1IHGA

Bovine cyclophilin 40, monoclinic form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
364
structure length
364
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
molecule keywords Cyclophilin 40
total genus 130
structure length 364
sequence length 364
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ihgA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1ihgA01
4N5CA 3NF1A 2V5FA 1Z81A 2BUGA 1DYWA 2OSEA 4UQXA 4HOSA 4XI0A 3MV3B 4CDRA 5ARFA 3GW4A 5HI7A 5KV5A 1M9EA 1M9CA 4JL0A 3UPVA 2FI7A 2KATA 3CVPA 3BO7A 4N1PA 3RD9X 4XNCA 3LY7A 4AM9A 3LKUA 4N1MA 4G24A 4UI9J 4J5EX 4N1QA 2GW2A 5KV6A 2VSNA 5CHEE 4YUGA 3GYZA 3OXLA 4I9YA 3ZFWA 1NA3A 1CWBA 3MA5A 4WNDA 3JYSA 1QZ2A 1KT1A 4N3AA 3ZPJA 3U3WA 3CK8A 3LY9A 1XYHA 5CCRA 5KJKA 1IHGA 5KUOA 5A7DB 3ESKA 2PQRA 3UUXA 5CCMA 3KS2A 2ALFA 3CK7A 3VTXA 2VGXA 3ICIA 4BT9A 1HXIA 5HQ8A 4XI9A 1BCKA 4E1QA 3O7TA 4S1EA 1AK4A 3E4BA 3SF4A 2CK1A 4CYHA 2X7KA 3TG4A 4UI9K 5LCWJ 2OJUA 1CWAA 2MS4A 4I9EA 2POEA 1Y8MA 2X83B 3IEGA 1OUVA 5FT9A 3TG5A 3AS5A 3URZA 4YVOA 3RFYA 4G23A 4LQWA 3PE4A 3S7BA 1A58A 2KCLA 1W3BA 2PHCB 4DGEA 4YUHA 4J5AX 5KV7A 1KT0A 1NMKA 3K0OA 5DUDA 3K2CA 5A0EA 4H7YA 3MKRA 4B94A 1M9XA 2RS4A 5KUQA 4FRVA 2OK3A 2CPLA 3JB9d 3PE3A 2C0MA 3CVLA 4I17A 4F3VA 2QFCA 1W8VA 1A17A 5KV2A 2YHCA 2PZIA 4BWRA 5G05C 2HAQA 5CCQA 4G25A 3RO3A 3RU0A 2CMTA 4KXKB 4GA0A 3T1UA 1PC2A 2LNIA 1CWFA 2UWJG 4U0ZA 1OCAA 3VA7A 4GCNA 4GPKA 4N1RA 3SZ7A 2BITX 3LYAA 1ELWA 2VGYA 2IFUA 1NZNA 2B71A 4HY7A 5KJMA 4NQ0A 3R57A 2XCBA 1KLXA 2XGMA 4GZ6A 1CWOA 4YULA 1H0PA 3RKVA 5EX3A 4N2SA 3R56A 3ASGA 3CKBA 1M9YA 1J2AA 1WM5A 1MF8C 2P0OA 2HQJA 4O8IA 4ZSDA 4DGAA 1M63C 5EX0A 4J59A 1HZ4A 1MIKA 3QDNA 4GA2A 3Q15A 5M72A 2FU0A 5KUSA 5KUVA 4U04A 5CCLA 3LY8A 2DBAA 4I9CA 1AWRA 1YNDA 1AWUA 4BTAA 1QNHA 1CYNA 2C2LA 2XEVA 3RDDA 4AY5A 5BW8C 5KV0A 1QQEA 3QWVA 4Y6CA 1M9DA 2QERA 3EOVA 3RDAX 2WFJA 3FWVA 3N71A 2WQHA 3AS4A 2IGVA 4TOTA 4JA7A 4EYVA 4J5DX 4GCOA 1W74A 5ARGA 4J5CX 5JJTA 4YNDA 2R99A 5FZRA 3CYSA 1AWVA 1CLHA 2ESLA 4J8DA 1AWTA 1XWNA 4LEUA 4N39A 2FEZA 5FTPA 5BNWA 3TGOA 2HR2A 2A2NA 1CWLA 3OEPA 5KJNA 3S7FA 4YUOA 3RDBA 1IYGA 4R3FA 3KAEA 4O6FA 1X7FA 1FCHA 1QNGA 2KCVA 4GYWA 2XGOA 3PDNA 3RCLA 4O8HA 4UI9C 4WUYA 1ELRA 3K0QA 3ODLA 2RMBA 5CYHA 1XO7A 2RMCA 1ZU2A 4IPZA 1W8MA 2BIUX 3ODIA 1CWCA 1TJCA 4UQYA 2KC7A 5A6CA 1VDNA 2XGYB 1P5QA 2I6HA 3WXXA 1HH8A 4R3EA 2FBNA 3ZHEB 4HOUA 3R4GA 4KYOB 4IN3B 2ZP2A 3QWPA 2L6JA 4GZ3A 3R9AB 4I2WA 5KUUA 3LCAA 2MZUA 1V9TA 2J9QA 3MEKA 3FP3A 4GA1A 3O48A 5KUNA 2Q7FA 2FF4A 2MVZA 4ABNA 4N1NA 4YVQC 2LSUA 3K9IA 4XIFA 3MMLB 2NC9A 1QOIA 1XQ7A 1CWMA 2XCCA 3MV2B 5FZQA 2N0TA 3AS8A 3R49A 5KV3A 1NA0A 3ASDA 4S1JA 1LOPA 2PL2A 3ZGQA 3R54A 3CV0A 4RG6A 2IF4A 4YUJA 2PQNA 1ISTA 4DGDA 5G04C 3PMPA 3HYMB 2VSYA 3CK9A 4GZ5A 3S7DA 4J5BA 2OOEA 3EDTB 4BT8A 4WNGA 2X2CK 2HO1A 3RO2A 4N1SA 3CEQA 5FJYA 3ULQA 2P58C 2MC9A 4N3BA 4J58A 1VAIA 5CCNA 5AYWD 3QOUA 2PLUA 5KV4A 2VYIA 2WPVA 1XNFA 4ME2A 4YUKA 2IGWA 1A33A 5LCWC 4YUNA 1E8KA 2C3BA 2HQ6A 2E2EA 3GZ1A 3UCHA 4APOA 3Q49B 3K0PA 5G04J 3BT8A 5JJ7A 4DGBA 2C0LA 1M9FA 3Q5MA 5JJ6A 4N3CA 3ASFA 5CCSX 4WNFA 2VQ2A 2KCKA 1VBSA 1IIPA 5KUZA 1FGLA 2POYA 3QWWA 1CWHA 3OXFA 4JA9A 5C1DA 4HORA 1RMHA 2ONDA 2R5SA 5KJLA 2JLBA 3OPFA 2YQ8A 3RCGA 3CYHA 3S7JA 4U07A 1MZWA 4JJMA 5EKQD 3Q47B 3CVQA 3CKCA 3QYUA 1CWJA 5KUWA 4G26A 4YUPA 2X2DB 2Z6WA 5CBUA 3Q4AB 5F66A 2CFEA 4N2QA 1AWSA 1W8LA 2UY1A 4EQFA 4HOTA 5G05J 5KULA 3R59A 4ZSCA 3RIBA 4WNEA 2X25B 2K7NA 5KV1A 3GZ2A 1YA0A 4J8FA 3OXGA 4AY6A 4GYYA 4U0UA 3U4TA 5JHEA 1E96B 5KURA 5DIZA 2LSVA 3OREA 4G1TA 4BTBA 3FFLA 5CBTA 4KBQA 1AWQA 3VTYA 5BT1A 3K0MA 4DGCA 2Y4TA 4CGVA 4G2VA 2WFIA 4H7XA 2MHKA 3LPZA 3K0NA 3RCKX 2HYZA 2CYHA 4J0UA 2RMAA 4UQZA 4I2ZA 4HOQA 3ZN3A 3BKPA 2WLWA 4YUIA 3RCFA 2UY1B 4W9RA 1C5FA 5FZSA 3UQ3A 4JHRA 1E3BA 5D0OD 3ICHA 4N1OA 4Y6WA 4CGWA 2HE9A 3S6MA 3ZHEA 5D0QD 4YUMA 4J8EA 2AVPA 1WAO1 1B89A 1ZKCA 5DBKA 4JCPA 3TAXA 5CBVA 4U0SA 1VBTA 3K0RA 2XGSA 4A1SA 2FO7A 3CVNA 1CWKA 1ZKFA 4AIFA 2GW1A 1ZBPA 2XPIA 1CWIA 3BEEA 4FRUA 3RCIX 3QKYA 4RG9A 5LUDA 3KD7A 4I1AA 2NULA 3RDCA 5CBWA 2X2AA 2VGXB 3MMLA 3RJVA 3ASHA 2Y4UA 1ZMFA 4NRHB 4GYOA
chains in the Genus database with same CATH superfamily
3HXDA 2P9KG 1DYWA 4HOSA 2R59A 4FHJA 3MGBA 4GMJA 1N52A 4JL0A 3BO7A 2IU1A 3D9KA 4AVXA 4UI9J 3IV0A 4KZ0A 4WAFA 2VSNA 3FTZA 1EF1C 3JXIA 4URKA 3GYZA 2WXHA 4G11A 3UT8A 3QAQA 3MA5A 5FQ7A 1TN8A 1KT1A 1MQSA 4MS6A 5ENNA 4FC8A 2DWZA 5CCRA 1BD8A 4OAVB 2WQ7A 1OWLA 4HI8A 2V0PA 4UWGA 5CCMA 3TWRA 3KS2A 2ALFA 2B0OE 2VGXA 2VJ8A 1TNOA 2BKKB 3FUFA 1S70B 4XI9A 1GW6A 4DRXE 3O7TA 3QK0A 4AEZC 1HF8A 3SF4A 4CYHA 3DSUA 2X83B 1SW6A 3FU0A 2XEEA 4YVOA 1E8ZA 4EZKA 1H6OA 4LQWA 3S7BA 2DZNA 4XKBA 5ENTD 1W3BA 4DGEA 4YUHA 4J7WA 4PDXA 1NMKA 5AENA 5DUDA 1FT1A 4H7YA 4B94A 2FO1E 1M9XA 4R7LA 3JUEA 3J5PA 4FRVA 2OK3A 3LS8A 1O5MA 2XQ0A 3JB9d 4FLBA 4F3VA 2C0MA 2QFCA 2YHCA 1E90A 1SA5A 5G05C 2KBXA 3Q7FA 4JZYA 1E8WA 2LNIA 4MRUA 5H7PA 1OCAA 2LUHA 3VA7A 3FTWA 4FJYA 2CFZA 2B71A 1NZNA 4I6EA 2BTDA 1SZAA 3UKUG 3AG1E 3BUAA 4J8YA 3B7TA 4A1GA 5EIBE 5EILA 4GZ6A 5CEAA 3R56A 4B8CB 2OCCE 2P0OA 2HQJA 2ZISA 4ZSDA 4DPRA 1HU3A 4J59A 4ILGA 5ENSD 5CRVA 1E8XA 2X6JA 2DBAA 5ENQD 4I9CA 1AWUA 3LVQE 5FINA 4TXQA 4O1OA 4AY5A 5BW8C 1QQEA 3EOVA 3RDAX 3FWVA 2WQHA 3AS4A 3U66A 1MJ0A 4CT0A 1W74A 4U8VD 2GRNB 3L9TA 4YNDA 5FZRA 1AWVA 2R17C 3HRAA 1XWNA 3TXMA 5BNWA 3TGOA 3SD5A 1DNPA 2BEDA 1FPPA 1BI7B 2AJAA 4IPZA 1W8MA 1UOHA 1CWCA 5A6CA 1VDNA 4HLLA 1SQMA 2X3MA 2DYSE 2I6HA 1TNYA 3WXXA 4R3EA 1K1BA 4HOUA 3R4GA 4GMLA 4IN3B 5G55A 1SA4A 4GZ3A 4I2WA 1IKND 4N5QA 4YDOA 3ZYKA 3ZU7B 2YNQA 1YMPA 3LXUX 2LSUA 1TJFA 4ACLA 2HM8A 5ENOD 2XCCA 1OWNA 4U96D 3R49A 2H6IA 3AS8A 1IHBA 3I3NA 2XRYA 4GB9A 2I1KA 2IF4A 4GTQA 3IBEA 5CMYA 4DGDA 4HLEA 3ZVVA 4P29A 3PMPA 2LAIA 3ONKA 3S7DA 2X6KA 3EDTB 1H6PA 4WNGA 2QC9A 2X2CK 2MOWA 2GROB 4N1SA 4JEHA 3CEQA 2MC9A 5ITZF 3HXFA 3OAWA 3D9HA 4CDNA 1JUQA 5KV4A 3EUVA 2VYIA 3PZ1A 2IGWA 4HRLA 1A33A 4Q94A 3T8KA 3HXBA 2LXMA 2WXOA 2E2EA 5FQ6A 5G04J 5JJ7A 2HE0A 3L08A 2P9IG 3ZW3A 3QC1A 4K5AB 3RRMB 3FTSA 5CCSX 2LO6A 2KCKA 3DPDA 1XGWA 1X5BA 3QWWA 3OXFA 5EYLA 3RRNB 4C0MA 4HORA 5KJLA 1H0AA 5AN8A 3OPFA 2CFUA 2YQ8A 3CYHA 1N94A 4QFVA 2WXFA 5CEDB 4UWKA 3W9FA 4JJMA 4TXPA 4PH4B 3IXEA 2AXZA 2WXIA 1YYHA 1CWJA 4G26A 4DK5A 2Z6WA 1LD8A 5F66A 5FIOA 3PZ2A 4LUNU 3ASNE 1W8LA 3WG7E 3PS6A 5G05J 3R59A 4ZSCA 3FEYA 3QARA 1HG2A 2L6BA 3E34A 2X25B 3GZ2A 4J8FA 4AY6A 4LCTA 2NNZA 3LDZA 3U4TA 3NOCD 2F8XK 1E96B 4AP2A 3DPYA 2J49A 4DX5D 4GMRA 1N4QA 1AWQA 3VTYA 5BT1A 3L16A 3ABME 2Y4TA 2QY7A 4CGVA 2WFIA 2OVFA 3U9WA 3ZXSA 3DSVA 3DSWA 4O1PA 2CYHA 3ZYMA 2RMAA 4I2ZA 4HXIA 3ZN3A 3UI2A 4YUIA 3RCFA 2EILE 3CR3A 4W9RA 4ANXA 2XPZA 4RQIA 2GRRB 3RRUA 4L2LA 4CGWA 1TYQG 2V4LA 1HO8A 3KOPA 2AVPA 1B89A 1ZKCA 4JCPA 3D9LA 5D66A 1ZKFA 4AIFA 4LRZA 4FU3A 4GTMA 4RG9A 4BY6A 2CHWA 4PS3A 3RDCA 3J5QB 2ZIRA 4HB5A 3MMLA 4NRHB 2V5FA 4DX1A 1Z81A 1EPUA 2I2OA 3QJZA 4OYSA 4L9PA 4XI0A 4G8KA 4DJAA 1Q2ZA 3ZUVB 2Y1LE 3AAAC 1WDYA 4BERA 4E85A 4OAUC 3Q9NC 1QBQA 3CVPA 3ISMC 3GZSA 3RD9X 3LY7A 5A23A 2WXRA 3S2AA 3L17A 4F7AA 3OXLA 1CWBA 3AJIA 3FHEA 4WNDA 3JYSA 4N3AA 3ZPJA 5KJKA 1IHGA 1JPLA 5A7DB 1JWGA 2IOSA 2MRIA 2PQRA 3ULYA 3UUXA 2ILRA 4GPMA 4E6HA 3AG2E 1N9AA 4S1EA 5AQAA 3FUMA 4FLHA 3DBSA 4L23A 1Z3YA 4UI9K 3ZRHA 1CWAA 2MS4A 4GTPA 4I9EA 3ZYLA 3ZNGA 2DIWA 3TXNA 4ANWA 4X8QA 2PM6A 3AS5A 3URZA 5KWDA 1SVXA 3PE4A 3APDA 3TWTA 2IOLA 2VSOE 3HDXA 1OT8A 1LTXA 4DX2A 1UG3A 3ZYQA 5J90A 3DXKG 5KV7A 4J8SA 1KT0A 4ZFHA 4D10C 3DWLG 3BG0B 3MKRA 1A5EA 4K03A 2RS4A 3L54A 2CPLA 4XX5A 1E8YA 3PE3A 1U3DA 3UIOC 1W8VA 1A17A 3FH7A 5BV0A 1IXVA 3FU5A 2IQCA 4XEIG 4TXRA 2R05A 3CHPA 3KSQA 1CWFA 4WWNA 2UWJG 4KVMA 4U0ZA 3AG3E 1ZX8A 2AXVA 3CHQA 4N1RA 3SZ7A 4I1OB 5CBNA 1MZCA 3FH5A 4NURA 3HVEB 4CCAA 2IFUA 3CQCB 1DVPA 3R7RA 2J08A 3SFYA 4C9BB 1H6KA 3L13A 5KJMA 4NQ0A 4M7CA 2RG8A 1CWOA 1SZ9A 4LNUD 5E75A 5EX3A 3RKVA 3FDHA 4N2SA 3V2XA 3CKBA 1M9YA 5JHAA 4B0ZA 1J2AA 3SNXA 1MF8C 4O8IA 2AW6A 1OCRE 3FTVA 1M63C 1HZ4A 3QDNA 3FUIA 2FU0A 4I1MA 5KUVA 3W9GA 3LY8A 2LAHA 1QNHA 4FHKA 1CYNA 5KV0A 2NYJA 3ASOE 4LG6A 1TEZA 4EYVA 3DRAA 3UTMA 4GCOA 5ARGA 3TJPA 4J5CX 3PZDA 3UIPC 3CYSA 3C3RA 4Q69A 2ESLA 4HRMB 1S64A 3KEAA 1TR4A 3LJNA 4N39A 2A2NA 5FTPA 3OEPA 2HR2A 3TWVA 4OVUA 1IQRA 4R3FA 3D9IA 4ZHBA 4K0RA 5HS0A 2XGOA 4O8HA 3E37A 2WVIA 2GGFA 3SHFA 4WWPA 2ZGGA 1AWCB 3ODLA 5CYHA 1S63A 3IHVA 4MLPA 2RMCA 4RLYA 4HFGA 3ODIA 4UQYA 3B95A 2KC7A 3TWSA 1P5QA 1HH8A 2FBNA 3ZHEB 1N54A 3CIAA 2ZP2A 3PZ4A 2L6JA 4HRNA 4CEMA 3R9AB 1FVFA 3TWXA 3D9JA 3LCAA 3NAWA 4B8AA 2XENA 2X38A 2J9QA 3FP3A 3O48A 1OWOA 5KUNA 2Y0BG 2MVZA 4ABNA 3K9IA 4XIFA 1HX8A 3ABKE 2NC9A 1XQ7A 1CWMA 3L82A 1KZPA 4L7TA 3I4RB 2PM7A 1NA0A 4HQDA 4WWOA 2L0IA 4RG6A 1N0RA 5G04C 3MZLB 3V31A 3HYMB 3EU5A 3CK9A 4J5BA 2OOEA 4KMOA 4Z68A 3HXCA 4MBGA 4L1BA 1OCCE 3EHMA 3JQ1A 3ULQA 3C5RA 3VLDA 4JB8P 4ME2A 4YUKA 3UT7A 5LCWC 4YDWA 4YUNA 3GZ1A 3HVEA 1VDYA 1D8DA 2R02A 4APOA 3PH0C 3TWQA 3ZIMA 4A3TA 4A63B 1JCSA 1M9FA 4GZCA 5IY5E 3JUIA 4AJWA 4WNFA 1IIPA 5B1BE 3QB2A 3FTYA 5AAOA 5LFAA 4F53A 4YDEA 2JLBA 3JQ0A 5HRYA 5BPPA 3EIJA 2ETCA 4J6IA 4ATZD 3EHRA 5KUWA 4YUPA 3I5PA 3ML8A 3Q4AB 4A3VA 2CFEA 4GTVA 3P1UA 1AWSA 3LVRE 2DZOA 2UY1A 4EQFA 3G2VA 3RIBA 2OVBA 2QYUA 2K7NA 4EZJA 1TN6A 5KV1A 2XRZA 1YA0A 3R9MA 5FWQA 4U0UA 5DIZA 4GTRA 3OREA 4BTBA 2P9UG 3FFLA 4MKTA 4KVOA 5CBTA 5BXOA 4DGCA 1K3ZD 3G2WA 3PNTB 1N4SA 1EYHA 4PS8A 3CVWA 2WXGA 3LPZA 3RCKX 1V54E 4UQZA 3L22A 4HOQA 4CRWA 1ZB1A 1H2TC 3G2UA 2UY1B 2WXKA 1C5FA 1UJKA 2F0YA 4JHRA 1E3BA 3R7QA 5D0OD 3ICHA 4CT4A 4Y6WA 3Q73A 5D0QD 4YUMA 4UWHA 4HS2A 1OY3D 1VBTA 3K0RA 2XGSA 3FUNA 5AJLA 3ASHA 1ELKA 4FRUA 1TN7A 4LNBA 4M3OA 5LUDA 4I1AA 5CBWA 2X2AA 5T4YA 4CYMD 2Y4UA 1ZMFA 2P58C 3NF1A 1MX2A 1QNFA 4U95D 4UQXA 4FADA 4EHMA 5ARFA 4CDRA 2VTBB 5HI7A 5KV5A 2RKKA 4EZLA 3SFXA 2V4HC 1H2UA 2IO3C 4AV7A 4N1PA 1FT2A 4ANVA 4AM9A 4N1MA 4G24A 4J5EX 3D3MA 5G2NA 3CQGB 4IRUA 4I9YA 4IYPA 4FA6A 3ZFWA 2X6HA 2WXQA 3MKQB 1QZ2A 4JD2G 1K1AA 3U3WA 4XZ4A 3CK8A 3FTXA 1Z6TA 4HVBA 5KUOA 5EYPF 3ESKA 3PEUB 4G8LA 2H6HA 3SBTB 2WMOA 3DSSA 5HKPA 1NI1A 3NBNB 1BCKA 4E1QA 1KZOA 2EIME 1AK4A 2CK1A 3TG4A 3FU6A 2OJUA 3TWUA 2EINE 1Y8MA 5BV1A 4PS7A 2P9SG 1U3CA 4F1PA 3TG5A 5FT9A 1Z3XA 1H19A 3BU8A 3CVYA 5CMWA 4DLQA 3T9KA 4BSXA 4ILHB 3PUJA 4G23A 4BETA 3EIQC 2GRMA 3TL5A 4EBAG 3Q79A 3NZUA 1PY1A 2WXNA 1E7UA 2DCPA 4J5AX 1DCEA 5EIDA 2JABA 1MX4A 5BXUA 2AWIA 4DI3A 3KSLA 4TUMA 5LX8A 3TWWA 4BWRA 1D8EA 4G25A 5CCQA 3RO3A 4KXKB 2RFAA 3T1UA 3HIZA 1PC2A 3SFZA 3ABLE 2KA0A 1NFIE 1O1SA 1X81A 4EPZA 4GPKA 2BITX 3LYAA 1ELWA 3P2BA 1OWPA 4HY7A 5ENPD 1E7VA 3R57A 1V55E 2XCBA 1JWFA 3FEXA 2XGMA 3DSXA 1H0PA 3E30A 1MX6A 3UT4A 4GTTA 5EX0A 1MIKA 4Q96A 4GA2A 3RAUA 3AU4A 1U2VG 3B7BA 3Q15A 5M72A 1HE8A 5CCLA 3X2QE 2GRQB 1AWRA 5EDSA 1YNDA 5AQ9A 1HS6A 5AIJA 4BTAA 2RFMA 3DXMG 2C2LA 3RDDA 1RW2A 3QWVA 4Y6CA 1M9DA 2J09A 2IEJA 4BX9A 2WFJA 4BFRA 5CRUA 3SO8A 1RZ4A 4AXHA 4TOTA 4JA7A 4A55A 4FP7A 4ACKA 2FULA 3FUHA 3BQOA 3CVUA 5JJTA 2QZAA 2R99A 1CLHA 4ILIA 1IQUA 1S0PA 4BEPA 5ANLA 4LEUA 2FEZA 1CWLA 5KJNA 3S7FA 5D2MC 2NSZA 3KAEA 1QNGA 2KCVA 2AXUA 4GYWA 1FVHA 4WUYA 2ZXWE 2CG2A 4V3IA 1PAQA 4O60A 2A4ZA 3APCA 3C3OA 3K0QA 4HI9A 1ZU2A 2BIUX 2H6GA 1TJCA 3SY2A 2XGYB 4ANUA 1DC2A 4JEUA 3SGHA 3FH8A 4ATGA 4KYOB 3JCKC 1UJJA 5KUUA 2DVWA 2CHZA 2MZUA 4GTSA 2Y69E 2P2CP 2BF0X 2Q7FA 2FF4A 3ML9A 2NXPA 1QOIA 4LERA 3MV2B 1N95A 2E0IA 3FTUA 5FZQA 2N0TA 5KV3A 2XS1A 4HNAD 1OCOE 3CGHA 3UKRG 4UWFA 3ASDA 4S1JA 4DUIA 1L5JA 3ZGQA 3IHYA 4YUJA 5E76A 2PQNA 1ISTA 2KZTB 1N11A 2J07A 4GZ5A 4BT8A 1MHQA 2CHXA 5FJYA 2I9CA 4N3BA 4JPSA 1VAIA 5CCNA 3CHOA 4XE0A 3QOUA 1XNFA 1TNZA 3CHRA 1N4RA 1E8KA 2HQ6A 3NZSA 3UCHA 3Q49B 3DSTA 5JMND 2L9BA 1N4PA 4DGBA 3CVXA 5AJDA 3MKQA 2IY0C 1BI8B 3ASFA 1INZA 3EJNA 4GTOA 1VBSA 5KUZA 4BESA 2POYA 1CWHA 1D9SA 4JHJA 1TNUA 2WXJA 1K8KG 4JA9A 5C1DA 4GZDA 2ONDA 3V30A 3D9OA 3RCGA 1MZWA 3CVQA 2VSXE 1HFAA 3CKCA 3QYUA 4PUCA 4F6RD 4N2QA 4CZ2D 4HOTA 2MYOA 5KULA 4WNEA 3OXGA 1NP7A 2WB2A 1LD7A 4JC8A 2ZU6B 3MJWA 2LSVA 4KBQA 2GRLA 2J4DA 3I4GA 5CERB 4C0EA 2EQXA 3K0NA 2HYZA 4J0UA 1LF8A 5B3SE 4GU5A 4DI4A 3UMVA 4OVVA 3SQVA 3UQ3A 4RVBA 3T8MA 1EDUA 3G2TA 4KT6B 4N1OA 2HE9A 1OCZE 3ZHEA 1UN9A 5J08A 1WAO1 5DBKA 3TAXA 4U0SA 2XEHA 2QYJA 2FO7A 3CVNA 2IO2C 1ZBPA 1CWIA 5AQ7A 3BEEA 3FUJA 1Y6IA 5AQBA 4JHKA 3C72A 4GYOA 4N5CA 2CG3A 2KZTA 2A5EA 2BUGA 3EHQA 2OSEA 5ENRD 3FUKA 2M63A 3HG0D 3Q9UC 3EU9A 1O1TA 1UN8A 3MV3B 5T3RA 2VGEA 3GW4A 3C98A 4C48B 3SI5A 1M9EA 3Q78A 3Q75A 1M9CA 2X6IA 3UPVA 3D9MA 2LXLA 2FI7A 2KATA 2V5QC 5T8IA 4XNCA 3LKUA 2DYRE 4N1QA 2GW2A 5KV6A 5CHEE 4FJZA 5KNHD 4YUGA 1NA3A 3ULEG 2R2LA 2WXMA 1QYMA 3ENEA 2RD0A 3CHMA 3LY9A 2OEWA 1XYHA 2KM4A 1NL4A 4BSZB 3G2SA 1HG5A 3CK7A 3VTXA 3ICIA 4BT9A 1HXIA 3PEVB 5HQ8A 3C3QA 2YHEA 3E4BA 3PVLA 2X7KA 5LCWJ 3PUKA 2VTBA 2POEA 3ZXPA 3IEGA 4TUUA 1OUVA 4QQIA 4L2YA 3CVVA 3RFYA 4U7EB 3ONLA 4TRQA 1A58A 2KCLA 3UM0A 2V8SE 4JVSA 5JA4D 3ZEFA 2PHCB 1JCQA 2R03A 1O1RA 5KNGA 4JXTA 3K0OA 5A0EA 3K2CA 3ESLA 3ZKJA 4GAAA 4NACA 4YDYA 5KUQA 2OEVA 5EN5D 2JEKA 3BG1B 3CVLA 2I1JA 4I17A 5KV2A 5JHBA 2PZIA 2HAQA 3APFA 3RU0A 2CMTA 4GA0A 3T5XA 3D9NA 3UINC 1N0QA 3FY4A 3SBSA 4GCNA 2WXLA 3B7RL 2VGYA 3PREA 2XZTG 3JXJA 4K5CA 3DEOA 3CSFA 3PNLB 2P9PG 2KXPC 1KLXA 3FULA 4YULA 3PZ3A 2XS8A 3ASGA 5LP0A 1WM5A 2Y3AA 4DGAA 4IULA 3B7UX 3B7SA 3MX3A 5KUSA 4K5BA 4U04A 3UX4A 4LNGA 2XHEA 2XEVA 5KCMA 5LOZA 2BKGA 2QERA 1Z5SC 4FULA 3N71A 3MCXA 2IGVA 2B6CA 2ETBA 5CBOA 4J5DX 3UXGA 1G3NB 4J8DA 1AWTA 4YUOA 3RDBA 1IYGA 4O6FA 1X7FA 1FCHA 3PDNA 3RCLA 4UI9C 1ELRA 1H2VC 3FU3A 3NOGD 2RMBA 2XPYA 1XO7A 3CSTA 2ETAA 5BUZA 1BPOA 3E32A 2J4BA 3VLEA 5AARA 2WQ6A 3FUDA 4TV3A 3UM2A 4RSYA 3QWPA 3LJ3A 1V9TA 3MEKA 4GA1A 2WM9A 2WMNA 2XZDG 2J8SD 4N1NA 4YVQC 3MMLB 3X27A 1AP7A 3CHSA 2WXPA 4I6GA 4EECA 1WY6A 4APFA 3UM1A 1WG0A 1OWMA 1LOPA 4XKCA 2PL2A 4U63A 3R54A 3CV0A 5KBAA 3AU5A 2VSYA 3KEZA 3V2OA 2HO1A 3RO2A 4UUCA 3IKOB 4LSZE 3T5VA 5FQ4A 4B93B 4J58A 5C2YA 5AYWD 3HXEA 5CECB 2PLUA 3NQPA 2WPVA 5B1AE 2EIJE 4DLOA 2F37A 2A5UA 3NB2A 2C3BA 4EBAA 2X6FA 4I43A 3K0PA 4CDMA 3BT8A 1YCSB 4DX7D 1OXJA 1BLXB 1UW4B 2C0LA 3Q5MA 3V79K 5JJ6A 4N3CA 2VQ2A 2ZGDA 1FGLA 4BX8A 1RMHA 5ANRA 3F6QA 4DX6D 2R5SA 5FQ8A 3U64A 2P9LG 4F1SA 3S7JA 4U07A 4AOFA 5EKQD 3Q47B 3PRZA 3FUEA 4NIKA 4U8YD 2X2DB 5CBUA 3D9PA 2YINA 3MYVA 1TNBA 3VLFA 2L0TB 4UWLA 4GYYA 3Q7AA 3E33A 3OTNA 5JHEA 2PNNA 3RK6A 1MYOA 2IONA 4KZCA 5KURA 3B13A 4G1TA 3QNKA 3RSEG 2GRPB 3K0MA 2H6FA 3O4ZA 4G2VA 3DEPA 4H7XA 2MHKA 3AG4E 2P9NG 1KPSB 2EIKE 4B89A 1BU9A 3BKPA 2WLWA 1JCRA 4JW1A 5FZSA 2IJGX 3HHMA 4HBDA 3S6MA 4J8EA 4U8HA 5CBVA 4A1SA 1CWKA 2OV8A 2GW1A 3L6AA 2XPIA 2F8YA 3CLJA 1DCQA 3RCIX 3QKYA 3KD7A 2NULA 3LEWA 3UM3A 2VGXB 3RJVA 4I6JA 3EHNA
chains in the Genus database with same CATH topology
4N5CA 3NF1A 2CG3A 2KZTA 2V5FA 1Z81A 2BUGA 1DYWA 1EPUA 2I2OA 3QJZA 1QNFA 3FUKA 4OYSA 4UQXA 4HOSA 2M63A 2OSEA 2R59A 4FADA 4XI0A 4FHJA 4DJAA 1UN8A 3MV3B 3MGBA 5T3RA 5ARFA 4CDRA 4GMJA 2VTBB 3GW4A 3C98A 5HI7A 5KV5A 3SI5A 4EZLA 1N52A 1M9EA 4E85A 1M9CA 1H2UA 2X6IA 4JL0A 3UPVA 3D9MA 2FI7A 2KATA 4AV7A 3CVPA 5T8IA 3BO7A 4N1PA 3GZSA 4ANVA 3RD9X 4XNCA 3LY7A 4AM9A 3LKUA 2IU1A 3D9KA 4G24A 5A23A 4AVXA 4N1MA 4UI9J 4J5EX 3IV0A 2GW2A 2WXRA 3D3MA 4KZ0A 4WAFA 3S2AA 4N1QA 5G2NA 5KV6A 2VSNA 5CHEE 3FTZA 3L17A 1EF1C 4FJZA 4YUGA 3CQGB 4IRUA 4F7AA 3GYZA 4URKA 3OXLA 4IYPA 4I9YA 4FA6A 3ZFWA 2X6HA 2WXHA 1NA3A 4G11A 3JB9d 3UT8A 2WXQA 1CWBA 3QAQA 3MKQB 3FHEA 3MA5A 4WNDA 3JYSA 1QZ2A 5FQ7A 2WXMA 1KT1A 3ENEA 4I6JA 4N3AA 3ZPJA 3U3WA 4XZ4A 2RD0A 3CHMA 1MQSA 3CK8A 3LY9A 4FC8A 4MS6A 5ENNA 1XYHA 5CCRA 2KM4A 3FTXA 5KJKA 1IHGA 1Z6TA 1JPLA 4HVBA 2WQ7A 1MIKA 1OWLA 5KUOA 5A7DB 1JWGA 4UWGA 2IOSA 2V0PA 3ESKA 2MRIA 2PQRA 3UUXA 5CCMA 3PEUB 2ILRA 3G2SA 3KS2A 2ALFA 1HG5A 3CK7A 3VTXA 2VGXA 2VJ8A 2WMOA 3SBTB 4BT9A 1HXIA 4E6HA 3PEVB 3ICIA 3FUFA 5HQ8A 4XI9A 1BCKA 4E1QA 1GW6A 3O7TA 4S1EA 2YHEA 3FUMA 3QK0A 4AEZC 1AK4A 4FLHA 1HF8A 3E4BA 3SF4A 3DBSA 3PVLA 2CK1A 4CYHA 4L23A 2X7KA 3TG4A 1Z3YA 4UI9K 5LCWJ 3PUKA 3ZRHA 3FU6A 2OJUA 1CWAA 2VTBA 2MS4A 4I9EA 2POEA 1Y8MA 2X83B 3ZYLA 3FU0A 3IEGA 4PS7A 5BV1A 1U3CA 2DIWA 4TUUA 3TXNA 1OUVA 5FT9A 3TG5A 1Z3XA 4ANWA 1H19A 3CVYA 4L2YA 5CMWA 4DLQA 2PM6A 3AS5A 3CVVA 3URZA 4YVOA 4BSXA 3RFYA 1E8ZA 4ILHB 3PUJA 4G23A 4EZKA 4LQWA 3PE4A 3S7BA 3APDA 3ONLA 4TRQA 3EIQC 2GRMA 2KCLA 3TL5A 4EBAG 2V8SE 1A58A 4GYOA 4JVSA 4XKBA 2IOLA 3NZUA 2VSOE 3ZEFA 1W3BA 3HDXA 2PHCB 1PY1A 4DGEA 2WXNA 4YUHA 1E7UA 1UG3A 3ZYQA 5J90A 2DCPA 4J5AX 5KV7A 4J8SA 1KT0A 4PDXA 1NMKA 4D10C 4JXTA 5AENA 3K0OA 5DUDA 3K2CA 3BG0B 3ESLA 4H7YA 5A0EA 3MKRA 4B94A 1M9XA 4K03A 4R7LA 2RS4A 4GAAA 3L54A 4NACA 5KUQA 4FRVA 2OK3A 2AWIA 2CPLA 3LS8A 4XX5A 2XQ0A 1E8YA 4DI3A 3PE3A 4FLBA 2JEKA 2C0MA 3BG1B 3CVLA 1U3DA 2I1JA 2QFCA 4I17A 4F3VA 5LX8A 1A17A 1W8VA 2YHCA 5KV2A 3FH7A 1E90A 5JHBA 2PZIA 4BWRA 5G05C 2HAQA 5BV0A 4G25A 5CCQA 3RO3A 3FU5A 3APFA 2IQCA 4JZYA 3RU0A 2CMTA 4KXKB 4GA0A 3T1UA 1E8WA 1PC2A 2LNIA 3HIZA 3T5XA 3SFZA 3CHPA 3D9NA 1CWFA 4WWNA 2UWJG 4KVMA 4MRUA 4U0ZA 3FY4A 4EPZA 3SBSA 1OCAA 3VA7A 2AXVA 4GCNA 2WXLA 3CHQA 3B7RL 3FTWA 3SZ7A 4GPKA 2BITX 4I1OB 4N1RA 3LYAA 1ELWA 3FH5A 4FJYA 2VGYA 3HVEB 3PREA 4NURA 2CFZA 2IFUA 1NZNA 4CCAA 2B71A 3P2BA 1OWPA 4HY7A 3CQCB 1DVPA 2BTDA 4I6EA 3R7RA 1SZAA 2J08A 1E7VA 4C9BB 1H6KA 3CSFA 3L13A 3PNLB 5KJMA 4NQ0A 3B7TA 4A1GA 3R57A 2XCBA 1KLXA 3FULA 1JWFA 3FEXA 2RG8A 2XGMA 4GZ6A 1CWOA 4YULA 1SZ9A 1H0PA 5E75A 3RKVA 5EX3A 3FDHA 4N2SA 3R56A 3ASGA 3CKBA 5LP0A 1M9YA 5JHAA 4B0ZA 1J2AA 3SNXA 4B8CB 1WM5A 2Y3AA 1MF8C 2P0OA 2HQJA 4O8IA 2AW6A 3FTVA 4ZSDA 4DPRA 1M63C 4DGAA 3UT4A 1HU3A 5EX0A 4J59A 1HZ4A 4IULA 4Q96A 3B7UX 3FUIA 3QDNA 3B7SA 3AU4A 3MX3A 4GA2A 4ILGA 3Q15A 5M72A 2FU0A 4I1MA 5KUSA 1HE8A 5KUVA 4U04A 1E8XA 5CCLA 2X6JA 3LY8A 3UX4A 2DBAA 2LAHA 4I9CA 1AWRA 5EDSA 1YNDA 1AWUA 2XHEA 3LVQE 1HS6A 5AIJA 4BTAA 1QNHA 4FHKA 1CYNA 2C2LA 2XEVA 5KCMA 4AY5A 5BW8C 3RDDA 5KV0A 1QQEA 5LOZA 3QWVA 4Y6CA 1M9DA 2QERA 3EOVA 3RDAX 2J09A 4FULA 4BX9A 3FWVA 2WFJA 3N71A 2WQHA 3AS4A 3MCXA 4BFRA 4AXHA 3U66A 1TEZA 2IGVA 4TOTA 4JA7A 4A55A 4EYVA 4FP7A 2MC9A 4CT0A 4ACKA 4J5DX 4GCOA 1W74A 2FULA 5ARGA 3TJPA 3FUHA 3CVUA 4J5CX 5JJTA 3PZDA 4YNDA 2R99A 5FZRA 3CYSA 1AWVA 1CLHA 4ILIA 4Q69A 1IQUA 2R17C 2ESLA 1S0PA 4J8DA 1AWTA 1XWNA 5ANLA 4LEUA 4N39A 2FEZA 5FTPA 3SD5A 3TXMA 2HR2A 5BNWA 3TGOA 1CWLA 2A2NA 3OEPA 5KJNA 3S7FA 4YUOA 4OVUA 3RDBA 1IQRA 2NSZA 1IYGA 3KAEA 3D9IA 4R3FA 4O6FA 4K0RA 1X7FA 1FCHA 1QNGA 1DNPA 2AXUA 2KCVA 4GYWA 2XGOA 3PDNA 3RCLA 4O8HA 4UI9C 2WVIA 2GGFA 1FVHA 4WUYA 3SHFA 1ELRA 1H2VC 2CG2A 1PAQA 3FU3A 4V3IA 2A4ZA 3APCA 4WWPA 3K0QA 3ODLA 2RMBA 5CYHA 2XPYA 3IHVA 1XO7A 3CSTA 4MLPA 2RMCA 1ZU2A 5BUZA 1BPOA 4IPZA 1W8MA 2J4BA 2BIUX 4HFGA 3ODIA 1CWCA 1TJCA 4UQYA 2KC7A 3VLEA 5A6CA 1VDNA 2XGYB 2WQ6A 1SQMA 4ANUA 1P5QA 2I6HA 2X3MA 3WXXA 1HH8A 3FUDA 4JEUA 4TV3A 2FBNA 3SGHA 3ZHEB 4R3EA 4HOUA 1N54A 3FH8A 4ATGA 3R4GA 3CIAA 4KYOB 4GMLA 4RSYA 4IN3B 3JCKC 5G55A 2ZP2A 3QWPA 2L6JA 4GZ3A 1UJJA 3R9AB 1FVFA 4I2WA 3LJ3A 4CEMA 5KUUA 3D9JA 3LCAA 2CHZA 2MZUA 1V9TA 3ZYKA 4B8AA 2X38A 2J9QA 3MEKA 3FP3A 4GA1A 2BF0X 3O48A 2WM9A 1OWOA 5KUNA 2Q7FA 2YNQA 2WMNA 2FF4A 3ML9A 2MVZA 4ABNA 4N1NA 3LXUX 4YVQC 2LSUA 3K9IA 1TJFA 2NXPA 4XIFA 4ACLA 1HX8A 3MMLB 2HM8A 2NC9A 1QOIA 4LERA 1XQ7A 1CWMA 2XCCA 3MV2B 1OWNA 2E0IA 3CHSA 3FTUA 2WXPA 4I6GA 5FZQA 4EECA 2N0TA 3AS8A 3R49A 1WY6A 3I4RB 4L7TA 4APFA 5KV3A 3CGHA 2PM7A 4UWFA 1NA0A 1OWMA 3ASDA 4S1JA 1LOPA 2PL2A 3I3NA 2XRYA 4GB9A 4XKCA 1L5JA 2I1KA 2L0IA 3IHYA 4U63A 4WWOA 3ZGQA 3CV0A 4RG6A 2IF4A 3R54A 4YUJA 5E76A 2PQNA 3IBEA 1ISTA 5CMYA 2KZTB 4DGDA 5G04C 4HLEA 3MZLB 3ZVVA 3AU5A 4P29A 3HYMB 3PMPA 2LAIA 2VSYA 3ONKA 2J07A 3KEZA 3CK9A 4GZ5A 3S7DA 4J5BA 2OOEA 2X6KA 3EDTB 4KMOA 4BT8A 4WNGA 1MHQA 2X2CK 2HO1A 2MOWA 3RO2A 4L1BA 4N1SA 4JEHA 3EHMA 2CHXA 3CEQA 2P58C 3IKOB 3JQ1A 5FJYA 3OAWA 2I9CA 4N3BA 5FQ4A 3ULQA 4JPSA 3VLDA 3T5VA 1VAIA 4J58A 5CCNA 3CHOA 5C2YA 5AYWD 4XE0A 4CDNA 3QOUA 1JUQA 2PLUA 5KV4A 2VYIA 2WPVA 3NQPA 1XNFA 4ME2A 4YUKA 2IGWA 1A33A 4Q94A 3UT7A 4DLOA 5LCWC 4YUNA 2A5UA 3CHRA 2WXOA 1E8KA 2C3BA 2HQ6A 2E2EA 3GZ1A 3HVEA 3NZSA 4EBAA 1VDYA 2X6FA 3UCHA 4APOA 5FQ6A 3PH0C 3Q49B 4I43A 5G04J 4CDMA 3K0PA 3ZIMA 3BT8A 5JJ7A 4A3TA 2L9BA 3L08A 4DGBA 1UW4B 2C0LA 5AJDA 3MKQA 3CVXA 3Q5MA 4GZCA 3ZW3A 1M9FA 3QC1A 3RRMB 5JJ6A 3FTSA 4N3CA 3ASFA 3JUIA 5CCSX 4AJWA 1INZA 3EJNA 4WNFA 2LO6A 2VQ2A 2KCKA 1VBSA 3DPDA 1XGWA 1IIPA 5KUZA 1FGLA 1X5BA 3FTYA 3QB2A 3QWWA 1CWHA 2POYA 4BX8A 3OXFA 4JHJA 2WXJA 3RRNB 4C0MA 4JA9A 5ANRA 5C1DA 4HORA 1RMHA 4GZDA 2ONDA 2R5SA 3D9OA 5FQ8A 3U64A 4F53A 2JLBA 3JQ0A 5KJLA 5LFAA 1H0AA 5BPPA 2CFUA 2YQ8A 3OPFA 3CYHA 3RCGA 4F1SA 4QFVA 2WXFA 3S7JA 4UWKA 3EIJA 4U07A 4AOFA 1MZWA 4JJMA 5EKQD 3Q47B 3CVQA 2VSXE 4PH4B 1HFAA 3CKCA 2AXZA 4J6IA 2WXIA 3QYUA 3PRZA 1CWJA 5KUWA 3FUEA 4G26A 3I5PA 3ML8A 4PUCA 4YUPA 4DK5A 2X2DB 2Z6WA 5CBUA 3Q4AB 4A3VA 3D9PA 2YINA 5F66A 4LUNU 2CFEA 4N2QA 3P1UA 1AWSA 3LVRE 1W8LA 2UY1A 4EQFA 4HOTA 3MYVA 3PS6A 3G2VA 5G05J 5KULA 3R59A 4ZSCA 3FEYA 3RIBA 4WNEA 2OVBA 3QARA 1HG2A 3VLFA 2K7NA 4EZJA 2X25B 5KV1A 2L0TB 2XRZA 3GZ2A 1YA0A 4J8FA 3OXGA 4AY6A 4UWLA 5FWQA 1NP7A 4GYYA 4LCTA 4U0UA 2WB2A 3LDZA 3OTNA 4JC8A 3U4TA 5JHEA 1E96B 4AP2A 2IONA 2ZU6B 5DIZA 4KZCA 3RK6A 3B13A 3MJWA 5KURA 2LSVA 2J49A 4G1TA 3OREA 4BTBA 3FFLA 4MKTA 3QNKA 4KVOA 5CBTA 4KBQA 1AWQA 3VTYA 5BT1A 2GRLA 3K0MA 3L16A 4DGCA 3G2WA 3PNTB 2Y4TA 2J4DA 1EYHA 2QY7A 3I4GA 3O4ZA 4PS8A 4C0EA 4CGVA 3CVWA 4G2VA 2WXGA 2WFIA 2OVFA 4H7XA 2EQXA 2MHKA 3LPZA 3K0NA 3RCKX 3U9WA 2HYZA 3ZXSA 2CYHA 3ZYMA 4J0UA 4B89A 2RMAA 4UQZA 4I2ZA 3L22A 1LF8A 4HXIA 4GU5A 4HOQA 3ZN3A 4CRWA 3BKPA 1H2TC 3G2UA 2WLWA 4YUIA 3RCFA 4DI4A 3UMVA 3CR3A 2UY1B 2WXKA 4JW1A 4W9RA 1UJKA 4OVVA 5FZSA 3UQ3A 4ANXA 1C5FA 4RVBA 1EDUA 2IJGX 2XPZA 3G2TA 3T8MA 4KT6B 4JHRA 1E3BA 3HHMA 3R7QA 5D0OD 3RRUA 4L2LA 3ICHA 4N1OA 4CT4A 4Y6WA 4CGWA 2HE9A 3S6MA 3ZHEA 1UN9A 2V4LA 5D0QD 1HO8A 5J08A 4YUMA 4J8EA 4UWHA 2AVPA 1WAO1 1B89A 4U8HA 5DBKA 1ZKCA 4HS2A 3TAXA 4JCPA 5CBVA 4U0SA 1VBTA 3K0RA 2XGSA 3D9LA 2FO7A 3CVNA 4A1SA 1CWKA 2OV8A 4AIFA 2GW1A 1ZKFA 1ZBPA 2XPIA 3L6AA 3CLJA 4LRZA 1CWIA 3FUNA 4FU3A 5AJLA 3BEEA 1ELKA 4FRUA 3RCIX 3QKYA 4RG9A 4BY6A 3FUJA 1Y6IA 2CHWA 4M3OA 5LUDA 4JHKA 3KD7A 4I1AA 2NULA 3LEWA 4PS3A 3RDCA 5CBWA 2X2AA 2VGXB 5T4YA 3MMLA 3RJVA 3ASHA 2Y4UA 1ZMFA 4NRHB 3EHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5C A;  3NF1 A;  2V5F A;  1Z81 A;  2BUG A;  1DYW A;  2OSE A;  4UQX A;  4HOS A;  4XI0 A;  3MV3 B;  4CDR A;  5ARF A;  3GW4 A;  5HI7 A;  5KV5 A;  1M9E A;  1M9C A;  4JL0 A;  3UPV A;  2FI7 A;  2KAT A;  3CVP A;  3BO7 A;  4N1P A;  3RD9 X;  4XNC A;  3LY7 A;  4AM9 A;  3LKU A;  4N1M A;  4G24 A;  4UI9 J;  4J5E X;  4N1Q A;  2GW2 A;  5KV6 A;  2VSN A;  5CHE E;  4YUG A;  3GYZ A;  3OXL A;  4I9Y A;  3ZFW A;  1NA3 A;  1CWB A;  3MA5 A;  4WND A;  3JYS A;  1QZ2 A;  1KT1 A;  4N3A A;  3ZPJ A;  3U3W A;  3CK8 A;  3LY9 A;  1XYH A;  5CCR A;  5KJK A;  1IHG A;  5KUO A;  5A7D B;  3ESK A;  2PQR A;  3UUX A;  5CCM A;  3KS2 A;  2ALF A;  3CK7 A;  3VTX A;  2VGX A;  3ICI A;  4BT9 A;  1HXI A;  5HQ8 A;  4XI9 A;  1BCK A;  4E1Q A;  3O7T A;  4S1E A;  1AK4 A;  3E4B A;  3SF4 A;  2CK1 A;  4CYH A;  2X7K A;  3TG4 A;  4UI9 K;  5LCW J;  2OJU A;  1CWA A;  2MS4 A;  4I9E A;  2POE A;  1Y8M A;  2X83 B;  3IEG A;  1OUV A;  5FT9 A;  3TG5 A;  3AS5 A;  3URZ A;  4YVO A;  3RFY A;  4G23 A;  4LQW A;  3PE4 A;  3S7B A;  1A58 A;  2KCL A;  1W3B A;  2PHC B;  4DGE A;  4YUH A;  4J5A X;  5KV7 A;  1KT0 A;  1NMK A;  3K0O A;  5DUD A;  3K2C A;  5A0E A;  4H7Y A;  3MKR A;  4B94 A;  1M9X A;  2RS4 A;  5KUQ A;  4FRV A;  2OK3 A;  2CPL A;  3JB9 d;  3PE3 A;  2C0M A;  3CVL A;  4I17 A;  4F3V A;  2QFC A;  1W8V A;  1A17 A;  5KV2 A;  2YHC A;  2PZI A;  4BWR A;  5G05 C;  2HAQ A;  5CCQ A;  4G25 A;  3RO3 A;  3RU0 A;  2CMT A;  4KXK B;  4GA0 A;  3T1U A;  1PC2 A;  2LNI A;  1CWF A;  2UWJ G;  4U0Z A;  1OCA A;  3VA7 A;  4GCN A;  4GPK A;  4N1R A;  3SZ7 A;  2BIT X;  3LYA A;  1ELW A;  2VGY A;  2IFU A;  1NZN A;  2B71 A;  4HY7 A;  5KJM A;  4NQ0 A;  3R57 A;  2XCB A;  1KLX A;  2XGM A;  4GZ6 A;  1CWO A;  4YUL A;  1H0P A;  3RKV A;  5EX3 A;  4N2S A;  3R56 A;  3ASG A;  3CKB A;  1M9Y A;  1J2A A;  1WM5 A;  1MF8 C;  2P0O A;  2HQJ A;  4O8I A;  4ZSD A;  4DGA A;  1M63 C;  5EX0 A;  4J59 A;  1HZ4 A;  1MIK A;  3QDN A;  4GA2 A;  3Q15 A;  5M72 A;  2FU0 A;  5KUS A;  5KUV A;  4U04 A;  5CCL A;  3LY8 A;  2DBA A;  4I9C A;  1AWR A;  1YND A;  1AWU A;  4BTA A;  1QNH A;  1CYN A;  2C2L A;  2XEV A;  3RDD A;  4AY5 A;  5BW8 C;  5KV0 A;  1QQE A;  3QWV A;  4Y6C A;  1M9D A;  2QER A;  3EOV A;  3RDA X;  2WFJ A;  3FWV A;  3N71 A;  2WQH A;  3AS4 A;  2IGV A;  4TOT A;  4JA7 A;  4EYV A;  4J5D X;  4GCO A;  1W74 A;  5ARG A;  4J5C X;  5JJT A;  4YND A;  2R99 A;  5FZR A;  3CYS A;  1AWV A;  1CLH A;  2ESL A;  4J8D A;  1AWT A;  1XWN A;  4LEU A;  4N39 A;  2FEZ A;  5FTP A;  5BNW A;  3TGO A;  2HR2 A;  2A2N A;  1CWL A;  3OEP A;  5KJN A;  3S7F A;  4YUO A;  3RDB A;  1IYG A;  4R3F A;  3KAE A;  4O6F A;  1X7F A;  1FCH A;  1QNG A;  2KCV A;  4GYW A;  2XGO A;  3PDN A;  3RCL A;  4O8H A;  4UI9 C;  4WUY A;  1ELR A;  3K0Q A;  3ODL A;  2RMB A;  5CYH A;  1XO7 A;  2RMC A;  1ZU2 A;  4IPZ A;  1W8M A;  2BIU X;  3ODI A;  1CWC A;  1TJC A;  4UQY A;  2KC7 A;  5A6C A;  1VDN A;  2XGY B;  1P5Q A;  2I6H A;  3WXX A;  1HH8 A;  4R3E A;  2FBN A;  3ZHE B;  4HOU A;  3R4G A;  4KYO B;  4IN3 B;  2ZP2 A;  3QWP A;  2L6J A;  4GZ3 A;  3R9A B;  4I2W A;  5KUU A;  3LCA A;  2MZU A;  1V9T A;  2J9Q A;  3MEK A;  3FP3 A;  4GA1 A;  3O48 A;  5KUN A;  2Q7F A;  2FF4 A;  2MVZ A;  4ABN A;  4N1N A;  4YVQ C;  2LSU A;  3K9I A;  4XIF A;  3MML B;  2NC9 A;  1QOI A;  1XQ7 A;  1CWM A;  2XCC A;  3MV2 B;  5FZQ A;  2N0T A;  3AS8 A;  3R49 A;  5KV3 A;  1NA0 A;  3ASD A;  4S1J A;  1LOP A;  2PL2 A;  3ZGQ A;  3R54 A;  3CV0 A;  4RG6 A;  2IF4 A;  4YUJ A;  2PQN A;  1IST A;  4DGD A;  5G04 C;  3PMP A;  3HYM B;  2VSY A;  3CK9 A;  4GZ5 A;  3S7D A;  4J5B A;  2OOE A;  3EDT B;  4BT8 A;  4WNG A;  2X2C K;  2HO1 A;  3RO2 A;  4N1S A;  3CEQ A;  5FJY A;  3ULQ A;  2P58 C;  2MC9 A;  4N3B A;  4J58 A;  1VAI A;  5CCN A;  5AYW D;  3QOU A;  2PLU A;  5KV4 A;  2VYI A;  2WPV A;  1XNF A;  4ME2 A;  4YUK A;  2IGW A;  1A33 A;  5LCW C;  4YUN A;  1E8K A;  2C3B A;  2HQ6 A;  2E2E A;  3GZ1 A;  3UCH A;  4APO A;  3Q49 B;  3K0P A;  5G04 J;  3BT8 A;  5JJ7 A;  4DGB A;  2C0L A;  1M9F A;  3Q5M A;  5JJ6 A;  4N3C A;  3ASF A;  5CCS X;  4WNF A;  2VQ2 A;  2KCK A;  1VBS A;  1IIP A;  5KUZ A;  1FGL A;  2POY A;  3QWW A;  1CWH A;  3OXF A;  4JA9 A;  5C1D A;  4HOR A;  1RMH A;  2OND A;  2R5S A;  5KJL A;  2JLB A;  3OPF A;  2YQ8 A;  3RCG A;  3CYH A;  3S7J A;  4U07 A;  1MZW A;  4JJM A;  5EKQ D;  3Q47 B;  3CVQ A;  3CKC A;  3QYU A;  1CWJ A;  5KUW A;  4G26 A;  4YUP A;  2X2D B;  2Z6W A;  5CBU A;  3Q4A B;  5F66 A;  2CFE A;  4N2Q A;  1AWS A;  1W8L A;  2UY1 A;  4EQF A;  4HOT A;  5G05 J;  5KUL A;  3R59 A;  4ZSC A;  3RIB A;  4WNE A;  2X25 B;  2K7N A;  5KV1 A;  3GZ2 A;  1YA0 A;  4J8F A;  3OXG A;  4AY6 A;  4GYY A;  4U0U A;  3U4T A;  5JHE A;  1E96 B;  5KUR A;  5DIZ A;  2LSV A;  3ORE A;  4G1T A;  4BTB A;  3FFL A;  5CBT A;  4KBQ A;  1AWQ A;  3VTY A;  5BT1 A;  3K0M A;  4DGC A;  2Y4T A;  4CGV A;  4G2V A;  2WFI A;  4H7X A;  2MHK A;  3LPZ A;  3K0N A;  3RCK X;  2HYZ A;  2CYH A;  4J0U A;  2RMA A;  4UQZ A;  4I2Z A;  4HOQ A;  3ZN3 A;  3BKP A;  2WLW A;  4YUI A;  3RCF A;  2UY1 B;  4W9R A;  1C5F A;  5FZS A;  3UQ3 A;  4JHR A;  1E3B A;  5D0O D;  3ICH A;  4N1O A;  4Y6W A;  4CGW A;  2HE9 A;  3S6M A;  3ZHE A;  5D0Q D;  4YUM A;  4J8E A;  2AVP A;  1WAO 1;  1B89 A;  1ZKC A;  5DBK A;  4JCP A;  3TAX A;  5CBV A;  4U0S A;  1VBT A;  3K0R A;  2XGS A;  4A1S A;  2FO7 A;  3CVN A;  1CWK A;  1ZKF A;  4AIF A;  2GW1 A;  1ZBP A;  2XPI A;  1CWI A;  3BEE A;  4FRU A;  3RCI X;  3QKY A;  4RG9 A;  5LUD A;  3KD7 A;  4I1A A;  2NUL A;  3RDC A;  5CBW A;  2X2A A;  2VGX B;  3MML A;  3RJV A;  3ASH A;  2Y4U A;  1ZMF A;  4NRH B;  4GYO A; 
#chains in the Genus database with same CATH topology
 3HXD A;  2P9K G;  1DYW A;  4HOS A;  2R59 A;  4FHJ A;  3MGB A;  4GMJ A;  1N52 A;  4JL0 A;  3BO7 A;  2IU1 A;  3D9K A;  4AVX A;  4UI9 J;  3IV0 A;  4KZ0 A;  4WAF A;  2VSN A;  3FTZ A;  1EF1 C;  3JXI A;  4URK A;  3GYZ A;  2WXH A;  4G11 A;  3UT8 A;  3QAQ A;  3MA5 A;  5FQ7 A;  1TN8 A;  1KT1 A;  1MQS A;  4MS6 A;  5ENN A;  4FC8 A;  2DWZ A;  5CCR A;  1BD8 A;  4OAV B;  2WQ7 A;  1OWL A;  4HI8 A;  2V0P A;  4UWG A;  5CCM A;  3TWR A;  3KS2 A;  2ALF A;  2B0O E;  2VGX A;  2VJ8 A;  1TNO A;  2BKK B;  3FUF A;  1S70 B;  4XI9 A;  1GW6 A;  4DRX E;  3O7T A;  3QK0 A;  4AEZ C;  1HF8 A;  3SF4 A;  4CYH A;  3DSU A;  2X83 B;  1SW6 A;  3FU0 A;  2XEE A;  4YVO A;  1E8Z A;  4EZK A;  1H6O A;  4LQW A;  3S7B A;  2DZN A;  4XKB A;  5ENT D;  1W3B A;  4DGE A;  4YUH A;  4J7W A;  4PDX A;  1NMK A;  5AEN A;  5DUD A;  1FT1 A;  4H7Y A;  4B94 A;  2FO1 E;  1M9X A;  4R7L A;  3JUE A;  3J5P A;  4FRV A;  2OK3 A;  3LS8 A;  1O5M A;  2XQ0 A;  3JB9 d;  4FLB A;  4F3V A;  2C0M A;  2QFC A;  2YHC A;  1E90 A;  1SA5 A;  5G05 C;  2KBX A;  3Q7F A;  4JZY A;  1E8W A;  2LNI A;  4MRU A;  5H7P A;  1OCA A;  2LUH A;  3VA7 A;  3FTW A;  4FJY A;  2CFZ A;  2B71 A;  1NZN A;  4I6E A;  2BTD A;  1SZA A;  3UKU G;  3AG1 E;  3BUA A;  4J8Y A;  3B7T A;  4A1G A;  5EIB E;  5EIL A;  4GZ6 A;  5CEA A;  3R56 A;  4B8C B;  2OCC E;  2P0O A;  2HQJ A;  2ZIS A;  4ZSD A;  4DPR A;  1HU3 A;  4J59 A;  4ILG A;  5ENS D;  5CRV A;  1E8X A;  2X6J A;  2DBA A;  5ENQ D;  4I9C A;  1AWU A;  3LVQ E;  5FIN A;  4TXQ A;  4O1O A;  4AY5 A;  5BW8 C;  1QQE A;  3EOV A;  3RDA X;  3FWV A;  2WQH A;  3AS4 A;  3U66 A;  1MJ0 A;  4CT0 A;  1W74 A;  4U8V D;  2GRN B;  3L9T A;  4YND A;  5FZR A;  1AWV A;  2R17 C;  3HRA A;  1XWN A;  3TXM A;  5BNW A;  3TGO A;  3SD5 A;  1DNP A;  2BED A;  1FPP A;  1BI7 B;  2AJA A;  4IPZ A;  1W8M A;  1UOH A;  1CWC A;  5A6C A;  1VDN A;  4HLL A;  1SQM A;  2X3M A;  2DYS E;  2I6H A;  1TNY A;  3WXX A;  4R3E A;  1K1B A;  4HOU A;  3R4G A;  4GML A;  4IN3 B;  5G55 A;  1SA4 A;  4GZ3 A;  4I2W A;  1IKN D;  4N5Q A;  4YDO A;  3ZYK A;  3ZU7 B;  2YNQ A;  1YMP A;  3LXU X;  2LSU A;  1TJF A;  4ACL A;  2HM8 A;  5ENO D;  2XCC A;  1OWN A;  4U96 D;  3R49 A;  2H6I A;  3AS8 A;  1IHB A;  3I3N A;  2XRY A;  4GB9 A;  2I1K A;  2IF4 A;  4GTQ A;  3IBE A;  5CMY A;  4DGD A;  4HLE A;  3ZVV A;  4P29 A;  3PMP A;  2LAI A;  3ONK A;  3S7D A;  2X6K A;  3EDT B;  1H6P A;  4WNG A;  2QC9 A;  2X2C K;  2MOW A;  2GRO B;  4N1S A;  4JEH A;  3CEQ A;  2MC9 A;  5ITZ F;  3HXF A;  3OAW A;  3D9H A;  4CDN A;  1JUQ A;  5KV4 A;  3EUV A;  2VYI A;  3PZ1 A;  2IGW A;  4HRL A;  1A33 A;  4Q94 A;  3T8K A;  3HXB A;  2LXM A;  2WXO A;  2E2E A;  5FQ6 A;  5G04 J;  5JJ7 A;  2HE0 A;  3L08 A;  2P9I G;  3ZW3 A;  3QC1 A;  4K5A B;  3RRM B;  3FTS A;  5CCS X;  2LO6 A;  2KCK A;  3DPD A;  1XGW A;  1X5B A;  3QWW A;  3OXF A;  5EYL A;  3RRN B;  4C0M A;  4HOR A;  5KJL A;  1H0A A;  5AN8 A;  3OPF A;  2CFU A;  2YQ8 A;  3CYH A;  1N94 A;  4QFV A;  2WXF A;  5CED B;  4UWK A;  3W9F A;  4JJM A;  4TXP A;  4PH4 B;  3IXE A;  2AXZ A;  2WXI A;  1YYH A;  1CWJ A;  4G26 A;  4DK5 A;  2Z6W A;  1LD8 A;  5F66 A;  5FIO A;  3PZ2 A;  4LUN U;  3ASN E;  1W8L A;  3WG7 E;  3PS6 A;  5G05 J;  3R59 A;  4ZSC A;  3FEY A;  3QAR A;  1HG2 A;  2L6B A;  3E34 A;  2X25 B;  3GZ2 A;  4J8F A;  4AY6 A;  4LCT A;  2NNZ A;  3LDZ A;  3U4T A;  3NOC D;  2F8X K;  1E96 B;  4AP2 A;  3DPY A;  2J49 A;  4DX5 D;  4GMR A;  1N4Q A;  1AWQ A;  3VTY A;  5BT1 A;  3L16 A;  3ABM E;  2Y4T A;  2QY7 A;  4CGV A;  2WFI A;  2OVF A;  3U9W A;  3ZXS A;  3DSV A;  3DSW A;  4O1P A;  2CYH A;  3ZYM A;  2RMA A;  4I2Z A;  4HXI A;  3ZN3 A;  3UI2 A;  4YUI A;  3RCF A;  2EIL E;  3CR3 A;  4W9R A;  4ANX A;  2XPZ A;  4RQI A;  2GRR B;  3RRU A;  4L2L A;  4CGW A;  1TYQ G;  2V4L A;  1HO8 A;  3KOP A;  2AVP A;  1B89 A;  1ZKC A;  4JCP A;  3D9L A;  5D66 A;  1ZKF A;  4AIF A;  4LRZ A;  4FU3 A;  4GTM A;  4RG9 A;  4BY6 A;  2CHW A;  4PS3 A;  3RDC A;  3J5Q B;  2ZIR A;  4HB5 A;  3MML A;  4NRH B;  2V5F A;  4DX1 A;  1Z81 A;  1EPU A;  2I2O A;  3QJZ A;  4OYS A;  4L9P A;  4XI0 A;  4G8K A;  4DJA A;  1Q2Z A;  3ZUV B;  2Y1L E;  3AAA C;  1WDY A;  4BER A;  4E85 A;  4OAU C;  3Q9N C;  1QBQ A;  3CVP A;  3ISM C;  3GZS A;  3RD9 X;  3LY7 A;  5A23 A;  2WXR A;  3S2A A;  3L17 A;  4F7A A;  3OXL A;  1CWB A;  3AJI A;  3FHE A;  4WND A;  3JYS A;  4N3A A;  3ZPJ A;  5KJK A;  1IHG A;  1JPL A;  5A7D B;  1JWG A;  2IOS A;  2MRI A;  2PQR A;  3ULY A;  3UUX A;  2ILR A;  4GPM A;  4E6H A;  3AG2 E;  1N9A A;  4S1E A;  5AQA A;  3FUM A;  4FLH A;  3DBS A;  4L23 A;  1Z3Y A;  4UI9 K;  3ZRH A;  1CWA A;  2MS4 A;  4GTP A;  4I9E A;  3ZYL A;  3ZNG A;  2DIW A;  3TXN A;  4ANW A;  4X8Q A;  2PM6 A;  3AS5 A;  3URZ A;  5KWD A;  1SVX A;  3PE4 A;  3APD A;  3TWT A;  2IOL A;  2VSO E;  3HDX A;  1OT8 A;  1LTX A;  4DX2 A;  1UG3 A;  3ZYQ A;  5J90 A;  3DXK G;  5KV7 A;  4J8S A;  1KT0 A;  4ZFH A;  4D10 C;  3DWL G;  3BG0 B;  3MKR A;  1A5E A;  4K03 A;  2RS4 A;  3L54 A;  2CPL A;  4XX5 A;  1E8Y A;  3PE3 A;  1U3D A;  3UIO C;  1W8V A;  1A17 A;  3FH7 A;  5BV0 A;  1IXV A;  3FU5 A;  2IQC A;  4XEI G;  4TXR A;  2R05 A;  3CHP A;  3KSQ A;  1CWF A;  4WWN A;  2UWJ G;  4KVM A;  4U0Z A;  3AG3 E;  1ZX8 A;  2AXV A;  3CHQ A;  4N1R A;  3SZ7 A;  4I1O B;  5CBN A;  1MZC A;  3FH5 A;  4NUR A;  3HVE B;  4CCA A;  2IFU A;  3CQC B;  1DVP A;  3R7R A;  2J08 A;  3SFY A;  4C9B B;  1H6K A;  3L13 A;  5KJM A;  4NQ0 A;  4M7C A;  2RG8 A;  1CWO A;  1SZ9 A;  4LNU D;  5E75 A;  5EX3 A;  3RKV A;  3FDH A;  4N2S A;  3V2X A;  3CKB A;  1M9Y A;  5JHA A;  4B0Z A;  1J2A A;  3SNX A;  1MF8 C;  4O8I A;  2AW6 A;  1OCR E;  3FTV A;  1M63 C;  1HZ4 A;  3QDN A;  3FUI A;  2FU0 A;  4I1M A;  5KUV A;  3W9G A;  3LY8 A;  2LAH A;  1QNH A;  4FHK A;  1CYN A;  5KV0 A;  2NYJ A;  3ASO E;  4LG6 A;  1TEZ A;  4EYV A;  3DRA A;  3UTM A;  4GCO A;  5ARG A;  3TJP A;  4J5C X;  3PZD A;  3UIP C;  3CYS A;  3C3R A;  4Q69 A;  2ESL A;  4HRM B;  1S64 A;  3KEA A;  1TR4 A;  3LJN A;  4N39 A;  2A2N A;  5FTP A;  3OEP A;  2HR2 A;  3TWV A;  4OVU A;  1IQR A;  4R3F A;  3D9I A;  4ZHB A;  4K0R A;  5HS0 A;  2XGO A;  4O8H A;  3E37 A;  2WVI A;  2GGF A;  3SHF A;  4WWP A;  2ZGG A;  1AWC B;  3ODL A;  5CYH A;  1S63 A;  3IHV A;  4MLP A;  2RMC A;  4RLY A;  4HFG A;  3ODI A;  4UQY A;  3B95 A;  2KC7 A;  3TWS A;  1P5Q A;  1HH8 A;  2FBN A;  3ZHE B;  1N54 A;  3CIA A;  2ZP2 A;  3PZ4 A;  2L6J A;  4HRN A;  4CEM A;  3R9A B;  1FVF A;  3TWX A;  3D9J A;  3LCA A;  3NAW A;  4B8A A;  2XEN A;  2X38 A;  2J9Q A;  3FP3 A;  3O48 A;  1OWO A;  5KUN A;  2Y0B G;  2MVZ A;  4ABN A;  3K9I A;  4XIF A;  1HX8 A;  3ABK E;  2NC9 A;  1XQ7 A;  1CWM A;  3L82 A;  1KZP A;  4L7T A;  3I4R B;  2PM7 A;  1NA0 A;  4HQD A;  4WWO A;  2L0I A;  4RG6 A;  1N0R A;  5G04 C;  3MZL B;  3V31 A;  3HYM B;  3EU5 A;  3CK9 A;  4J5B A;  2OOE A;  4KMO A;  4Z68 A;  3HXC A;  4MBG A;  4L1B A;  1OCC E;  3EHM A;  3JQ1 A;  3ULQ A;  3C5R A;  3VLD A;  4JB8 P;  4ME2 A;  4YUK A;  3UT7 A;  5LCW C;  4YDW A;  4YUN A;  3GZ1 A;  3HVE A;  1VDY A;  1D8D A;  2R02 A;  4APO A;  3PH0 C;  3TWQ A;  3ZIM A;  4A3T A;  4A63 B;  1JCS A;  1M9F A;  4GZC A;  5IY5 E;  3JUI A;  4AJW A;  4WNF A;  1IIP A;  5B1B E;  3QB2 A;  3FTY A;  5AAO A;  5LFA A;  4F53 A;  4YDE A;  2JLB A;  3JQ0 A;  5HRY A;  5BPP A;  3EIJ A;  2ETC A;  4J6I A;  4ATZ D;  3EHR A;  5KUW A;  4YUP A;  3I5P A;  3ML8 A;  3Q4A B;  4A3V A;  2CFE A;  4GTV A;  3P1U A;  1AWS A;  3LVR E;  2DZO A;  2UY1 A;  4EQF A;  3G2V A;  3RIB A;  2OVB A;  2QYU A;  2K7N A;  4EZJ A;  1TN6 A;  5KV1 A;  2XRZ A;  1YA0 A;  3R9M A;  5FWQ A;  4U0U A;  5DIZ A;  4GTR A;  3ORE A;  4BTB A;  2P9U G;  3FFL A;  4MKT A;  4KVO A;  5CBT A;  5BXO A;  4DGC A;  1K3Z D;  3G2W A;  3PNT B;  1N4S A;  1EYH A;  4PS8 A;  3CVW A;  2WXG A;  3LPZ A;  3RCK X;  1V54 E;  4UQZ A;  3L22 A;  4HOQ A;  4CRW A;  1ZB1 A;  1H2T C;  3G2U A;  2UY1 B;  2WXK A;  1C5F A;  1UJK A;  2F0Y A;  4JHR A;  1E3B A;  3R7Q A;  5D0O D;  3ICH A;  4CT4 A;  4Y6W A;  3Q73 A;  5D0Q D;  4YUM A;  4UWH A;  4HS2 A;  1OY3 D;  1VBT A;  3K0R A;  2XGS A;  3FUN A;  5AJL A;  3ASH A;  1ELK A;  4FRU A;  1TN7 A;  4LNB A;  4M3O A;  5LUD A;  4I1A A;  5CBW A;  2X2A A;  5T4Y A;  4CYM D;  2Y4U A;  1ZMF A;  2P58 C;  3NF1 A;  1MX2 A;  1QNF A;  4U95 D;  4UQX A;  4FAD A;  4EHM A;  5ARF A;  4CDR A;  2VTB B;  5HI7 A;  5KV5 A;  2RKK A;  4EZL A;  3SFX A;  2V4H C;  1H2U A;  2IO3 C;  4AV7 A;  4N1P A;  1FT2 A;  4ANV A;  4AM9 A;  4N1M A;  4G24 A;  4J5E X;  3D3M A;  5G2N A;  3CQG B;  4IRU A;  4I9Y A;  4IYP A;  4FA6 A;  3ZFW A;  2X6H A;  2WXQ A;  3MKQ B;  1QZ2 A;  4JD2 G;  1K1A A;  3U3W A;  4XZ4 A;  3CK8 A;  3FTX A;  1Z6T A;  4HVB A;  5KUO A;  5EYP F;  3ESK A;  3PEU B;  4G8L A;  2H6H A;  3SBT B;  2WMO A;  3DSS A;  5HKP A;  1NI1 A;  3NBN B;  1BCK A;  4E1Q A;  1KZO A;  2EIM E;  1AK4 A;  2CK1 A;  3TG4 A;  3FU6 A;  2OJU A;  3TWU A;  2EIN E;  1Y8M A;  5BV1 A;  4PS7 A;  2P9S G;  1U3C A;  4F1P A;  3TG5 A;  5FT9 A;  1Z3X A;  1H19 A;  3BU8 A;  3CVY A;  5CMW A;  4DLQ A;  3T9K A;  4BSX A;  4ILH B;  3PUJ A;  4G23 A;  4BET A;  3EIQ C;  2GRM A;  3TL5 A;  4EBA G;  3Q79 A;  3NZU A;  1PY1 A;  2WXN A;  1E7U A;  2DCP A;  4J5A X;  1DCE A;  5EID A;  2JAB A;  1MX4 A;  5BXU A;  2AWI A;  4DI3 A;  3KSL A;  4TUM A;  5LX8 A;  3TWW A;  4BWR A;  1D8E A;  4G25 A;  5CCQ A;  3RO3 A;  4KXK B;  2RFA A;  3T1U A;  3HIZ A;  1PC2 A;  3SFZ A;  3ABL E;  2KA0 A;  1NFI E;  1O1S A;  1X81 A;  4EPZ A;  4GPK A;  2BIT X;  3LYA A;  1ELW A;  3P2B A;  1OWP A;  4HY7 A;  5ENP D;  1E7V A;  3R57 A;  1V55 E;  2XCB A;  1JWF A;  3FEX A;  2XGM A;  3DSX A;  1H0P A;  3E30 A;  1MX6 A;  3UT4 A;  4GTT A;  5EX0 A;  1MIK A;  4Q96 A;  4GA2 A;  3RAU A;  3AU4 A;  1U2V G;  3B7B A;  3Q15 A;  5M72 A;  1HE8 A;  5CCL A;  3X2Q E;  2GRQ B;  1AWR A;  5EDS A;  1YND A;  5AQ9 A;  1HS6 A;  5AIJ A;  4BTA A;  2RFM A;  3DXM G;  2C2L A;  3RDD A;  1RW2 A;  3QWV A;  4Y6C A;  1M9D A;  2J09 A;  2IEJ A;  4BX9 A;  2WFJ A;  4BFR A;  5CRU A;  3SO8 A;  1RZ4 A;  4AXH A;  4TOT A;  4JA7 A;  4A55 A;  4FP7 A;  4ACK A;  2FUL A;  3FUH A;  3BQO A;  3CVU A;  5JJT A;  2QZA A;  2R99 A;  1CLH A;  4ILI A;  1IQU A;  1S0P A;  4BEP A;  5ANL A;  4LEU A;  2FEZ A;  1CWL A;  5KJN A;  3S7F A;  5D2M C;  2NSZ A;  3KAE A;  1QNG A;  2KCV A;  2AXU A;  4GYW A;  1FVH A;  4WUY A;  2ZXW E;  2CG2 A;  4V3I A;  1PAQ A;  4O60 A;  2A4Z A;  3APC A;  3C3O A;  3K0Q A;  4HI9 A;  1ZU2 A;  2BIU X;  2H6G A;  1TJC A;  3SY2 A;  2XGY B;  4ANU A;  1DC2 A;  4JEU A;  3SGH A;  3FH8 A;  4ATG A;  4KYO B;  3JCK C;  1UJJ A;  5KUU A;  2DVW A;  2CHZ A;  2MZU A;  4GTS A;  2Y69 E;  2P2C P;  2BF0 X;  2Q7F A;  2FF4 A;  3ML9 A;  2NXP A;  1QOI A;  4LER A;  3MV2 B;  1N95 A;  2E0I A;  3FTU A;  5FZQ A;  2N0T A;  5KV3 A;  2XS1 A;  4HNA D;  1OCO E;  3CGH A;  3UKR G;  4UWF A;  3ASD A;  4S1J A;  4DUI A;  1L5J A;  3ZGQ A;  3IHY A;  4YUJ A;  5E76 A;  2PQN A;  1IST A;  2KZT B;  1N11 A;  2J07 A;  4GZ5 A;  4BT8 A;  1MHQ A;  2CHX A;  5FJY A;  2I9C A;  4N3B A;  4JPS A;  1VAI A;  5CCN A;  3CHO A;  4XE0 A;  3QOU A;  1XNF A;  1TNZ A;  3CHR A;  1N4R A;  1E8K A;  2HQ6 A;  3NZS A;  3UCH A;  3Q49 B;  3DST A;  5JMN D;  2L9B A;  1N4P A;  4DGB A;  3CVX A;  5AJD A;  3MKQ A;  2IY0 C;  1BI8 B;  3ASF A;  1INZ A;  3EJN A;  4GTO A;  1VBS A;  5KUZ A;  4BES A;  2POY A;  1CWH A;  1D9S A;  4JHJ A;  1TNU A;  2WXJ A;  1K8K G;  4JA9 A;  5C1D A;  4GZD A;  2OND A;  3V30 A;  3D9O A;  3RCG A;  1MZW A;  3CVQ A;  2VSX E;  1HFA A;  3CKC A;  3QYU A;  4PUC A;  4F6R D;  4N2Q A;  4CZ2 D;  4HOT A;  2MYO A;  5KUL A;  4WNE A;  3OXG A;  1NP7 A;  2WB2 A;  1LD7 A;  4JC8 A;  2ZU6 B;  3MJW A;  2LSV A;  4KBQ A;  2GRL A;  2J4D A;  3I4G A;  5CER B;  4C0E A;  2EQX A;  3K0N A;  2HYZ A;  4J0U A;  1LF8 A;  5B3S E;  4GU5 A;  4DI4 A;  3UMV A;  4OVV A;  3SQV A;  3UQ3 A;  4RVB A;  3T8M A;  1EDU A;  3G2T A;  4KT6 B;  4N1O A;  2HE9 A;  1OCZ E;  3ZHE A;  1UN9 A;  5J08 A;  1WAO 1;  5DBK A;  3TAX A;  4U0S A;  2XEH A;  2QYJ A;  2FO7 A;  3CVN A;  2IO2 C;  1ZBP A;  1CWI A;  5AQ7 A;  3BEE A;  3FUJ A;  1Y6I A;  5AQB A;  4JHK A;  3C72 A;  4GYO A;  4N5C A;  2CG3 A;  2KZT A;  2A5E A;  2BUG A;  3EHQ A;  2OSE A;  5ENR D;  3FUK A;  2M63 A;  3HG0 D;  3Q9U C;  3EU9 A;  1O1T A;  1UN8 A;  3MV3 B;  5T3R A;  2VGE A;  3GW4 A;  3C98 A;  4C48 B;  3SI5 A;  1M9E A;  3Q78 A;  3Q75 A;  1M9C A;  2X6I A;  3UPV A;  3D9M A;  2LXL A;  2FI7 A;  2KAT A;  2V5Q C;  5T8I A;  4XNC A;  3LKU A;  2DYR E;  4N1Q A;  2GW2 A;  5KV6 A;  5CHE E;  4FJZ A;  5KNH D;  4YUG A;  1NA3 A;  3ULE G;  2R2L A;  2WXM A;  1QYM A;  3ENE A;  2RD0 A;  3CHM A;  3LY9 A;  2OEW A;  1XYH A;  2KM4 A;  1NL4 A;  4BSZ B;  3G2S A;  1HG5 A;  3CK7 A;  3VTX A;  3ICI A;  4BT9 A;  1HXI A;  3PEV B;  5HQ8 A;  3C3Q A;  2YHE A;  3E4B A;  3PVL A;  2X7K A;  5LCW J;  3PUK A;  2VTB A;  2POE A;  3ZXP A;  3IEG A;  4TUU A;  1OUV A;  4QQI A;  4L2Y A;  3CVV A;  3RFY A;  4U7E B;  3ONL A;  4TRQ A;  1A58 A;  2KCL A;  3UM0 A;  2V8S E;  4JVS A;  5JA4 D;  3ZEF A;  2PHC B;  1JCQ A;  2R03 A;  1O1R A;  5KNG A;  4JXT A;  3K0O A;  5A0E A;  3K2C A;  3ESL A;  3ZKJ A;  4GAA A;  4NAC A;  4YDY A;  5KUQ A;  2OEV A;  5EN5 D;  2JEK A;  3BG1 B;  3CVL A;  2I1J A;  4I17 A;  5KV2 A;  5JHB A;  2PZI A;  2HAQ A;  3APF A;  3RU0 A;  2CMT A;  4GA0 A;  3T5X A;  3D9N A;  3UIN C;  1N0Q A;  3FY4 A;  3SBS A;  4GCN A;  2WXL A;  3B7R L;  2VGY A;  3PRE A;  2XZT G;  3JXJ A;  4K5C A;  3DEO A;  3CSF A;  3PNL B;  2P9P G;  2KXP C;  1KLX A;  3FUL A;  4YUL A;  3PZ3 A;  2XS8 A;  3ASG A;  5LP0 A;  1WM5 A;  2Y3A A;  4DGA A;  4IUL A;  3B7U X;  3B7S A;  3MX3 A;  5KUS A;  4K5B A;  4U04 A;  3UX4 A;  4LNG A;  2XHE A;  2XEV A;  5KCM A;  5LOZ A;  2BKG A;  2QER A;  1Z5S C;  4FUL A;  3N71 A;  3MCX A;  2IGV A;  2B6C A;  2ETB A;  5CBO A;  4J5D X;  3UXG A;  1G3N B;  4J8D A;  1AWT A;  4YUO A;  3RDB A;  1IYG A;  4O6F A;  1X7F A;  1FCH A;  3PDN A;  3RCL A;  4UI9 C;  1ELR A;  1H2V C;  3FU3 A;  3NOG D;  2RMB A;  2XPY A;  1XO7 A;  3CST A;  2ETA A;  5BUZ A;  1BPO A;  3E32 A;  2J4B A;  3VLE A;  5AAR A;  2WQ6 A;  3FUD A;  4TV3 A;  3UM2 A;  4RSY A;  3QWP A;  3LJ3 A;  1V9T A;  3MEK A;  4GA1 A;  2WM9 A;  2WMN A;  2XZD G;  2J8S D;  4N1N A;  4YVQ C;  3MML B;  3X27 A;  1AP7 A;  3CHS A;  2WXP A;  4I6G A;  4EEC A;  1WY6 A;  4APF A;  3UM1 A;  1WG0 A;  1OWM A;  1LOP A;  4XKC A;  2PL2 A;  4U63 A;  3R54 A;  3CV0 A;  5KBA A;  3AU5 A;  2VSY A;  3KEZ A;  3V2O A;  2HO1 A;  3RO2 A;  4UUC A;  3IKO B;  4LSZ E;  3T5V A;  5FQ4 A;  4B93 B;  4J58 A;  5C2Y A;  5AYW D;  3HXE A;  5CEC B;  2PLU A;  3NQP A;  2WPV A;  5B1A E;  2EIJ E;  4DLO A;  2F37 A;  2A5U A;  3NB2 A;  2C3B A;  4EBA A;  2X6F A;  4I43 A;  3K0P A;  4CDM A;  3BT8 A;  1YCS B;  4DX7 D;  1OXJ A;  1BLX B;  1UW4 B;  2C0L A;  3Q5M A;  3V79 K;  5JJ6 A;  4N3C A;  2VQ2 A;  2ZGD A;  1FGL A;  4BX8 A;  1RMH A;  5ANR A;  3F6Q A;  4DX6 D;  2R5S A;  5FQ8 A;  3U64 A;  2P9L G;  4F1S A;  3S7J A;  4U07 A;  4AOF A;  5EKQ D;  3Q47 B;  3PRZ A;  3FUE A;  4NIK A;  4U8Y D;  2X2D B;  5CBU A;  3D9P A;  2YIN A;  3MYV A;  1TNB A;  3VLF A;  2L0T B;  4UWL A;  4GYY A;  3Q7A A;  3E33 A;  3OTN A;  5JHE A;  2PNN A;  3RK6 A;  1MYO A;  2ION A;  4KZC A;  5KUR A;  3B13 A;  4G1T A;  3QNK A;  3RSE G;  2GRP B;  3K0M A;  2H6F A;  3O4Z A;  4G2V A;  3DEP A;  4H7X A;  2MHK A;  3AG4 E;  2P9N G;  1KPS B;  2EIK E;  4B89 A;  1BU9 A;  3BKP A;  2WLW A;  1JCR A;  4JW1 A;  5FZS A;  2IJG X;  3HHM A;  4HBD A;  3S6M A;  4J8E A;  4U8H A;  5CBV A;  4A1S A;  1CWK A;  2OV8 A;  2GW1 A;  3L6A A;  2XPI A;  2F8Y A;  3CLJ A;  1DCQ A;  3RCI X;  3QKY A;  3KD7 A;  2NUL A;  3LEW A;  3UM3 A;  2VGX B;  3RJV A;  4I6J A;  3EHN A; 
#chains in the Genus database with same CATH homology
 4N5C A;  3NF1 A;  2CG3 A;  2KZT A;  2V5F A;  1Z81 A;  2BUG A;  1DYW A;  1EPU A;  2I2O A;  3QJZ A;  1QNF A;  3FUK A;  4OYS A;  4UQX A;  4HOS A;  2M63 A;  2OSE A;  2R59 A;  4FAD A;  4XI0 A;  4FHJ A;  4DJA A;  1UN8 A;  3MV3 B;  3MGB A;  5T3R A;  5ARF A;  4CDR A;  4GMJ A;  2VTB B;  3GW4 A;  3C98 A;  5HI7 A;  5KV5 A;  3SI5 A;  4EZL A;  1N52 A;  1M9E A;  4E85 A;  1M9C A;  1H2U A;  2X6I A;  4JL0 A;  3UPV A;  3D9M A;  2FI7 A;  2KAT A;  4AV7 A;  3CVP A;  5T8I A;  3BO7 A;  4N1P A;  3GZS A;  4ANV A;  3RD9 X;  4XNC A;  3LY7 A;  4AM9 A;  3LKU A;  2IU1 A;  3D9K A;  4G24 A;  5A23 A;  4AVX A;  4N1M A;  4UI9 J;  4J5E X;  3IV0 A;  2GW2 A;  2WXR A;  3D3M A;  4KZ0 A;  4WAF A;  3S2A A;  4N1Q A;  5G2N A;  5KV6 A;  2VSN A;  5CHE E;  3FTZ A;  3L17 A;  1EF1 C;  4FJZ A;  4YUG A;  3CQG B;  4IRU A;  4F7A A;  3GYZ A;  4URK A;  3OXL A;  4IYP A;  4I9Y A;  4FA6 A;  3ZFW A;  2X6H A;  2WXH A;  1NA3 A;  4G11 A;  3JB9 d;  3UT8 A;  2WXQ A;  1CWB A;  3QAQ A;  3MKQ B;  3FHE A;  3MA5 A;  4WND A;  3JYS A;  1QZ2 A;  5FQ7 A;  2WXM A;  1KT1 A;  3ENE A;  4I6J A;  4N3A A;  3ZPJ A;  3U3W A;  4XZ4 A;  2RD0 A;  3CHM A;  1MQS A;  3CK8 A;  3LY9 A;  4FC8 A;  4MS6 A;  5ENN A;  1XYH A;  5CCR A;  2KM4 A;  3FTX A;  5KJK A;  1IHG A;  1Z6T A;  1JPL A;  4HVB A;  2WQ7 A;  1MIK A;  1OWL A;  5KUO A;  5A7D B;  1JWG A;  4UWG A;  2IOS A;  2V0P A;  3ESK A;  2MRI A;  2PQR A;  3UUX A;  5CCM A;  3PEU B;  2ILR A;  3G2S A;  3KS2 A;  2ALF A;  1HG5 A;  3CK7 A;  3VTX A;  2VGX A;  2VJ8 A;  2WMO A;  3SBT B;  4BT9 A;  1HXI A;  4E6H A;  3PEV B;  3ICI A;  3FUF A;  5HQ8 A;  4XI9 A;  1BCK A;  4E1Q A;  1GW6 A;  3O7T A;  4S1E A;  2YHE A;  3FUM A;  3QK0 A;  4AEZ C;  1AK4 A;  4FLH A;  1HF8 A;  3E4B A;  3SF4 A;  3DBS A;  3PVL A;  2CK1 A;  4CYH A;  4L23 A;  2X7K A;  3TG4 A;  1Z3Y A;  4UI9 K;  5LCW J;  3PUK A;  3ZRH A;  3FU6 A;  2OJU A;  1CWA A;  2VTB A;  2MS4 A;  4I9E A;  2POE A;  1Y8M A;  2X83 B;  3ZYL A;  3FU0 A;  3IEG A;  4PS7 A;  5BV1 A;  1U3C A;  2DIW A;  4TUU A;  3TXN A;  1OUV A;  5FT9 A;  3TG5 A;  1Z3X A;  4ANW A;  1H19 A;  3CVY A;  4L2Y A;  5CMW A;  4DLQ A;  2PM6 A;  3AS5 A;  3CVV A;  3URZ A;  4YVO A;  4BSX A;  3RFY A;  1E8Z A;  4ILH B;  3PUJ A;  4G23 A;  4EZK A;  4LQW A;  3PE4 A;  3S7B A;  3APD A;  3ONL A;  4TRQ A;  3EIQ C;  2GRM A;  2KCL A;  3TL5 A;  4EBA G;  2V8S E;  1A58 A;  4GYO A;  4JVS A;  4XKB A;  2IOL A;  3NZU A;  2VSO E;  3ZEF A;  1W3B A;  3HDX A;  2PHC B;  1PY1 A;  4DGE A;  2WXN A;  4YUH A;  1E7U A;  1UG3 A;  3ZYQ A;  5J90 A;  2DCP A;  4J5A X;  5KV7 A;  4J8S A;  1KT0 A;  4PDX A;  1NMK A;  4D10 C;  4JXT A;  5AEN A;  3K0O A;  5DUD A;  3K2C A;  3BG0 B;  3ESL A;  4H7Y A;  5A0E A;  3MKR A;  4B94 A;  1M9X A;  4K03 A;  4R7L A;  2RS4 A;  4GAA A;  3L54 A;  4NAC A;  5KUQ A;  4FRV A;  2OK3 A;  2AWI A;  2CPL A;  3LS8 A;  4XX5 A;  2XQ0 A;  1E8Y A;  4DI3 A;  3PE3 A;  4FLB A;  2JEK A;  2C0M A;  3BG1 B;  3CVL A;  1U3D A;  2I1J A;  2QFC A;  4I17 A;  4F3V A;  5LX8 A;  1A17 A;  1W8V A;  2YHC A;  5KV2 A;  3FH7 A;  1E90 A;  5JHB A;  2PZI A;  4BWR A;  5G05 C;  2HAQ A;  5BV0 A;  4G25 A;  5CCQ A;  3RO3 A;  3FU5 A;  3APF A;  2IQC A;  4JZY A;  3RU0 A;  2CMT A;  4KXK B;  4GA0 A;  3T1U A;  1E8W A;  1PC2 A;  2LNI A;  3HIZ A;  3T5X A;  3SFZ A;  3CHP A;  3D9N A;  1CWF A;  4WWN A;  2UWJ G;  4KVM A;  4MRU A;  4U0Z A;  3FY4 A;  4EPZ A;  3SBS A;  1OCA A;  3VA7 A;  2AXV A;  4GCN A;  2WXL A;  3CHQ A;  3B7R L;  3FTW A;  3SZ7 A;  4GPK A;  2BIT X;  4I1O B;  4N1R A;  3LYA A;  1ELW A;  3FH5 A;  4FJY A;  2VGY A;  3HVE B;  3PRE A;  4NUR A;  2CFZ A;  2IFU A;  1NZN A;  4CCA A;  2B71 A;  3P2B A;  1OWP A;  4HY7 A;  3CQC B;  1DVP A;  2BTD A;  4I6E A;  3R7R A;  1SZA A;  2J08 A;  1E7V A;  4C9B B;  1H6K A;  3CSF A;  3L13 A;  3PNL B;  5KJM A;  4NQ0 A;  3B7T A;  4A1G A;  3R57 A;  2XCB A;  1KLX A;  3FUL A;  1JWF A;  3FEX A;  2RG8 A;  2XGM A;  4GZ6 A;  1CWO A;  4YUL A;  1SZ9 A;  1H0P A;  5E75 A;  3RKV A;  5EX3 A;  3FDH A;  4N2S A;  3R56 A;  3ASG A;  3CKB A;  5LP0 A;  1M9Y A;  5JHA A;  4B0Z A;  1J2A A;  3SNX A;  4B8C B;  1WM5 A;  2Y3A A;  1MF8 C;  2P0O A;  2HQJ A;  4O8I A;  2AW6 A;  3FTV A;  4ZSD A;  4DPR A;  1M63 C;  4DGA A;  3UT4 A;  1HU3 A;  5EX0 A;  4J59 A;  1HZ4 A;  4IUL A;  4Q96 A;  3B7U X;  3FUI A;  3QDN A;  3B7S A;  3AU4 A;  3MX3 A;  4GA2 A;  4ILG A;  3Q15 A;  5M72 A;  2FU0 A;  4I1M A;  5KUS A;  1HE8 A;  5KUV A;  4U04 A;  1E8X A;  5CCL A;  2X6J A;  3LY8 A;  3UX4 A;  2DBA A;  2LAH A;  4I9C A;  1AWR A;  5EDS A;  1YND A;  1AWU A;  2XHE A;  3LVQ E;  1HS6 A;  5AIJ A;  4BTA A;  1QNH A;  4FHK A;  1CYN A;  2C2L A;  2XEV A;  5KCM A;  4AY5 A;  5BW8 C;  3RDD A;  5KV0 A;  1QQE A;  5LOZ A;  3QWV A;  4Y6C A;  1M9D A;  2QER A;  3EOV A;  3RDA X;  2J09 A;  4FUL A;  4BX9 A;  3FWV A;  2WFJ A;  3N71 A;  2WQH A;  3AS4 A;  3MCX A;  4BFR A;  4AXH A;  3U66 A;  1TEZ A;  2IGV A;  4TOT A;  4JA7 A;  4A55 A;  4EYV A;  4FP7 A;  2MC9 A;  4CT0 A;  4ACK A;  4J5D X;  4GCO A;  1W74 A;  2FUL A;  5ARG A;  3TJP A;  3FUH A;  3CVU A;  4J5C X;  5JJT A;  3PZD A;  4YND A;  2R99 A;  5FZR A;  3CYS A;  1AWV A;  1CLH A;  4ILI A;  4Q69 A;  1IQU A;  2R17 C;  2ESL A;  1S0P A;  4J8D A;  1AWT A;  1XWN A;  5ANL A;  4LEU A;  4N39 A;  2FEZ A;  5FTP A;  3SD5 A;  3TXM A;  2HR2 A;  5BNW A;  3TGO A;  1CWL A;  2A2N A;  3OEP A;  5KJN A;  3S7F A;  4YUO A;  4OVU A;  3RDB A;  1IQR A;  2NSZ A;  1IYG A;  3KAE A;  3D9I A;  4R3F A;  4O6F A;  4K0R A;  1X7F A;  1FCH A;  1QNG A;  1DNP A;  2AXU A;  2KCV A;  4GYW A;  2XGO A;  3PDN A;  3RCL A;  4O8H A;  4UI9 C;  2WVI A;  2GGF A;  1FVH A;  4WUY A;  3SHF A;  1ELR A;  1H2V C;  2CG2 A;  1PAQ A;  3FU3 A;  4V3I A;  2A4Z A;  3APC A;  4WWP A;  3K0Q A;  3ODL A;  2RMB A;  5CYH A;  2XPY A;  3IHV A;  1XO7 A;  3CST A;  4MLP A;  2RMC A;  1ZU2 A;  5BUZ A;  1BPO A;  4IPZ A;  1W8M A;  2J4B A;  2BIU X;  4HFG A;  3ODI A;  1CWC A;  1TJC A;  4UQY A;  2KC7 A;  3VLE A;  5A6C A;  1VDN A;  2XGY B;  2WQ6 A;  1SQM A;  4ANU A;  1P5Q A;  2I6H A;  2X3M A;  3WXX A;  1HH8 A;  3FUD A;  4JEU A;  4TV3 A;  2FBN A;  3SGH A;  3ZHE B;  4R3E A;  4HOU A;  1N54 A;  3FH8 A;  4ATG A;  3R4G A;  3CIA A;  4KYO B;  4GML A;  4RSY A;  4IN3 B;  3JCK C;  5G55 A;  2ZP2 A;  3QWP A;  2L6J A;  4GZ3 A;  1UJJ A;  3R9A B;  1FVF A;  4I2W A;  3LJ3 A;  4CEM A;  5KUU A;  3D9J A;  3LCA A;  2CHZ A;  2MZU A;  1V9T A;  3ZYK A;  4B8A A;  2X38 A;  2J9Q A;  3MEK A;  3FP3 A;  4GA1 A;  2BF0 X;  3O48 A;  2WM9 A;  1OWO A;  5KUN A;  2Q7F A;  2YNQ A;  2WMN A;  2FF4 A;  3ML9 A;  2MVZ A;  4ABN A;  4N1N A;  3LXU X;  4YVQ C;  2LSU A;  3K9I A;  1TJF A;  2NXP A;  4XIF A;  4ACL A;  1HX8 A;  3MML B;  2HM8 A;  2NC9 A;  1QOI A;  4LER A;  1XQ7 A;  1CWM A;  2XCC A;  3MV2 B;  1OWN A;  2E0I A;  3CHS A;  3FTU A;  2WXP A;  4I6G A;  5FZQ A;  4EEC A;  2N0T A;  3AS8 A;  3R49 A;  1WY6 A;  3I4R B;  4L7T A;  4APF A;  5KV3 A;  3CGH A;  2PM7 A;  4UWF A;  1NA0 A;  1OWM A;  3ASD A;  4S1J A;  1LOP A;  2PL2 A;  3I3N A;  2XRY A;  4GB9 A;  4XKC A;  1L5J A;  2I1K A;  2L0I A;  3IHY A;  4U63 A;  4WWO A;  3ZGQ A;  3CV0 A;  4RG6 A;  2IF4 A;  3R54 A;  4YUJ A;  5E76 A;  2PQN A;  3IBE A;  1IST A;  5CMY A;  2KZT B;  4DGD A;  5G04 C;  4HLE A;  3MZL B;  3ZVV A;  3AU5 A;  4P29 A;  3HYM B;  3PMP A;  2LAI A;  2VSY A;  3ONK A;  2J07 A;  3KEZ A;  3CK9 A;  4GZ5 A;  3S7D A;  4J5B A;  2OOE A;  2X6K A;  3EDT B;  4KMO A;  4BT8 A;  4WNG A;  1MHQ A;  2X2C K;  2HO1 A;  2MOW A;  3RO2 A;  4L1B A;  4N1S A;  4JEH A;  3EHM A;  2CHX A;  3CEQ A;  2P58 C;  3IKO B;  3JQ1 A;  5FJY A;  3OAW A;  2I9C A;  4N3B A;  5FQ4 A;  3ULQ A;  4JPS A;  3VLD A;  3T5V A;  1VAI A;  4J58 A;  5CCN A;  3CHO A;  5C2Y A;  5AYW D;  4XE0 A;  4CDN A;  3QOU A;  1JUQ A;  2PLU A;  5KV4 A;  2VYI A;  2WPV A;  3NQP A;  1XNF A;  4ME2 A;  4YUK A;  2IGW A;  1A33 A;  4Q94 A;  3UT7 A;  4DLO A;  5LCW C;  4YUN A;  2A5U A;  3CHR A;  2WXO A;  1E8K A;  2C3B A;  2HQ6 A;  2E2E A;  3GZ1 A;  3HVE A;  3NZS A;  4EBA A;  1VDY A;  2X6F A;  3UCH A;  4APO A;  5FQ6 A;  3PH0 C;  3Q49 B;  4I43 A;  5G04 J;  4CDM A;  3K0P A;  3ZIM A;  3BT8 A;  5JJ7 A;  4A3T A;  2L9B A;  3L08 A;  4DGB A;  1UW4 B;  2C0L A;  5AJD A;  3MKQ A;  3CVX A;  3Q5M A;  4GZC A;  3ZW3 A;  1M9F A;  3QC1 A;  3RRM B;  5JJ6 A;  3FTS A;  4N3C A;  3ASF A;  3JUI A;  5CCS X;  4AJW A;  1INZ A;  3EJN A;  4WNF A;  2LO6 A;  2VQ2 A;  2KCK A;  1VBS A;  3DPD A;  1XGW A;  1IIP A;  5KUZ A;  1FGL A;  1X5B A;  3FTY A;  3QB2 A;  3QWW A;  1CWH A;  2POY A;  4BX8 A;  3OXF A;  4JHJ A;  2WXJ A;  3RRN B;  4C0M A;  4JA9 A;  5ANR A;  5C1D A;  4HOR A;  1RMH A;  4GZD A;  2OND A;  2R5S A;  3D9O A;  5FQ8 A;  3U64 A;  4F53 A;  2JLB A;  3JQ0 A;  5KJL A;  5LFA A;  1H0A A;  5BPP A;  2CFU A;  2YQ8 A;  3OPF A;  3CYH A;  3RCG A;  4F1S A;  4QFV A;  2WXF A;  3S7J A;  4UWK A;  3EIJ A;  4U07 A;  4AOF A;  1MZW A;  4JJM A;  5EKQ D;  3Q47 B;  3CVQ A;  2VSX E;  4PH4 B;  1HFA A;  3CKC A;  2AXZ A;  4J6I A;  2WXI A;  3QYU A;  3PRZ A;  1CWJ A;  5KUW A;  3FUE A;  4G26 A;  3I5P A;  3ML8 A;  4PUC A;  4YUP A;  4DK5 A;  2X2D B;  2Z6W A;  5CBU A;  3Q4A B;  4A3V A;  3D9P A;  2YIN A;  5F66 A;  4LUN U;  2CFE A;  4N2Q A;  3P1U A;  1AWS A;  3LVR E;  1W8L A;  2UY1 A;  4EQF A;  4HOT A;  3MYV A;  3PS6 A;  3G2V A;  5G05 J;  5KUL A;  3R59 A;  4ZSC A;  3FEY A;  3RIB A;  4WNE A;  2OVB A;  3QAR A;  1HG2 A;  3VLF A;  2K7N A;  4EZJ A;  2X25 B;  5KV1 A;  2L0T B;  2XRZ A;  3GZ2 A;  1YA0 A;  4J8F A;  3OXG A;  4AY6 A;  4UWL A;  5FWQ A;  1NP7 A;  4GYY A;  4LCT A;  4U0U A;  2WB2 A;  3LDZ A;  3OTN A;  4JC8 A;  3U4T A;  5JHE A;  1E96 B;  4AP2 A;  2ION A;  2ZU6 B;  5DIZ A;  4KZC A;  3RK6 A;  3B13 A;  3MJW A;  5KUR A;  2LSV A;  2J49 A;  4G1T A;  3ORE A;  4BTB A;  3FFL A;  4MKT A;  3QNK A;  4KVO A;  5CBT A;  4KBQ A;  1AWQ A;  3VTY A;  5BT1 A;  2GRL A;  3K0M A;  3L16 A;  4DGC A;  3G2W A;  3PNT B;  2Y4T A;  2J4D A;  1EYH A;  2QY7 A;  3I4G A;  3O4Z A;  4PS8 A;  4C0E A;  4CGV A;  3CVW A;  4G2V A;  2WXG A;  2WFI A;  2OVF A;  4H7X A;  2EQX A;  2MHK A;  3LPZ A;  3K0N A;  3RCK X;  3U9W A;  2HYZ A;  3ZXS A;  2CYH A;  3ZYM A;  4J0U A;  4B89 A;  2RMA A;  4UQZ A;  4I2Z A;  3L22 A;  1LF8 A;  4HXI A;  4GU5 A;  4HOQ A;  3ZN3 A;  4CRW A;  3BKP A;  1H2T C;  3G2U A;  2WLW A;  4YUI A;  3RCF A;  4DI4 A;  3UMV A;  3CR3 A;  2UY1 B;  2WXK A;  4JW1 A;  4W9R A;  1UJK A;  4OVV A;  5FZS A;  3UQ3 A;  4ANX A;  1C5F A;  4RVB A;  1EDU A;  2IJG X;  2XPZ A;  3G2T A;  3T8M A;  4KT6 B;  4JHR A;  1E3B A;  3HHM A;  3R7Q A;  5D0O D;  3RRU A;  4L2L A;  3ICH A;  4N1O A;  4CT4 A;  4Y6W A;  4CGW A;  2HE9 A;  3S6M A;  3ZHE A;  1UN9 A;  2V4L A;  5D0Q D;  1HO8 A;  5J08 A;  4YUM A;  4J8E A;  4UWH A;  2AVP A;  1WAO 1;  1B89 A;  4U8H A;  5DBK A;  1ZKC A;  4HS2 A;  3TAX A;  4JCP A;  5CBV A;  4U0S A;  1VBT A;  3K0R A;  2XGS A;  3D9L A;  2FO7 A;  3CVN A;  4A1S A;  1CWK A;  2OV8 A;  4AIF A;  2GW1 A;  1ZKF A;  1ZBP A;  2XPI A;  3L6A A;  3CLJ A;  4LRZ A;  1CWI A;  3FUN A;  4FU3 A;  5AJL A;  3BEE A;  1ELK A;  4FRU A;  3RCI X;  3QKY A;  4RG9 A;  4BY6 A;  3FUJ A;  1Y6I A;  2CHW A;  4M3O A;  5LUD A;  4JHK A;  3KD7 A;  4I1A A;  2NUL A;  3LEW A;  4PS3 A;  3RDC A;  5CBW A;  2X2A A;  2VGX B;  5T4Y A;  3MML A;  3RJV A;  3ASH A;  2Y4U A;  1ZMF A;  4NRH B;  3EHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...