1IIPA

Bovine cyclophilin 40, tetragonal form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
297
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Cyclophilin 40
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
total genus 102
structure length 297
sequence length 297
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.160 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1iipA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1iipA01
1M9DA 2WFIA 5KV3A 4YUIA 2CPLA 1CWHA 5JHEA 1AWQA 3OREA 1VAIA 5CCQA 3OEPA 1A33A 1LOPA 3ICIA 1M9EA 2RMCA 4DGBA 2C3BA 3CYHA 4R3FA 2X7KA 2R99A 1IHGA 1C5FA 1E3BA 3OPFA 5KUSA 1CLHA 4N1OA 1IIPA 4DGDA 1M9YA 4J5CX 1V9TA 3RCLA 3K0MA 4XNCA 2CFEA 3RCKX 3RDBA 2HQ6A 2X2AA 2HE9A 4N1PA 4YUOA 4YUHA 1MIKA 4J5AX 1X7FA 2WLWA 4E1QA 1ISTA 2X2CK 4IPZA 3K0NA 3RDAX 1AWVA 3BO7A 2PLUA 4ZSCA 2IGWA 1W8LA 1W74A 1RMHA 5KV6A 1BCKA 4S1JA 1VDNA 1ZKFA 1XYHA 4YUNA 5CBTA 3JB9d 5KULA 1NMKA 4YUPA 1J2AA 4N1QA 3K0RA 3RCFA 1AWTA 1FGLA 2HQJA 4J58A 4J5EX 2XGYB 3BKPA 1M63C 1ZMFA 1QNHA 5KV4A 4DGCA 4HY7A 5KUNA 4DGEA 5KV0A 2QERA 2P0OA 4R3EA 5KV1A 4N1NA 3EOVA 1QOIA 5KUUA 5CCRA 5LUDA 5KV7A 2HAQA 2POYA 2OK3A 3MMLB 1VBSA 4J5BA 4YUJA 3T1UA 3CYSA 5A0EA 2BIUX 2RMAA 1MZWA 2ZP2A 4O8HA 4S1EA 4DGAA 2X25B 1CWMA 2NULA 3QYUA 5CCSX 1M9CA 2A2NA 3K2CA 4JCPA 3BT8A 5KUZA 1XO7A 3ODLA 2CMTA 1Z81A 2CYHA 5KV2A 4YULA 3RD9X 5KUVA 3RDDA 5CBWA 4LQWA 4FRVA 2CK1A 2ESLA 4YUGA 1CWKA 4O8IA 4ZSDA 4YUKA 2RMBA 2WFJA 1CWFA 2OJUA 1A58A 1CWCA 4N1SA 1VBTA 3K0QA 5KUWA 3ICHA 5CYHA 5F66A 4J5DX 5CBUA 1DYWA 1M9XA 2ALFA 2POEA 1ZKCA 1CWLA 2K7NA 2GW2A 2N0TA 1AWRA 1YNDA 2PHCB 3RDCA 1CYNA 3PMPA 1XWNA 3VA7A 3R49A 3RCIX 4EYVA 1OCAA 1XQ7A 5KUOA 2MZUA 1W8MA 3O7TA 3S6MA 1CWIA 2FU0A 2MS4A 1H0PA 3K0PA 3RCGA 3R56A 4N1RA 4CYHA 2BITX 2RS4A 3R54A 3ODIA 3R57A 2B71A 4N1MA 4TOTA 2IGVA 3MMLA 1AK4A 1MF8C 3UCHA 1W8VA 4FRUA 1CWOA 2X83B 2MC9A 5KURA 4YUMA 1CWAA 1QNGA 2MVZA 1AWSA 4I9YA 1M9FA 2OSEA 2X2DB 3RFYA 2Z6WA 3K0OA 5DUDA 5CBVA 1E8KA 1CWBA 4J59A 1AWUA 3R4GA 4JJMA 5CCNA 1CWJA 5KUQA 5KV5A 3R59A
chains in the Genus database with same CATH superfamily
2KHVA 3F53A 4ACOA 4G9BA 1SKSA 3EWAA 4Y2UA 2MA1A 2AQ4A 1O03A 3NRZA 5J0OA 3QE9Y 1ZX8A 3PMLA 5DG9A 3QZ8A 5E79U 2X2AA 2KSOB 3D6JA 5J2FA 2A1JB 3UMCA 1AWVA 4M04A 4ELTA 5J8YA 2NRVA 5CBTA 1AROP 4O0IA 9ICBA 3VCBA 1NMKA 5KULA 2E1FA 2KZ3A 4J9OA 4RQ2A 5KV4A 1PK3A 4ED7A 2KHQA 5KG4A 4KLHA 2LMRA 4M6WB 5DQIA 4TQSA 5AIBA 3BDPA 3X27A 2F1JA 5HNKA 5BPCA 3ETLA 1X9MA 3I1YA 3IHQB 3THVA 1CWKA 2GO7A 9ICEA 3PR4A 2EDUA 4R66A 4RQ0A 2N0TA 1J97A 1JALA 1Z4NA 5DGBA 1JRPA 4ECZA 5KFAA 1OUQA 4DEZA 5ALJA 1W8MA 4RPXA 2MS4A 1DGSA 3HRDD 2J6SA 3KZIU 1H38A 2BITX 5KFYA 3R57A 1ZJNA 2IGVA 1ED1A 4QZ8A 5J0SA 2W11A 2PKEA 4CE6A 3M6KA 5KURA 2VA3A 5J0XA 8ICZA 3N28A 1KQQA 4ICAA 2PFQA 2JXJA 2ZUDA 2ZG6A 3L4PA 4B9NA 1M9DA 4NL9C 5AM0A 1SWWA 1QLNA 3OREA 1VJ5A 4C8LA 3ICIA 4DGBA 1RM6C 3WK5A 4QJFB 2R18A 5AKHA 2AHOB 1KN5A 3PSIA 2HQ6A 9ICCA 1ZOLA 5KNIA 1KKXA 4TUPA 1X7FA 2PFNA 3QEBZ 2MAXA 1U45A 5J0WA 4M2YA 4IPZA 3RDAX 3WKBA 4JV1A 5DB6A 2H5XA 2RDJA 5H2FU 2K60A 1ZMFA 5KFMA 5KFLA 4Y2SA 2D6FC 2W8LA 4DGEA 1NKEA 3T79A 1COOA 5CR0A 3N97B 1VBSA 2KIVA 4UBCA 3F2CA 4O8HA 3RF9A 9ICXA 1VLBA 1WG8A 2KTQA 2BR0A 4K4GA 3QEAZ 1D9FA 5ALXA 5J2GA 2OH2A 2CYHA 5AM5A 1HJPA 2KN7A 4YULA 4JV0A 2HHTA 2YMLA 4Y2JA 2BKEA 4FZNA 5EE0A 2OYYA 8ICGA 9ICUA 4PJ0U 2PHCB 2XY7A 7ICJA 4UQGA 1FIQA 4EYVA 2C2EA 8ICXA 1WYGA 2UVRA 1S76D 4IRCA 5F3XB 4N1MA 4RQ6A 2W9BB 2ASJA 2KFZA 2HHVA 1MF8C 3QXGA 3WK6A 2MC9A 1UA0A 2HVHA 2W04A 2W9CA 2K4IA 5KAIU 1Z00A 4ECVA 2YQEA 3ZDDA 4KMOB 5ALFA 5AKZA 2Z6WA 5CBVA 2HOFA 2QKQA 3R4GA 4R8UA 2QARA 3PSPA 1XWLA 2VA2A 1NKCA 4IR9A 5KFOA 3AMZA 2PI5A 1CWHA 2G08A 3RJHA 3OEPA 3EYZA 3SI8A 2ZJ5A 3IV6A 3HWTA 5AM1A 4C8KA 5BOMA 3MDAA 1T94A 2PFOA 3B0YA 4KN4A 4QZIA 2KFNA 3HPOA 4XNCA 8ICKA 4EYIB 1HUOA 5ALVA 3NASA 2IBKA 1XU4A 3V6HA 1S97A 3BO7A 1IV8A 3LVVA 1LKYB 1J2NA 4KITB 9ICQA 2V9WA 4F5QA 1ZJMA 4J9QA 1TV9A 4KLGA 4BX9C 4KLTA 3K0RA 2M9NA 5J29A 4ECTA 1X9SA 1TFRA 1NNLA 4F92B 3HX0A 3PX0A 4CF4A 5J2EA 1KBUA 5A0EA 5J0RA 3OTQA 7ICIA 5ALEA 2UVWA 3ONNA 5DQHA 5KFSA 1X42A 3T5KA 1ZQIA 3MC1A 4NLCA 4YMMA 4YUGA 2FE9A 5IIJA 5J0TA 1A58A 2W43A 4US8A 3ZDAA 4NLGA 1TAMA 5CBUA 3K4GA 2ALFA 4PL2A 1ZKCA 1ZQUA 3RJKA 1NJZA 8ICSA 3S6MA 2H3QA 1JN3A 3WKAA 4O9MA 4YXMA 4F8RA 2E1EA 4F2RA 1CWAA 3RRHA 1RYRA 1KFTA 2ZIUA 2WF8A 2LBOA 5JTIA 3CW2C 5ALUA 2R8IA 3AU2A 5ALHA 3K1RB 4KLFA 3UMBA 5KTQA 1DRGA 3HILA 3Q8MA 4DFMA 3RJJA 1JUDA 2E8OA 3LVWA 2OM6A 4BJQA 2X7KA 3M6ZA 5ALYA 3WK9A 1Q46A 3LYSA 4ZH4A 2BHNA 1XSNA 5KFPA 3RDBA 4M9HA 7ICOA 4QZ9A 3CRXA 7ICNA 4N1PA 1NI3A 4YUOA 1SV0C 4E1QA 1BPDA 9ICRA 4O3OA 3PZPA 2K8AA 3QU5A 1ZQYA 2B21A 4B9TA 4S1JA 2JHDA 3WK7A 3KOPA 5KT6A 2BPCA 4OJOA 5KFCA 4J9SA 1J2AA 1UPHA 5DB7A 4O3NA 1KDHA 2EAMA 4YVZA 4EBEA 4J5EX 3E58A 2FLPA 8ICLA 2WAQF 4B9VA 5CB1A 5KV0A 1ZQQA 1BGXT 1L5UA 4RT2A 5TISU 1KSPA 1S0VA 2WB1C 4QWBA 1ZQBA 5ALWA 4DL2A 4UB3A 3EOVA 2NRWA 2C2RA 4M9JA 2P35A 3SR6A 4QW8A 5KL1B 5JUMA 4EYHB 3RFAA 3I76A 5G5HA 1PK1B 2ZTCA 4CF3A 3MGIA 4OJLA 1IXRA 2K4HA 4UB2A 1SL2A 2H3FA 2VKQA 5EWEA 9ICFA 3M9NB 4YCXA 3E0FA 4O3MA 2YMQA 4P2HA 5AK5A 3OPXA 4P0PA 2QLTA 3PMPA 3SD7A 5KAFU 4OO1J 3C2KA 4FS2A 5LUDA 2V4QA 3TADA 3KFUF 2P66A 1H0PA 1SKRA 1XO1A 4PHAA 4Q8EA 4Q44A 4JV2A 2O6KA 3FAHA 4I2GA 3QU7A 4F50A 9ICVA 3GFKB 2GLEA 3UXOA 4DSKA 1QH9A 4I2AA 4MF2A 2AJQA 1LV5A 4M9NA 4F4XA 7ICPA 1XSLA 5KFEA 2JR5A 4NLNA 4J9NA 3HKZC 1CWBA 4J59A 2FMSA 5KUQA 3BS7A 4PHDA 4PPXA 4Z6CA 2XIDA 1SGGA 3FM9A 2KVSA 3ZDCA 5ALNA 4O3RA 3H0MB 5KFTA 3MFIA 3TANA 1VAIA 1F44A 4KN7A 3ICXA 4ECQA 3TAQA 4R3FA 8ICUA 4O3SA 4Z6FA 2MUTA 2W3SA 4UB4A 1X2IA 2CFEA 2Q0ZX 1KLNA 2W9MA 1ZQZA 2ZIWA 5KFVA 4ED8A 2FPKA 2HBLA 2LM4A 1JROA 1N5WA 2JEJA 1N60A 1LVHA 1BCKA 5AI4A 1VDNA 1ZYQA 3PNCA 1NOMA 2JH7A 1L3VA 9ICOA 1K5OA 1MC8A 1F5SA 5IIOA 5KUNA 5DDMA 2P0OA 3WKEA 3RAQA 2BCRA 1JX4A 3QUQA 2HHWA 4PHEA 4GXJA 4DWIA 2LYAA 3AN1A 3G6VA 1B0XA 3R9KA 1M9CA 3K2CA 2WF7A 1T3NA 4Y2QA 1ZD2P 3PMNA 2PMZF 3RDDA 3MBYA 4DS5A 4ZSDA 2A3VA 5KFGA 1ZXIA 4QWEA 1SKWA 2DUYA 3H8MA 5CYHA 4UAYA 1L3UA 4J5DX 3WKCA 1ZQGA 4PZNA 4GLXA 5AK6A 1RPLA 3BQ0A 3GDXA 3OHBA 2R8KA 3R54A 2K8CB 8ICWA 8ICTA 4LJXA 4KLOA 4NWIA 4O5CA 2BGWA 4DOCA 2QB0A 1QNGA 2BDUA 1B22A 2KG5A 2LKYA 1C7YA 3BS5B 3N7RC 1MQ3A 1AWUA 4QIWF 3NRWA 4Y2VA 2HHQA 1L7PA 5KFNA 1RQNA 5L1IA 2WFIA 2JH1A 2Q4TA 2MSNA 3AEVA 4ECXA 1KL9A 3BZCA 1RYSA 3CYHA 4FZLA 5KUSA 3PW7A 9ICNA 1ZQLA 2J6UA 4DGDA 1ZD5A 3EPIA 1JI7A 1S10A 5KFKA 1IM4A 4PGYA 9ICLA 4DSFA 2EAPA 2XY5A 9ICPA 2JGAA 4OCZA 2VIXA 5DKWA 5J0YA 3OHAA 4AYBC 2F2AB 4DF4A 1W8LA 9ICMA 5IIMA 3WKDA 1ZQSA 1WWUA 2C2DA 2KNJA 2R8HA 5K4LA 1IG6A 2A1JA 1AWTA 2KOBA 5EE3A 4DFKA 1NK5A 5B66U 3SYZA 4IS7A 1A0PA 3LWMA 2B6GA 3OJUA 1S8OA 2GH1A 4UARA 4RQ3A 3ISCA 2OXOA 1JXEA 1HEKA 4M9GA 3MMLB 4DOAA 2BIUX 5DG8A 1N2XA 4LVSA 1MSWD 1ZQAA 4QZEA 4F5PA 4M6WA 5AI0A 3BQ2A 5KV2A 5DDYA 7ICRA 4JWNA 5L1MA 3KHHA 2G07A 3V6JA 2F8KA 3SEIA 1TK0A 3BQTA 2WTFA 3H8SA 3ICHA 1Z3EB 8ICYA 1CRXA 1S0MA 2FI1A 2H3VA 1QCKA 2JZBB 4C80A 1BPYA 2ZUBA 3M9OB 3I28A 3UQ2A 2BCQA 1DGJA 1ZD3A 1MA7A 1RYUA 5KFFA 1ZQNA 3Q8SB 4K4HA 5ALDA 1AK4A 8ICEA 2HDOA 4QWCA 5F9NA 3HJEA 3ALRA 2B0CA 4KMUA 3T5JA 3KOOA 3RJFA 2FJ6A 3K0OA 2IMWP 2MU2A 2Y1JA 5AKGA 5DB8A 2XVTA 2BCSA 3EW9A 1A6SA 2RHFA 1F0MA 3NGDA 4MEXA 1ZQOA 5CCQA 1SL0A 2AXTU 1YZ6A 7ICTA 1IIPA 2DFLA 5AKXA 1M9YA 4B9LA 7ICQA 3RJEA 3H8WA 4J5AX 1L3SA 3SZ2A 1NK6A 2X2CK 4ZSCA 4B9MA 7ICGA 2F8LA 5DBCA 5A0LA 3GU3A 1SXEA 9ICKA 4N1QA 2AGQA 1UT5A 3C23A 1UA1A 5ALMA 1QNHA 5AKLA 4ED3A 3AM9A 1C20A 4F5RA 4B9UA 3QNMA 1COKA 4EBDA 4N1NA 1LB2B 2EZXA 1NKBA 2PFPA 1ZQXA 4FZMA 4PH5A 3KZXA 2W9AA 4J9MA 9ICJA 4NJ8A 3ODLA 3F2DA 3Q8RB 1QQ5A 5GTHU 2XC9A 9ICWA 2N1RA 2UVUA 3K0QA 2VANA 5KL8B 2ODGA 3JPTA 2F76X 3WK8A 2WF6A 8ICHA 3MGHA 1TVAA 1XWNA 2LYBA 3R49A 3RCIX 1XQ7A 1ZRNA 4F5OA 3NS1A 9ICGA 3ORYA 1W8VA 2A1AA 1TE2A 4DL4A 3ZD8A 4EX7A 4J03A 2MVZA 2IA6A 1M9FA 1WWVA 3QU2A 3WU2U 4YD2A 1BPXA 2W9BA 4YP3A 4R64A 1SWVA 2W55A 5CCNA 2HBKA 3V6KA 5KV5A 2ZUCA 3RJIA 5EE1A 3JPSA 5J8YC 4MF8A 4U6PA 2H3ZA 5KV3A 4YUIA 3KHLA 5KFWA 5AM2A 2BCVA 5DB9A 1A33A 1SB3C 1TKDA 1X9WA 4ED0A 4DQPA 4P4MA 1URJA 2VJ4A 3T5LA 3UQ0A 4B6JA 5AKEA 4QZBA 5AKKA 4MFFA 3NVVA 3V7KA 1SV4A 3KD3A 3M1YA 5KT2A 1J2MA 2IGWA 1ZD4A 4BGDA 3EPGA 4NV0A 4IC9A 3UXPA 3TFRA 9ICHA 4YUPA 3IRUA 3JPPA 1LKYA 3BKPA 4DGCA 3AQFA 2FLNA 3QZ7A 5KFZA 5DLGA 1ZQWA 5DBAA 5GTIU 1ZQJA 1UCVA 4QWAA 1RXVA 1QOIA 1XO0A 2P6UA 2G09A 1MN8A 4J5BA 4RPYA 3GV7B 1JXLA 1MZWA 4DGAA 2X25B 2W9CB 5CCSX 3TI0A 1Z00B 3T3FA 4KLUA 2A2NA 4JCPA 2ZIXA 3K75D 1SZPA 7ICLA 2WAQC 2XI9A 3KKAA 4ECUA 2KJ8A 4R8UB 4F4KA 3D2QA 4KX3A 1CWFA 4DF8A 3RH5A 1Q3UA 4I2EA 1QSLA 1X6IA 1PVQA 1QSSA 1MQ2A 2ISOA 4DLEA 1OCAA 3E2EA 1CWIA 5CRXA 5T14A 2W7PA 5KG3A 4F2SA 2ZXHA 4DLGA 2DGZA 3M8RA 4FRUA 1M6YA 2LHTA 5FP0A 3IM1A 1L7MA 4YUMA 4NY8A 3RBEA 5KG5A 5KT4A 2IHNA 2AQ0A 4RUCA 5J0PA 4UB8U 3NVYA 5J0UA 3LDAA 2F1HA 3R59A 3SAHA 3N7PD 2DPJA 4QZFA 5JHEA 2P6RA 3DDHA 1U49A 1TAUA 1OW5A 3PW2A 2ASLA 2IOHA 1YZ7A 3OSNA 1WCNA 1X66A 1VDVA 2JEIA 5ALRA 8ICRA 5J0QA 1V9TA 4UATA 3RCKX 2OEHA 2Y0SC 2R8JA 2EH9A 4UB5A 5CHGA 4YMOA 4QZDA 4ECRA 5F9LA 1N56A 4YN4A 1ZRMA 5CWRA 4DSEA 5G5GA 4J9LA 1ZKFA 1XYHA 2QB1A 2HVIA 4PZOA 2NRXA 1X40A 5EOZA 2CXYA 1S5LU 4FFDA 3ISBA 2W03A 3SMVA 2HBMA 4RQ5A 1L7NA 4GXKA 1GO3F 2C22A 4DFDA 5HHHA 1RQLA 2RP5A 2RMAA 2HHSA 4S1EA 5IILA 3NUQA 4RZRA 1PVPA 1QTMA 3JPRA 1HIWA 3TKAA 3UXNA 5KFHA 5J2AA 1L3TA 4F4ZA 4BXOB 3V7LA 3KBBA 4DQIA 3NVZA 5DGAA 2GWSA 2XO7A 4MFAA 4RNOA 2WHEA 3NVWA 3HP6A 4PGQA 3S6JA 4ECWA 1N63A 4BWJA 1DYWA 8ICBA 3PW4A 2WF9A 1BNPA 2XGPA 1K1SA 3R56A 2PMZC 2B71A 4JWMA 4NM2A 2DBYA 4M0AA 2KK0A 5AM3A 8ICJA 8ICMA 2DKXA 8ICFA 4PHPA 3PY8A 2DL0A 4UB6U 5KG6A 3PW0A 4C7ZA 1DXSA 1SXDA 1NJYA 1N48A 3C5GA 1T8EA 4BUGA 3ZD9A 3A0HU 2EZYA 1U47A 3IG8A 1L7OA 4JB3A 4PGXA 2W8KA 3RTVA 2Y9TA 3KKAC 2CPLA 3MR3A 1ZQKA 4KX5A 2DWQA 2I9GA 2KVCA 3M7DA 3WK4A 4ED1A 1Z1BA 1ZQPA 3SQIA 8ICCA 2E8NA 4UAVA 4J5CX 4QIWC 4F4YA 4RQ1A 1CI4A 9ICSA 1ZQHA 3PSTA 4I2FA 4YUHA 1SZHA 2XCPA 1QQ7A 2WLWA 3SENA 1ISTA 4O3QA 5L1KA 2EAOA 3FC4A 9ICIA 5AIAA 1W74A 3MABA 4P0QB 2G06A 4KLIA 4C4SA 2HHXA 1KTQA 3OSPA 4KLJA 1FGLA 5AM4A 1NK4A 4DS4A 3KHGA 3G6XA 4JUZA 3CNHA 2KD1A 5CCRA 1BPZA 4EEYA 3F2BA 1JIHA 3PX4A 2KJ9A 4RQ8A 1Z81A 1NZBA 2YY6A 5ALKA 5KUVA 4RQNA 2KA0A 3Q8QB 5CA7A 4UASA 9ICAA 1A76A 1NZPA 4A8EA 1AWRA 4Y2RA 7ICUA 3H4BA 3VA7A 1FEZA 2MZUA 1TK8A 2EQYA 4Y2PA 2RS4A 2KMDA 2K4EA 4I2JA 5J2BA 1L6NA 2W54A 4MFCA 2BDPA 4I2DA 1OXJA 5D46A 1UHUA 2CPRA 4I9YA 2DKZA 3MR5A 8ICVA 3RFYA 5AI5A 5DUDA 4USAA 1PZNA 1CWJA 3ZDEA 1FFVA 5DG7A 3PV8A 1UT8A 4Y2YA 5HMLA 4DL7A 5AKIA 4O5EA 4CGZA 1TK5A 5ALGA 5J2IA 3ISDA 3PO5A 1AWQA 1A77A 2G0AA 4RU9A 3QX7A 3MDCA 5JRTA 2KJ5A 4N1OA 3TQ1A 1EXNA 1DK3A 2NO5A 3IDWA 5ALQA 4YQWA 2JMGA 2NNZA 3PR5B 2AGOA 5ALLA 3H4DA 3BQ7A 3SV3A 1QSYA 2PLUA 4C8OA 4I2IA 4LZGA 4QWDA 2DQNB 3IP4B 2ALZA 1KRPA 3B9JA 4LZDA 4NL9A 1CEZA 4E0DA 5TZVA 2IOFA 1M63C 4OJ6A 3Q8LA 4NXZA 1WCLA 5ALOA 5KV1A 2ASDA 2W7OA 4DQRA 3GV8B 3GV5B 3TADC 3RH6A 8ICAA 2ZP2A 4P4PA 2PXIA 2ZTEA 4RUAA 2XCAA 2I6XA 2GOLA 2YMPA 3H0RB 2K4PA 2KSOA 3RD9X 4DL6A 4RNMA 2G5IB 2XGQA 4CRXA 3MGVA 3U26A 5KFJA 5KFDA 2E3TA 7ICKA 2JV3A 1N5XA 2V4RA 4N1SA 1VBTA 5AK4A 5C0YA 4DL3A 2PI4A 4NLKA 2ZTDA 2ZIVB 4CF5A 5D4BA 5EE9A 3QUCA 4KLDA 3FYHA 2LPEA 3K0PA 5KFUA 5KG1A 9ICTA 2JZBA 3IN5A 3Q8PB 4EX6A 2I1QA 3TFSA 3M8SA 4B9SA 1L8LA 4DOBA 1V97A 4QZCA 1T7PA 1HUZA 1Z19A 2YB1A 2KICA 5L1JA 4NLBA 2FPMA 1CLHA 2WFAA 2IOFK 3LK9A 3RCLA 4CDGA 4QZHA 1NK0A 4YG2A 1UQVA 5J2DA 5J2JA 5J2CA 4GXIA 5EWGA 2ZXIA 4GC6A 2FDRA 5KV6A 1N62A 2LM1A 4RT3A 3N4MB 3JB9d 7ICVA 4ED6A 1FO4A 4DFJA 2FMQA 4DO9A 2OCEA 1S9FA 4J58A 2KKPA 2XGYB 3C29A 3IG5A 4KLSA 1NK9A 1U48A 7ICMA 2FPLA 4FE3A 4Z6EA 4XRHA 5KV7A 2HW3A 1ECWA 2HAQA 1XC9A 1Y88A 4ED2A 3RB4A 3FDSA 1CWMA 3H8JA 2I5HA 2XICA 2NRZA 2LYHA 2ATLA 2OWOA 4BWMA 2CN1A 2NV3A 2K8BB 4BDPA 2ESEA 4O8IA 3C28A 3MFHA 5D49A 8ICQA 4U7CA 4IRKA 1S77D 1N61A 2F1IA 2DPIA 4I27A 1M9XA 4YR0A 2POEA 4F91B 3RB3A 3RDCA 4FBUA 4EBCA 1BPBA 4AYBF 4CNQA 3QYPA 4EENA 1BNOA 4Y2TA 3BJYA 2Y1IA 1JMSA 2HHUA 3CP8A 3B0XA 1RG6A 3GZFA 3C2LA 8ICNA 5KT5A 1CUKA 2ZJ8A 1FFUA 1WUDA 1M9EA 3RR8A 2C3BA 5HR6A 4C4TA 2KIWA 1IHGA 1C5FA 4YXJA 2FMPA 4M47A 1NK8A 4ECYA 3RH4A 2HI0A 4EZ9A 5KG2A 8ICIA 4C4RA 4FS1A 5IINA 4RQ7A 4QNLA 3RJGA 1KEJA 1ZQEA 1DK2A 1Q8KA 1U9LA 1U4BA 3MR6A 2KEYA 2NRTA 5CEHA 2JEGA 4TURA 5KFQA 1KFSA 2BQRA 2QERA 1S0OA 4TUQA 5DBBA 5KUUA 2H3IA 4F72A 2NYVA 1SV0A 2HCFA 5ALSA 2W3RA 1TAQA 5KUZA 4MHVA 4F71A 2CMTA 3GQCA 3AUOA 5KFXA 4KLMA 3EZ5A 4YR3A 4IR1A 1NJWA 2HOQA 2OJUA 4CCHA 4UBBA 2VJ5A 2F44A 3AL0B 4IQTA 4RPZA 2E8MA 2XY6A 2KE7A 3AU6A 4RQMA 3RCGA 1KW4A 4HYKA 4N1RA 3NTUA 3GIKA 2L5YA 1V38A 3ODIA 2AH5A 5HP4A 4TOTA 1DOQA 3QUTA 4F3OA 4FBTA 3QU9A 2QARB 4C0ZA 2D8CA 2C28A 4Q45A 4DQQA 2JEFA 1ZETA 3RR7A 1E8KA 4JJMA 4GIBA 1RDFA 1B4FA 5L1LA 4R63A 3RB6A 1V9PA 3ED5A 4EEKA 1ZQFA 5AKJA 4K4IA 4M9LA 2RLTA 2HOIA 4ZOHC 2BCUA 2K89A 3ZDBA 3ETRA 3D2NA 1S0NA 2KZZA 3K0MA 7ICFA 2ZIXB 4QZGA 5AICA 5KG7A 4UAWA 3JPQA 4C7YA 2Y9UA 2YTUA 5B5EU 3K0NA 3AQEA 1RMHA 5BOLA 3RBDA 4AP9A 4X5VA 3RCFA 2R8GA 1D8LA 1NK7A 1ZQMA 4R3EA 5ALPA 1SIJA 5HHIA 4TQRA 4KLEA 4IQVA 2ISPA 1XSPA 3C21A 4KTQA 4IQWA 2F77X 2VA8A 4KLQA 1AQ6A 3T1UA 3CYSA 4GC7A 2OHFA 3QYUA 2NULA 3UMGA 2YMMA 4KLLA 3OGUA 5AI8A 4YFKA 4NM1A 2CRXA 3TACB 3JPOA 4UB1A 2WFJA 2IHMA 2KKVA 4BXOA 2BPGA 1PVRA 5DQGA 3GILA 5IIKA 8ICOA 1BVSA 3PO4A 5AI9A 2FU0A 3PX6A 3JPNA 4O5KA 2ZIUB 4PL1A 3OJSA 3TARA 2X83B 2Z7JA 3C1ZA 3J81j 3GIIA 4XQ8A 4MEYA 3M9MB 1D8YA 3T5HA 4Q8FA 2OSEA 5HMMA 4YR2A 3BQ1A 3PW5A 2MRLA 1PK1A 5KFBA 3RRGA 5KG0A 4OD0A 5AHXA 2JRZA 2RRDA 4DCCA 1ZQCA 5IIIA 1Z1VA 2RMCA 1B43A 4JMUA 4GFJA 4UW9A 4C8MA 7ICHA 2R99A 1E3BA 3OPFA 3Q8KA 5DLFA 3PSFA 1KFDA 3G6YA 4DQSA 5AK3A 4JK1A 3PVXA 2BQUA 3UM9A 5L9XA 4IL6U 3SAFA 2WF5A 2RDIA 4TUSA 4I2HA 4YMNA 4UAZA 2LI6A 2BQ3A 3VC8A 3UPQA 1O08A 3GIJA 3F5AA 2HQJA 3C1YA 3LWLA 3EUB2 4P0QA 4Q43A 3H40A 3V72A 4WJ3B 1NJXA 2POYA 1T3QA 2OK3A 4RQ4A 3RB0A 4YUJA 1P7DA 5CP2A 2HSZA 1Z4OA 1Q3VA 3H0LB 2BPFA 4F4WA 5AI6A 4F93B 3SAGA 3TAPA 2E8PA 2EANA 4IQUA 4FRVA 2CK1A 4P0PB 5HR7A 4YUKA 3HT3A 4ECSA 4R65A 2AU0A 2Y0SF 2BZFA 1CWLA 2UVVA 2GW2A 1YNDA 4IRDA 3A0BU 2ES6A 3KTQA 3KHRA 7ICEA 1X6JA 4CYHA 5J2KA 4P4OA 2YB4A 3DV9A 2FLLA 1XS9D 4NLZA 1RZTA 1PUZA 4Z6DA 4QZAA 1CWOA 4Y2XA 8ICPA 3GIMA 4EZ6A 1D9DA 2X2DB 4I2BA 4XA5A 5KT3A 3QU4A 4J9RA 1ZQDA 4I29A 3C2MA 1RXWA 2G5HB 2YN4A 3O0FA 5ALIA 1ZQVA 2MUTB 1XNSA 1BPEA 4DSIA 4RNNA 1LOPA 2ZIWB 3HW8A 4C8NA 2NO4A 1X9XA 1ZQRA 5KFRA 4DSLA 2D3DA 4YD1A 2HE9A 1MIKA 3DEEA 2WB1F 2KV2A 3V7JA 5ALZA 3K1ZA 3MR2A 4O3PA 3QUBA 2EZZA 1SL1A 3ZI4A 3SV4A 3L3FX 5KT7A 4YUNA 4XUSA 3BS5A 2HBJA 2E5SA 2KZMA 3D2SA 4OJPA 4HY7A 4J9KA 2HMXA 2ZJAA 5C5JA 4F5NA 2DF4B 4US9A 1K1QA 1QQ6A 1ZQTA 1D8BA 3BT8A 1XO7A 3L5KA 4OJ5A 4DL5A 4I28A 4FO6A 5CBWA 5CJ7A 4LQWA 2ESLA 2M0NA 2RMBA 2RQ5A 1CWCA 5KUWA 5ALTA 5AKYA 5F66A 5EWFA 7ICSA 2K7NA 3H7IA 3HKZF 1CYNA 3BZKA 5KUOA 2A19A 4DFPA 1L8OA 3O7TA 3N7SC 4DSJA 5JU5A 3C5FA 2QB0B 4ELVA 4HAIA 4I2CA 4EELA 3F5EA 5J2HA 1YT3A 5KFIA 3MMLA 4ELUA 2F3NA 3UCHA 1V85A 2ZIVA 4J9PA 2AGPA 1AWSA 1ZQ1C 2YX8A 4QW9A 2KP7A 3CYMA 4UAUA 4G3IA 1T4GA 3RAXA 2J6TA
chains in the Genus database with same CATH topology
2KHVA 3F53A 4ACOA 2XIDA 3GZFA 5JHEA 3H0MB 1VAIA 2MA1A 1F44A 1WUDA 3ICXA 1M9EA 2C3BA 4R3FA 5HR6A 2KIWA 1IHGA 1C5FA 1V9TA 2CFEA 3RCKX 2Y0SC 2ZIWA 2X2AA 2HBLA 4QNLA 1AWVA 1BCKA 1VDNA 1ZKFA 1XYHA 5CBTA 5KULA 1NMKA 3VCBA 2E1FA 2JH7A 2KEYA 5KV4A 2W03A 3SMVA 2HBMA 5KUNA 2QERA 2P0OA 1GO3F 2KHQA 5KUUA 2H3IA 2RP5A 2RMAA 4S1EA 2LYAA 3NUQA 1PVPA 1HIWA 1M9CA 3K2CA 5KUZA 2CMTA 2PMZF 3RDDA 1CWKA 4ZSDA 2A3VA 2HOQA 2OJUA 5CYHA 4J5DX 1DYWA 2VJ5A 3AL0B 2N0TA 1OUQA 1W8MA 2MS4A 3RCGA 3R56A 4N1RA 2BITX 2PMZC 3R54A 3ODIA 2K8CB 2B71A 3R57A 4TOTA 2IGVA 1ED1A 4NWIA 3M6KA 5KURA 4C0ZA 1QNGA 2BDUA 2LKYA 3N7RC 1E8KA 4JJMA 1AWUA 4BUGA 4ICAA 4QIWF 3NRWA 3IG8A 2ZG6A 1M9DA 2WFIA 2JH1A 2Q4TA 2CPLA 3OREA 4KX5A 3ICIA 2KVCA 3M7DA 4DGBA 3CYHA 1Z1BA 3SQIA 2HOIA 4FZLA 4QJFB 2R18A 5KUSA 2K89A 4DGDA 4J5CX 3D2NA 4QIWC 3K0MA 3PSIA 2HQ6A 2ZIXB 3PSTA 4YUHA 1SZHA 1X7FA 2WLWA 2JGAA 1ISTA 2VIXA 4IPZA 3K0NA 3RDAX 3AQEA 4AYBC 2F2AB 1W8LA 1W74A 1RMHA 4P0QB 2G06A 2KNJA 3RCFA 1AWTA 2KOBA 1FGLA 1ZMFA 2D6FC 1A0PA 4DGEA 4R3EA 2GH1A 2OXOA 3T79A 5CCRA 2KD1A 1HEKA 3MMLB 2F77X 1VBSA 3T1UA 3F2BA 3CYSA 3F2CA 2BIUX 4O8HA 3RF9A 3QYUA 2NULA 2KJ9A 2OH2A 1Z81A 2CYHA 1NZBA 5KV2A 4YULA 5KUVA 2CRXA 2G07A 2WFJA 2KKVA 3ICHA 1PVRA 4FZNA 4A8EA 1CRXA 2OYYA 1AWRA 2H3VA 2PHCB 3VA7A 4EYVA 2MZUA 2FU0A 1MA7A 2RS4A 4N1MA 2K4EA 1L6NA 2ZIUB 1AK4A 1MF8C 4PL1A 2X83B 2MC9A 2Z7JA 2W04A 3ALRA 2K4IA 4I9YA 2CPRA 4KMOB 2OSEA 3RFYA 2Z6WA 3K0OA 5DUDA 5CBVA 2HOFA 2MRLA 3R4GA 1CWJA 3PSPA 2XVTA 4CGZA 2RRDA 2G08A 1A6SA 1CWHA 2RHFA 1AWQA 5CCQA 3OEPA 2G0AA 2RMCA 4JMUA 4GFJA 2R99A 1T94A 2KJ5A 1E3BA 3OPFA 4N1OA 3PSFA 1IIPA 1M9YA 4XNCA 2JMGA 4J5AX 2X2CK 3SAFA 3BO7A 2PLUA 3LVVA 4ZSCA 2F8LA 2DQNB 3IP4B 3VC8A 5A0LA 3GU3A 4BX9C 4N1QA 3K0RA 3F5AA 2HQJA 1M63C 1QNHA 4OJ6A 4P0QA 4WJ3B 5KV1A 4N1NA 2W7OA 2POYA 1KBUA 2OK3A 4FZMA 4YUJA 5A0EA 3KZXA 2ZP2A 1P7DA 1Q3VA 3H0LB 3ONNA 2GOLA 3SAGA 3H0RB 3ODLA 3F2DA 3RD9X 2G5IB 4NLCA 4CRXA 3MGVA 4FRVA 2CK1A 4YUGA 2N1RA 4P0PB 5HR7A 4YUKA 1A58A 4N1SA 1VBTA 3K0QA 1TAMA 5KL8B 5CBUA 5C0YA 2ALFA 4PL2A 1ZKCA 2Y0SF 2F76X 1CWLA 2GW2A 1YNDA 1XWNA 2ZIVB 2LYBA 3R49A 3RCIX 1XQ7A 3S6MA 3K0PA 4CYHA 2H3QA 2YB4A 1W8VA 1CWOA 2E1EA 1CWAA 3IN5A 2MVZA 1M9FA 2X2DB 2ZIUA 2LBOA 5CCNA 2HBKA 5KV5A 4U6PA 2G5HB 1DRGA 2H3ZA 5KV3A 3O0FA 4YUIA 1XNSA 1Z19A 2YB1A 3LVWA 1A33A 1LOPA 2OM6A 4BJQA 2KICA 2ZIWB 2X7KA 3M6ZA 4NLBA 1CLHA 3LYSA 1URJA 3RCLA 3RDBA 2VJ4A 4CDGA 3CRXA 4N1PA 2HE9A 4YUOA 1MIKA 3DEEA 2WB1F 2KV2A 2ZXIA 3K1ZA 4E1QA 3PZPA 2K8AA 2IGWA 3L3FX 5KV6A 4YUNA 4S1JA 2JHDA 4NV0A 4IC9A 3JB9d 4OJOA 4YUPA 1J2AA 2HBJA 1UPHA 2E5SA 3D2SA 4J58A 2KKPA 2XGYB 3C29A 3AQFA 3BKPA 4OJPA 4J5EX 2WAQF 4HY7A 4DGCA 3IG5A 5KV0A 2WB1C 4FE3A 3EOVA 1QOIA 1XO0A 5KV7A 2HAQA 1ECWA 2G09A 2HMXA 4J5BA 1MZWA 4DGAA 2DF4B 2X25B 1CWMA 5CCSX 5KL1B 1D8BA 2XICA 2A2NA 3BT8A 4JCPA 2ZIXA 1XO7A 4OJ5A 3RFAA 2WAQC 2XI9A 2KJ8A 2CN1A 2NV3A 3D2QA 5CBWA 4LQWA 4KX3A 2K8BB 2ESLA 2M0NA 4O8IA 2RMBA 4OJLA 3C28A 2K4HA 1CWFA 4U7CA 1Q3UA 1CWCA 5KUWA 2H3FA 2VKQA 5F66A 1M9XA 2POEA 3E0FA 4O3MA 1PVQA 2K7NA 3OPXA 4P0PA 3RDCA 3HKZF 1CYNA 3PMPA 4OO1J 5KUOA 5LUDA 1OCAA 3O7TA 3N7SC 1CWIA 3KFUF 5CRXA 5T14A 4AYBF 2W7PA 1H0PA 3F5EA 1YT3A 2ZXHA 3MMLA 3UCHA 2DGZA 2ZIVA 4FRUA 2LHTA 4YUMA 1AWSA 1ZQ1C 2YX8A 3CYMA 3HKZC 1CWBA 4J59A 5KUQA 3R59A 3SAHA 3CP8A 3N7PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9D A;  2WFI A;  5KV3 A;  4YUI A;  2CPL A;  1CWH A;  5JHE A;  1AWQ A;  3ORE A;  1VAI A;  5CCQ A;  3OEP A;  1A33 A;  1LOP A;  3ICI A;  1M9E A;  2RMC A;  4DGB A;  2C3B A;  3CYH A;  4R3F A;  2X7K A;  2R99 A;  1IHG A;  1C5F A;  1E3B A;  3OPF A;  5KUS A;  1CLH A;  4N1O A;  1IIP A;  4DGD A;  1M9Y A;  4J5C X;  1V9T A;  3RCL A;  3K0M A;  4XNC A;  2CFE A;  3RCK X;  3RDB A;  2HQ6 A;  2X2A A;  2HE9 A;  4N1P A;  4YUO A;  4YUH A;  1MIK A;  4J5A X;  1X7F A;  2WLW A;  4E1Q A;  1IST A;  2X2C K;  4IPZ A;  3K0N A;  3RDA X;  1AWV A;  3BO7 A;  2PLU A;  4ZSC A;  2IGW A;  1W8L A;  1W74 A;  1RMH A;  5KV6 A;  1BCK A;  4S1J A;  1VDN A;  1ZKF A;  1XYH A;  4YUN A;  5CBT A;  3JB9 d;  5KUL A;  1NMK A;  4YUP A;  1J2A A;  4N1Q A;  3K0R A;  3RCF A;  1AWT A;  1FGL A;  2HQJ A;  4J58 A;  4J5E X;  2XGY B;  3BKP A;  1M63 C;  1ZMF A;  1QNH A;  5KV4 A;  4DGC A;  4HY7 A;  5KUN A;  4DGE A;  5KV0 A;  2QER A;  2P0O A;  4R3E A;  5KV1 A;  4N1N A;  3EOV A;  1QOI A;  5KUU A;  5CCR A;  5LUD A;  5KV7 A;  2HAQ A;  2POY A;  2OK3 A;  3MML B;  1VBS A;  4J5B A;  4YUJ A;  3T1U A;  3CYS A;  5A0E A;  2BIU X;  2RMA A;  1MZW A;  2ZP2 A;  4O8H A;  4S1E A;  4DGA A;  2X25 B;  1CWM A;  2NUL A;  3QYU A;  5CCS X;  1M9C A;  2A2N A;  3K2C A;  4JCP A;  3BT8 A;  5KUZ A;  1XO7 A;  3ODL A;  2CMT A;  1Z81 A;  2CYH A;  5KV2 A;  4YUL A;  3RD9 X;  5KUV A;  3RDD A;  5CBW A;  4LQW A;  4FRV A;  2CK1 A;  2ESL A;  4YUG A;  1CWK A;  4O8I A;  4ZSD A;  4YUK A;  2RMB A;  2WFJ A;  1CWF A;  2OJU A;  1A58 A;  1CWC A;  4N1S A;  1VBT A;  3K0Q A;  5KUW A;  3ICH A;  5CYH A;  5F66 A;  4J5D X;  5CBU A;  1DYW A;  1M9X A;  2ALF A;  2POE A;  1ZKC A;  1CWL A;  2K7N A;  2GW2 A;  2N0T A;  1AWR A;  1YND A;  2PHC B;  3RDC A;  1CYN A;  3PMP A;  1XWN A;  3VA7 A;  3R49 A;  3RCI X;  4EYV A;  1OCA A;  1XQ7 A;  5KUO A;  2MZU A;  1W8M A;  3O7T A;  3S6M A;  1CWI A;  2FU0 A;  2MS4 A;  1H0P A;  3K0P A;  3RCG A;  3R56 A;  4N1R A;  4CYH A;  2BIT X;  2RS4 A;  3R54 A;  3ODI A;  3R57 A;  2B71 A;  4N1M A;  4TOT A;  2IGV A;  3MML A;  1AK4 A;  1MF8 C;  3UCH A;  1W8V A;  4FRU A;  1CWO A;  2X83 B;  2MC9 A;  5KUR A;  4YUM A;  1CWA A;  1QNG A;  2MVZ A;  1AWS A;  4I9Y A;  1M9F A;  2OSE A;  2X2D B;  3RFY A;  2Z6W A;  3K0O A;  5DUD A;  5CBV A;  1E8K A;  1CWB A;  4J59 A;  1AWU A;  3R4G A;  4JJM A;  5CCN A;  1CWJ A;  5KUQ A;  5KV5 A;  3R59 A; 
#chains in the Genus database with same CATH topology
 2KHV A;  3F53 A;  4ACO A;  4G9B A;  1SKS A;  3EWA A;  4Y2U A;  2MA1 A;  2AQ4 A;  1O03 A;  3NRZ A;  5J0O A;  3QE9 Y;  1ZX8 A;  3PML A;  5DG9 A;  3QZ8 A;  5E79 U;  2X2A A;  2KSO B;  3D6J A;  5J2F A;  2A1J B;  3UMC A;  1AWV A;  4M04 A;  4ELT A;  5J8Y A;  2NRV A;  5CBT A;  1ARO P;  4O0I A;  9ICB A;  3VCB A;  1NMK A;  5KUL A;  2E1F A;  2KZ3 A;  4J9O A;  4RQ2 A;  5KV4 A;  1PK3 A;  4ED7 A;  2KHQ A;  5KG4 A;  4KLH A;  2LMR A;  4M6W B;  5DQI A;  4TQS A;  5AIB A;  3BDP A;  3X27 A;  2F1J A;  5HNK A;  5BPC A;  3ETL A;  1X9M A;  3I1Y A;  3IHQ B;  3THV A;  1CWK A;  2GO7 A;  9ICE A;  3PR4 A;  2EDU A;  4R66 A;  4RQ0 A;  2N0T A;  1J97 A;  1JAL A;  1Z4N A;  5DGB A;  1JRP A;  4ECZ A;  5KFA A;  1OUQ A;  4DEZ A;  5ALJ A;  1W8M A;  4RPX A;  2MS4 A;  1DGS A;  3HRD D;  2J6S A;  3KZI U;  1H38 A;  2BIT X;  5KFY A;  3R57 A;  1ZJN A;  2IGV A;  1ED1 A;  4QZ8 A;  5J0S A;  2W11 A;  2PKE A;  4CE6 A;  3M6K A;  5KUR A;  2VA3 A;  5J0X A;  8ICZ A;  3N28 A;  1KQQ A;  4ICA A;  2PFQ A;  2JXJ A;  2ZUD A;  2ZG6 A;  3L4P A;  4B9N A;  1M9D A;  4NL9 C;  5AM0 A;  1SWW A;  1QLN A;  3ORE A;  1VJ5 A;  4C8L A;  3ICI A;  4DGB A;  1RM6 C;  3WK5 A;  4QJF B;  2R18 A;  5AKH A;  2AHO B;  1KN5 A;  3PSI A;  2HQ6 A;  9ICC A;  1ZOL A;  5KNI A;  1KKX A;  4TUP A;  1X7F A;  2PFN A;  3QEB Z;  2MAX A;  1U45 A;  5J0W A;  4M2Y A;  4IPZ A;  3RDA X;  3WKB A;  4JV1 A;  5DB6 A;  2H5X A;  2RDJ A;  5H2F U;  2K60 A;  1ZMF A;  5KFM A;  5KFL A;  4Y2S A;  2D6F C;  2W8L A;  4DGE A;  1NKE A;  3T79 A;  1COO A;  5CR0 A;  3N97 B;  1VBS A;  2KIV A;  4UBC A;  3F2C A;  4O8H A;  3RF9 A;  9ICX A;  1VLB A;  1WG8 A;  2KTQ A;  2BR0 A;  4K4G A;  3QEA Z;  1D9F A;  5ALX A;  5J2G A;  2OH2 A;  2CYH A;  5AM5 A;  1HJP A;  2KN7 A;  4YUL A;  4JV0 A;  2HHT A;  2YML A;  4Y2J A;  2BKE A;  4FZN A;  5EE0 A;  2OYY A;  8ICG A;  9ICU A;  4PJ0 U;  2PHC B;  2XY7 A;  7ICJ A;  4UQG A;  1FIQ A;  4EYV A;  2C2E A;  8ICX A;  1WYG A;  2UVR A;  1S76 D;  4IRC A;  5F3X B;  4N1M A;  4RQ6 A;  2W9B B;  2ASJ A;  2KFZ A;  2HHV A;  1MF8 C;  3QXG A;  3WK6 A;  2MC9 A;  1UA0 A;  2HVH A;  2W04 A;  2W9C A;  2K4I A;  5KAI U;  1Z00 A;  4ECV A;  2YQE A;  3ZDD A;  4KMO B;  5ALF A;  5AKZ A;  2Z6W A;  5CBV A;  2HOF A;  2QKQ A;  3R4G A;  4R8U A;  2QAR A;  3PSP A;  1XWL A;  2VA2 A;  1NKC A;  4IR9 A;  5KFO A;  3AMZ A;  2PI5 A;  1CWH A;  2G08 A;  3RJH A;  3OEP A;  3EYZ A;  3SI8 A;  2ZJ5 A;  3IV6 A;  3HWT A;  5AM1 A;  4C8K A;  5BOM A;  3MDA A;  1T94 A;  2PFO A;  3B0Y A;  4KN4 A;  4QZI A;  2KFN A;  3HPO A;  4XNC A;  8ICK A;  4EYI B;  1HUO A;  5ALV A;  3NAS A;  2IBK A;  1XU4 A;  3V6H A;  1S97 A;  3BO7 A;  1IV8 A;  3LVV A;  1LKY B;  1J2N A;  4KIT B;  9ICQ A;  2V9W A;  4F5Q A;  1ZJM A;  4J9Q A;  1TV9 A;  4KLG A;  4BX9 C;  4KLT A;  3K0R A;  2M9N A;  5J29 A;  4ECT A;  1X9S A;  1TFR A;  1NNL A;  4F92 B;  3HX0 A;  3PX0 A;  4CF4 A;  5J2E A;  1KBU A;  5A0E A;  5J0R A;  3OTQ A;  7ICI A;  5ALE A;  2UVW A;  3ONN A;  5DQH A;  5KFS A;  1X42 A;  3T5K A;  1ZQI A;  3MC1 A;  4NLC A;  4YMM A;  4YUG A;  2FE9 A;  5IIJ A;  5J0T A;  1A58 A;  2W43 A;  4US8 A;  3ZDA A;  4NLG A;  1TAM A;  5CBU A;  3K4G A;  2ALF A;  4PL2 A;  1ZKC A;  1ZQU A;  3RJK A;  1NJZ A;  8ICS A;  3S6M A;  2H3Q A;  1JN3 A;  3WKA A;  4O9M A;  4YXM A;  4F8R A;  2E1E A;  4F2R A;  1CWA A;  3RRH A;  1RYR A;  1KFT A;  2ZIU A;  2WF8 A;  2LBO A;  5JTI A;  3CW2 C;  5ALU A;  2R8I A;  3AU2 A;  5ALH A;  3K1R B;  4KLF A;  3UMB A;  5KTQ A;  1DRG A;  3HIL A;  3Q8M A;  4DFM A;  3RJJ A;  1JUD A;  2E8O A;  3LVW A;  2OM6 A;  4BJQ A;  2X7K A;  3M6Z A;  5ALY A;  3WK9 A;  1Q46 A;  3LYS A;  4ZH4 A;  2BHN A;  1XSN A;  5KFP A;  3RDB A;  4M9H A;  7ICO A;  4QZ9 A;  3CRX A;  7ICN A;  4N1P A;  1NI3 A;  4YUO A;  1SV0 C;  4E1Q A;  1BPD A;  9ICR A;  4O3O A;  3PZP A;  2K8A A;  3QU5 A;  1ZQY A;  2B21 A;  4B9T A;  4S1J A;  2JHD A;  3WK7 A;  3KOP A;  5KT6 A;  2BPC A;  4OJO A;  5KFC A;  4J9S A;  1J2A A;  1UPH A;  5DB7 A;  4O3N A;  1KDH A;  2EAM A;  4YVZ A;  4EBE A;  4J5E X;  3E58 A;  2FLP A;  8ICL A;  2WAQ F;  4B9V A;  5CB1 A;  5KV0 A;  1ZQQ A;  1BGX T;  1L5U A;  4RT2 A;  5TIS U;  1KSP A;  1S0V A;  2WB1 C;  4QWB A;  1ZQB A;  5ALW A;  4DL2 A;  4UB3 A;  3EOV A;  2NRW A;  2C2R A;  4M9J A;  2P35 A;  3SR6 A;  4QW8 A;  5KL1 B;  5JUM A;  4EYH B;  3RFA A;  3I76 A;  5G5H A;  1PK1 B;  2ZTC A;  4CF3 A;  3MGI A;  4OJL A;  1IXR A;  2K4H A;  4UB2 A;  1SL2 A;  2H3F A;  2VKQ A;  5EWE A;  9ICF A;  3M9N B;  4YCX A;  3E0F A;  4O3M A;  2YMQ A;  4P2H A;  5AK5 A;  3OPX A;  4P0P A;  2QLT A;  3PMP A;  3SD7 A;  5KAF U;  4OO1 J;  3C2K A;  4FS2 A;  5LUD A;  2V4Q A;  3TAD A;  3KFU F;  2P66 A;  1H0P A;  1SKR A;  1XO1 A;  4PHA A;  4Q8E A;  4Q44 A;  4JV2 A;  2O6K A;  3FAH A;  4I2G A;  3QU7 A;  4F50 A;  9ICV A;  3GFK B;  2GLE A;  3UXO A;  4DSK A;  1QH9 A;  4I2A A;  4MF2 A;  2AJQ A;  1LV5 A;  4M9N A;  4F4X A;  7ICP A;  1XSL A;  5KFE A;  2JR5 A;  4NLN A;  4J9N A;  3HKZ C;  1CWB A;  4J59 A;  2FMS A;  5KUQ A;  3BS7 A;  4PHD A;  4PPX A;  4Z6C A;  2XID A;  1SGG A;  3FM9 A;  2KVS A;  3ZDC A;  5ALN A;  4O3R A;  3H0M B;  5KFT A;  3MFI A;  3TAN A;  1VAI A;  1F44 A;  4KN7 A;  3ICX A;  4ECQ A;  3TAQ A;  4R3F A;  8ICU A;  4O3S A;  4Z6F A;  2MUT A;  2W3S A;  4UB4 A;  1X2I A;  2CFE A;  2Q0Z X;  1KLN A;  2W9M A;  1ZQZ A;  2ZIW A;  5KFV A;  4ED8 A;  2FPK A;  2HBL A;  2LM4 A;  1JRO A;  1N5W A;  2JEJ A;  1N60 A;  1LVH A;  1BCK A;  5AI4 A;  1VDN A;  1ZYQ A;  3PNC A;  1NOM A;  2JH7 A;  1L3V A;  9ICO A;  1K5O A;  1MC8 A;  1F5S A;  5IIO A;  5KUN A;  5DDM A;  2P0O A;  3WKE A;  3RAQ A;  2BCR A;  1JX4 A;  3QUQ A;  2HHW A;  4PHE A;  4GXJ A;  4DWI A;  2LYA A;  3AN1 A;  3G6V A;  1B0X A;  3R9K A;  1M9C A;  3K2C A;  2WF7 A;  1T3N A;  4Y2Q A;  1ZD2 P;  3PMN A;  2PMZ F;  3RDD A;  3MBY A;  4DS5 A;  4ZSD A;  2A3V A;  5KFG A;  1ZXI A;  4QWE A;  1SKW A;  2DUY A;  3H8M A;  5CYH A;  4UAY A;  1L3U A;  4J5D X;  3WKC A;  1ZQG A;  4PZN A;  4GLX A;  5AK6 A;  1RPL A;  3BQ0 A;  3GDX A;  3OHB A;  2R8K A;  3R54 A;  2K8C B;  8ICW A;  8ICT A;  4LJX A;  4KLO A;  4NWI A;  4O5C A;  2BGW A;  4DOC A;  2QB0 A;  1QNG A;  2BDU A;  1B22 A;  2KG5 A;  2LKY A;  1C7Y A;  3BS5 B;  3N7R C;  1MQ3 A;  1AWU A;  4QIW F;  3NRW A;  4Y2V A;  2HHQ A;  1L7P A;  5KFN A;  1RQN A;  5L1I A;  2WFI A;  2JH1 A;  2Q4T A;  2MSN A;  3AEV A;  4ECX A;  1KL9 A;  3BZC A;  1RYS A;  3CYH A;  4FZL A;  5KUS A;  3PW7 A;  9ICN A;  1ZQL A;  2J6U A;  4DGD A;  1ZD5 A;  3EPI A;  1JI7 A;  1S10 A;  5KFK A;  1IM4 A;  4PGY A;  9ICL A;  4DSF A;  2EAP A;  2XY5 A;  9ICP A;  2JGA A;  4OCZ A;  2VIX A;  5DKW A;  5J0Y A;  3OHA A;  4AYB C;  2F2A B;  4DF4 A;  1W8L A;  9ICM A;  5IIM A;  3WKD A;  1ZQS A;  1WWU A;  2C2D A;  2KNJ A;  2R8H A;  5K4L A;  1IG6 A;  2A1J A;  1AWT A;  2KOB A;  5EE3 A;  4DFK A;  1NK5 A;  5B66 U;  3SYZ A;  4IS7 A;  1A0P A;  3LWM A;  2B6G A;  3OJU A;  1S8O A;  2GH1 A;  4UAR A;  4RQ3 A;  3ISC A;  2OXO A;  1JXE A;  1HEK A;  4M9G A;  3MML B;  4DOA A;  2BIU X;  5DG8 A;  1N2X A;  4LVS A;  1MSW D;  1ZQA A;  4QZE A;  4F5P A;  4M6W A;  5AI0 A;  3BQ2 A;  5KV2 A;  5DDY A;  7ICR A;  4JWN A;  5L1M A;  3KHH A;  2G07 A;  3V6J A;  2F8K A;  3SEI A;  1TK0 A;  3BQT A;  2WTF A;  3H8S A;  3ICH A;  1Z3E B;  8ICY A;  1CRX A;  1S0M A;  2FI1 A;  2H3V A;  1QCK A;  2JZB B;  4C80 A;  1BPY A;  2ZUB A;  3M9O B;  3I28 A;  3UQ2 A;  2BCQ A;  1DGJ A;  1ZD3 A;  1MA7 A;  1RYU A;  5KFF A;  1ZQN A;  3Q8S B;  4K4H A;  5ALD A;  1AK4 A;  8ICE A;  2HDO A;  4QWC A;  5F9N A;  3HJE A;  3ALR A;  2B0C A;  4KMU A;  3T5J A;  3KOO A;  3RJF A;  2FJ6 A;  3K0O A;  2IMW P;  2MU2 A;  2Y1J A;  5AKG A;  5DB8 A;  2XVT A;  2BCS A;  3EW9 A;  1A6S A;  2RHF A;  1F0M A;  3NGD A;  4MEX A;  1ZQO A;  5CCQ A;  1SL0 A;  2AXT U;  1YZ6 A;  7ICT A;  1IIP A;  2DFL A;  5AKX A;  1M9Y A;  4B9L A;  7ICQ A;  3RJE A;  3H8W A;  4J5A X;  1L3S A;  3SZ2 A;  1NK6 A;  2X2C K;  4ZSC A;  4B9M A;  7ICG A;  2F8L A;  5DBC A;  5A0L A;  3GU3 A;  1SXE A;  9ICK A;  4N1Q A;  2AGQ A;  1UT5 A;  3C23 A;  1UA1 A;  5ALM A;  1QNH A;  5AKL A;  4ED3 A;  3AM9 A;  1C20 A;  4F5R A;  4B9U A;  3QNM A;  1COK A;  4EBD A;  4N1N A;  1LB2 B;  2EZX A;  1NKB A;  2PFP A;  1ZQX A;  4FZM A;  4PH5 A;  3KZX A;  2W9A A;  4J9M A;  9ICJ A;  4NJ8 A;  3ODL A;  3F2D A;  3Q8R B;  1QQ5 A;  5GTH U;  2XC9 A;  9ICW A;  2N1R A;  2UVU A;  3K0Q A;  2VAN A;  5KL8 B;  2ODG A;  3JPT A;  2F76 X;  3WK8 A;  2WF6 A;  8ICH A;  3MGH A;  1TVA A;  1XWN A;  2LYB A;  3R49 A;  3RCI X;  1XQ7 A;  1ZRN A;  4F5O A;  3NS1 A;  9ICG A;  3ORY A;  1W8V A;  2A1A A;  1TE2 A;  4DL4 A;  3ZD8 A;  4EX7 A;  4J03 A;  2MVZ A;  2IA6 A;  1M9F A;  1WWV A;  3QU2 A;  3WU2 U;  4YD2 A;  1BPX A;  2W9B A;  4YP3 A;  4R64 A;  1SWV A;  2W55 A;  5CCN A;  2HBK A;  3V6K A;  5KV5 A;  2ZUC A;  3RJI A;  5EE1 A;  3JPS A;  5J8Y C;  4MF8 A;  4U6P A;  2H3Z A;  5KV3 A;  4YUI A;  3KHL A;  5KFW A;  5AM2 A;  2BCV A;  5DB9 A;  1A33 A;  1SB3 C;  1TKD A;  1X9W A;  4ED0 A;  4DQP A;  4P4M A;  1URJ A;  2VJ4 A;  3T5L A;  3UQ0 A;  4B6J A;  5AKE A;  4QZB A;  5AKK A;  4MFF A;  3NVV A;  3V7K A;  1SV4 A;  3KD3 A;  3M1Y A;  5KT2 A;  1J2M A;  2IGW A;  1ZD4 A;  4BGD A;  3EPG A;  4NV0 A;  4IC9 A;  3UXP A;  3TFR A;  9ICH A;  4YUP A;  3IRU A;  3JPP A;  1LKY A;  3BKP A;  4DGC A;  3AQF A;  2FLN A;  3QZ7 A;  5KFZ A;  5DLG A;  1ZQW A;  5DBA A;  5GTI U;  1ZQJ A;  1UCV A;  4QWA A;  1RXV A;  1QOI A;  1XO0 A;  2P6U A;  2G09 A;  1MN8 A;  4J5B A;  4RPY A;  3GV7 B;  1JXL A;  1MZW A;  4DGA A;  2X25 B;  2W9C B;  5CCS X;  3TI0 A;  1Z00 B;  3T3F A;  4KLU A;  2A2N A;  4JCP A;  2ZIX A;  3K75 D;  1SZP A;  7ICL A;  2WAQ C;  2XI9 A;  3KKA A;  4ECU A;  2KJ8 A;  4R8U B;  4F4K A;  3D2Q A;  4KX3 A;  1CWF A;  4DF8 A;  3RH5 A;  1Q3U A;  4I2E A;  1QSL A;  1X6I A;  1PVQ A;  1QSS A;  1MQ2 A;  2ISO A;  4DLE A;  1OCA A;  3E2E A;  1CWI A;  5CRX A;  5T14 A;  2W7P A;  5KG3 A;  4F2S A;  2ZXH A;  4DLG A;  2DGZ A;  3M8R A;  4FRU A;  1M6Y A;  2LHT A;  5FP0 A;  3IM1 A;  1L7M A;  4YUM A;  4NY8 A;  3RBE A;  5KG5 A;  5KT4 A;  2IHN A;  2AQ0 A;  4RUC A;  5J0P A;  4UB8 U;  3NVY A;  5J0U A;  3LDA A;  2F1H A;  3R59 A;  3SAH A;  3N7P D;  2DPJ A;  4QZF A;  5JHE A;  2P6R A;  3DDH A;  1U49 A;  1TAU A;  1OW5 A;  3PW2 A;  2ASL A;  2IOH A;  1YZ7 A;  3OSN A;  1WCN A;  1X66 A;  1VDV A;  2JEI A;  5ALR A;  8ICR A;  5J0Q A;  1V9T A;  4UAT A;  3RCK X;  2OEH A;  2Y0S C;  2R8J A;  2EH9 A;  4UB5 A;  5CHG A;  4YMO A;  4QZD A;  4ECR A;  5F9L A;  1N56 A;  4YN4 A;  1ZRM A;  5CWR A;  4DSE A;  5G5G A;  4J9L A;  1ZKF A;  1XYH A;  2QB1 A;  2HVI A;  4PZO A;  2NRX A;  1X40 A;  5EOZ A;  2CXY A;  1S5L U;  4FFD A;  3ISB A;  2W03 A;  3SMV A;  2HBM A;  4RQ5 A;  1L7N A;  4GXK A;  1GO3 F;  2C22 A;  4DFD A;  5HHH A;  1RQL A;  2RP5 A;  2RMA A;  2HHS A;  4S1E A;  5IIL A;  3NUQ A;  4RZR A;  1PVP A;  1QTM A;  3JPR A;  1HIW A;  3TKA A;  3UXN A;  5KFH A;  5J2A A;  1L3T A;  4F4Z A;  4BXO B;  3V7L A;  3KBB A;  4DQI A;  3NVZ A;  5DGA A;  2GWS A;  2XO7 A;  4MFA A;  4RNO A;  2WHE A;  3NVW A;  3HP6 A;  4PGQ A;  3S6J A;  4ECW A;  1N63 A;  4BWJ A;  1DYW A;  8ICB A;  3PW4 A;  2WF9 A;  1BNP A;  2XGP A;  1K1S A;  3R56 A;  2PMZ C;  2B71 A;  4JWM A;  4NM2 A;  2DBY A;  4M0A A;  2KK0 A;  5AM3 A;  8ICJ A;  8ICM A;  2DKX A;  8ICF A;  4PHP A;  3PY8 A;  2DL0 A;  4UB6 U;  5KG6 A;  3PW0 A;  4C7Z A;  1DXS A;  1SXD A;  1NJY A;  1N48 A;  3C5G A;  1T8E A;  4BUG A;  3ZD9 A;  3A0H U;  2EZY A;  1U47 A;  3IG8 A;  1L7O A;  4JB3 A;  4PGX A;  2W8K A;  3RTV A;  2Y9T A;  3KKA C;  2CPL A;  3MR3 A;  1ZQK A;  4KX5 A;  2DWQ A;  2I9G A;  2KVC A;  3M7D A;  3WK4 A;  4ED1 A;  1Z1B A;  1ZQP A;  3SQI A;  8ICC A;  2E8N A;  4UAV A;  4J5C X;  4QIW C;  4F4Y A;  4RQ1 A;  1CI4 A;  9ICS A;  1ZQH A;  3PST A;  4I2F A;  4YUH A;  1SZH A;  2XCP A;  1QQ7 A;  2WLW A;  3SEN A;  1IST A;  4O3Q A;  5L1K A;  2EAO A;  3FC4 A;  9ICI A;  5AIA A;  1W74 A;  3MAB A;  4P0Q B;  2G06 A;  4KLI A;  4C4S A;  2HHX A;  1KTQ A;  3OSP A;  4KLJ A;  1FGL A;  5AM4 A;  1NK4 A;  4DS4 A;  3KHG A;  3G6X A;  4JUZ A;  3CNH A;  2KD1 A;  5CCR A;  1BPZ A;  4EEY A;  3F2B A;  1JIH A;  3PX4 A;  2KJ9 A;  4RQ8 A;  1Z81 A;  1NZB A;  2YY6 A;  5ALK A;  5KUV A;  4RQN A;  2KA0 A;  3Q8Q B;  5CA7 A;  4UAS A;  9ICA A;  1A76 A;  1NZP A;  4A8E A;  1AWR A;  4Y2R A;  7ICU A;  3H4B A;  3VA7 A;  1FEZ A;  2MZU A;  1TK8 A;  2EQY A;  4Y2P A;  2RS4 A;  2KMD A;  2K4E A;  4I2J A;  5J2B A;  1L6N A;  2W54 A;  4MFC A;  2BDP A;  4I2D A;  1OXJ A;  5D46 A;  1UHU A;  2CPR A;  4I9Y A;  2DKZ A;  3MR5 A;  8ICV A;  3RFY A;  5AI5 A;  5DUD A;  4USA A;  1PZN A;  1CWJ A;  3ZDE A;  1FFV A;  5DG7 A;  3PV8 A;  1UT8 A;  4Y2Y A;  5HML A;  4DL7 A;  5AKI A;  4O5E A;  4CGZ A;  1TK5 A;  5ALG A;  5J2I A;  3ISD A;  3PO5 A;  1AWQ A;  1A77 A;  2G0A A;  4RU9 A;  3QX7 A;  3MDC A;  5JRT A;  2KJ5 A;  4N1O A;  3TQ1 A;  1EXN A;  1DK3 A;  2NO5 A;  3IDW A;  5ALQ A;  4YQW A;  2JMG A;  2NNZ A;  3PR5 B;  2AGO A;  5ALL A;  3H4D A;  3BQ7 A;  3SV3 A;  1QSY A;  2PLU A;  4C8O A;  4I2I A;  4LZG A;  4QWD A;  2DQN B;  3IP4 B;  2ALZ A;  1KRP A;  3B9J A;  4LZD A;  4NL9 A;  1CEZ A;  4E0D A;  5TZV A;  2IOF A;  1M63 C;  4OJ6 A;  3Q8L A;  4NXZ A;  1WCL A;  5ALO A;  5KV1 A;  2ASD A;  2W7O A;  4DQR A;  3GV8 B;  3GV5 B;  3TAD C;  3RH6 A;  8ICA A;  2ZP2 A;  4P4P A;  2PXI A;  2ZTE A;  4RUA A;  2XCA A;  2I6X A;  2GOL A;  2YMP A;  3H0R B;  2K4P A;  2KSO A;  3RD9 X;  4DL6 A;  4RNM A;  2G5I B;  2XGQ A;  4CRX A;  3MGV A;  3U26 A;  5KFJ A;  5KFD A;  2E3T A;  7ICK A;  2JV3 A;  1N5X A;  2V4R A;  4N1S A;  1VBT A;  5AK4 A;  5C0Y A;  4DL3 A;  2PI4 A;  4NLK A;  2ZTD A;  2ZIV B;  4CF5 A;  5D4B A;  5EE9 A;  3QUC A;  4KLD A;  3FYH A;  2LPE A;  3K0P A;  5KFU A;  5KG1 A;  9ICT A;  2JZB A;  3IN5 A;  3Q8P B;  4EX6 A;  2I1Q A;  3TFS A;  3M8S A;  4B9S A;  1L8L A;  4DOB A;  1V97 A;  4QZC A;  1T7P A;  1HUZ A;  1Z19 A;  2YB1 A;  2KIC A;  5L1J A;  4NLB A;  2FPM A;  1CLH A;  2WFA A;  2IOF K;  3LK9 A;  3RCL A;  4CDG A;  4QZH A;  1NK0 A;  4YG2 A;  1UQV A;  5J2D A;  5J2J A;  5J2C A;  4GXI A;  5EWG A;  2ZXI A;  4GC6 A;  2FDR A;  5KV6 A;  1N62 A;  2LM1 A;  4RT3 A;  3N4M B;  3JB9 d;  7ICV A;  4ED6 A;  1FO4 A;  4DFJ A;  2FMQ A;  4DO9 A;  2OCE A;  1S9F A;  4J58 A;  2KKP A;  2XGY B;  3C29 A;  3IG5 A;  4KLS A;  1NK9 A;  1U48 A;  7ICM A;  2FPL A;  4FE3 A;  4Z6E A;  4XRH A;  5KV7 A;  2HW3 A;  1ECW A;  2HAQ A;  1XC9 A;  1Y88 A;  4ED2 A;  3RB4 A;  3FDS A;  1CWM A;  3H8J A;  2I5H A;  2XIC A;  2NRZ A;  2LYH A;  2ATL A;  2OWO A;  4BWM A;  2CN1 A;  2NV3 A;  2K8B B;  4BDP A;  2ESE A;  4O8I A;  3C28 A;  3MFH A;  5D49 A;  8ICQ A;  4U7C A;  4IRK A;  1S77 D;  1N61 A;  2F1I A;  2DPI A;  4I27 A;  1M9X A;  4YR0 A;  2POE A;  4F91 B;  3RB3 A;  3RDC A;  4FBU A;  4EBC A;  1BPB A;  4AYB F;  4CNQ A;  3QYP A;  4EEN A;  1BNO A;  4Y2T A;  3BJY A;  2Y1I A;  1JMS A;  2HHU A;  3CP8 A;  3B0X A;  1RG6 A;  3GZF A;  3C2L A;  8ICN A;  5KT5 A;  1CUK A;  2ZJ8 A;  1FFU A;  1WUD A;  1M9E A;  3RR8 A;  2C3B A;  5HR6 A;  4C4T A;  2KIW A;  1IHG A;  1C5F A;  4YXJ A;  2FMP A;  4M47 A;  1NK8 A;  4ECY A;  3RH4 A;  2HI0 A;  4EZ9 A;  5KG2 A;  8ICI A;  4C4R A;  4FS1 A;  5IIN A;  4RQ7 A;  4QNL A;  3RJG A;  1KEJ A;  1ZQE A;  1DK2 A;  1Q8K A;  1U9L A;  1U4B A;  3MR6 A;  2KEY A;  2NRT A;  5CEH A;  2JEG A;  4TUR A;  5KFQ A;  1KFS A;  2BQR A;  2QER A;  1S0O A;  4TUQ A;  5DBB A;  5KUU A;  2H3I A;  4F72 A;  2NYV A;  1SV0 A;  2HCF A;  5ALS A;  2W3R A;  1TAQ A;  5KUZ A;  4MHV A;  4F71 A;  2CMT A;  3GQC A;  3AUO A;  5KFX A;  4KLM A;  3EZ5 A;  4YR3 A;  4IR1 A;  1NJW A;  2HOQ A;  2OJU A;  4CCH A;  4UBB A;  2VJ5 A;  2F44 A;  3AL0 B;  4IQT A;  4RPZ A;  2E8M A;  2XY6 A;  2KE7 A;  3AU6 A;  4RQM A;  3RCG A;  1KW4 A;  4HYK A;  4N1R A;  3NTU A;  3GIK A;  2L5Y A;  1V38 A;  3ODI A;  2AH5 A;  5HP4 A;  4TOT A;  1DOQ A;  3QUT A;  4F3O A;  4FBT A;  3QU9 A;  2QAR B;  4C0Z A;  2D8C A;  2C28 A;  4Q45 A;  4DQQ A;  2JEF A;  1ZET A;  3RR7 A;  1E8K A;  4JJM A;  4GIB A;  1RDF A;  1B4F A;  5L1L A;  4R63 A;  3RB6 A;  1V9P A;  3ED5 A;  4EEK A;  1ZQF A;  5AKJ A;  4K4I A;  4M9L A;  2RLT A;  2HOI A;  4ZOH C;  2BCU A;  2K89 A;  3ZDB A;  3ETR A;  3D2N A;  1S0N A;  2KZZ A;  3K0M A;  7ICF A;  2ZIX B;  4QZG A;  5AIC A;  5KG7 A;  4UAW A;  3JPQ A;  4C7Y A;  2Y9U A;  2YTU A;  5B5E U;  3K0N A;  3AQE A;  1RMH A;  5BOL A;  3RBD A;  4AP9 A;  4X5V A;  3RCF A;  2R8G A;  1D8L A;  1NK7 A;  1ZQM A;  4R3E A;  5ALP A;  1SIJ A;  5HHI A;  4TQR A;  4KLE A;  4IQV A;  2ISP A;  1XSP A;  3C21 A;  4KTQ A;  4IQW A;  2F77 X;  2VA8 A;  4KLQ A;  1AQ6 A;  3T1U A;  3CYS A;  4GC7 A;  2OHF A;  3QYU A;  2NUL A;  3UMG A;  2YMM A;  4KLL A;  3OGU A;  5AI8 A;  4YFK A;  4NM1 A;  2CRX A;  3TAC B;  3JPO A;  4UB1 A;  2WFJ A;  2IHM A;  2KKV A;  4BXO A;  2BPG A;  1PVR A;  5DQG A;  3GIL A;  5IIK A;  8ICO A;  1BVS A;  3PO4 A;  5AI9 A;  2FU0 A;  3PX6 A;  3JPN A;  4O5K A;  2ZIU B;  4PL1 A;  3OJS A;  3TAR A;  2X83 B;  2Z7J A;  3C1Z A;  3J81 j;  3GII A;  4XQ8 A;  4MEY A;  3M9M B;  1D8Y A;  3T5H A;  4Q8F A;  2OSE A;  5HMM A;  4YR2 A;  3BQ1 A;  3PW5 A;  2MRL A;  1PK1 A;  5KFB A;  3RRG A;  5KG0 A;  4OD0 A;  5AHX A;  2JRZ A;  2RRD A;  4DCC A;  1ZQC A;  5III A;  1Z1V A;  2RMC A;  1B43 A;  4JMU A;  4GFJ A;  4UW9 A;  4C8M A;  7ICH A;  2R99 A;  1E3B A;  3OPF A;  3Q8K A;  5DLF A;  3PSF A;  1KFD A;  3G6Y A;  4DQS A;  5AK3 A;  4JK1 A;  3PVX A;  2BQU A;  3UM9 A;  5L9X A;  4IL6 U;  3SAF A;  2WF5 A;  2RDI A;  4TUS A;  4I2H A;  4YMN A;  4UAZ A;  2LI6 A;  2BQ3 A;  3VC8 A;  3UPQ A;  1O08 A;  3GIJ A;  3F5A A;  2HQJ A;  3C1Y A;  3LWL A;  3EUB 2;  4P0Q A;  4Q43 A;  3H40 A;  3V72 A;  4WJ3 B;  1NJX A;  2POY A;  1T3Q A;  2OK3 A;  4RQ4 A;  3RB0 A;  4YUJ A;  1P7D A;  5CP2 A;  2HSZ A;  1Z4O A;  1Q3V A;  3H0L B;  2BPF A;  4F4W A;  5AI6 A;  4F93 B;  3SAG A;  3TAP A;  2E8P A;  2EAN A;  4IQU A;  4FRV A;  2CK1 A;  4P0P B;  5HR7 A;  4YUK A;  3HT3 A;  4ECS A;  4R65 A;  2AU0 A;  2Y0S F;  2BZF A;  1CWL A;  2UVV A;  2GW2 A;  1YND A;  4IRD A;  3A0B U;  2ES6 A;  3KTQ A;  3KHR A;  7ICE A;  1X6J A;  4CYH A;  5J2K A;  4P4O A;  2YB4 A;  3DV9 A;  2FLL A;  1XS9 D;  4NLZ A;  1RZT A;  1PUZ A;  4Z6D A;  4QZA A;  1CWO A;  4Y2X A;  8ICP A;  3GIM A;  4EZ6 A;  1D9D A;  2X2D B;  4I2B A;  4XA5 A;  5KT3 A;  3QU4 A;  4J9R A;  1ZQD A;  4I29 A;  3C2M A;  1RXW A;  2G5H B;  2YN4 A;  3O0F A;  5ALI A;  1ZQV A;  2MUT B;  1XNS A;  1BPE A;  4DSI A;  4RNN A;  1LOP A;  2ZIW B;  3HW8 A;  4C8N A;  2NO4 A;  1X9X A;  1ZQR A;  5KFR A;  4DSL A;  2D3D A;  4YD1 A;  2HE9 A;  1MIK A;  3DEE A;  2WB1 F;  2KV2 A;  3V7J A;  5ALZ A;  3K1Z A;  3MR2 A;  4O3P A;  3QUB A;  2EZZ A;  1SL1 A;  3ZI4 A;  3SV4 A;  3L3F X;  5KT7 A;  4YUN A;  4XUS A;  3BS5 A;  2HBJ A;  2E5S A;  2KZM A;  3D2S A;  4OJP A;  4HY7 A;  4J9K A;  2HMX A;  2ZJA A;  5C5J A;  4F5N A;  2DF4 B;  4US9 A;  1K1Q A;  1QQ6 A;  1ZQT A;  1D8B A;  3BT8 A;  1XO7 A;  3L5K A;  4OJ5 A;  4DL5 A;  4I28 A;  4FO6 A;  5CBW A;  5CJ7 A;  4LQW A;  2ESL A;  2M0N A;  2RMB A;  2RQ5 A;  1CWC A;  5KUW A;  5ALT A;  5AKY A;  5F66 A;  5EWF A;  7ICS A;  2K7N A;  3H7I A;  3HKZ F;  1CYN A;  3BZK A;  5KUO A;  2A19 A;  4DFP A;  1L8O A;  3O7T A;  3N7S C;  4DSJ A;  5JU5 A;  3C5F A;  2QB0 B;  4ELV A;  4HAI A;  4I2C A;  4EEL A;  3F5E A;  5J2H A;  1YT3 A;  5KFI A;  3MML A;  4ELU A;  2F3N A;  3UCH A;  1V85 A;  2ZIV A;  4J9P A;  2AGP A;  1AWS A;  1ZQ1 C;  2YX8 A;  4QW9 A;  2KP7 A;  3CYM A;  4UAU A;  4G3I A;  1T4G A;  3RAX A;  2J6T A; 
#chains in the Genus database with same CATH homology
 2KHV A;  3F53 A;  4ACO A;  2XID A;  3GZF A;  5JHE A;  3H0M B;  1VAI A;  2MA1 A;  1F44 A;  1WUD A;  3ICX A;  1M9E A;  2C3B A;  4R3F A;  5HR6 A;  2KIW A;  1IHG A;  1C5F A;  1V9T A;  2CFE A;  3RCK X;  2Y0S C;  2ZIW A;  2X2A A;  2HBL A;  4QNL A;  1AWV A;  1BCK A;  1VDN A;  1ZKF A;  1XYH A;  5CBT A;  5KUL A;  1NMK A;  3VCB A;  2E1F A;  2JH7 A;  2KEY A;  5KV4 A;  2W03 A;  3SMV A;  2HBM A;  5KUN A;  2QER A;  2P0O A;  1GO3 F;  2KHQ A;  5KUU A;  2H3I A;  2RP5 A;  2RMA A;  4S1E A;  2LYA A;  3NUQ A;  1PVP A;  1HIW A;  1M9C A;  3K2C A;  5KUZ A;  2CMT A;  2PMZ F;  3RDD A;  1CWK A;  4ZSD A;  2A3V A;  2HOQ A;  2OJU A;  5CYH A;  4J5D X;  1DYW A;  2VJ5 A;  3AL0 B;  2N0T A;  1OUQ A;  1W8M A;  2MS4 A;  3RCG A;  3R56 A;  4N1R A;  2BIT X;  2PMZ C;  3R54 A;  3ODI A;  2K8C B;  2B71 A;  3R57 A;  4TOT A;  2IGV A;  1ED1 A;  4NWI A;  3M6K A;  5KUR A;  4C0Z A;  1QNG A;  2BDU A;  2LKY A;  3N7R C;  1E8K A;  4JJM A;  1AWU A;  4BUG A;  4ICA A;  4QIW F;  3NRW A;  3IG8 A;  2ZG6 A;  1M9D A;  2WFI A;  2JH1 A;  2Q4T A;  2CPL A;  3ORE A;  4KX5 A;  3ICI A;  2KVC A;  3M7D A;  4DGB A;  3CYH A;  1Z1B A;  3SQI A;  2HOI A;  4FZL A;  4QJF B;  2R18 A;  5KUS A;  2K89 A;  4DGD A;  4J5C X;  3D2N A;  4QIW C;  3K0M A;  3PSI A;  2HQ6 A;  2ZIX B;  3PST A;  4YUH A;  1SZH A;  1X7F A;  2WLW A;  2JGA A;  1IST A;  2VIX A;  4IPZ A;  3K0N A;  3RDA X;  3AQE A;  4AYB C;  2F2A B;  1W8L A;  1W74 A;  1RMH A;  4P0Q B;  2G06 A;  2KNJ A;  3RCF A;  1AWT A;  2KOB A;  1FGL A;  1ZMF A;  2D6F C;  1A0P A;  4DGE A;  4R3E A;  2GH1 A;  2OXO A;  3T79 A;  5CCR A;  2KD1 A;  1HEK A;  3MML B;  2F77 X;  1VBS A;  3T1U A;  3F2B A;  3CYS A;  3F2C A;  2BIU X;  4O8H A;  3RF9 A;  3QYU A;  2NUL A;  2KJ9 A;  2OH2 A;  1Z81 A;  2CYH A;  1NZB A;  5KV2 A;  4YUL A;  5KUV A;  2CRX A;  2G07 A;  2WFJ A;  2KKV A;  3ICH A;  1PVR A;  4FZN A;  4A8E A;  1CRX A;  2OYY A;  1AWR A;  2H3V A;  2PHC B;  3VA7 A;  4EYV A;  2MZU A;  2FU0 A;  1MA7 A;  2RS4 A;  4N1M A;  2K4E A;  1L6N A;  2ZIU B;  1AK4 A;  1MF8 C;  4PL1 A;  2X83 B;  2MC9 A;  2Z7J A;  2W04 A;  3ALR A;  2K4I A;  4I9Y A;  2CPR A;  4KMO B;  2OSE A;  3RFY A;  2Z6W A;  3K0O A;  5DUD A;  5CBV A;  2HOF A;  2MRL A;  3R4G A;  1CWJ A;  3PSP A;  2XVT A;  4CGZ A;  2RRD A;  2G08 A;  1A6S A;  1CWH A;  2RHF A;  1AWQ A;  5CCQ A;  3OEP A;  2G0A A;  2RMC A;  4JMU A;  4GFJ A;  2R99 A;  1T94 A;  2KJ5 A;  1E3B A;  3OPF A;  4N1O A;  3PSF A;  1IIP A;  1M9Y A;  4XNC A;  2JMG A;  4J5A X;  2X2C K;  3SAF A;  3BO7 A;  2PLU A;  3LVV A;  4ZSC A;  2F8L A;  2DQN B;  3IP4 B;  3VC8 A;  5A0L A;  3GU3 A;  4BX9 C;  4N1Q A;  3K0R A;  3F5A A;  2HQJ A;  1M63 C;  1QNH A;  4OJ6 A;  4P0Q A;  4WJ3 B;  5KV1 A;  4N1N A;  2W7O A;  2POY A;  1KBU A;  2OK3 A;  4FZM A;  4YUJ A;  5A0E A;  3KZX A;  2ZP2 A;  1P7D A;  1Q3V A;  3H0L B;  3ONN A;  2GOL A;  3SAG A;  3H0R B;  3ODL A;  3F2D A;  3RD9 X;  2G5I B;  4NLC A;  4CRX A;  3MGV A;  4FRV A;  2CK1 A;  4YUG A;  2N1R A;  4P0P B;  5HR7 A;  4YUK A;  1A58 A;  4N1S A;  1VBT A;  3K0Q A;  1TAM A;  5KL8 B;  5CBU A;  5C0Y A;  2ALF A;  4PL2 A;  1ZKC A;  2Y0S F;  2F76 X;  1CWL A;  2GW2 A;  1YND A;  1XWN A;  2ZIV B;  2LYB A;  3R49 A;  3RCI X;  1XQ7 A;  3S6M A;  3K0P A;  4CYH A;  2H3Q A;  2YB4 A;  1W8V A;  1CWO A;  2E1E A;  1CWA A;  3IN5 A;  2MVZ A;  1M9F A;  2X2D B;  2ZIU A;  2LBO A;  5CCN A;  2HBK A;  5KV5 A;  4U6P A;  2G5H B;  1DRG A;  2H3Z A;  5KV3 A;  3O0F A;  4YUI A;  1XNS A;  1Z19 A;  2YB1 A;  3LVW A;  1A33 A;  1LOP A;  2OM6 A;  4BJQ A;  2KIC A;  2ZIW B;  2X7K A;  3M6Z A;  4NLB A;  1CLH A;  3LYS A;  1URJ A;  3RCL A;  3RDB A;  2VJ4 A;  4CDG A;  3CRX A;  4N1P A;  2HE9 A;  4YUO A;  1MIK A;  3DEE A;  2WB1 F;  2KV2 A;  2ZXI A;  3K1Z A;  4E1Q A;  3PZP A;  2K8A A;  2IGW A;  3L3F X;  5KV6 A;  4YUN A;  4S1J A;  2JHD A;  4NV0 A;  4IC9 A;  3JB9 d;  4OJO A;  4YUP A;  1J2A A;  2HBJ A;  1UPH A;  2E5S A;  3D2S A;  4J58 A;  2KKP A;  2XGY B;  3C29 A;  3AQF A;  3BKP A;  4OJP A;  4J5E X;  2WAQ F;  4HY7 A;  4DGC A;  3IG5 A;  5KV0 A;  2WB1 C;  4FE3 A;  3EOV A;  1QOI A;  1XO0 A;  5KV7 A;  2HAQ A;  1ECW A;  2G09 A;  2HMX A;  4J5B A;  1MZW A;  4DGA A;  2DF4 B;  2X25 B;  1CWM A;  5CCS X;  5KL1 B;  1D8B A;  2XIC A;  2A2N A;  3BT8 A;  4JCP A;  2ZIX A;  1XO7 A;  4OJ5 A;  3RFA A;  2WAQ C;  2XI9 A;  2KJ8 A;  2CN1 A;  2NV3 A;  3D2Q A;  5CBW A;  4LQW A;  4KX3 A;  2K8B B;  2ESL A;  2M0N A;  4O8I A;  2RMB A;  4OJL A;  3C28 A;  2K4H A;  1CWF A;  4U7C A;  1Q3U A;  1CWC A;  5KUW A;  2H3F A;  2VKQ A;  5F66 A;  1M9X A;  2POE A;  3E0F A;  4O3M A;  1PVQ A;  2K7N A;  3OPX A;  4P0P A;  3RDC A;  3HKZ F;  1CYN A;  3PMP A;  4OO1 J;  5KUO A;  5LUD A;  1OCA A;  3O7T A;  3N7S C;  1CWI A;  3KFU F;  5CRX A;  5T14 A;  4AYB F;  2W7P A;  1H0P A;  3F5E A;  1YT3 A;  2ZXH A;  3MML A;  3UCH A;  2DGZ A;  2ZIV A;  4FRU A;  2LHT A;  4YUM A;  1AWS A;  1ZQ1 C;  2YX8 A;  3CYM A;  3HKZ C;  1CWB A;  4J59 A;  5KUQ A;  3R59 A;  3SAH A;  3CP8 A;  3N7P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...