1IIPA

Bovine cyclophilin 40, tetragonal form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
297
Chain Sequence
b'SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin 40
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
total genus 102
structure length 297
sequence length 297
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.160 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1iipA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1iipA01
4J59A 5CCQA 2X2CK 1J2AA 1A58A 3ODIA 2RMBA 3K0QA 4YUIA 3JB9d 4YUGA 3R57A 1CLHA 2RS4A 2MVZA 4DGCA 1AWSA 1CWHA 3CYHA 2X83B 5F66A 1V9TA 4N1RA 3BT8A 2NULA 3RD9X 2POEA 4N1OA 1IHGA 2N0TA 2WFIA 4O8IA 1Z81A 3RDDA 4E1QA 1H0PA 3R49A 4EYVA 2X2AA 4O8HA 5KV6A 5CBTA 5DUDA 5LUDA 1VAIA 3R59A 1IIPA 4R3FA 1NMKA 4YUMA 5CYHA 3K0PA 3QYUA 2CPLA 3K0RA 1CWLA 4LQWA 5KUQA 1DYWA 2MS4A 4ZSDA 5KUNA 1VDNA 1CWJA 1ZKCA 3R56A 4J5AX 4S1EA 3UCHA 2B71A 3RCGA 3R4GA 2HE9A 1W8LA 3T1UA 1BCKA 2RMCA 2POYA 4DGEA 1ISTA 1YNDA 1QOIA 2ESLA 5KUVA 2ALFA 5KUSA 3RDAX 2C3BA 1MIKA 2IGWA 2R99A 5CCNA 4YUJA 3OREA 3K0NA 3RCLA 1M9EA 1M9YA 2ZP2A 4YUHA 1M9XA 4S1JA 2XGYB 2MZUA 4DGBA 1XQ7A 3S6MA 4YUPA 4YUKA 4N1NA 5CCSX 5KV0A 4YUOA 4J58A 1CWOA 5CBUA 1MZWA 2MC9A 3R54A 1CWIA 2HQJA 3RCIX 2OK3A 4FRVA 4IPZA 1XWNA 5CCRA 1VBSA 4XNCA 1OCAA 1AWRA 4N1SA 5KV4A 1AWQA 1LOPA 3RDCA 4TOTA 1XYHA 5KV3A 5KUZA 3RCKX 2OJUA 1CYNA 1QNGA 1M9CA 2PHCB 1CWFA 1X7FA 3PMPA 3OPFA 1RMHA 5KUWA 3OEPA 1M9FA 2PLUA 4J5DX 1VBTA 2BIUX 5KV1A 1QNHA 3BKPA 5KV7A 5CBVA 2FU0A 3MMLB 1W8VA 5JHEA 2GW2A 4DGAA 3K0MA 3O7TA 4J5CX 1MF8C 2RMAA 2HQ6A 1AWUA 2CFEA 3RFYA 4FRUA 4R3EA 4DGDA 5KULA 1C5FA 1W8MA 1ZKFA 2WLWA 1FGLA 1AWTA 2CYHA 2X7KA 3VA7A 1W74A 2K7NA 4YULA 1M63C 1CWAA 3EOVA 3ODLA 4N1PA 2X2DB 4JJMA 5KUOA 1M9DA 3ICHA 2A2NA 1ZMFA 2Z6WA 4HY7A 2P0OA 3K0OA 4ZSCA 5KV2A 4N1QA 1E8KA 4I9YA 4J5EX 2CK1A 3ICIA 5CBWA 2WFJA 3CYSA 5KURA 5A0EA 4CYHA 3BO7A 1E3BA 2OSEA 2X25B 3RDBA 3RCFA 1CWKA 2CMTA 1CWBA 1AK4A 2IGVA 3MMLA 4N1MA 1AWVA 2BITX 3K2CA 1CWMA 1CWCA 1XO7A 5KUUA 2QERA 4YUNA 1A33A 2HAQA 4J5BA 4JCPA 5KV5A
chains in the Genus database with same CATH superfamily
2JGAA 3RR7A 5CCQA 5J0WA 3RTVA 3K0QA 1DGSA 4R65A 3R57A 3TKAA 2RS4A 3K75D 2M9NA 2F2AB 4DSIA 4EYVA 5AIBA 4O8HA 2K4HA 5KV6A 4OJ5A 3MABA 2DPJA 5AI4A 2MS4A 4JWNA 5KFSA 2A1JB 5J2FA 5J2CA 4BXOB 1B4FA 3T5JA 2YMMA 1BCKA 1DK3A 1PK3A 2G0AA 2ESLA 5DDYA 2RDJA 3DDHA 2C28A 3THVA 2HHUA 4YUJA 8ICPA 1SZHA 2F1IA 2E8MA 5J0SA 3KHLA 2C2DA 1ZQRA 2YX8A 4KLTA 8ICFA 4DS5A 4UAUA 4ECUA 4J58A 2PFPA 4QZDA 2PMZF 2ZIXA 1ZQQA 2KEYA 4I2IA 2WF5A 3MDAA 3N97B 4OJLA 5KV3A 5KUZA 9ICPA 3LK9A 2LKYA 2WAQC 1ZX8A 1X6JA 5D49A 8ICYA 1MA7A 3GV8B 1S97A 2PMZC 3D2QA 2CRXA 2LM4A 1V38A 1QQ6A 4UB4A 3F2CA 1BGXT 3MDCA 4EBEA 1PVRA 4IR1A 3HP6A 4DOCA 4PJ0U 3KOOA 2HCFA 7ICMA 2E3TA 4NV0A 2OH2A 3NS1A 1IV8A 1VDVA 1N5WA 5CBWA 1QQ5A 2OCEA 5DBAA 4ELTA 4IR9A 4P2HA 7ICJA 4ECXA 4NXZA 4FS1A 2BITX 3I76A 1B0XA 3RAQA 2QERA 2H3VA 1QH9A 1J2AA 4DSEA 4YUIA 3NUQA 5AI0A 5KT3A 5J2IA 2ESEA 3FAHA 1ZQ1C 4N1RA 2HOIA 1ZQAA 3KZIU 3R49A 3M6ZA 2X2AA 5DUDA 2NV3A 5AKKA 2RRDA 3QU4A 4NJ8A 3MR6A 3BQTA 1SGGA 2FDRA 1RYUA 2EDUA 2NRWA 1CUKA 1B22A 2POYA 4O9MA 2KSOA 2YMPA 2H3IA 5KUVA 1NK7A 5IIKA 2GOLA 4F93B 3OSPA 4MF8A 2G07A 3RB3A 8ICRA 2KNJA 4KLSA 2MZUA 2UVVA 1ZETA 5CCSX 2EZXA 2K8AA 4BWJA 4JV0A 3WKBA 1L7MA 9ICMA 1ZD2P 5CB1A 5KV4A 1QTMA 2ASLA 1RXWA 3ZD9A 2HBKA 1CYNA 4ECSA 2OJUA 4P4PA 3OPFA 1RMHA 1Z3EB 3AL0B 3Q8RB 2EQYA 5DG8A 5JHEA 3OJUA 3QU7A 3O7TA 1MF8C 2RMAA 4F5QA 4I29A 3I1YA 4OD0A 1AWUA 5DGBA 5ALLA 1U49A 2W9CB 4R3EA 3BQ0A 1F44A 3C23A 2KIWA 3A0BU 3RR8A 2CYHA 2PI4A 4Y2QA 2XCAA 3SI8A 3M7DA 5D46A 2KK0A 1ZRNA 1E8KA 3BQ2A 5C5JA 5KURA 2BZFA 4YR2A 5ALMA 2XY7A 4KLGA 1ZQEA 8ICXA 3QYPA 4CCHA 4QWDA 3BQ7A 4YUNA 4PZOA 4NL9C 3JPPA 3NASA 1CLHA 4UB2A 1CWHA 2AXTU 1J97A 4M2YA 8ICAA 2G5IB 9ICHA 4YUMA 4BDPA 3RF9A 3EPGA 2XI9A 3F53A 2ZTCA 4R64A 3RCGA 3KHGA 3ALRA 4UB6U 4PZNA 3QXGA 2ALFA 1T7PA 4RQ3A 1LKYB 4GLXA 2W54A 1M9YA 4DF4A 3GZFA 4YVZA 2NRZA 2Y9TA 2BCSA 2PFQA 4DL3A 2NRXA 3ZDBA 4IQVA 4RT3A 5AK5A 1NK5A 2FJ6A 1VBSA 3EWAA 9ICJA 3AMZA 1LOPA 2OXOA 8ICWA 4NWIA 2FPLA 2PHCB 1HIWA 5KFCA 1X7FA 1JROA 3UXPA 3RJHA 2J6UA 4J9RA 4J03A 1MQ2A 2ZIVA 3S6JA 1XSLA 2JR5A 4DWIA 4I2HA 5EE0A 4F72A 3TQ1A 5KFRA 3OGUA 2MAXA 3JPTA 1V85A 1ZXIA 3GV7B 4EZ6A 4FRUA 2OM6A 1UT5A 1L3UA 5EWGA 1NI3A 4HAIA 4QWAA 2IHNA 2RP5A 5KUOA 2A2NA 2E8PA 7ICKA 3MFHA 4I9YA 2YMQA 2VANA 4DOAA 2JZBA 2KA0A 3RDBA 5DQGA 3C21A 2YQEA 3SAFA 1TK8A 4KMUA 1URJA 2VA3A 4I2BA 2C2EA 5JRTA 2X83B 2XICA 3ISBA 1UA1A 5J0PA 4I2AA 3QUCA 1Z81A 4R66A 4K4HA 4KX3A 4DFMA 4NM1A 1UHUA 2HDOA 1Z00B 3FYHA 3IG5A 3GIIA 1O03A 3K0RA 4QZAA 1O08A 3ISCA 4Y2XA 4Q8FA 3PW0A 4GC6A 3EYZA 5J2AA 1MIKA 8ICJA 3OREA 3IN5A 4Y2PA 1HUZA 2QARB 3JPOA 4O3OA 4YUPA 2YTUA 4RQ4A 1SXEA 2ASDA 5J2HA 2VKQA 1SV4A 4FS2A 1LV5A 4M9JA 5JUMA 4RZRA 4UB1A 3H0LB 5AI9A 3OSNA 2KE7A 1PZNA 3CP8A 3QUTA 1ZQDA 5F9LA 5ALFA 3DEEA 1SIJA 4O3PA 3AUOA 4EBDA 1RYRA 2QKQA 2GW2A 1SWWA 2CFEA 1KN5A 4PGXA 4JV2A 2Q4TA 5ALIA 4QWCA 3M9NB 1ZRMA 1ZD4A 4XRHA 4JWMA 2E1EA 4JJMA 4BWMA 4DFDA 1S10A 4IRKA 4DL4A 4ED0A 5KT4A 3ICIA 2LBOA 2K60A 2X25B 2WF9A 3MMLA 3L3FX 1SB3C 2LI6A 4QZIA 3A0HU 5DDMA 4DS4A 5J8YA 2X2CK 9ICFA 4J9SA 4YUGA 2ZJ5A 4DSJA 1VLBA 4DGCA 2W8LA 1ZQKA 1QSSA 4UW9A 3ZDCA 1V9TA 3RD9X 2BDPA 3QUQA 4E1QA 5DG9A 1Z1VA 1NZBA 8ICSA 2FE9A 5KUQA 1UQVA 4EELA 2B6GA 4M9LA 3QZ8A 2B71A 3SZ2A 1YT3A 5AKLA 4J9KA 4I2DA 4F91B 4QWEA 4NLCA 9ICBA 3TANA 1A0PA 2HBLA 4YUHA 2DQNB 8ICHA 1N60A 3PW2A 1ZQWA 1CI4A 1RDFA 1ZOLA 4YUOA 4PHAA 2WHEA 1SKSA 1CWIA 1QLNA 1ZQCA 1L3SA 1RQLA 1K1QA 4FE3A 4RNOA 5AIAA 4CF5A 3R9KA 2BDUA 5ALEA 5ALTA 5KFNA 2J6SA 8ICIA 1QSLA 1DGJA 1KBUA 1OXJA 2AQ0A 2QB0A 4RUCA 5E79U 2A19A 1S9FA 2KHVA 3T79A 3MGHA 7ICOA 2A3VA 4NL9A 4PL2A 2EANA 2CN1A 1X9XA 1ZQMA 3PX4A 1S0OA 1L7OA 2MU2A 2W7PA 3VA7A 1BNPA 4J9LA 1FIQA 3V7LA 2Y1JA 3RB4A 1XU4A 9ICNA 2P0OA 1S8OA 5KG7A 4IC9A 1RQNA 1NJWA 1L7NA 4O0IA 1NOMA 3BO7A 1E3BA 3CRXA 4KLMA 3RCFA 4N1MA 1S0VA 4M6WB 3K2CA 1NKEA 5GTHU 4C8KA 3IP4B 2MSNA 4ECYA 4JCPA 4XUSA 5TZVA 3BS5B 2ZIUB 2H3QA 2KVSA 4PPXA 1A58A 3ODIA 5DBCA 4OO1J 4Z6EA 3V7JA 4C8NA 2BHNA 1ZJMA 2N0TA 1H0PA 1JMSA 1HUOA 5DQIA 5KFKA 3TAQA 2M0NA 2ZIWA 4P0PB 4YD2A 2W43A 1SXDA 1VDNA 3Q8QB 3D6JA 4BXOA 5DQHA 2BCVA 4DGEA 5JTIA 3H8JA 1ISTA 4F4KA 3FDSA 4MFAA 5ALOA 3WKCA 5CEHA 1SV0C 2KOBA 1ZQNA 1U9LA 3N28A 1IM4A 5ALDA 3LYSA 4LZGA 3OHBA 5L9XA 9ICKA 4ELUA 5J0TA 1X42A 4YXMA 1KEJA 4F50A 2PKEA 4B9UA 1D8BA 2GLEA 3QU9A 1ZQYA 2Y0SC 2ODGA 5IILA 1FO4A 1DK2A 4G9BA 2NRTA 2MUTA 5AKIA 5EWFA 3RB0A 3PR5B 4O3MA 4J5CX 4I2EA 4XQ8A 1QQ7A 3RFYA 2H3ZA 8ICLA 2QLTA 2FPKA 4DF8A 1A76A 5L1LA 2X7KA 3X27A 4YMMA 5KFBA 3EPIA 1XC9A 3AQFA 2Z6WA 4ZSCA 1KSPA 4PL1A 1TAQA 3ICXA 2V4RA 4GXKA 2BPFA 5J0RA 2FMSA 4Z6CA 8ICVA 4US8A 5ALJA 4RQMA 1RM6C 5AI6A 4DFPA 2KJ8A 3RRGA 4JUZA 4ED7A 3QUBA 2OEHA 4JV1A 1P7DA 3CYHA 3ZDDA 2I6XA 3ONNA 2VJ5A 3WU2U 4YQWA 4RPZA 1RXVA 2ZIXB 3KFUF 4DQQA 1COKA 4EYIB 3KBBA 3DV9A 4GFJA 5KFVA 3UCHA 1V97A 5HMLA 4QNLA 2DKZA 1W8LA 1MC8A 3IV6A 4KLDA 4F92B 4QZHA 1WYGA 3H4DA 2ZTDA 2IBKA 4QZEA 5KFUA 9ICRA 9ICSA 1X6IA 4F5NA 1RZTA 2YMLA 2EAOA 3SENA 5KT5A 3GQCA 3H8WA 2JEIA 1TK5A 1OCAA 3UXNA 5BOMA 1N56A 1TE2A 4RNNA 4P4MA 5D4BA 5KFYA 4KLHA 3I28A 3WK5A 4U7CA 3GIKA 8ICKA 1NK8A 4Q43A 2HHTA 5J8YC 2BIUX 5KV1A 4EYHB 4PGQA 4C8LA 4Y2RA 1BPYA 4IS7A 1UA0A 7ICPA 3MR2A 3QNMA 2HOQA 3QZ7A 3ISDA 1QCKA 4UAZA 4NLZA 3AQEA 4FZMA 2UVUA 4QWBA 3UQ0A 2K7NA 5CRXA 1M9DA 1FFUA 4B9SA 1ZMFA 5KL8B 9ICVA 3H8SA 4AYBF 4N1QA 4CE6A 3CYSA 5AKEA 4Y2YA 3RRHA 2R8KA 5KNIA 4C4SA 3AEVA 2HSZA 5KFZA 4QZGA 1AWVA 9ICTA 2BKEA 5ALGA 4UAVA 3KHHA 8ICBA 5KV5A 2KSOB 4P0QA 2LYAA 1K1SA 4ED6A 5AM1A 2HHSA 2KIVA 4NLNA 4FFDA 3GILA 8ICUA 4N1OA 9ICQA 4AYBC 3SV4A 3TAPA 1A77A 1X9WA 1VAIA 4Y2UA 3ZDEA 2WFAA 2K4EA 2AU0A 2BR0A 2KVCA 1DYWA 3GIMA 2DFLA 4ZSDA 5KFOA 3ETRA 1CWJA 4DEZA 1TV9A 4TUQA 2JEFA 3R4GA 9ICCA 5AHXA 3RAXA 1QOIA 2F1HA 3T5KA 4Q45A 4FO6A 3OJSA 4DFKA 5CCNA 4UASA 3K0NA 1M6YA 4YG2A 3HW8A 4S1JA 2XGYB 4UAYA 1UPHA 4M47A 1NK4A 4ECQA 2P35A 4RQ6A 3BS7A 1KFDA 3PSTA 3NVWA 4BUGA 3D2NA 4F3OA 3PW7A 4QW9A 3RJKA 5ALPA 1U45A 1KRPA 2KFZA 3K4GA 5AM4A 1JRPA 2ZUBA 5L1MA 2D8CA 2BGWA 2BQRA 3NTUA 5J2GA 3BKPA 5KV7A 1T94A 1PK1A 1MQ3A 5KFTA 1L8LA 2HQ6A 2F1JA 2DPIA 4LVSA 3ED5A 4RQNA 5J2DA 5EE3A 3U26A 3M8SA 4M9NA 5DG7A 3ZDAA 9ICIA 3PSFA 1AROP 4C7YA 3ICHA 2HVHA 3M8RA 3B0XA 4EX7A 4CYHA 1XO1A 1KDHA 2DKXA 4QW8A 1SKWA 1COOA 8ICZA 1X9MA 3MC1A 1SV0A 4I2GA 3UQ2A 2LYBA 4OJOA 5TISU 1NKBA 3V6HA 4RT2A 1LVHA 1HEKA 3N7SC 4F4ZA 4UBCA 4LQWA 4JMUA 1TK0A 1KQQA 2XGQA 4P4OA 2EAPA 1DRGA 3UPQA 2P6RA 1JXLA 5AKYA 2XO7A 4UATA 4KLOA 3RJFA 2H5XA 2WF7A 2IGWA 1ZQPA 1PVPA 4F2SA 2OWOA 5T14A 2ZIVB 3C28A 4R8UA 4DLEA 3MGVA 4J9QA 2UVRA 3SV3A 2W9BA 2P66A 2F3NA 9ICOA 1U48A 3UM9A 1N48A 3SAHA 3SR6A 3RCKX 4C8MA 2A1AA 8ICGA 2C2RA 3JPRA 4G3IA 3MBYA 3IHQB 5JU5A 5KAFU 5KFDA 2EZZA 2E8NA 4TQSA 2ATLA 3QU5A 1N62A 4Y2JA 5CBVA 2JZBB 1L3TA 3PO5A 2Y1IA 3F2DA 4DO9A 4MEXA 4J9PA 5AM5A 3PY8A 3RH4A 3HX0A 7ICNA 4DGDA 2H3FA 4J9NA 4BJQA 2FLPA 4PHPA 2BCQA 4N1PA 3JPSA 2NNZA 2DF4B 4K4GA 2KZMA 4M9GA 1KKXA 4DQSA 2ZG6A 3BDPA 4F4WA 4F5PA 5KT6A 3WKDA 2CMTA 3SAGA 3KOPA 1D8YA 5KFQA 2KTQA 5KUUA 1ZQTA 4C4TA 4KTQA 4J5BA 5AM2A 1OW5A 4ED1A 4YXJA 3JB9d 2ZJ8A 4RPYA 4YR3A 1KFTA 2AGQA 2IOFA 2XVTA 5ALSA 1N63A 2XC9A 1ZQIA 1CRXA 3C1ZA 5AM0A 4R3FA 4QZCA 4F5RA 3RJJA 5F3XB 1DOQA 3K0PA 4OJPA 4F5OA 3IM1A 3VCBA 5KAIU 2IHMA 4PH5A 4RQ1A 1L3VA 2Y9UA 4O3SA 3PZPA 5J0UA 2RQ5A 5KG1A 4C8OA 2K4IA 4ECTA 1QSYA 4F8RA 2GH1A 1PVQA 5KFPA 2DL0A 7ICUA 2DUYA 2ZP2A 1FFVA 4DGBA 3B0YA 2BPCA 1Z1BA 2I1QA 2F8KA 2JXJA 2W55A 3K1RB 3H4BA 3AM9A 1ZQXA 8ICOA 3F5AA 1BPZA 5CHGA 3RCIX 5KFXA 2VJ4A 5AI5A 1PUZA 3EZ5A 3CW2C 1B43A 2AH5A 1AWQA 2NO4A 3OTQA 4C7ZA 4ECWA 1CWFA 3MR5A 2J6TA 3PVXA 4Q44A 3PMPA 5ALKA 2R8JA 4EBCA 3RB6A 1JX4A 4UB3A 2L5YA 1KW4A 5HP4A 2FU0A 2Z7JA 3PX0A 4TQRA 3MMLB 4RU9A 3FC4A 3QEAZ 3BQ1A 1C5FA 3L5KA 2DGZA 1AWTA 5J2KA 1M63C 4GC7A 3EOVA 5HR6A 4IQUA 2XIDA 2XCPA 5GTIU 4KX5A 3RBEA 3WK8A 1JUDA 4QJFB 1ZQGA 4EEYA 1TAMA 3SEIA 5J29A 3JPQA 4ECZA 5KV0A 1CWKA 5AKJA 9ICUA 1YZ7A 2GWSA 3C2LA 1CWMA 2ZXIA 4YR0A 9ICXA 5KFAA 5HNKA 4CRXA 2HBJA 5KFEA 4J59A 1D9DA 1Q8KA 5DB8A 7ICIA 3WKAA 2MVZA 3TI0A 4DSFA 2DBYA 3GDXA 4O8IA 4K4IA 4Y2VA 1BVSA 1NMKA 5J0XA 5A0LA 2K8CB 5L1KA 5KUNA 3C29A 4RQ8A 2JRZA 3IG8A 5ALQA 3PMNA 2BQUA 2R8IA 3BZCA 4CF4A 4JK1A 5KG2A 4DSKA 5KUSA 3G6VA 5AICA 5CWRA 1J2MA 2VIXA 5CP2A 2CXYA 4EZ9A 1Q3VA 2QB0B 3GFKB 5HR7A 2KKVA 4QZBA 1RPLA 1XQ7A 4YUKA 4I28A 2ZJAA 1NZPA 4UAWA 2XY5A 8ICMA 5B5EU 2FLLA 4CGZA 4F4YA 1TVAA 2A1JA 4DL7A 4XNCA 4UBBA 3PV8A 4ZH4A 1C20A 1WWVA 4KLJA 4UARA 1D8LA 3HRDD 3H8MA 4RUAA 1Z19A 9ICLA 4F4XA 4Q8EA 3ORYA 1JIHA 1WG8A 4IQTA 5HHIA 5KFWA 3PO4A 3WKEA 2JMGA 2WB1F 3JPNA 3MGIA 3ZD8A 4NLGA 2C22A 4Y2SA 2WLWA 2P6UA 4DOBA 2NO5A 2KD1A 2X2DB 1V9PA 5KG5A 5G5GA 3RFAA 5J0OA 4YMOA 4B9NA 1S5LU 3LDAA 2ZIWB 2IOHA 2OSEA 4IRCA 5G5HA 2WB1C 4Z6FA 1A33A 3E0FA 2HAQA 4RNMA 5J2BA 1FEZA 4YMNA 5EOZA 2WAQF 4ED8A 5HMMA 3M6KA 2KN7A 3RDDA 4NM2A 1ZQLA 4ED3A 2W3RA 2JH1A 3B9JA 4KLIA 7ICVA 1N61A 4YCXA 3M9OB 4J5AX 3NRWA 3NVVA 3QEBZ 4MFCA 1NJYA 8ICCA 2MUTB 2C3BA 2Q0ZX 2FMPA 3LWLA 1L5UA 1JI7A 2F77X 3RCLA 4ICAA 4B9VA 2GO7A 4LJXA 4I2CA 1BNOA 2EAMA 2R18A 4FBUA 1WUDA 1MZWA 3FM9A 1XWNA 2D3DA 3IRUA 5CCRA 3C5GA 3PW5A 4N1SA 1S0MA 4US9A 2HW3A 4HYKA 3RDCA 1NJZA 2AJQA 2V9WA 2I5HA 1SL1A 3ETLA 4DL5A 1N2XA 2PFOA 4B9LA 1AQ6A 3Q8PB 4DGAA 2ZXHA 3HJEA 2KJ5A 2CPRA 5L1IA 2IA6A 2O6KA 1L8OA 2KKPA 5KFGA 1FGLA 1W74A 1XO0A 2N1RA 1J2NA 2W03A 5DLFA 4B9MA 5KV2A 2FLNA 2LHTA 4U6PA 3UMCA 5ALVA 4NLBA 1U47A 2RLTA 1CWBA 5AKGA 4KLUA 2W04A 1BPEA 1XO7A 1KL9A 9ICEA 5AKXA 1ZQFA 1RYSA 2K4PA 3VC8A 2EH9A 4WJ3B 4KN7A 3WK4A 2MRLA 4BX9C 4RQ5A 3GV5B 2W9CA 5IIMA 4QZ8A 3C5FA 1IG6A 5J2JA 1L7PA 5CA7A 5F66A 2F8LA 2NULA 2POEA 1HJPA 2YY6A 4YP3A 3LWMA 2HVIA 1NK9A 5KG6A 1BPDA 3HILA 2KJ9A 2CPLA 3O0FA 4KLFA 8ICNA 5KFHA 5ALRA 2ALZA 3MFIA 1YZ6A 4CNQA 4DSLA 2HE9A 5KFMA 3TFRA 3V72A 2W9AA 3T1UA 2QB1A 4DL2A 1UT8A 4KLQA 4A8EA 1U4BA 3RBDA 3AU2A 3RDAX 2R99A 4NY8A 2KZ3A 3EUB2 4RPXA 2W9MA 5ALUA 3Q8LA 4NLKA 4Z6DA 4C0ZA 3SMVA 2NYVA 5KG4A 2R8HA 3S6MA 5DB7A 8ICEA 4TUPA 1JALA 1CWOA 3NVYA 3TADA 2KFNA 2HQJA 5ALXA 3LVWA 5ALYA 3HPOA 2JH7A 2OK3A 4FRVA 1IXRA 3KKAA 4MFFA 2IMWP 3T3FA 2FMQA 2G5HB 2EZYA 3AU6A 3WK9A 1ZQHA 4M9HA 4O3NA 3IDWA 1LKYA 5AKZA 4TURA 1ZQUA 1TFRA 3PMLA 2G08A 5KTQA 2I9GA 2RHFA 3Q8MA 1T3QA 3T5LA 2WTFA 5EE9A 3K0MA 5AM3A 4E0DA 2ZUDA 4PHDA 1KLNA 4QZ9A 4P0QB 3KTQA 4ELVA 5KULA 1ZKFA 2AGPA 3G6YA 1SZPA 1S77D 5AI8A 2LYHA 1CWAA 3C1YA 2R8GA 3QE9Y 2E8OA 2KMDA 2ASJA 4RQ0A 3T5HA 3H0RB 3HWTA 5ALZA 2OHFA 3SD7A 5KG0A 5BPCA 3H7IA 2ISPA 1JN3A 2KV2A 5BOLA 4M0AA 4UB5A 3RJIA 4C80A 5CR0A 3GU3A 4O3QA 2F76X 2RMBA 1OUQA 1SL2A 4EX6A 1ZQVA 4MEYA 3SYZA 2B0CA 7ICQA 1AWSA 3V6JA 3AN1A 1SKRA 3R59A 1F5SA 1ZQOA 5CYHA 1WCNA 5DBBA 1XSNA 1NKCA 1CWLA 5IIJA 4KLLA 1ECWA 2VA8A 4MHVA 2YB4A 1MN8A 5CJ7A 4DQRA 2MA1A 2AHOB 2RMCA 4YD1A 3C2KA 5HHHA 5DGAA 7ICSA 5AK6A 4O5CA 3V7KA 4JB3A 1NK0A 2HBMA 4IQWA 4O5EA 3QX7A 1PK1B 3E2EA 5B66U 1DXSA 4J9MA 1Q46A 4N1NA 1Z00A 5C0YA 4GIBA 4KMOB 5CBUA 2MC9A 3N7RC 1LB2B 2FPMA 1ZD3A 2HI0A 5KFJA 3CNHA 5L1JA 1Y88A 1WCLA 5J2EA 3L4PA 4GXIA 7ICHA 4TOTA 2OYYA 4FZNA 4ECRA 5AK4A 1BPBA 1T3NA 3OEPA 5EE1A 4J5DX 4DL6A 3H0MB 3QU2A 1X40A 3RJEA 2QARA 3MR3A 3NVZA 3H40A 3BZKA 7ICEA 2E1FA 2JEJA 5ALWA 1ZQJA 2B21A 4F2RA 5KT2A 2BQ3A 2BCRA 5IIIA 3TACB 4ACOA 2ISOA 3RH5A 1RG6A 2D6FC 5J0QA 1SWVA 3KHRA 4FZLA 1K5OA 4USAA 3PSIA 3PSPA 1N5XA 3K1ZA 1H38A 3NGDA 4B9TA 1UCVA 3N7PD 2PXIA 4DCCA 5EWEA 1NK6A 3Q8KA 5KT7A 1WWUA 4R8UB 1IHGA 3BJYA 5KL1B 1Z4NA 3Q8SB 2W8KA 1IIPA 2RDIA 2W9BB 1T4GA 3M1YA 4I27A 5J0YA 5IIOA 4RQ2A 4I2JA 1ZKCA 4BGDA 3R56A 4S1EA 1X2IA 5KFFA 2FI1A 1XWLA 1JXEA 5ALHA 5IINA 5AK3A 3KZXA 2WF8A 1XS9D 4OJ6A 4CDGA 5DLGA 3F5EA 2UVWA 2G09A 3LVVA 4IRDA 3M9MB 1M9EA 2JV3A 1T8EA 1ZD5A 4LZDA 3G6XA 4YFKA 1TKDA 3HT3A 1D9FA 3F2BA 5AKHA 1SL0A 4KLEA 4TUSA 2IOFK 1ZJNA 4F71A 3R54A 5H2FU 1A6SA 4EENA 1Z4OA 4IPZA 2W7OA 1AWRA 1XYHA 5ALNA 2HHVA 1QNGA 3EW9A 4M04A 3TFSA 4UB8U 5KUWA 2LMRA 1M9FA 1NJXA 1VBTA 4IL6U 4PHEA 7ICLA 3UMBA 4X5VA 2PI5A 4ECVA 1W8VA 2AQ4A 8ICTA 4GXJA 9ICGA 4J9OA 1ED1A 3N4MB 5DB6A 7ICFA 3PW4A 1VJ5A 2KICA 3V6KA 1W8MA 2LM1A 1S76D 2JHDA 4QZFA 3PNCA 3ODLA 2BCUA 4O5KA 1ZQZA 2JEGA 4O3RA 4Y2TA 3UXOA 4CF3A 4HY7A 3K0OA 4J5EX 4DQIA 2WF6A 2KG5A 5A0EA 2XY6A 2E5SA 3OPXA 1L6NA 2HHXA 2IGVA 1AK4A 2HHWA 3PX6A 2HHQA 1C7YA 5KFIA 1MSWD 3PR4A 2DWQA 1BPXA 3TADC 2VA2A 4R63A 2KP7A 1X66A 2PFNA 2K89A 3KKAC 2YB1A 3BT8A 2LPEA 4ZOHC 2WFIA 3ZI4A 5CBTA 5LUDA 4RQ7A 3UMGA 4QIWF 1EXNA 3QYUA 7ICRA 2W3SA 2ZTEA 4M6WA 7ICGA 4OCZA 1YNDA 3BS5A 2ZIUA 4KN4A 2G06A 2ZUCA 2F44A 3GIJA 2HMXA 4DFJA 4MF2A 2KHQA 4AP9A 4DQPA 1XSPA 2HOFA 1M9XA 4QIWC 3CYMA 5FP0A 1GO3F 1KTQA 4P0PA 5DB9A 1F0MA 3D2SA 4YN4A 3RJGA 4ED2A 3WK7A 2YN4A 1M9CA 1Q3UA 5DKWA 2K8BB 2W11A 3OHAA 3J81j 4I2FA 3HKZF 2PLUA 1KFSA 1ZQSA 2AGOA 1QNHA 1XNSA 3NRZA 4B6JA 8ICQA 3C2MA 4UQGA 4PGYA 1ZQBA 2BPGA 2XGPA 5F9NA 4KITB 3RH6A 1TAUA 1S0NA 3E58A 1ZYQA 2ES6A 2KZZA 4YULA 1X9SA 2NRVA 4DLGA 7ICTA 1CEZA 4XA5A 9ICWA 3HKZC 2V4QA 5KG3A 1NNLA 5K4LA 4C4RA 2CK1A 2WFJA 3KD3A 3WK6A 9ICAA 3SQIA 3TARA 4FBTA 1CWCA 5KFLA 4EEKA 2Y0SF
chains in the Genus database with same CATH topology
2JGAA 2MRLA 4BX9C 5CCQA 2X2CK 3K0QA 4YUGA 2LYBA 4OJOA 3R57A 2RS4A 4DGCA 5F66A 1V9TA 2F8LA 2NULA 3RD9X 2POEA 2F2AB 4E1QA 4EYVA 4O8HA 1HEKA 2K4HA 3N7SC 5KV6A 4OJ5A 2KJ9A 1NZBA 2CPLA 3O0FA 4LQWA 5KUQA 4JMUA 2MS4A 2B71A 2HE9A 3T1UA 1BCKA 1DRGA 1YT3A 2G0AA 2ESLA 4A8EA 3RDAX 2IGWA 2R99A 4YUJA 4NLCA 1PVPA 5T14A 2ZIVB 1SZHA 3C28A 1A0PA 2HBLA 4YUHA 2DQNB 3MGVA 2YX8A 4C0ZA 3SMVA 3S6MA 4YUOA 4J58A 1CWOA 2PMZF 1CWIA 2ZIXA 2HQJA 3LVWA 2OK3A 4FRVA 2JH7A 2KEYA 4FE3A 3SAHA 4OJLA 5KV3A 5KUZA 3RCKX 2BDUA 2G5HB 2LKYA 2WAQC 1KBUA 2G08A 5CBVA 2KHVA 3T79A 2RHFA 1MA7A 2A3VA 3F2DA 3K0MA 4PL2A 2PMZC 3D2QA 2CRXA 2CN1A 4P0QB 4DGDA 5KULA 2H3FA 3F2CA 4BJQA 1ZKFA 2W7PA 1PVRA 3VA7A 1CWAA 4N1PA 2DF4B 3H0RB 4NV0A 2P0OA 2OH2A 5CBWA 4IC9A 2ZG6A 3BO7A 1E3BA 3CRXA 3RCFA 2KV2A 2CMTA 3SAGA 4N1MA 2BITX 3K2CA 3IP4B 5KUUA 2QERA 4J5BA 4JCPA 2H3VA 3GU3A 2F76X 2ZIUB 2H3QA 1A58A 1J2AA 2RMBA 1OUQA 3ODIA 4YUIA 3JB9d 3NUQA 4OO1J 2XVTA 1AWSA 1ZQ1C 4N1RA 2HOIA 2N0TA 1CRXA 3M6ZA 1H0PA 2X2AA 3R49A 5DUDA 3R59A 4R3FA 2NV3A 5CYHA 2M0NA 2RRDA 3K0PA 4OJPA 1CWLA 2ZIWA 4P0PB 1ECWA 3VCBA 2YB4A 1VDNA 2MA1A 2RMCA 2POYA 4DGEA 3PZPA 1ISTA 5KUVA 2H3IA 2K4IA 2KOBA 2GOLA 2HBMA 2GH1A 1PVQA 2G07A 2ZP2A 2KNJA 4DGBA 2MZUA 3LYSA 1Z1BA 4N1NA 5CCSX 5C0YA 4KMOB 5CBUA 2MC9A 3N7RC 3F5AA 3RCIX 2K8AA 2VJ4A 1D8BA 5KV4A 1AWQA 2Y0SC 4TOTA 2OYYA 2HBKA 4FZNA 1CYNA 2OJUA 1CWFA 3PMPA 3OPFA 1RMHA 3OEPA 4J5DX 3H0MB 3AL0B 2FU0A 2Z7JA 3MMLB 5JHEA 4O3MA 3O7TA 4J5CX 1MF8C 2RMAA 2E1FA 1AWUA 3RFYA 2H3ZA 4R3EA 1F44A 2KIWA 1C5FA 2DGZA 1AWTA 2CYHA 2X7KA 1M63C 3EOVA 5HR6A 2XIDA 3AQFA 3M7DA 4KX5A 2Z6WA 4ZSCA 4ACOA 4QJFB 2D6FC 1E8KA 4PL1A 1TAMA 3ICXA 5KURA 4FZLA 5KV0A 3PSIA 1CWKA 3PSPA 1CWMA 2ZXIA 3K1ZA 4YUNA 2KJ8A 4CRXA 2HBJA 4J59A 3N7PD 1CLHA 2MVZA 1P7DA 3CYHA 1CWHA 3ONNA 1IHGA 4O8IA 2VJ5A 5KL1B 1IIPA 2G5IB 1NMKA 4YUMA 5A0LA 3RF9A 2ZIXB 3KFUF 2K8CB 5KUNA 2XI9A 1ZKCA 3C29A 3F53A 4GFJA 3R56A 4S1EA 3UCHA 3IG8A 3RCGA 4QNLA 3ALRA 1W8LA 3KZXA 2ALFA 5KUSA 4OJ6A 4CDGA 3F5EA 2VIXA 2G09A 1Q3VA 3LVVA 5HR7A 1M9EA 2KKVA 1M9YA 3GZFA 1XQ7A 3F2BA 4YUKA 3R54A 4CGZA 1A6SA 4IPZA 1VBSA 4XNCA 1OCAA 2W7OA 1AWRA 1LOPA 2OXOA 1XYHA 4NWIA 1QNGA 2PHCB 1HIWA 1X7FA 4U7CA 5KUWA 1M9FA 1VBTA 2BIUX 2ZIVA 5KV1A 1Z19A 1W8VA 1ED1A 2HOQA 2JMGA 2WB1F 4FRUA 2OM6A 2KICA 3AQEA 4FZMA 1W8MA 2WLWA 2JHDA 2K7NA 2KD1A 3ODLA 5CRXA 2X2DB 2RP5A 5KUOA 1M9DA 2A2NA 1ZMFA 4HY7A 5KL8B 3K0OA 4AYBF 4N1QA 4I9YA 3RFAA 4J5EX 3CYSA 5A0EA 2ZIWB 2E5SA 3OPXA 1L6NA 2OSEA 3RDBA 2IGVA 1AK4A 1AWVA 2WB1C 3SAFA 1A33A 3E0FA 2HAQA 1URJA 5KV5A 4P0QA 2LYAA 2WAQF 2K89A 2YB1A 2X83B 2XICA 3BT8A 3M6KA 4N1OA 2WFIA 4AYBC 1Z81A 3RDDA 4KX3A 5CBTA 5LUDA 1VAIA 3IG5A 2K4EA 4QIWF 3QYUA 2JH1A 3K0RA 2KVCA 1DYWA 4ZSDA 1CWJA 4J5AX 3R4GA 3NRWA 1YNDA 1QOIA 2ZIUA 2C3BA 1MIKA 2G06A 5CCNA 3OREA 3IN5A 3K0NA 2HMXA 3RCLA 2F77X 2KHQA 4ICAA 2HOFA 1M9XA 4S1JA 2XGYB 4QIWC 3CYMA 4YUPA 2R18A 1WUDA 1GO3F 2VKQA 1UPHA 1MZWA 4P0PA 1XWNA 3PSTA 4BUGA 5CCRA 3D2NA 3D2SA 4N1SA 3RDCA 3H0LB 1M9CA 1Q3UA 2K8BB 3CP8A 3HKZF 2PLUA 3DEEA 1QNHA 1XNSA 3BKPA 5KV7A 1T94A 2GW2A 4DGAA 2ZXHA 2KJ5A 2CPRA 2HQ6A 2CFEA 2KKPA 1FGLA 2Q4TA 1W74A 4YULA 1XO0A 2E1EA 4JJMA 2N1RA 3PSFA 3ICHA 3HKZC 2W03A 5KV2A 2LHTA 4U6PA 2CK1A 3ICIA 2WFJA 4NLBA 2LBOA 4CYHA 2X25B 3SQIA 3MMLA 1CWBA 3L3FX 2W04A 1CWCA 1XO7A 4WJ3B 3VC8A 2Y0SF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J59 A;  5CCQ A;  2X2C K;  1J2A A;  1A58 A;  3ODI A;  2RMB A;  3K0Q A;  4YUI A;  3JB9 d;  4YUG A;  3R57 A;  1CLH A;  2RS4 A;  2MVZ A;  4DGC A;  1AWS A;  1CWH A;  3CYH A;  2X83 B;  5F66 A;  1V9T A;  4N1R A;  3BT8 A;  2NUL A;  3RD9 X;  2POE A;  4N1O A;  1IHG A;  2N0T A;  2WFI A;  4O8I A;  1Z81 A;  3RDD A;  4E1Q A;  1H0P A;  3R49 A;  4EYV A;  2X2A A;  4O8H A;  5KV6 A;  5CBT A;  5DUD A;  5LUD A;  1VAI A;  3R59 A;  1IIP A;  4R3F A;  1NMK A;  4YUM A;  5CYH A;  3K0P A;  3QYU A;  2CPL A;  3K0R A;  1CWL A;  4LQW A;  5KUQ A;  1DYW A;  2MS4 A;  4ZSD A;  5KUN A;  1VDN A;  1CWJ A;  1ZKC A;  3R56 A;  4J5A X;  4S1E A;  3UCH A;  2B71 A;  3RCG A;  3R4G A;  2HE9 A;  1W8L A;  3T1U A;  1BCK A;  2RMC A;  2POY A;  4DGE A;  1IST A;  1YND A;  1QOI A;  2ESL A;  5KUV A;  2ALF A;  5KUS A;  3RDA X;  2C3B A;  1MIK A;  2IGW A;  2R99 A;  5CCN A;  4YUJ A;  3ORE A;  3K0N A;  3RCL A;  1M9E A;  1M9Y A;  2ZP2 A;  4YUH A;  1M9X A;  4S1J A;  2XGY B;  2MZU A;  4DGB A;  1XQ7 A;  3S6M A;  4YUP A;  4YUK A;  4N1N A;  5CCS X;  5KV0 A;  4YUO A;  4J58 A;  1CWO A;  5CBU A;  1MZW A;  2MC9 A;  3R54 A;  1CWI A;  2HQJ A;  3RCI X;  2OK3 A;  4FRV A;  4IPZ A;  1XWN A;  5CCR A;  1VBS A;  4XNC A;  1OCA A;  1AWR A;  4N1S A;  5KV4 A;  1AWQ A;  1LOP A;  3RDC A;  4TOT A;  1XYH A;  5KV3 A;  5KUZ A;  3RCK X;  2OJU A;  1CYN A;  1QNG A;  1M9C A;  2PHC B;  1CWF A;  1X7F A;  3PMP A;  3OPF A;  1RMH A;  5KUW A;  3OEP A;  1M9F A;  2PLU A;  4J5D X;  1VBT A;  2BIU X;  5KV1 A;  1QNH A;  3BKP A;  5KV7 A;  5CBV A;  2FU0 A;  3MML B;  1W8V A;  5JHE A;  2GW2 A;  4DGA A;  3K0M A;  3O7T A;  4J5C X;  1MF8 C;  2RMA A;  2HQ6 A;  1AWU A;  2CFE A;  3RFY A;  4FRU A;  4R3E A;  4DGD A;  5KUL A;  1C5F A;  1W8M A;  1ZKF A;  2WLW A;  1FGL A;  1AWT A;  2CYH A;  2X7K A;  3VA7 A;  1W74 A;  2K7N A;  4YUL A;  1M63 C;  1CWA A;  3EOV A;  3ODL A;  4N1P A;  2X2D B;  4JJM A;  5KUO A;  1M9D A;  3ICH A;  2A2N A;  1ZMF A;  2Z6W A;  4HY7 A;  2P0O A;  3K0O A;  4ZSC A;  5KV2 A;  4N1Q A;  1E8K A;  4I9Y A;  4J5E X;  2CK1 A;  3ICI A;  5CBW A;  2WFJ A;  3CYS A;  5KUR A;  5A0E A;  4CYH A;  3BO7 A;  1E3B A;  2OSE A;  2X25 B;  3RDB A;  3RCF A;  1CWK A;  2CMT A;  1CWB A;  1AK4 A;  2IGV A;  3MML A;  4N1M A;  1AWV A;  2BIT X;  3K2C A;  1CWM A;  1CWC A;  1XO7 A;  5KUU A;  2QER A;  4YUN A;  1A33 A;  2HAQ A;  4J5B A;  4JCP A;  5KV5 A; 
#chains in the Genus database with same CATH topology
 2JGA A;  3RR7 A;  5CCQ A;  5J0W A;  3RTV A;  3K0Q A;  1DGS A;  4R65 A;  3R57 A;  3TKA A;  2RS4 A;  3K75 D;  2M9N A;  2F2A B;  4DSI A;  4EYV A;  5AIB A;  4O8H A;  2K4H A;  5KV6 A;  4OJ5 A;  3MAB A;  2DPJ A;  5AI4 A;  2MS4 A;  4JWN A;  5KFS A;  2A1J B;  5J2F A;  5J2C A;  4BXO B;  1B4F A;  3T5J A;  2YMM A;  1BCK A;  1DK3 A;  1PK3 A;  2G0A A;  2ESL A;  5DDY A;  2RDJ A;  3DDH A;  2C28 A;  3THV A;  2HHU A;  4YUJ A;  8ICP A;  1SZH A;  2F1I A;  2E8M A;  5J0S A;  3KHL A;  2C2D A;  1ZQR A;  2YX8 A;  4KLT A;  8ICF A;  4DS5 A;  4UAU A;  4ECU A;  4J58 A;  2PFP A;  4QZD A;  2PMZ F;  2ZIX A;  1ZQQ A;  2KEY A;  4I2I A;  2WF5 A;  3MDA A;  3N97 B;  4OJL A;  5KV3 A;  5KUZ A;  9ICP A;  3LK9 A;  2LKY A;  2WAQ C;  1ZX8 A;  1X6J A;  5D49 A;  8ICY A;  1MA7 A;  3GV8 B;  1S97 A;  2PMZ C;  3D2Q A;  2CRX A;  2LM4 A;  1V38 A;  1QQ6 A;  4UB4 A;  3F2C A;  1BGX T;  3MDC A;  4EBE A;  1PVR A;  4IR1 A;  3HP6 A;  4DOC A;  4PJ0 U;  3KOO A;  2HCF A;  7ICM A;  2E3T A;  4NV0 A;  2OH2 A;  3NS1 A;  1IV8 A;  1VDV A;  1N5W A;  5CBW A;  1QQ5 A;  2OCE A;  5DBA A;  4ELT A;  4IR9 A;  4P2H A;  7ICJ A;  4ECX A;  4NXZ A;  4FS1 A;  2BIT X;  3I76 A;  1B0X A;  3RAQ A;  2QER A;  2H3V A;  1QH9 A;  1J2A A;  4DSE A;  4YUI A;  3NUQ A;  5AI0 A;  5KT3 A;  5J2I A;  2ESE A;  3FAH A;  1ZQ1 C;  4N1R A;  2HOI A;  1ZQA A;  3KZI U;  3R49 A;  3M6Z A;  2X2A A;  5DUD A;  2NV3 A;  5AKK A;  2RRD A;  3QU4 A;  4NJ8 A;  3MR6 A;  3BQT A;  1SGG A;  2FDR A;  1RYU A;  2EDU A;  2NRW A;  1CUK A;  1B22 A;  2POY A;  4O9M A;  2KSO A;  2YMP A;  2H3I A;  5KUV A;  1NK7 A;  5IIK A;  2GOL A;  4F93 B;  3OSP A;  4MF8 A;  2G07 A;  3RB3 A;  8ICR A;  2KNJ A;  4KLS A;  2MZU A;  2UVV A;  1ZET A;  5CCS X;  2EZX A;  2K8A A;  4BWJ A;  4JV0 A;  3WKB A;  1L7M A;  9ICM A;  1ZD2 P;  5CB1 A;  5KV4 A;  1QTM A;  2ASL A;  1RXW A;  3ZD9 A;  2HBK A;  1CYN A;  4ECS A;  2OJU A;  4P4P A;  3OPF A;  1RMH A;  1Z3E B;  3AL0 B;  3Q8R B;  2EQY A;  5DG8 A;  5JHE A;  3OJU A;  3QU7 A;  3O7T A;  1MF8 C;  2RMA A;  4F5Q A;  4I29 A;  3I1Y A;  4OD0 A;  1AWU A;  5DGB A;  5ALL A;  1U49 A;  2W9C B;  4R3E A;  3BQ0 A;  1F44 A;  3C23 A;  2KIW A;  3A0B U;  3RR8 A;  2CYH A;  2PI4 A;  4Y2Q A;  2XCA A;  3SI8 A;  3M7D A;  5D46 A;  2KK0 A;  1ZRN A;  1E8K A;  3BQ2 A;  5C5J A;  5KUR A;  2BZF A;  4YR2 A;  5ALM A;  2XY7 A;  4KLG A;  1ZQE A;  8ICX A;  3QYP A;  4CCH A;  4QWD A;  3BQ7 A;  4YUN A;  4PZO A;  4NL9 C;  3JPP A;  3NAS A;  1CLH A;  4UB2 A;  1CWH A;  2AXT U;  1J97 A;  4M2Y A;  8ICA A;  2G5I B;  9ICH A;  4YUM A;  4BDP A;  3RF9 A;  3EPG A;  2XI9 A;  3F53 A;  2ZTC A;  4R64 A;  3RCG A;  3KHG A;  3ALR A;  4UB6 U;  4PZN A;  3QXG A;  2ALF A;  1T7P A;  4RQ3 A;  1LKY B;  4GLX A;  2W54 A;  1M9Y A;  4DF4 A;  3GZF A;  4YVZ A;  2NRZ A;  2Y9T A;  2BCS A;  2PFQ A;  4DL3 A;  2NRX A;  3ZDB A;  4IQV A;  4RT3 A;  5AK5 A;  1NK5 A;  2FJ6 A;  1VBS A;  3EWA A;  9ICJ A;  3AMZ A;  1LOP A;  2OXO A;  8ICW A;  4NWI A;  2FPL A;  2PHC B;  1HIW A;  5KFC A;  1X7F A;  1JRO A;  3UXP A;  3RJH A;  2J6U A;  4J9R A;  4J03 A;  1MQ2 A;  2ZIV A;  3S6J A;  1XSL A;  2JR5 A;  4DWI A;  4I2H A;  5EE0 A;  4F72 A;  3TQ1 A;  5KFR A;  3OGU A;  2MAX A;  3JPT A;  1V85 A;  1ZXI A;  3GV7 B;  4EZ6 A;  4FRU A;  2OM6 A;  1UT5 A;  1L3U A;  5EWG A;  1NI3 A;  4HAI A;  4QWA A;  2IHN A;  2RP5 A;  5KUO A;  2A2N A;  2E8P A;  7ICK A;  3MFH A;  4I9Y A;  2YMQ A;  2VAN A;  4DOA A;  2JZB A;  2KA0 A;  3RDB A;  5DQG A;  3C21 A;  2YQE A;  3SAF A;  1TK8 A;  4KMU A;  1URJ A;  2VA3 A;  4I2B A;  2C2E A;  5JRT A;  2X83 B;  2XIC A;  3ISB A;  1UA1 A;  5J0P A;  4I2A A;  3QUC A;  1Z81 A;  4R66 A;  4K4H A;  4KX3 A;  4DFM A;  4NM1 A;  1UHU A;  2HDO A;  1Z00 B;  3FYH A;  3IG5 A;  3GII A;  1O03 A;  3K0R A;  4QZA A;  1O08 A;  3ISC A;  4Y2X A;  4Q8F A;  3PW0 A;  4GC6 A;  3EYZ A;  5J2A A;  1MIK A;  8ICJ A;  3ORE A;  3IN5 A;  4Y2P A;  1HUZ A;  2QAR B;  3JPO A;  4O3O A;  4YUP A;  2YTU A;  4RQ4 A;  1SXE A;  2ASD A;  5J2H A;  2VKQ A;  1SV4 A;  4FS2 A;  1LV5 A;  4M9J A;  5JUM A;  4RZR A;  4UB1 A;  3H0L B;  5AI9 A;  3OSN A;  2KE7 A;  1PZN A;  3CP8 A;  3QUT A;  1ZQD A;  5F9L A;  5ALF A;  3DEE A;  1SIJ A;  4O3P A;  3AUO A;  4EBD A;  1RYR A;  2QKQ A;  2GW2 A;  1SWW A;  2CFE A;  1KN5 A;  4PGX A;  4JV2 A;  2Q4T A;  5ALI A;  4QWC A;  3M9N B;  1ZRM A;  1ZD4 A;  4XRH A;  4JWM A;  2E1E A;  4JJM A;  4BWM A;  4DFD A;  1S10 A;  4IRK A;  4DL4 A;  4ED0 A;  5KT4 A;  3ICI A;  2LBO A;  2K60 A;  2X25 B;  2WF9 A;  3MML A;  3L3F X;  1SB3 C;  2LI6 A;  4QZI A;  3A0H U;  5DDM A;  4DS4 A;  5J8Y A;  2X2C K;  9ICF A;  4J9S A;  4YUG A;  2ZJ5 A;  4DSJ A;  1VLB A;  4DGC A;  2W8L A;  1ZQK A;  1QSS A;  4UW9 A;  3ZDC A;  1V9T A;  3RD9 X;  2BDP A;  3QUQ A;  4E1Q A;  5DG9 A;  1Z1V A;  1NZB A;  8ICS A;  2FE9 A;  5KUQ A;  1UQV A;  4EEL A;  2B6G A;  4M9L A;  3QZ8 A;  2B71 A;  3SZ2 A;  1YT3 A;  5AKL A;  4J9K A;  4I2D A;  4F91 B;  4QWE A;  4NLC A;  9ICB A;  3TAN A;  1A0P A;  2HBL A;  4YUH A;  2DQN B;  8ICH A;  1N60 A;  3PW2 A;  1ZQW A;  1CI4 A;  1RDF A;  1ZOL A;  4YUO A;  4PHA A;  2WHE A;  1SKS A;  1CWI A;  1QLN A;  1ZQC A;  1L3S A;  1RQL A;  1K1Q A;  4FE3 A;  4RNO A;  5AIA A;  4CF5 A;  3R9K A;  2BDU A;  5ALE A;  5ALT A;  5KFN A;  2J6S A;  8ICI A;  1QSL A;  1DGJ A;  1KBU A;  1OXJ A;  2AQ0 A;  2QB0 A;  4RUC A;  5E79 U;  2A19 A;  1S9F A;  2KHV A;  3T79 A;  3MGH A;  7ICO A;  2A3V A;  4NL9 A;  4PL2 A;  2EAN A;  2CN1 A;  1X9X A;  1ZQM A;  3PX4 A;  1S0O A;  1L7O A;  2MU2 A;  2W7P A;  3VA7 A;  1BNP A;  4J9L A;  1FIQ A;  3V7L A;  2Y1J A;  3RB4 A;  1XU4 A;  9ICN A;  2P0O A;  1S8O A;  5KG7 A;  4IC9 A;  1RQN A;  1NJW A;  1L7N A;  4O0I A;  1NOM A;  3BO7 A;  1E3B A;  3CRX A;  4KLM A;  3RCF A;  4N1M A;  1S0V A;  4M6W B;  3K2C A;  1NKE A;  5GTH U;  4C8K A;  3IP4 B;  2MSN A;  4ECY A;  4JCP A;  4XUS A;  5TZV A;  3BS5 B;  2ZIU B;  2H3Q A;  2KVS A;  4PPX A;  1A58 A;  3ODI A;  5DBC A;  4OO1 J;  4Z6E A;  3V7J A;  4C8N A;  2BHN A;  1ZJM A;  2N0T A;  1H0P A;  1JMS A;  1HUO A;  5DQI A;  5KFK A;  3TAQ A;  2M0N A;  2ZIW A;  4P0P B;  4YD2 A;  2W43 A;  1SXD A;  1VDN A;  3Q8Q B;  3D6J A;  4BXO A;  5DQH A;  2BCV A;  4DGE A;  5JTI A;  3H8J A;  1IST A;  4F4K A;  3FDS A;  4MFA A;  5ALO A;  3WKC A;  5CEH A;  1SV0 C;  2KOB A;  1ZQN A;  1U9L A;  3N28 A;  1IM4 A;  5ALD A;  3LYS A;  4LZG A;  3OHB A;  5L9X A;  9ICK A;  4ELU A;  5J0T A;  1X42 A;  4YXM A;  1KEJ A;  4F50 A;  2PKE A;  4B9U A;  1D8B A;  2GLE A;  3QU9 A;  1ZQY A;  2Y0S C;  2ODG A;  5IIL A;  1FO4 A;  1DK2 A;  4G9B A;  2NRT A;  2MUT A;  5AKI A;  5EWF A;  3RB0 A;  3PR5 B;  4O3M A;  4J5C X;  4I2E A;  4XQ8 A;  1QQ7 A;  3RFY A;  2H3Z A;  8ICL A;  2QLT A;  2FPK A;  4DF8 A;  1A76 A;  5L1L A;  2X7K A;  3X27 A;  4YMM A;  5KFB A;  3EPI A;  1XC9 A;  3AQF A;  2Z6W A;  4ZSC A;  1KSP A;  4PL1 A;  1TAQ A;  3ICX A;  2V4R A;  4GXK A;  2BPF A;  5J0R A;  2FMS A;  4Z6C A;  8ICV A;  4US8 A;  5ALJ A;  4RQM A;  1RM6 C;  5AI6 A;  4DFP A;  2KJ8 A;  3RRG A;  4JUZ A;  4ED7 A;  3QUB A;  2OEH A;  4JV1 A;  1P7D A;  3CYH A;  3ZDD A;  2I6X A;  3ONN A;  2VJ5 A;  3WU2 U;  4YQW A;  4RPZ A;  1RXV A;  2ZIX B;  3KFU F;  4DQQ A;  1COK A;  4EYI B;  3KBB A;  3DV9 A;  4GFJ A;  5KFV A;  3UCH A;  1V97 A;  5HML A;  4QNL A;  2DKZ A;  1W8L A;  1MC8 A;  3IV6 A;  4KLD A;  4F92 B;  4QZH A;  1WYG A;  3H4D A;  2ZTD A;  2IBK A;  4QZE A;  5KFU A;  9ICR A;  9ICS A;  1X6I A;  4F5N A;  1RZT A;  2YML A;  2EAO A;  3SEN A;  5KT5 A;  3GQC A;  3H8W A;  2JEI A;  1TK5 A;  1OCA A;  3UXN A;  5BOM A;  1N56 A;  1TE2 A;  4RNN A;  4P4M A;  5D4B A;  5KFY A;  4KLH A;  3I28 A;  3WK5 A;  4U7C A;  3GIK A;  8ICK A;  1NK8 A;  4Q43 A;  2HHT A;  5J8Y C;  2BIU X;  5KV1 A;  4EYH B;  4PGQ A;  4C8L A;  4Y2R A;  1BPY A;  4IS7 A;  1UA0 A;  7ICP A;  3MR2 A;  3QNM A;  2HOQ A;  3QZ7 A;  3ISD A;  1QCK A;  4UAZ A;  4NLZ A;  3AQE A;  4FZM A;  2UVU A;  4QWB A;  3UQ0 A;  2K7N A;  5CRX A;  1M9D A;  1FFU A;  4B9S A;  1ZMF A;  5KL8 B;  9ICV A;  3H8S A;  4AYB F;  4N1Q A;  4CE6 A;  3CYS A;  5AKE A;  4Y2Y A;  3RRH A;  2R8K A;  5KNI A;  4C4S A;  3AEV A;  2HSZ A;  5KFZ A;  4QZG A;  1AWV A;  9ICT A;  2BKE A;  5ALG A;  4UAV A;  3KHH A;  8ICB A;  5KV5 A;  2KSO B;  4P0Q A;  2LYA A;  1K1S A;  4ED6 A;  5AM1 A;  2HHS A;  2KIV A;  4NLN A;  4FFD A;  3GIL A;  8ICU A;  4N1O A;  9ICQ A;  4AYB C;  3SV4 A;  3TAP A;  1A77 A;  1X9W A;  1VAI A;  4Y2U A;  3ZDE A;  2WFA A;  2K4E A;  2AU0 A;  2BR0 A;  2KVC A;  1DYW A;  3GIM A;  2DFL A;  4ZSD A;  5KFO A;  3ETR A;  1CWJ A;  4DEZ A;  1TV9 A;  4TUQ A;  2JEF A;  3R4G A;  9ICC A;  5AHX A;  3RAX A;  1QOI A;  2F1H A;  3T5K A;  4Q45 A;  4FO6 A;  3OJS A;  4DFK A;  5CCN A;  4UAS A;  3K0N A;  1M6Y A;  4YG2 A;  3HW8 A;  4S1J A;  2XGY B;  4UAY A;  1UPH A;  4M47 A;  1NK4 A;  4ECQ A;  2P35 A;  4RQ6 A;  3BS7 A;  1KFD A;  3PST A;  3NVW A;  4BUG A;  3D2N A;  4F3O A;  3PW7 A;  4QW9 A;  3RJK A;  5ALP A;  1U45 A;  1KRP A;  2KFZ A;  3K4G A;  5AM4 A;  1JRP A;  2ZUB A;  5L1M A;  2D8C A;  2BGW A;  2BQR A;  3NTU A;  5J2G A;  3BKP A;  5KV7 A;  1T94 A;  1PK1 A;  1MQ3 A;  5KFT A;  1L8L A;  2HQ6 A;  2F1J A;  2DPI A;  4LVS A;  3ED5 A;  4RQN A;  5J2D A;  5EE3 A;  3U26 A;  3M8S A;  4M9N A;  5DG7 A;  3ZDA A;  9ICI A;  3PSF A;  1ARO P;  4C7Y A;  3ICH A;  2HVH A;  3M8R A;  3B0X A;  4EX7 A;  4CYH A;  1XO1 A;  1KDH A;  2DKX A;  4QW8 A;  1SKW A;  1COO A;  8ICZ A;  1X9M A;  3MC1 A;  1SV0 A;  4I2G A;  3UQ2 A;  2LYB A;  4OJO A;  5TIS U;  1NKB A;  3V6H A;  4RT2 A;  1LVH A;  1HEK A;  3N7S C;  4F4Z A;  4UBC A;  4LQW A;  4JMU A;  1TK0 A;  1KQQ A;  2XGQ A;  4P4O A;  2EAP A;  1DRG A;  3UPQ A;  2P6R A;  1JXL A;  5AKY A;  2XO7 A;  4UAT A;  4KLO A;  3RJF A;  2H5X A;  2WF7 A;  2IGW A;  1ZQP A;  1PVP A;  4F2S A;  2OWO A;  5T14 A;  2ZIV B;  3C28 A;  4R8U A;  4DLE A;  3MGV A;  4J9Q A;  2UVR A;  3SV3 A;  2W9B A;  2P66 A;  2F3N A;  9ICO A;  1U48 A;  3UM9 A;  1N48 A;  3SAH A;  3SR6 A;  3RCK X;  4C8M A;  2A1A A;  8ICG A;  2C2R A;  3JPR A;  4G3I A;  3MBY A;  3IHQ B;  5JU5 A;  5KAF U;  5KFD A;  2EZZ A;  2E8N A;  4TQS A;  2ATL A;  3QU5 A;  1N62 A;  4Y2J A;  5CBV A;  2JZB B;  1L3T A;  3PO5 A;  2Y1I A;  3F2D A;  4DO9 A;  4MEX A;  4J9P A;  5AM5 A;  3PY8 A;  3RH4 A;  3HX0 A;  7ICN A;  4DGD A;  2H3F A;  4J9N A;  4BJQ A;  2FLP A;  4PHP A;  2BCQ A;  4N1P A;  3JPS A;  2NNZ A;  2DF4 B;  4K4G A;  2KZM A;  4M9G A;  1KKX A;  4DQS A;  2ZG6 A;  3BDP A;  4F4W A;  4F5P A;  5KT6 A;  3WKD A;  2CMT A;  3SAG A;  3KOP A;  1D8Y A;  5KFQ A;  2KTQ A;  5KUU A;  1ZQT A;  4C4T A;  4KTQ A;  4J5B A;  5AM2 A;  1OW5 A;  4ED1 A;  4YXJ A;  3JB9 d;  2ZJ8 A;  4RPY A;  4YR3 A;  1KFT A;  2AGQ A;  2IOF A;  2XVT A;  5ALS A;  1N63 A;  2XC9 A;  1ZQI A;  1CRX A;  3C1Z A;  5AM0 A;  4R3F A;  4QZC A;  4F5R A;  3RJJ A;  5F3X B;  1DOQ A;  3K0P A;  4OJP A;  4F5O A;  3IM1 A;  3VCB A;  5KAI U;  2IHM A;  4PH5 A;  4RQ1 A;  1L3V A;  2Y9U A;  4O3S A;  3PZP A;  5J0U A;  2RQ5 A;  5KG1 A;  4C8O A;  2K4I A;  4ECT A;  1QSY A;  4F8R A;  2GH1 A;  1PVQ A;  5KFP A;  2DL0 A;  7ICU A;  2DUY A;  2ZP2 A;  1FFV A;  4DGB A;  3B0Y A;  2BPC A;  1Z1B A;  2I1Q A;  2F8K A;  2JXJ A;  2W55 A;  3K1R B;  3H4B A;  3AM9 A;  1ZQX A;  8ICO A;  3F5A A;  1BPZ A;  5CHG A;  3RCI X;  5KFX A;  2VJ4 A;  5AI5 A;  1PUZ A;  3EZ5 A;  3CW2 C;  1B43 A;  2AH5 A;  1AWQ A;  2NO4 A;  3OTQ A;  4C7Z A;  4ECW A;  1CWF A;  3MR5 A;  2J6T A;  3PVX A;  4Q44 A;  3PMP A;  5ALK A;  2R8J A;  4EBC A;  3RB6 A;  1JX4 A;  4UB3 A;  2L5Y A;  1KW4 A;  5HP4 A;  2FU0 A;  2Z7J A;  3PX0 A;  4TQR A;  3MML B;  4RU9 A;  3FC4 A;  3QEA Z;  3BQ1 A;  1C5F A;  3L5K A;  2DGZ A;  1AWT A;  5J2K A;  1M63 C;  4GC7 A;  3EOV A;  5HR6 A;  4IQU A;  2XID A;  2XCP A;  5GTI U;  4KX5 A;  3RBE A;  3WK8 A;  1JUD A;  4QJF B;  1ZQG A;  4EEY A;  1TAM A;  3SEI A;  5J29 A;  3JPQ A;  4ECZ A;  5KV0 A;  1CWK A;  5AKJ A;  9ICU A;  1YZ7 A;  2GWS A;  3C2L A;  1CWM A;  2ZXI A;  4YR0 A;  9ICX A;  5KFA A;  5HNK A;  4CRX A;  2HBJ A;  5KFE A;  4J59 A;  1D9D A;  1Q8K A;  5DB8 A;  7ICI A;  3WKA A;  2MVZ A;  3TI0 A;  4DSF A;  2DBY A;  3GDX A;  4O8I A;  4K4I A;  4Y2V A;  1BVS A;  1NMK A;  5J0X A;  5A0L A;  2K8C B;  5L1K A;  5KUN A;  3C29 A;  4RQ8 A;  2JRZ A;  3IG8 A;  5ALQ A;  3PMN A;  2BQU A;  2R8I A;  3BZC A;  4CF4 A;  4JK1 A;  5KG2 A;  4DSK A;  5KUS A;  3G6V A;  5AIC A;  5CWR A;  1J2M A;  2VIX A;  5CP2 A;  2CXY A;  4EZ9 A;  1Q3V A;  2QB0 B;  3GFK B;  5HR7 A;  2KKV A;  4QZB A;  1RPL A;  1XQ7 A;  4YUK A;  4I28 A;  2ZJA A;  1NZP A;  4UAW A;  2XY5 A;  8ICM A;  5B5E U;  2FLL A;  4CGZ A;  4F4Y A;  1TVA A;  2A1J A;  4DL7 A;  4XNC A;  4UBB A;  3PV8 A;  4ZH4 A;  1C20 A;  1WWV A;  4KLJ A;  4UAR A;  1D8L A;  3HRD D;  3H8M A;  4RUA A;  1Z19 A;  9ICL A;  4F4X A;  4Q8E A;  3ORY A;  1JIH A;  1WG8 A;  4IQT A;  5HHI A;  5KFW A;  3PO4 A;  3WKE A;  2JMG A;  2WB1 F;  3JPN A;  3MGI A;  3ZD8 A;  4NLG A;  2C22 A;  4Y2S A;  2WLW A;  2P6U A;  4DOB A;  2NO5 A;  2KD1 A;  2X2D B;  1V9P A;  5KG5 A;  5G5G A;  3RFA A;  5J0O A;  4YMO A;  4B9N A;  1S5L U;  3LDA A;  2ZIW B;  2IOH A;  2OSE A;  4IRC A;  5G5H A;  2WB1 C;  4Z6F A;  1A33 A;  3E0F A;  2HAQ A;  4RNM A;  5J2B A;  1FEZ A;  4YMN A;  5EOZ A;  2WAQ F;  4ED8 A;  5HMM A;  3M6K A;  2KN7 A;  3RDD A;  4NM2 A;  1ZQL A;  4ED3 A;  2W3R A;  2JH1 A;  3B9J A;  4KLI A;  7ICV A;  1N61 A;  4YCX A;  3M9O B;  4J5A X;  3NRW A;  3NVV A;  3QEB Z;  4MFC A;  1NJY A;  8ICC A;  2MUT B;  2C3B A;  2Q0Z X;  2FMP A;  3LWL A;  1L5U A;  1JI7 A;  2F77 X;  3RCL A;  4ICA A;  4B9V A;  2GO7 A;  4LJX A;  4I2C A;  1BNO A;  2EAM A;  2R18 A;  4FBU A;  1WUD A;  1MZW A;  3FM9 A;  1XWN A;  2D3D A;  3IRU A;  5CCR A;  3C5G A;  3PW5 A;  4N1S A;  1S0M A;  4US9 A;  2HW3 A;  4HYK A;  3RDC A;  1NJZ A;  2AJQ A;  2V9W A;  2I5H A;  1SL1 A;  3ETL A;  4DL5 A;  1N2X A;  2PFO A;  4B9L A;  1AQ6 A;  3Q8P B;  4DGA A;  2ZXH A;  3HJE A;  2KJ5 A;  2CPR A;  5L1I A;  2IA6 A;  2O6K A;  1L8O A;  2KKP A;  5KFG A;  1FGL A;  1W74 A;  1XO0 A;  2N1R A;  1J2N A;  2W03 A;  5DLF A;  4B9M A;  5KV2 A;  2FLN A;  2LHT A;  4U6P A;  3UMC A;  5ALV A;  4NLB A;  1U47 A;  2RLT A;  1CWB A;  5AKG A;  4KLU A;  2W04 A;  1BPE A;  1XO7 A;  1KL9 A;  9ICE A;  5AKX A;  1ZQF A;  1RYS A;  2K4P A;  3VC8 A;  2EH9 A;  4WJ3 B;  4KN7 A;  3WK4 A;  2MRL A;  4BX9 C;  4RQ5 A;  3GV5 B;  2W9C A;  5IIM A;  4QZ8 A;  3C5F A;  1IG6 A;  5J2J A;  1L7P A;  5CA7 A;  5F66 A;  2F8L A;  2NUL A;  2POE A;  1HJP A;  2YY6 A;  4YP3 A;  3LWM A;  2HVI A;  1NK9 A;  5KG6 A;  1BPD A;  3HIL A;  2KJ9 A;  2CPL A;  3O0F A;  4KLF A;  8ICN A;  5KFH A;  5ALR A;  2ALZ A;  3MFI A;  1YZ6 A;  4CNQ A;  4DSL A;  2HE9 A;  5KFM A;  3TFR A;  3V72 A;  2W9A A;  3T1U A;  2QB1 A;  4DL2 A;  1UT8 A;  4KLQ A;  4A8E A;  1U4B A;  3RBD A;  3AU2 A;  3RDA X;  2R99 A;  4NY8 A;  2KZ3 A;  3EUB 2;  4RPX A;  2W9M A;  5ALU A;  3Q8L A;  4NLK A;  4Z6D A;  4C0Z A;  3SMV A;  2NYV A;  5KG4 A;  2R8H A;  3S6M A;  5DB7 A;  8ICE A;  4TUP A;  1JAL A;  1CWO A;  3NVY A;  3TAD A;  2KFN A;  2HQJ A;  5ALX A;  3LVW A;  5ALY A;  3HPO A;  2JH7 A;  2OK3 A;  4FRV A;  1IXR A;  3KKA A;  4MFF A;  2IMW P;  3T3F A;  2FMQ A;  2G5H B;  2EZY A;  3AU6 A;  3WK9 A;  1ZQH A;  4M9H A;  4O3N A;  3IDW A;  1LKY A;  5AKZ A;  4TUR A;  1ZQU A;  1TFR A;  3PML A;  2G08 A;  5KTQ A;  2I9G A;  2RHF A;  3Q8M A;  1T3Q A;  3T5L A;  2WTF A;  5EE9 A;  3K0M A;  5AM3 A;  4E0D A;  2ZUD A;  4PHD A;  1KLN A;  4QZ9 A;  4P0Q B;  3KTQ A;  4ELV A;  5KUL A;  1ZKF A;  2AGP A;  3G6Y A;  1SZP A;  1S77 D;  5AI8 A;  2LYH A;  1CWA A;  3C1Y A;  2R8G A;  3QE9 Y;  2E8O A;  2KMD A;  2ASJ A;  4RQ0 A;  3T5H A;  3H0R B;  3HWT A;  5ALZ A;  2OHF A;  3SD7 A;  5KG0 A;  5BPC A;  3H7I A;  2ISP A;  1JN3 A;  2KV2 A;  5BOL A;  4M0A A;  4UB5 A;  3RJI A;  4C80 A;  5CR0 A;  3GU3 A;  4O3Q A;  2F76 X;  2RMB A;  1OUQ A;  1SL2 A;  4EX6 A;  1ZQV A;  4MEY A;  3SYZ A;  2B0C A;  7ICQ A;  1AWS A;  3V6J A;  3AN1 A;  1SKR A;  3R59 A;  1F5S A;  1ZQO A;  5CYH A;  1WCN A;  5DBB A;  1XSN A;  1NKC A;  1CWL A;  5IIJ A;  4KLL A;  1ECW A;  2VA8 A;  4MHV A;  2YB4 A;  1MN8 A;  5CJ7 A;  4DQR A;  2MA1 A;  2AHO B;  2RMC A;  4YD1 A;  3C2K A;  5HHH A;  5DGA A;  7ICS A;  5AK6 A;  4O5C A;  3V7K A;  4JB3 A;  1NK0 A;  2HBM A;  4IQW A;  4O5E A;  3QX7 A;  1PK1 B;  3E2E A;  5B66 U;  1DXS A;  4J9M A;  1Q46 A;  4N1N A;  1Z00 A;  5C0Y A;  4GIB A;  4KMO B;  5CBU A;  2MC9 A;  3N7R C;  1LB2 B;  2FPM A;  1ZD3 A;  2HI0 A;  5KFJ A;  3CNH A;  5L1J A;  1Y88 A;  1WCL A;  5J2E A;  3L4P A;  4GXI A;  7ICH A;  4TOT A;  2OYY A;  4FZN A;  4ECR A;  5AK4 A;  1BPB A;  1T3N A;  3OEP A;  5EE1 A;  4J5D X;  4DL6 A;  3H0M B;  3QU2 A;  1X40 A;  3RJE A;  2QAR A;  3MR3 A;  3NVZ A;  3H40 A;  3BZK A;  7ICE A;  2E1F A;  2JEJ A;  5ALW A;  1ZQJ A;  2B21 A;  4F2R A;  5KT2 A;  2BQ3 A;  2BCR A;  5III A;  3TAC B;  4ACO A;  2ISO A;  3RH5 A;  1RG6 A;  2D6F C;  5J0Q A;  1SWV A;  3KHR A;  4FZL A;  1K5O A;  4USA A;  3PSI A;  3PSP A;  1N5X A;  3K1Z A;  1H38 A;  3NGD A;  4B9T A;  1UCV A;  3N7P D;  2PXI A;  4DCC A;  5EWE A;  1NK6 A;  3Q8K A;  5KT7 A;  1WWU A;  4R8U B;  1IHG A;  3BJY A;  5KL1 B;  1Z4N A;  3Q8S B;  2W8K A;  1IIP A;  2RDI A;  2W9B B;  1T4G A;  3M1Y A;  4I27 A;  5J0Y A;  5IIO A;  4RQ2 A;  4I2J A;  1ZKC A;  4BGD A;  3R56 A;  4S1E A;  1X2I A;  5KFF A;  2FI1 A;  1XWL A;  1JXE A;  5ALH A;  5IIN A;  5AK3 A;  3KZX A;  2WF8 A;  1XS9 D;  4OJ6 A;  4CDG A;  5DLG A;  3F5E A;  2UVW A;  2G09 A;  3LVV A;  4IRD A;  3M9M B;  1M9E A;  2JV3 A;  1T8E A;  1ZD5 A;  4LZD A;  3G6X A;  4YFK A;  1TKD A;  3HT3 A;  1D9F A;  3F2B A;  5AKH A;  1SL0 A;  4KLE A;  4TUS A;  2IOF K;  1ZJN A;  4F71 A;  3R54 A;  5H2F U;  1A6S A;  4EEN A;  1Z4O A;  4IPZ A;  2W7O A;  1AWR A;  1XYH A;  5ALN A;  2HHV A;  1QNG A;  3EW9 A;  4M04 A;  3TFS A;  4UB8 U;  5KUW A;  2LMR A;  1M9F A;  1NJX A;  1VBT A;  4IL6 U;  4PHE A;  7ICL A;  3UMB A;  4X5V A;  2PI5 A;  4ECV A;  1W8V A;  2AQ4 A;  8ICT A;  4GXJ A;  9ICG A;  4J9O A;  1ED1 A;  3N4M B;  5DB6 A;  7ICF A;  3PW4 A;  1VJ5 A;  2KIC A;  3V6K A;  1W8M A;  2LM1 A;  1S76 D;  2JHD A;  4QZF A;  3PNC A;  3ODL A;  2BCU A;  4O5K A;  1ZQZ A;  2JEG A;  4O3R A;  4Y2T A;  3UXO A;  4CF3 A;  4HY7 A;  3K0O A;  4J5E X;  4DQI A;  2WF6 A;  2KG5 A;  5A0E A;  2XY6 A;  2E5S A;  3OPX A;  1L6N A;  2HHX A;  2IGV A;  1AK4 A;  2HHW A;  3PX6 A;  2HHQ A;  1C7Y A;  5KFI A;  1MSW D;  3PR4 A;  2DWQ A;  1BPX A;  3TAD C;  2VA2 A;  4R63 A;  2KP7 A;  1X66 A;  2PFN A;  2K89 A;  3KKA C;  2YB1 A;  3BT8 A;  2LPE A;  4ZOH C;  2WFI A;  3ZI4 A;  5CBT A;  5LUD A;  4RQ7 A;  3UMG A;  4QIW F;  1EXN A;  3QYU A;  7ICR A;  2W3S A;  2ZTE A;  4M6W A;  7ICG A;  4OCZ A;  1YND A;  3BS5 A;  2ZIU A;  4KN4 A;  2G06 A;  2ZUC A;  2F44 A;  3GIJ A;  2HMX A;  4DFJ A;  4MF2 A;  2KHQ A;  4AP9 A;  4DQP A;  1XSP A;  2HOF A;  1M9X A;  4QIW C;  3CYM A;  5FP0 A;  1GO3 F;  1KTQ A;  4P0P A;  5DB9 A;  1F0M A;  3D2S A;  4YN4 A;  3RJG A;  4ED2 A;  3WK7 A;  2YN4 A;  1M9C A;  1Q3U A;  5DKW A;  2K8B B;  2W11 A;  3OHA A;  3J81 j;  4I2F A;  3HKZ F;  2PLU A;  1KFS A;  1ZQS A;  2AGO A;  1QNH A;  1XNS A;  3NRZ A;  4B6J A;  8ICQ A;  3C2M A;  4UQG A;  4PGY A;  1ZQB A;  2BPG A;  2XGP A;  5F9N A;  4KIT B;  3RH6 A;  1TAU A;  1S0N A;  3E58 A;  1ZYQ A;  2ES6 A;  2KZZ A;  4YUL A;  1X9S A;  2NRV A;  4DLG A;  7ICT A;  1CEZ A;  4XA5 A;  9ICW A;  3HKZ C;  2V4Q A;  5KG3 A;  1NNL A;  5K4L A;  4C4R A;  2CK1 A;  2WFJ A;  3KD3 A;  3WK6 A;  9ICA A;  3SQI A;  3TAR A;  4FBT A;  1CWC A;  5KFL A;  4EEK A;  2Y0S F; 
#chains in the Genus database with same CATH homology
 2JGA A;  2MRL A;  4BX9 C;  5CCQ A;  2X2C K;  3K0Q A;  4YUG A;  2LYB A;  4OJO A;  3R57 A;  2RS4 A;  4DGC A;  5F66 A;  1V9T A;  2F8L A;  2NUL A;  3RD9 X;  2POE A;  2F2A B;  4E1Q A;  4EYV A;  4O8H A;  1HEK A;  2K4H A;  3N7S C;  5KV6 A;  4OJ5 A;  2KJ9 A;  1NZB A;  2CPL A;  3O0F A;  4LQW A;  5KUQ A;  4JMU A;  2MS4 A;  2B71 A;  2HE9 A;  3T1U A;  1BCK A;  1DRG A;  1YT3 A;  2G0A A;  2ESL A;  4A8E A;  3RDA X;  2IGW A;  2R99 A;  4YUJ A;  4NLC A;  1PVP A;  5T14 A;  2ZIV B;  1SZH A;  3C28 A;  1A0P A;  2HBL A;  4YUH A;  2DQN B;  3MGV A;  2YX8 A;  4C0Z A;  3SMV A;  3S6M A;  4YUO A;  4J58 A;  1CWO A;  2PMZ F;  1CWI A;  2ZIX A;  2HQJ A;  3LVW A;  2OK3 A;  4FRV A;  2JH7 A;  2KEY A;  4FE3 A;  3SAH A;  4OJL A;  5KV3 A;  5KUZ A;  3RCK X;  2BDU A;  2G5H B;  2LKY A;  2WAQ C;  1KBU A;  2G08 A;  5CBV A;  2KHV A;  3T79 A;  2RHF A;  1MA7 A;  2A3V A;  3F2D A;  3K0M A;  4PL2 A;  2PMZ C;  3D2Q A;  2CRX A;  2CN1 A;  4P0Q B;  4DGD A;  5KUL A;  2H3F A;  3F2C A;  4BJQ A;  1ZKF A;  2W7P A;  1PVR A;  3VA7 A;  1CWA A;  4N1P A;  2DF4 B;  3H0R B;  4NV0 A;  2P0O A;  2OH2 A;  5CBW A;  4IC9 A;  2ZG6 A;  3BO7 A;  1E3B A;  3CRX A;  3RCF A;  2KV2 A;  2CMT A;  3SAG A;  4N1M A;  2BIT X;  3K2C A;  3IP4 B;  5KUU A;  2QER A;  4J5B A;  4JCP A;  2H3V A;  3GU3 A;  2F76 X;  2ZIU B;  2H3Q A;  1A58 A;  1J2A A;  2RMB A;  1OUQ A;  3ODI A;  4YUI A;  3JB9 d;  3NUQ A;  4OO1 J;  2XVT A;  1AWS A;  1ZQ1 C;  4N1R A;  2HOI A;  2N0T A;  1CRX A;  3M6Z A;  1H0P A;  2X2A A;  3R49 A;  5DUD A;  3R59 A;  4R3F A;  2NV3 A;  5CYH A;  2M0N A;  2RRD A;  3K0P A;  4OJP A;  1CWL A;  2ZIW A;  4P0P B;  1ECW A;  3VCB A;  2YB4 A;  1VDN A;  2MA1 A;  2RMC A;  2POY A;  4DGE A;  3PZP A;  1IST A;  5KUV A;  2H3I A;  2K4I A;  2KOB A;  2GOL A;  2HBM A;  2GH1 A;  1PVQ A;  2G07 A;  2ZP2 A;  2KNJ A;  4DGB A;  2MZU A;  3LYS A;  1Z1B A;  4N1N A;  5CCS X;  5C0Y A;  4KMO B;  5CBU A;  2MC9 A;  3N7R C;  3F5A A;  3RCI X;  2K8A A;  2VJ4 A;  1D8B A;  5KV4 A;  1AWQ A;  2Y0S C;  4TOT A;  2OYY A;  2HBK A;  4FZN A;  1CYN A;  2OJU A;  1CWF A;  3PMP A;  3OPF A;  1RMH A;  3OEP A;  4J5D X;  3H0M B;  3AL0 B;  2FU0 A;  2Z7J A;  3MML B;  5JHE A;  4O3M A;  3O7T A;  4J5C X;  1MF8 C;  2RMA A;  2E1F A;  1AWU A;  3RFY A;  2H3Z A;  4R3E A;  1F44 A;  2KIW A;  1C5F A;  2DGZ A;  1AWT A;  2CYH A;  2X7K A;  1M63 C;  3EOV A;  5HR6 A;  2XID A;  3AQF A;  3M7D A;  4KX5 A;  2Z6W A;  4ZSC A;  4ACO A;  4QJF B;  2D6F C;  1E8K A;  4PL1 A;  1TAM A;  3ICX A;  5KUR A;  4FZL A;  5KV0 A;  3PSI A;  1CWK A;  3PSP A;  1CWM A;  2ZXI A;  3K1Z A;  4YUN A;  2KJ8 A;  4CRX A;  2HBJ A;  4J59 A;  3N7P D;  1CLH A;  2MVZ A;  1P7D A;  3CYH A;  1CWH A;  3ONN A;  1IHG A;  4O8I A;  2VJ5 A;  5KL1 B;  1IIP A;  2G5I B;  1NMK A;  4YUM A;  5A0L A;  3RF9 A;  2ZIX B;  3KFU F;  2K8C B;  5KUN A;  2XI9 A;  1ZKC A;  3C29 A;  3F53 A;  4GFJ A;  3R56 A;  4S1E A;  3UCH A;  3IG8 A;  3RCG A;  4QNL A;  3ALR A;  1W8L A;  3KZX A;  2ALF A;  5KUS A;  4OJ6 A;  4CDG A;  3F5E A;  2VIX A;  2G09 A;  1Q3V A;  3LVV A;  5HR7 A;  1M9E A;  2KKV A;  1M9Y A;  3GZF A;  1XQ7 A;  3F2B A;  4YUK A;  3R54 A;  4CGZ A;  1A6S A;  4IPZ A;  1VBS A;  4XNC A;  1OCA A;  2W7O A;  1AWR A;  1LOP A;  2OXO A;  1XYH A;  4NWI A;  1QNG A;  2PHC B;  1HIW A;  1X7F A;  4U7C A;  5KUW A;  1M9F A;  1VBT A;  2BIU X;  2ZIV A;  5KV1 A;  1Z19 A;  1W8V A;  1ED1 A;  2HOQ A;  2JMG A;  2WB1 F;  4FRU A;  2OM6 A;  2KIC A;  3AQE A;  4FZM A;  1W8M A;  2WLW A;  2JHD A;  2K7N A;  2KD1 A;  3ODL A;  5CRX A;  2X2D B;  2RP5 A;  5KUO A;  1M9D A;  2A2N A;  1ZMF A;  4HY7 A;  5KL8 B;  3K0O A;  4AYB F;  4N1Q A;  4I9Y A;  3RFA A;  4J5E X;  3CYS A;  5A0E A;  2ZIW B;  2E5S A;  3OPX A;  1L6N A;  2OSE A;  3RDB A;  2IGV A;  1AK4 A;  1AWV A;  2WB1 C;  3SAF A;  1A33 A;  3E0F A;  2HAQ A;  1URJ A;  5KV5 A;  4P0Q A;  2LYA A;  2WAQ F;  2K89 A;  2YB1 A;  2X83 B;  2XIC A;  3BT8 A;  3M6K A;  4N1O A;  2WFI A;  4AYB C;  1Z81 A;  3RDD A;  4KX3 A;  5CBT A;  5LUD A;  1VAI A;  3IG5 A;  2K4E A;  4QIW F;  3QYU A;  2JH1 A;  3K0R A;  2KVC A;  1DYW A;  4ZSD A;  1CWJ A;  4J5A X;  3R4G A;  3NRW A;  1YND A;  1QOI A;  2ZIU A;  2C3B A;  1MIK A;  2G06 A;  5CCN A;  3ORE A;  3IN5 A;  3K0N A;  2HMX A;  3RCL A;  2F77 X;  2KHQ A;  4ICA A;  2HOF A;  1M9X A;  4S1J A;  2XGY B;  4QIW C;  3CYM A;  4YUP A;  2R18 A;  1WUD A;  1GO3 F;  2VKQ A;  1UPH A;  1MZW A;  4P0P A;  1XWN A;  3PST A;  4BUG A;  5CCR A;  3D2N A;  3D2S A;  4N1S A;  3RDC A;  3H0L B;  1M9C A;  1Q3U A;  2K8B B;  3CP8 A;  3HKZ F;  2PLU A;  3DEE A;  1QNH A;  1XNS A;  3BKP A;  5KV7 A;  1T94 A;  2GW2 A;  4DGA A;  2ZXH A;  2KJ5 A;  2CPR A;  2HQ6 A;  2CFE A;  2KKP A;  1FGL A;  2Q4T A;  1W74 A;  4YUL A;  1XO0 A;  2E1E A;  4JJM A;  2N1R A;  3PSF A;  3ICH A;  3HKZ C;  2W03 A;  5KV2 A;  2LHT A;  4U6P A;  2CK1 A;  3ICI A;  2WFJ A;  4NLB A;  2LBO A;  4CYH A;  2X25 B;  3SQI A;  3MML A;  1CWB A;  3L3F X;  2W04 A;  1CWC A;  1XO7 A;  4WJ3 B;  3VC8 A;  2Y0S F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...