2E8N A;  1SZH A;  4QZG A;  1ZQH A;  2D8C A;  2HBM A;  1B43 A;  2W7O A;  4F4W A;  2K8B B;  4N1S A;  3F2B A;  1X2I A;  4I2G A;  5TIS U;  3QZ7 A;  3H4B A;  2WLW A;  3NAS A;  8ICG A;  8ICF A;  3DV9 A;  2CFE A;  2Y9U A;  2FDR A;  4P2H A;  4JMU A;  3R4G A;  2KP7 A;  2HOQ A;  4Y2P A;  3ICX A;  3MBY A;  2WFA A;  2KVC A;  3GU3 A;  4YP3 A;  2K7N A;  2ASL A;  2FLL A;  5HNK A;  4O9M A;  3Q8K A;  1HUZ A;  1QQ6 A;  4ZSD A;  5J2B A;  4Y2Q A;  5AKL A;  3EYZ A;  3JPP A;  3PSF A;  4F2R A;  2RMB A;  3ICI A;  7ICP A;  1XYH A;  5AKZ A;  1ECW A;  3M9O B;  4DGA A;  5DUD A;  2AGO A;  5J0Y A;  2MSN A;  1JN3 A;  2XVT A;  5DBB A;  2HW3 A;  1S8O A;  7ICU A;  2F77 X;  4J9L A;  4B9L A;  1OUQ A;  2DBY A;  3DEE A;  1WCN A;  3KD3 A;  1BPB A;  1ZQA A;  2W7P A;  4I2D A;  4ED6 A;  1CWL A;  5J0U A;  2XY6 A;  2ES6 A;  3WKC A;  1QLN A;  5CYH A;  4DSL A;  1ZD3 A;  1ZQW A;  4O5E A;  3K0P A;  1QQ5 A;  4IR9 A;  2YY6 A;  1A58 A;  4XNC A;  4DFM A;  2PFN A;  4C8M A;  4F93 B;  2Y0S F;  1PZN A;  1RPL A;  5J2D A;  4J5D X;  4RQ1 A;  3ORY A;  4GC7 A;  1RYR A;  1CWB A;  4RUA A;  2Y0S C;  1SKS A;  1MIK A;  1NI3 A;  2UVU A;  3GDX A;  5J8Y A;  5CCS X;  1S10 A;  4I28 A;  8ICI A;  3OJU A;  4KMU A;  4HYK A;  2ZIW B;  3QE9 Y;  4NLC A;  4QJF B;  1ZQN A;  2WFJ A;  3RH5 A;  1X9W A;  1SZP A;  3ISC A;  3OJS A;  2ZIW A;  2C2D A;  1WG8 A;  4FRV A;  3BQ7 A;  5ALO A;  3RRG A;  5KFP A;  3QYP A;  5KL8 B;  3RB6 A;  5DGA A;  5JU5 A;  2WAQ C;  4R8U B;  1KKX A;  3M6K A;  4DSJ A;  1O03 A;  5KFR A;  5J0Q A;  1XO1 A;  2EAO A;  5C0Y A;  4KLS A;  4OJP A;  5KG7 A;  3B0X A;  1Y88 A;  4N1M A;  1X66 A;  1ZOL A;  4UB8 U;  3RR8 A;  2C28 A;  3F2C A;  3V7K A;  2RP5 A;  4RPY A;  2IGW A;  2LBO A;  1NK6 A;  2FLP A;  3K4G A;  1CWJ A;  2KZZ A;  2VJ5 A;  1SKR A;  8ICR A;  1ZQ1 C;  5ALJ A;  4P0Q A;  2ZUC A;  2YN4 A;  4MEX A;  1TE2 A;  5AM5 A;  1T3N A;  3D2S A;  3RBD A;  5IIJ A;  1J2N A;  4KLU A;  3HW8 A;  4QWE A;  4Q44 A;  8ICT A;  3H8J A;  4OJO A;  4DWI A;  4KLO A;  2G09 A;  3H40 A;  4LJX A;  4M6W B;  2MZU A;  2F1I A;  3THV A;  2CPL A;  5DG9 A;  1JRO A;  1YT3 A;  5EWE A;  3MR3 A;  4KTQ A;  2E5S A;  1H0P A;  2A19 A;  4I2E A;  2WTF A;  1TK8 A;  4ED7 A;  1JAL A;  3MR5 A;  1NKC A;  2R8K A;  3FYH A;  1D8B A;  5KFG A;  5L9X A;  3B0Y A;  1A33 A;  5KT2 A;  3WK9 A;  2KVS A;  4C8O A;  4XRH A;  4DLG A;  4ELV A;  4U6P A;  2C2E A;  3NVV A;  1ZKF A;  4TUS A;  1ZQB A;  1HUO A;  3PW7 A;  4YUM A;  1M9F A;  3RB0 A;  1B0X A;  4DGE A;  1SKW A;  2ZTE A;  1CWM A;  5IIN A;  2F44 A;  4NV0 A;  4P4P A;  4JV1 A;  5KFQ A;  3J81 j;  2G5I B;  2H3I A;  3H8S A;  4Q8F A;  3SEI A;  3QZ8 A;  4NL9 A;  2ZTC A;  2R99 A;  2W11 A;  3SYZ A;  4YUJ A;  1T94 A;  4BUG A;  5ALU A;  2M0N A;  1S77 D;  1ZQK A;  2ZXI A;  1ZQR A;  1N48 A;  1BPZ A;  5CJ7 A;  4F5R A;  4UB5 A;  3RJF A;  2R8I A;  5DQH A;  2J6S A;  2YML A;  3TQ1 A;  1YZ7 A;  1NJZ A;  2YMQ A;  3TAC B;  3RFY A;  2RDI A;  5ALF A;  5GTH U;  4C8N A;  1CWA A;  3NUQ A;  3S6M A;  2KOB A;  2JH7 A;  3BS5 B;  2FI1 A;  3ONN A;  4I2J A;  2ZIV A;  5KFE A;  1KN5 A;  4FZN A;  4DOA A;  1Z4O A;  2QAR A;  1U45 A;  2G0A A;  3A0B U;  1A77 A;  2WB1 F;  3CYH A;  3WK4 A;  1NK9 A;  4NM2 A;  3QNM A;  4RQ4 A;  4F8R A;  2F76 X;  4F91 B;  4RUC A;  1IXR A;  5HR7 A;  2AU0 A;  3KKA C;  2NO5 A;  2K8C B;  2MRL A;  3NVZ A;  3FDS A;  8ICV A;  5AKG A;  2QLT A;  5ALP A;  2F1J A;  3OGU A;  4ED2 A;  2BPG A;  2DPJ A;  3NRW A;  2JRZ A;  1NK8 A;  1QSL A;  1BPX A;  3AUO A;  1AK4 A;  4LVS A;  4Z6D A;  2AGQ A;  2UVW A;  5JHE A;  4KX5 A;  3HKZ C;  5KFU A;  1XSP A;  3PML A;  5K4L A;  5KFI A;  8ICN A;  4IRD A;  4KLJ A;  3RCI X;  3RCL A;  3TAN A;  4XUS A;  4QZ8 A;  3BQT A;  3RAX A;  1ZQO A;  4DQQ A;  3F5A A;  2R8H A;  1SWW A;  4C4T A;  4O8H A;  1SV4 A;  3QU7 A;  3OSP A;  2F1H A;  3CYM A;  4GXK A;  2OJU A;  1WCL A;  3V6H A;  5DDM A;  5ALH A;  4YR2 A;  1N56 A;  2KE7 A;  4RNO A;  4USA A;  4YVZ A;  1KLN A;  2ZUD A;  2MU2 A;  1VBT A;  1A76 A;  2XGY B;  1SIJ A;  3BQ2 A;  4UAT A;  2C22 A;  1Z81 A;  3AQE A;  2MUT B;  3QEB Z;  2V4R A;  1TAQ A;  1X6I A;  3F5E A;  5KFD A;  4EYI B;  2RHF A;  5F9N A;  4FBU A;  3NGD A;  1L3U A;  1KSP A;  1W74 A;  4G9B A;  1QCK A;  4PGX A;  2ATL A;  3ETR A;  8ICY A;  5EOZ A;  3ZD8 A;  2ZIX B;  2GO7 A;  4I2A A;  2POE A;  4IQV A;  1QSY A;  5ALS A;  4F72 A;  2FJ6 A;  2C2R A;  3QUT A;  4O3M A;  4CE6 A;  4AYB C;  3V6J A;  5ALK A;  2G5H B;  3HX0 A;  2F8K A;  9ICT A;  4Y2U A;  2KZM A;  3SV4 A;  5AI8 A;  2I9G A;  2P0O A;  2QER A;  3GZF A;  4QNL A;  3IG8 A;  2A2N A;  2MC9 A;  4ZOH C;  5KUO A;  4US8 A;  3N7P D;  2QAR B;  1YZ6 A;  2ZJ5 A;  3LYS A;  3UMB A;  3PZP A;  1NKB A;  4P0P B;  4RNN A;  4QWB A;  3RFA A;  2RS4 A;  4M0A A;  1MC8 A;  4YUN A;  1RXV A;  4O3R A;  5KG4 A;  3Q8Q B;  5CR0 A;  4J59 A;  4ACO A;  4G3I A;  4QZI A;  2ALZ A;  3G6Y A;  3R54 A;  2A1J B;  5CBW A;  4U7C A;  3TAD C;  4NWI A;  2HOI A;  9ICV A;  1PVR A;  5IIM A;  3K0R A;  3F2D A;  5J2G A;  1B4F A;  1X42 A;  2A1J A;  2ESL A;  4QZD A;  4JV0 A;  9ICS A;  3M7D A;  3GV7 B;  3M8R A;  3PST A;  3RJH A;  9ICW A;  4BGD A;  3GIJ A;  3PX6 A;  1MQ2 A;  4R64 A;  2NV3 A;  4EEN A;  3GQC A;  5IIK A;  4FZM A;  2Y9T A;  4N1N A;  2XID A;  8ICZ A;  2GH1 A;  4RPZ A;  3ODI A;  2K4P A;  1EXN A;  5AI4 A;  2POY A;  4QIW F;  3PMN A;  3QEA Z;  2LYA A;  4JUZ A;  9ICX A;  2QB0 B;  5DBC A;  4B9N A;  1UT8 A;  4IQW A;  3KOP A;  1ZQT A;  3LDA A;  3QX7 A;  1KTQ A;  4ELT A;  2IOH A;  2NRX A;  1XWN A;  4F5O A;  3WKB A;  5KT4 A;  5KV0 A;  2OXO A;  7ICQ A;  4IPZ A;  4IR1 A;  4EZ6 A;  1CWH A;  2W3S A;  4O0I A;  1J2A A;  4MFA A;  4ECT A;  3UPQ A;  4GLX A;  4I2B A;  2JEF A;  4AYB F;  4R63 A;  4QWA A;  1J97 A;  5AM1 A;  5LUD A;  1BGX T;  3UXN A;  3PO5 A;  1X9S A;  1ZQD A;  4C8L A;  2R8J A;  4P0P A;  9ICH A;  8ICX A;  1KFD A;  4DOB A;  9ICC A;  2OK3 A;  5BOM A;  4UW9 A;  2I6X A;  2F8L A;  3MML A;  1L7P A;  3EPG A;  1NKE A;  3PV8 A;  2K4E A;  1RQL A;  1NZP A;  9ICN A;  1NK7 A;  2L5Y A;  2KKP A;  3PR4 A;  3LVV A;  3PSP A;  4IC9 A;  1Z4N A;  5ALZ A;  2RMC A;  4EEK A;  5BPC A;  4HY7 A;  4E1Q A;  1UHU A;  2X7K A;  2V4Q A;  2D6F C;  2HQJ A;  1IIP A;  4ECW A;  4O5C A;  2XCP A;  1NK5 A;  4Y2X A;  8ICB A;  3PVX A;  5AKJ A;  3AU6 A;  2D3D A;  5CB1 A;  1U4B A;  1MQ3 A;  9ICB A;  5JTI A;  1RG6 A;  1ZKC A;  2PLU A;  3PMP A;  3ORE A;  3ZDD A;  2CK1 A;  2OCE A;  2P6U A;  3C23 A;  3PW0 A;  9ICE A;  5KFY A;  3GII A;  4UBB A;  3E2E A;  3LVW A;  8ICS A;  2VAN A;  2J6U A;  3TAP A;  3F53 A;  5KNI A;  5KFC A;  4RPX A;  3Q8S B;  1PVQ A;  4J9K A;  2OWO A;  5HML A;  1N61 A;  2BCS A;  2F2A B;  5L1I A;  4NLG A;  3WKD A;  4FRU A;  4F92 B;  4B9M A;  4YD1 A;  3C28 A;  2R8G A;  3OHA A;  4R66 A;  4BX9 C;  1IV8 A;  3HT3 A;  2JEJ A;  1N5X A;  1XC9 A;  3C2M A;  2E8M A;  1KQQ A;  4YQW A;  2ZP2 A;  7ICL A;  4QZC A;  2VIX A;  5AK3 A;  3RJI A;  4RQ7 A;  3Q8P B;  2DF4 B;  2KJ8 A;  9ICU A;  5CBV A;  5ALY A;  2YB1 A;  4MFF A;  4OD0 A;  3RJJ A;  4P4O A;  2W04 A;  4MF2 A;  1VAI A;  4F4Z A;  2W54 A;  4UB6 U;  3WKE A;  4RQN A;  2KHV A;  4Z6F A;  4F4K A;  4DEZ A;  2BPF A;  3UM9 A;  7ICV A;  2HHU A;  2LI6 A;  2A1A A;  4O3O A;  3TFR A;  2FPK A;  1V38 A;  3HKZ F;  2ASJ A;  5KFT A;  3QUC A;  2AGP A;  4J5A X;  2WF6 A;  1M9C A;  3TI0 A;  1N62 A;  4C7Y A;  4C4R A;  1JXL A;  2W9C B;  2EAP A;  3D2N A;  5ALX A;  3EW9 A;  4DFP A;  2ODG A;  3ED5 A;  2B6G A;  1S97 A;  2WF7 A;  9ICO A;  2MUT A;  4EBC A;  2LYH A;  4IRK A;  1HEK A;  5F3X B;  1X9M A;  2ASD A;  4IL6 U;  4NM1 A;  7ICF A;  3H8M A;  5ALT A;  9ICM A;  4E0D A;  4DGC A;  2PKE A;  2EQY A;  1AWR A;  2HAQ A;  2WB1 C;  2ZIV B;  2FMS A;  2LYB A;  4ED3 A;  1L8L A;  5DQI A;  4ELU A;  3JPT A;  4DQS A;  1GO3 F;  5J2C A;  3Q8L A;  3WKA A;  1WWV A;  1CYN A;  1L7M A;  2EZZ A;  3CNH A;  8ICP A;  2Z6W A;  4AP9 A;  3GV5 B;  2X2A A;  5KUL A;  4F4Y A;  5AM4 A;  2G08 A;  1KW4 A;  3Q8M A;  3QU5 A;  4PL2 A;  4QW8 A;  2WHE A;  1AWS A;  2PMZ C;  5ALI A;  4P0Q B;  5T14 A;  4UAV A;  2CPR A;  3RTV A;  3K2C A;  2HHV A;  3IHQ B;  4QZH A;  2G07 A;  4I29 A;  5KAF U;  2BQR A;  1BVS A;  2NO4 A;  2PFO A;  1ZJN A;  1D9F A;  5KV4 A;  1XU4 A;  2OEH A;  1BNP A;  8ICL A;  2XY5 A;  3IM1 A;  5AKI A;  1ZYQ A;  1KL9 A;  4Z6E A;  2FPL A;  1CLH A;  2IHN A;  3IP4 B;  2AJQ A;  8ICO A;  4DFD A;  4B9T A;  4CF3 A;  4R65 A;  3MC1 A;  1DGJ A;  3PSI A;  5KV5 A;  3BDP A;  2CRX A;  5AIC A;  5AM0 A;  5TZV A;  4FBT A;  1FFV A;  3AM9 A;  3UMC A;  5DB7 A;  2CXY A;  5DB9 A;  4DL6 A;  1TV9 A;  3AL0 B;  1AWT A;  5J2K A;  5J0T A;  4KLM A;  1AWQ A;  3FC4 A;  2B21 A;  5KFA A;  1CWC A;  5L1M A;  3M8S A;  1D8Y A;  5KV3 A;  8ICW A;  1NJW A;  4Y2J A;  5AM3 A;  2FLN A;  7ICK A;  2HHX A;  2DFL A;  4KIT B;  3SI8 A;  8ICA A;  3H0L B;  2OSE A;  4C0Z A;  2YMM A;  5B66 U;  3OSN A;  5ALR A;  5KFZ A;  1QNH A; 
#chains in the Genus database with same CATH homology
 5CCN A;  1OCA A;  2BDU A;  1VBT A;  2XGY B;  1Z81 A;  3AQE A;  2JGA A;  3K1Z A;  5CRX A;  2KD1 A;  3F5E A;  3O0F A;  3KFU F;  2CYH A;  2RHF A;  1W74 A;  1AWU A;  2LKY A;  4EYV A;  2ZG6 A;  3SQI A;  2K4H A;  3MGV A;  2K4I A;  4OJ6 A;  1X7F A;  3K0N A;  3RDC A;  2ZIX B;  3CRX A;  2POE A;  2XIC A;  1XQ7 A;  1M9Y A;  2OM6 A;  1IST A;  2H3Q A;  1E8K A;  3UCH A;  4O3M A;  1XO7 A;  4AYB C;  2G5H B;  1XO0 A;  1W8L A;  2WAQ F;  2P0O A;  2QER A;  3RF9 A;  3GZF A;  4QNL A;  3IG8 A;  4GFJ A;  2XI9 A;  2A2N A;  2MC9 A;  5KUO A;  1SZH A;  1URJ A;  1MA7 A;  1A6S A;  3N7P D;  2C3B A;  4YUK A;  3LYS A;  3RCK X;  1A0P A;  2HBM A;  3PZP A;  4ZSC A;  4CRX A;  4P0P B;  2W7O A;  3RFA A;  3K0M A;  2K8B B;  2VKQ A;  2RS4 A;  3E0F A;  2KKV A;  2ALF A;  4YUN A;  4N1S A;  3F2B A;  4J59 A;  4ACO A;  1CWK A;  2WLW A;  4JJM A;  2R18 A;  1L6N A;  4I9Y A;  3R54 A;  5CBW A;  4U7C A;  2CFE A;  5CCQ A;  4NWI A;  2HOI A;  1PVR A;  4JMU A;  3K0R A;  3F2D A;  3R4G A;  2KNJ A;  3IN5 A;  2ESL A;  3ODL A;  2HOQ A;  4N1P A;  3RCG A;  3M7D A;  1HIW A;  3ICX A;  3PST A;  2KVC A;  4J58 A;  5KUU A;  4LQW A;  3GU3 A;  2K7N A;  3SAH A;  3K0Q A;  4ZSD A;  2NV3 A;  2GW2 A;  4FZM A;  3PSF A;  4N1N A;  2XID A;  4N1O A;  2H3Z A;  2RMB A;  3ICI A;  4OJ5 A;  2GH1 A;  1XYH A;  3ODI A;  1ECW A;  4DGA A;  5DUD A;  4CGZ A;  2POY A;  4QIW F;  2JH1 A;  2LYA A;  2XVT A;  1VBS A;  2ZIX A;  2X25 B;  2OH2 A;  2F77 X;  2CMT A;  5KV2 A;  2MVZ A;  1OUQ A;  1Q3U A;  5KV6 A;  3DEE A;  3QYU A;  1XWN A;  4R3E A;  1CWO A;  2YB4 A;  2W7P A;  5KV0 A;  2OXO A;  1C5F A;  4IPZ A;  1CWL A;  5KUS A;  5CYH A;  1CWH A;  2KIW A;  3M6Z A;  1J2A A;  1Z19 A;  5CCR A;  4WJ3 B;  3CYS A;  3K0O A;  1W8M A;  4AYB F;  2X2D B;  3K0P A;  5KL1 B;  1A58 A;  3KZX A;  4XNC A;  5KV1 A;  2B71 A;  5LUD A;  2KJ5 A;  2Y0S F;  4J5D X;  4TOT A;  1CWI A;  4P0P A;  4QIW C;  2OK3 A;  2WFI A;  5A0E A;  1CWB A;  2F8L A;  3MML A;  2Y0S C;  2K4E A;  2X2C K;  1MIK A;  1TAM A;  1E3B A;  4DGD A;  1QNG A;  5CCS X;  2KKP A;  2KIC A;  5A0L A;  3LVV A;  4FE3 A;  3PSP A;  4IC9 A;  2DQN B;  4HY7 A;  2RMC A;  4E1Q A;  2ZIW B;  4NLC A;  2K8A A;  4QJF B;  2WFJ A;  2X7K A;  2D6F C;  2HQJ A;  1IIP A;  4KMO B;  1IHG A;  2ZIW A;  1DYW A;  4FRV A;  2HOF A;  2OYY A;  5KL8 B;  2HE9 A;  1ZKC A;  2PLU A;  3PMP A;  2WAQ C;  1LOP A;  3ORE A;  1MZW A;  2CK1 A;  1ZMF A;  3M6K A;  3RDA X;  1KBU A;  4S1J A;  1W8V A;  4YUI A;  1UPH A;  1M9E A;  5C0Y A;  1FGL A;  2KHQ A;  4JCP A;  4OJP A;  3LVW A;  1VDN A;  2KV2 A;  3SAG A;  4N1M A;  1DRG A;  3F53 A;  3AQF A;  1PVQ A;  4A8E A;  2F2A B;  3F2C A;  2ZXH A;  2RP5 A;  2IGW A;  2JMG A;  2LBO A;  1CWJ A;  4FRU A;  4J5B A;  2VJ5 A;  5F66 A;  3C28 A;  3C29 A;  1CRX A;  1ZQ1 C;  4PL1 A;  4P0Q A;  4BX9 C;  3D2S A;  2YX8 A;  1Q3V A;  2IGV A;  4OJO A;  2G09 A;  2Q4T A;  1PVP A;  3SAF A;  2ZP2 A;  2MZU A;  2CPL A;  2VIX A;  3ALR A;  2DF4 B;  1YT3 A;  2LHT A;  3N7S C;  2W03 A;  2KJ8 A;  5CBV A;  2E5S A;  2YB1 A;  3BO7 A;  1BCK A;  1H0P A;  1QOI A;  4CDG A;  2ZIU B;  2W04 A;  1VAI A;  2GOL A;  2A3V A;  1WUD A;  3IG5 A;  3OPF A;  2KHV A;  1D8B A;  2ZIU A;  1A33 A;  3JB9 d;  5KUW A;  4U6P A;  3HKZ F;  5KUN A;  2K89 A;  1P7D A;  1ZKF A;  4J5A X;  5KUZ A;  1M9C A;  4YUM A;  4BJQ A;  1M9F A;  3OEP A;  4YUL A;  3D2N A;  1AWV A;  1V9T A;  4DGE A;  2HBJ A;  3SMV A;  2VJ4 A;  1CWM A;  1NMK A;  4NV0 A;  5KUV A;  1HEK A;  4CYH A;  3RDD A;  1MF8 C;  2G5I B;  2H3I A;  3O7T A;  2RRD A;  5CBT A;  3RCF A;  2R99 A;  3OPX A;  4NLB A;  4YUJ A;  1T94 A;  4BUG A;  2CN1 A;  3EOV A;  1M9X A;  4DGC A;  1AWR A;  2HAQ A;  2M0N A;  2WB1 C;  1NZB A;  1M9D A;  2ZIV B;  2ZXI A;  5HR6 A;  2H3F A;  2LYB A;  4YUO A;  2KJ9 A;  2BIU X;  1GO3 F;  1XNS A;  4O8I A;  2JHD A;  1CYN A;  2H3V A;  3R57 A;  4OO1 J;  2NUL A;  2Z6W A;  5KUL A;  2G06 A;  3H0M B;  2X2A A;  4R3F A;  4YUP A;  2G08 A;  3R59 A;  4S1E A;  3RFY A;  2MA1 A;  4PL2 A;  1RMH A;  4N1R A;  3BT8 A;  1CWA A;  3NUQ A;  3S6M A;  1AWS A;  2KOB A;  2JH7 A;  2PMZ C;  4P0Q B;  2DGZ A;  5T14 A;  3ONN A;  2CPR A;  2ZIV A;  2E1E A;  3VCB A;  3K2C A;  2HBL A;  4FZN A;  1M63 C;  3T1U A;  3L3F X;  2G07 A;  2G0A A;  3VA7 A;  2WB1 F;  2HQ6 A;  3CYH A;  2KEY A;  5CBU A;  2E1F A;  3H0R B;  2N0T A;  5KV4 A;  3CP8 A;  4KX3 A;  1YND A;  3VC8 A;  2F76 X;  3N7R C;  5HR7 A;  2MS4 A;  1CWF A;  2K8C B;  1CLH A;  2MRL A;  2HMX A;  3RD9 X;  2X83 B;  3R56 A;  1F44 A;  3IP4 B;  3NRW A;  1AK4 A;  3PSI A;  2HBK A;  5KV5 A;  1Z1B A;  2CRX A;  4KX5 A;  5JHE A;  3HKZ C;  5KUQ A;  5KUR A;  2Z7J A;  4OJL A;  4ICA A;  3RCI X;  3RCL A;  3T79 A;  4YUH A;  2N1R A;  3AL0 B;  1AWT A;  4DGB A;  1AWQ A;  2FU0 A;  1CWC A;  3BKP A;  3RDB A;  5KV3 A;  2PMZ F;  3F5A A;  2BIT X;  2PHC B;  3ICH A;  4O8H A;  3R49 A;  4N1Q A;  2RMA A;  3MML B;  3D2Q A;  1ED1 A;  4J5C X;  4YUG A;  4J5E X;  3H0L B;  2OSE A;  4C0Z A;  3CYM A;  2OJU A;  5KV7 A;  1QNH A;  4FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...