1IHGA

Bovine cyclophilin 40, monoclinic form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
364
structure length
364
Chain Sequence
b'SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin 40
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
total genus 130
structure length 364
sequence length 364
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ihgA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1ihgA01
2OK3A 4LEUA 4J8DA 3NF1A 2VGXB 3K2CA 2RMBA 5FZQA 3RCIX 1Z81A 3RCKX 2HR2A 5FZSA 1XQ7A 5KV6A 4HORA 4W9RA 1M63C 5DIZA 1CWIA 3QWVA 5G04J 1E96B 3K0RA 4I9YA 3CVLA 1LOPA 2AVPA 3AS5A 5FTPA 3ASDA 5KJKA 2X2CK 2X7KA 5KV1A 1FCHA 1M9YA 1CWBA 5CHEE 2KATA 5EX3A 3RDCA 2GW1A 4F3VA 2HQJA 4U04A 3KAEA 4G26A 4N3BA 4FRUA 4UQZA 1M9CA 3ASFA 3Q5MA 4J5AX 1VDNA 5CYHA 4H7XA 1AWTA 1CYNA 3S7BA 1QZ2A 5G05C 4N39A 3ASGA 5EKQD 5KUNA 5KV7A 4RG6A 4JA9A 5A7DB 1MF8C 2R99A 1IYGA 2HE9A 5KJMA 4G1TA 4AIFA 3BKPA 4YUHA 4ABNA 4GA2A 4GYOA 1VBTA 1E3BA 5BT1A 4UI9K 3K0QA 2KCLA 2Z6WA 2RMAA 5CCLA 3RDDA 5C1DA 1QNGA 4N1QA 3GZ2A 4DGDA 1CWKA 4GA0A 2FU0A 3O48A 3WXXA 4N3CA 3RCFA 3MMLA 1WM5A 4I2ZA 1NZNA 3QWPA 4J59A 4WNEA 4N2SA 1AWSA 5F66A 4I9CA 3FP3A 3CK7A 2I6HA 4GZ3A 3EOVA 2RS4A 1MIKA 3RO2A 1VAIA 2GW2A 5JJTA 3K9IA 3TG4A 1QOIA 4KXKB 4KYOB 4HOSA 3MA5A 2HO1A 4N2QA 1W8VA 4GYWA 4U0UA 3ZGQA 2VYIA 2ESLA 4B94A 2X83B 2PQNA 5JHEA 5EX0A 2OOEA 5KUQA 3VA7A 1C5FA 1A33A 5KJNA 3TG5A 1FGLA 4WUYA 5HQ8A 5BNWA 2PZIA 2IGVA 4BTBA 1CWOA 4DGEA 2UY1A 3RO3A 5LCWJ 5CCMA 1E8KA 4R3EA 1X7FA 1ZMFA 2Y4UA 3IEGA 2YQ8A 4UQXA 3ZHEB 4BT9A 3CVNA 2CFEA 1XO7A 3R49A 3GW4A 2CK1A 2PQRA 2C2LA 5M72A 2VGXA 4G24A 4N1MA 3QYUA 3BT8A 2VGYA 3ULQA 2HYZA 2HQ6A 3CKBA 3ZFWA 3QWWA 5KUWA 2MS4A 3OEPA 4YUMA 2A2NA 2UWJG 4EYVA 1HH8A 2XCCA 4WNGA 5KURA 1NMKA 3LKUA 1AWRA 1J2AA 4BTAA 1XWNA 5CCQA 4Y6WA 4J8FA 5KV4A 3S7JA 3UUXA 5JJ6A 3R57A 4WNDA 4YVOA 3PE4A 4I1AA 1QQEA 5KV0A 3BEEA 4S1JA 4H7YA 1ISTA 3OXFA 2WQHA 3RJVA 1PC2A 1M9FA 4I17A 2OJUA 5LUDA 3U4TA 5DBKA 1A17A 2IF4A 2BUGA 3CK8A 4I2WA 3Q47B 4I9EA 4XIFA 5A0EA 4GYYA 3TAXA 1YA0A 3R59A 4J58A 2L6JA 4UI9C 3CV0A 3S7FA 2C0LA 3ZPJA 1OUVA 3PMPA 2ALFA 3CEQA 3KS2A 4DGBA 2FEZA 2XCBA 1Y8MA 2MZUA 2WFIA 2Q7FA 3CVPA 1M9DA 4WNFA 1WAO1 3VTXA 2P58C 5DUDA 1W74A 2V5FA 4RG9A 4AM9A 3CK9A 2VSNA 2MC9A 3QDNA 4TOTA 2KC7A 4BWRA 3T1UA 4HOTA 4YUPA 5A6CA 4HY7A 3MV3B 5CCSX 1KLXA 3RD9X 5KUZA 1AWQA 1VBSA 2CPLA 2X2AA 2VQ2A 3MMLB 1H0PA 3Q15A 2POEA 4CGVA 4XNCA 3K0OA 1W3BA 3TGOA 5G05J 2RMCA 3RFYA 4S1EA 4N1NA 3URZA 1DYWA 4U0SA 3E4BA 2DBAA 4YUKA 2ONDA 3K0MA 1A58A 4IPZA 2PHCB 2MHKA 2R5SA 2XPIA 4UQYA 5HI7A 3R9AB 3UQ3A 3ZN3A 3R4GA 1NA3A 4AY6A 5KUOA 3CKCA 1QNHA 4R3FA 1ZU2A 2PL2A 5G04C 1OCAA 4O8HA 3GZ1A 3FWVA 3MV2B 3RCLA 2X2DB 1B89A 2WPVA 1ZKCA 2PLUA 2LSUA 1V9TA 5CBUA 2WLWA 5ARGA 4CYHA 5KV3A 1IIPA 4YUIA 3CVQA 5CCRA 2X25B 3SZ7A 5FT9A 1ELRA 3ZHEA 1KT1A 4GPKA 2NULA 1BCKA 2ZP2A 4JL0A 2UY1B 4NRHB 3KD7A 1CWJA 5CBVA 4JHRA 4O6FA 4GZ6A 4XI0A 5KV5A 1TJCA 5D0OD 1W8LA 3MEKA 3OREA 4JCPA 4ZSDA 3Q4AB 5KULA 2N0TA 5JJ7A 2K7NA 2BIUX 3OXLA 3LCAA 1CWMA 2IFUA 3ICHA 3ICIA 4GCNA 2CMTA 4GA1A 3K0PA 3RIBA 3K0NA 1ZKFA 5CBWA 3LYAA 3AS4A 2C0MA 2QFCA 2JLBA 3QOUA 3OXGA 4U07A 1YNDA 3GYZA 2VSYA 1ZBPA 4J5EX 1RMHA 1CWHA 1XYHA 2XGSA 4FRVA 2FO7A 5AYWD 1HZ4A 3OPFA 5ARFA 3CYHA 4YNDA 4HOUA 4YUJA 3FFLA 2KCVA 2FF4A 2KCKA 4BT8A 2P0OA 3LY7A 4Y6CA 5FJYA 3AS8A 3LPZA 2J9QA 5CCNA 1ELWA 5KUVA 3PDNA 3QKYA 2LSVA 1P5QA 5KV2A 2XGMA 2XEVA 3SF4A 2NC9A 4DGCA 1KT0A 3U3WA 3PE3A 1NA0A 4J0UA 3JYSA 4AY5A 2QERA 1HXIA 2WFJA 2CYHA 1AK4A 4N1SA 4J8EA 4J5DX 2XGYB 2B71A 1AWVA 5BW8C 2OSEA 3RKVA 4N3AA 3S6MA 4NQ0A 4HOQA 3S7DA 5KUUA 2Y4TA 3CYSA 5CBTA 3LY9A 4LQWA 3BO7A 4YVQC 4JA7A 4N1OA 3RDBA 2MVZA 1W8MA 4ME2A 4N1PA 4DGAA 4GZ5A 4E1QA 4A1SA 5LCWC 4CGWA 3UCHA 2C3BA 4GCOA 4KBQA 3Q49B 3EDTB 3R56A 3RU0A 2HAQA 4ZSCA 4O8IA 4G25A 4YUGA 1XNFA 1CWLA 2E2EA 2POYA 1CLHA 3RDAX 1MZWA 2BITX 4UI9J 4N1RA 1CWFA 4XI9A 1CWAA 4CDRA 4J5CX 2XGOA 4EQFA 2LNIA 4IN3B 2FBNA 4J5BA 3N71A 1IHGA 4U0ZA 5KUSA 4N5CA 1AWUA 2IGWA 2FI7A 3JB9d 1M9XA 4YUNA 3LY8A 1CWCA 3HYMB 4JJMA 3R54A 5FZRA 3UPVA 4G23A 3ASHA 2YHCA 1M9EA 5KJLA 3O7TA 4YULA 3VTYA 3RCGA 3ODIA 3ESKA 5D0QD 3MKRA 4YUOA 3ODLA 4APOA 4G2VA
chains in the Genus database with same CATH superfamily
4DLQA 3L16A 2VGXB 5ITZF 2WXJA 4C0MA 3LEWA 1HX8A 3HVEB 3RCIX 1OWNA 3ZU7B 1XQ7A 1OCOE 1Y6IA 1M63C 4HRMB 3LJNA 4J8SA 3D9LA 4UUCA 1DVPA 1LOPA 2WXKA 2AVPA 3D9MA 2DYRE 3ASDA 4F1PA 4GTVA 5HKPA 1INZA 1FCHA 1SZ9A 4XEIG 5CHEE 5EX3A 3SFXA 4OAUC 3V2OA 2HQJA 1A5EA 4LUNU 2R05A 5ENPD 5BV1A 3S7BA 4YDOA 2WQ7A 4CDMA 3ASGA 3BQOA 4AEZC 5A7DB 1MF8C 2R99A 4I1MA 1IYGA 4AIFA 1E3BA 2VSXE 4NURA 4PS3A 3K0QA 5CCLA 3RRMB 3L22A 1YYHA 4PH4B 1WM5A 4AOFA 1NZNA 4N2SA 4MLPA 2P9LG 2P9PG 2VJ8A 4C0EA 2I6HA 3SBTB 4GZ3A 2HE0A 3BU8A 2X6FA 1VAIA 2P9SG 1K1AA 2GW2A 2JABA 4LNBA 4OAVB 3K9IA 1QOIA 4KXKB 3V31A 4GMLA 1W8VA 4G11A 3LS8A 5EYLA 1HG5A 4N5QA 4XZ4A 2WVIA 2X6HA 3APCA 2X83B 2PQNA 5LFAA 4HQDA 3ZXSA 3ZIMA 2R02A 2I9CA 1C5FA 1EF1C 4WUYA 5CEAA 2IU1A 2DZOA 4GTPA 3RO3A 5LCWJ 2CG3A 1X7FA 3ZHEB 2CFEA 4G8LA 3RSEG 5FQ7A 2HYZA 3D9OA 3E34A 2RD0A 3HDXA 3PZ3A 3OEPA 3FTZA 5ANRA 1KPSB 2XCCA 2CHZA 1JPLA 1NMKA 5BV0A 3CHOA 2J49A 1OY3D 1J2AA 4HBDA 3QK0A 4DK5A 1U3DA 3PZ1A 2L0IA 1DCEA 3UUXA 5JJ6A 2QYUA 3F6QA 1BI7B 4M7CA 1N4PA 1QNFA 2IO2C 3D9KA 3BEEA 3OXFA 2WQHA 1OWPA 4LSZE 3U66A 2OJUA 1UG3A 3I4GA 5LUDA 1A17A 3BG1B 1QYMA 5T8IA 4D10C 3Q47B 4F1SA 4ILHB 3ZYQA 3R59A 4J58A 3CV0A 2EIJE 3RK6A 1MHQA 3PMPA 4DGBA 2WXFA 2XCBA 3FTXA 2Q7FA 1YMPA 1RW2A 4WNFA 1WAO1 4KMOA 3VTXA 5DUDA 1JWFA 1VDYA 4BWRA 1V55E 2GRQB 4HY7A 5KUZA 2H6IA 3LVQE 3UM2A 1W3BA 3GZSA 3TGOA 5G05J 2EIME 2Y0BG 2AJAA 3FTVA 4S1EA 3HHMA 2E0IA 5CRVA 1DYWA 3CVVA 3E4BA 2DBAA 3SD5A 4OVUA 2I1JA 2PHCB 4U8HA 1ZB1A 2XPIA 3UQ3A 4B89A 1U3CA 4AY6A 1BLXB 1QNHA 5G04C 4O8HA 3ONKA 3QB2A 4CYHA 1LTXA 1OWLA 4J6IA 3EIJA 3DPYA 3Q78A 4B8CB 3SZ7A 1EDUA 4JD2G 1SW6A 4GPKA 3JQ1A 3PVLA 2ZP2A 4JHRA 4O6FA 4U95D 5D0OD 4JCPA 1D8DA 3DSTA 3DPDA 3C72A 4GTTA 1TN6A 1X81A 1CWMA 3L82A 3IXEA 5BUZA 3ICHA 3DSUA 5AQ9A 1NL4A 4J7WA 3K0PA 3ABME 3P1UA 5CBWA 3LYAA 3JXIA 2AXZA 4WWOA 5ANLA 3OXGA 1AWCB 4J5EX 3PZ4A 2XGSA 1S70B 3UX4A 1HZ4A 3SI5A 3UI2A 3TWRA 2QYJA 1HO8A 2MOWA 4HOUA 2KCVA 1N0QA 5ENTD 2OV8A 1O1TA 3JUIA 3ZNGA 5KV2A 2XGMA 2XPYA 2NC9A 1FPPA 4DGCA 1KT0A 4J0UA 4GMJA 3ZEFA 4DX7D 3APDA 4MS6A 4N3AA 3B13A 4KZCA 5LX8A 3B7TA 5CBTA 3LY9A 4LQWA 4N1OA 4OVVA 1W8MA 1Z3YA 4DGAA 3ESLA 5AENA 1MJ0A 4K5CA 1SA5A 3CHRA 4CGWA 4V3IA 3UINC 3R56A 4UWGA 1XNFA 3G2SA 1MX6A 2E2EA 3FUJA 2POYA 1N54A 4J5CX 4KVMA 2LNIA 3N71A 1IHGA 1H6KA 4N5CA 4WWPA 2IGWA 2FI7A 3JB9d 3FUFA 4JJMA 2XZTG 5FZRA 1MX4A 2XENA 4HNAD 2YHCA 5KJLA 1BPOA 3VTYA 2GGFA 3HXFA 4AP2A 2J09A 1YCSB 2ETCA 4APOA 1S0PA 5CERB 4J8DA 2ILRA 3K2CA 2DCPA 3RCKX 4PS8A 5JA4D 4HS2A 4U96D 5KV6A 4HORA 3C3RA 3AU4A 2XEHA 3K0RA 3HXEA 4I9YA 1JUQA 3CVLA 5ENQD 3AS5A 4U7EB 4MRUA 4HFGA 5KJKA 4EPZA 2X7KA 2P9KG 4Q69A 2GW1A 4F6RD 3MZLB 4U04A 2WXLA 4DX2A 3B7RL 4UQZA 4FRUA 3ZUVB 1M9CA 3ASFA 4BX9A 3Q5MA 1VDNA 5CYHA 4H7XA 4AV7A 1AWTA 1QZ2A 1WG0A 4ABNA 2VTBB 5AARA 1N94A 1H19A 5JHAA 1O1RA 4DUIA 4ANXA 4GA0A 5CECB 3O48A 2CHXA 4BSXA 1BI8B 4LG6A 4N3CA 1TN7A 2BEDA 3IHVA 5AQ7A 2BKKB 1TR4A 2PM6A 1OCCE 4O1PA 3C3QA 1IQUA 3CK7A 3ULYA 2X3MA 2LAHA 1MIKA 4JHKA 3FEXA 3B95A 3QNKA 1G3NB 3EU9A 3J5PA 3TG4A 2ZU6B 4GYWA 3FUIA 2VYIA 2ESLA 4JXTA 2DWZA 3ASNE 3X2QE 3IV0A 2V4HC 5EX0A 1Z3XA 5FINA 4IRUA 3VA7A 1A33A 5KJNA 3TG5A 4NIKA 4FLHA 4R7LA 2PZIA 2IGVA 3B7BA 2UY1A 3L08A 4BERA 4L9PA 2Y4UA 2NSZA 4BT9A 1XO7A 1JWGA 3R49A 4K03A 3W9FA 1OCZE 3HIZA 5M72A 4G24A 4N1MA 3QYUA 3BT8A 3ULQA 2HQ6A 3CKBA 3ZYLA 3QWWA 3ZFWA 4EECA 4Q96A 2A2NA 3FH7A 2RKKA 1HH8A 4GB9A 4WNGA 2HM8A 2WXQA 2J08A 4BTAA 1XWNA 5CCQA 3PEVB 4Y6WA 3FEYA 3D9PA 3B7SA 3ABKE 4RQIA 5AJLA 4BETA 4I1AA 4ZHBA 5T3RA 1TEZA 4H7YA 2X6KA 1PC2A 2R59A 3U4TA 2XRZA 2P9IG 3ZW3A 4GMRA 2IF4A 4A3TA 4I2WA 5A0EA 3UM0A 3HRAA 3TAXA 2V5QC 3TWUA 5CMWA 4UI9C 3S7FA 5E76A 3FTYA 3CVUA 1IXVA 4BY6A 1DNPA 1HU3A 2WFIA 2KBXA 3RAUA 1M9DA 3AU5A 1U2VG 1W74A 3CK9A 4HRNA 3JQ0A 3IBEA 3QDNA 2KC7A 2OCCE 2J8SD 3SFYA 4YUPA 5FIOA 5A6CA 5CCSX 4HXIA 1BU9A 5EIBE 1VBSA 3TXNA 1LD8A 1LF8A 4DPRA 2VQ2A 4B8AA 1UJJA 3K0OA 3I3NA 1N4QA 2B0OE 2RMCA 4G8KA 1D8EA 4UWFA 3EUVA 3RRNB 2OVFA 4ACKA 2YINA 4LERA 2ONDA 3FU0A 3K0MA 1JCRA 3UKUG 4UQYA 3R9AB 3ZN3A 5H7PA 4L2LA 4R3FA 2PL2A 2P9NG 1E7UA 3RCLA 2X2DB 5KNGA 3CHMA 2WPVA 3OAWA 1ZKCA 1O5MA 3E33A 1LD7A 1MZCA 4WWNA 5KV3A 4YUIA 3HXCA 3CVQA 5EN5D 3LVRE 4LCTA 1RZ4A 1KT1A 2WXMA 4JW1A 2UY1B 2XHEA 1MX2A 4XKCA 2XZDG 3Q73A 4HB5A 4Q94A 4HRLA 3OREA 5J90A 4ZSDA 2XEEA 3DSSA 1IQRA 2WXOA 4TV3A 2LXMA 3LCAA 3LXUX 3DEOA 1HF8A 1JCQA 2CMTA 3RIBA 1NFIE 1XGWA 3AS4A 2QFCA 2JLBA 2DVWA 4U07A 1YNDA 2VSYA 4DI4A 5EYPF 2R17C 3C98A 5AYWD 4L23A 3CYHA 4DX6D 4CCAA 1S64A 3FFLA 4JB8P 2P0OA 4Y6CA 5CCNA 3HG0D 2BKGA 4LNUD 2QC9A 1NA0A 5AAOA 1TNYA 3AAAC 2WFJA 3MYVA 3T5VA 4J5DX 4KT6B 2AW6A 4GTSA 2H6FA 3S7DA 5KUUA 2Y4TA 1EPUA 3RDBA 2MVZA 2KZTA 4FU3A 4HLLA 4E1QA 4A1SA 3FH5A 2IY0C 4FHJA 4I6GA 4FADA 3VLEA 4KBQA 4ANWA 3CQCB 3Q49B 3U64A 3ZRHA 4BX8A 1OXJA 3RU0A 4YUGA 2V0PA 3PUKA 3FU6A 5FQ6A 1CWAA 1H6PA 4EQFA 2NNZA 3UM3A 1MQSA 1H2UA 2FBNA 4FJZA 3WG7E 2GRRB 2A4ZA 4MKTA 1OCRE 1FT2A 3CIAA 3MJWA 4YUNA 3HYMB 5ENNA 3UPVA 3ASHA 1M9EA 4DRXE 1UN8A 3O7TA 3FU3A 3KOPA 3RCGA 3ODIA 4JEHA 5AN8A 4BESA 3MKRA 1NP7A 4G2VA 4LEUA 2X38A 3NF1A 2RMBA 1IHBA 5FZQA 4DI3A 5D2MC 3LJ3A 3UKRG 1Z81A 1AP7A 4CRWA 2HR2A 4FHKA 3TL5A 2NYJA 4B93B 4I1OB 1CWIA 3ZXPA 4LRZA 5G04J 4ATGA 3TWSA 4DX5D 2X2CK 5KV1A 2KATA 2IONA 1KZPA 1TNUA 1FVFA 4G26A 3SQVA 2LAIA 3QARA 4J5AX 4TXQA 1N11A 4E6HA 1CYNA 4N39A 4URKA 5AQAA 5KUNA 4RG6A 2P2CP 3ISMC 1X5BA 3ML9A 5B3SE 5KJMA 4YUHA 3UTMA 4GA2A 4GYOA 1VBTA 5BT1A 1JCSA 3DEPA 3UIOC 2Z6WA 5FQ8A 2RMAA 2A5UA 5C1DA 1QNGA 3Q7AA 4N1QA 1HG2A 3E37A 4P29A 4HVBA 3ULEG 3I4RB 3WXXA 3RCFA 1HE8A 4WNEA 1K8KG 5E75A 1TN8A 3FP3A 4JHJA 2RS4A 4F7AA 3RO2A 3V79K 2XRYA 4EZLA 2DZNA 4GZDA 3CHQA 5JJTA 4Z68A 4KYOB 2HO1A 4N2QA 1H6OA 1SVXA 3ZGQA 2ZGDA 4DX1A 4B94A 3FHEA 4BFRA 5JHEA 5AQBA 3KEAA 3W9GA 2OOEA 5KUQA 1ZX8A 2BF0X 5HQ8A 3D3MA 5BNWA 3NAWA 1ELKA 5CEDB 1CWOA 1SQMA 5CCMA 3IEGA 4UQXA 3NQPA 2LUHA 2B6CA 5B1BE 4CZ2D 3GW4A 2CK1A 2PQRA 5AJDA 3CVXA 2VGXA 2VGYA 3NBNB 5KUWA 3HVEA 2DYSE 4YUMA 2H6GA 2IQCA 2UWJG 2LO6A 5FQ4A 1N52A 5KURA 2X6JA 1N95A 2R03A 4I6JA 5J08A 4EBAG 4L1BA 3UT7A 4FULA 4J8FA 2IEJA 2WXHA 3S7JA 2RFMA 4K5AB 4WNDA 3PE4A 3SY2A 3RRUA 5KV0A 1ISTA 1L5JA 3RJVA 1M9FA 4I17A 3FU5A 3CGHA 3Q79A 3CK8A 4I9EA 1E8WA 5KNHD 4QQIA 4CT4A 2GRMA 2CHWA 4PS7A 3TJPA 3CEQA 3KS2A 4GTRA 2FEZA 2XQ0A 2MZUA 1EYHA 3V30A 3AJIA 2P58C 4K0RA 4RG9A 4LNGA 4RLYA 4TOTA 1HS6A 3T1UA 5CRUA 3MV3B 4TXPA 1KZOA 4OYSA 1AWQA 1OT8A 2CPLA 2X2AA 2F8XK 1H0PA 3Q15A 2POEA 4CGVA 4XNCA 3P2BA 4HI9A 2ZIRA 3D9JA 4A1GA 4TRQA 3DRAA 4N1NA 3T9KA 3T5XA 3URZA 2LXLA 4U0SA 3AG4E 4YUKA 1O1SA 2CFUA 3PUJA 3CQGB 1A58A 2R5SA 4I6EA 3AG2E 2EINE 4PUCA 3CKCA 4F53A 1PAQA 1PY1A 4GAAA 5LP0A 4M3OA 2PLUA 2L6BA 3ONLA 2WLWA 5ARGA 1IIPA 2L9BA 4ATZD 5IY5E 2X25B 5FT9A 5LOZA 3G2VA 3ZHEA 4U8VD 1FVHA 3APFA 4JVSA 3TWWA 3R9MA 2L0TB 1BCKA 1E8XA 4NRHB 3KD7A 1CWJA 5CBVA 3B7UX 4GZ6A 2Y3AA 5KV5A 1NI1A 2F0YA 3MEKA 2ZXWE 1DCQA 3NB2A 3Q4AB 2N0TA 3VLFA 3DSWA 2K7NA 2BIUX 5KCMA 2WXRA 3OXLA 4FP7A 1BD8A 3IKOB 1HFAA 3TWXA 4XE0A 2XPZA 3FUMA 3K0NA 1ZKFA 2OEVA 4CDNA 1K3ZD 2C0MA 3QOUA 2H6HA 3SFZA 1TNZA 2GRLA 3L17A 2F37A 3JXJA 1ZBPA 3CSTA 1RMHA 4NACA 3L6AA 4FRVA 4J8YA 3BUAA 1Q2ZA 5ARFA 4YNDA 3DXMG 4BT8A 4UWKA 3Q9NC 2J9QA 1E8YA 5KUVA 2AXUA 3FTSA 5B1AE 4ILIA 2XEVA 2OEWA 3L9TA 4I43A 3FTUA 4A55A 3PE3A 1TNBA 3JYSA 4AY5A 2QERA 2Y1LE 4B0ZA 2CYHA 1AK4A 4N1SA 3PNTB 4J8EA 4HLEA 3V2XA 3O4ZA 4HOQA 3CYSA 3BO7A 4C48B 4JA7A 5BPPA 4U63A 4GZCA 5CMYA 4GZ5A 4ILGA 4K5BA 4FLBA 1IKND 4X8QA 5LCWC 2IOSA 3UCHA 2C3BA 2WXGA 4GCOA 2WB2A 4BEPA 2HAQA 1OWOA 2BTDA 3MGBA 4O8IA 4G25A 4PDXA 4APFA 3RDAX 4RSYA 2BITX 4UI9J 4N1RA 4XI9A 4CDRA 2XGOA 3HXDA 4GTQA 4IN3B 2GRPB 3CSFA 4U0ZA 5KUSA 3PNLB 1UOHA 2QZAA 3Q7FA 1V54E 5D66A 3SHFA 3LY8A 2KM4A 2M63A 2RFAA 4G23A 2MRIA 3CR3A 4YULA 2X6IA 1N0RA 4I9CA 2OK3A 2RG8A 2XS8A 2ZISA 2WXNA 2WM9A 3L54A 4O60A 1Z5SC 3FH8A 3QC1A 5FZSA 3PEUB 1UW4B 4W9RA 5DIZA 2IO3C 3QWVA 3IHYA 3NZSA 1Z6TA 1E96B 3L13A 2EIKE 4EZKA 5FTPA 3JUEA 3ZKJA 4RVBA 4IYPA 2YHEA 1M9YA 1CWBA 3RDCA 3X27A 4YDYA 1WDYA 4F3VA 5ENRD 3ENEA 3KAEA 5EIDA 2AXVA 4JZYA 4N3BA 4FC8A 2I1KA 4AVXA 1OWMA 3PRZA 1E8ZA 5G05C 5EKQD 5KV7A 4JA9A 1E90A 3PS6A 4O1OA 5FWQA 2HE9A 4G1TA 5HRYA 3BKPA 2OVBA 3SO8A 2Y69E 3D9HA 4UI9K 4WAFA 2KCLA 5JHBA 1UN9A 3RDDA 2WQ6A 3CHSA 3GZ2A 4DGDA 1CWKA 3DBSA 2CG2A 2FU0A 3LDZA 3TWVA 4GTMA 4ANVA 2CFZA 3MMLA 4I2ZA 5G55A 2GROB 1H2TC 3QWPA 4J59A 4JEUA 1AWSA 3FULA 5F66A 2FULA 3MKQA 3EHNA 3PZ2A 4UWHA 3EOVA 4GTOA 2V4LA 4EBAA 3SNXA 4HOSA 3MA5A 2DIWA 4U0UA 5A23A 3S2AA 4DLOA 5CBNA 5T4YA 1FGLA 4BTBA 4CYMD 4DGEA 2MYOA 1H2VC 3OTNA 1E8KA 4R3EA 1ZMFA 3UMVA 2YQ8A 3CLJA 3CVNA 1N4SA 3TWTA 3QAQA 2ETBA 4KZ0A 2C2LA 4AJWA 3I5PA 5JMND 3CVYA 4CT0A 2MS4A 2VGEA 4EYVA 3ZVVA 3FUKA 3LKUA 1AWRA 4FA6A 4GPMA 5KV4A 3FUDA 3E30A 1UJKA 3FUEA 3R57A 4EHMA 4YVOA 3KSLA 3UT4A 1N4RA 1QQEA 3G2TA 1SA4A 2VSOE 4S1JA 5KWDA 5CBOA 4YDEA 5DBKA 2BUGA 1QBQA 4XIFA 4ZFHA 3NZUA 4GYYA 3C5RA 1YA0A 2L6JA 2EILE 3E32A 3FDHA 3PREA 3ZPJA 2C0LA 4TXRA 1OUVA 3MCXA 2VTBA 4ACLA 2ALFA 1Y8MA 2PNNA 3EIQC 2WMNA 3CVPA 4EZJA 3BG0B 2V5FA 4AM9A 4E85A 4MBGA 2VSNA 3D9IA 2MC9A 4A63B 2V8SE 4TUMA 2J4BA 4HOTA 2IOLA 3JCKC 1KLXA 3RD9X 2KZTB 2PM7A 3SGHA 3C3OA 3MMLB 3RFYA 2IJGX 3NOGD 3SBSA 1E7VA 3ASOE 2FO1E 3MKQB 3UIPC 4XX5A 1S63A 3FUNA 2NXPA 4AXHA 3D9NA 4IPZA 4HI8A 2MHKA 5HI7A 3R4GA 1NA3A 5KUOA 3ML8A 3QJZA 1ZU2A 1OCAA 4JC8A 3GZ1A 3EHRA 3FWVA 3MV2B 1DC2A 1B89A 2LSUA 3FY4A 1V9TA 5CBUA 2EQXA 1N9AA 5CCRA 1SZAA 3PH0C 3FTWA 2JEKA 3TWQA 1ELRA 5EILA 3VLDA 2KA0A 1TJFA 2NULA 4JL0A 4XI0A 1TJCA 3KEZA 1WY6A 1W8LA 3UT8A 4C9BB 5HS0A 5KULA 3ZYKA 5JJ7A 4BSZB 3R7RA 3CVWA 2GRNB 2IFUA 4ANUA 3ICIA 1GW6A 3FUHA 4GCNA 5G2NA 1MYOA 3MX3A 4GA1A 2I2OA 4JPSA 3TXMA 4A3VA 2F8YA 3GYZA 2WMOA 3DSXA 1CWHA 1XYHA 2FO7A 3OPFA 2XS1A 3Q9UC 4YUJA 1FT1A 5KBAA 2FF4A 2KCKA 3LY7A 3G2UA 2J07A 3EHQA 3AS8A 3LPZA 5FJYA 4QFVA 1ELWA 4GU5A 3PDNA 3QKYA 2LSVA 1P5QA 3U9WA 3G2WA 4FJYA 3SF4A 3U3WA 3CHPA 1HXIA 2KXPC 1TYQG 3KSQA 5C2YA 3T8MA 3Q75A 1K1BA 3NOCD 2XGYB 4L7TA 2B71A 2ZGGA 1AWVA 2YNQA 5BW8C 4DJAA 2OSEA 3RKVA 2ETAA 3J5QB 3PZDA 3S6MA 4U8YD 3T8KA 4NQ0A 5AIJA 3DSVA 4YVQC 1TNOA 5ENOD 4ME2A 4N1PA 4TUUA 3EHMA 5BXOA 3DXKG 1D9SA 3EDTB 3AG1E 4YDWA 3EJNA 4ZSCA 1H0AA 4L2YA 3ABLE 1CWLA 4XKBA 1CLHA 3HXBA 1MZWA 1CWFA 2P9UG 3R7QA 2QY7A 3UM1A 4J5BA 1AWUA 3UXGA 2R2LA 1M9XA 3DWLG 2AWIA 3EU5A 1CWCA 4IULA 2WXIA 3R54A 5EDSA 2A5EA 4CEMA 5ENSD 5BXUA 2J4DA 3ESKA 2WXPA 5D0QD 4KVOA 3AG3E 4UWLA 4YUOA 3ODLA 3ZYMA
chains in the Genus database with same CATH topology
2OK3A 4LEUA 4J8DA 2ILRA 2X38A 3NF1A 2RG8A 4DLQA 2WXNA 3L16A 2VGXB 2WM9A 3K2CA 2RMBA 2DCPA 2WXJA 5FZQA 4C0MA 4DI3A 3L54A 3LJ3A 3LEWA 1HX8A 3HVEB 1Z81A 3RCIX 3RCKX 1OWNA 4CRWA 4PS8A 4HS2A 2HR2A 3FH8A 3QC1A 4FHKA 3TL5A 5FZSA 1XQ7A 1Y6IA 5KV6A 3PEUB 1UW4B 4HORA 4W9RA 4I1OB 1M63C 5DIZA 1CWIA 3AU4A 3QWVA 3IHYA 3NZSA 1Z6TA 4LRZA 5G04J 4ATGA 1E96B 3L13A 4J8SA 3K0RA 3D9LA 4I9YA 1JUQA 3CVLA 1DVPA 1LOPA 4EZKA 2WXKA 2AVPA 3AS5A 3D9MA 5FTPA 4MRUA 3ASDA 4HFGA 5KJKA 4EPZA 2X2CK 4RVBA 4IYPA 1INZA 2YHEA 2X7KA 5KV1A 1FCHA 1SZ9A 1M9YA 4Q69A 1CWBA 5CHEE 2KATA 5EX3A 3RDCA 2IONA 2GW1A 3MZLB 4F3VA 1FVFA 2HQJA 4U04A 3ENEA 3KAEA 2WXLA 2AXVA 4G26A 4JZYA 4N3BA 3B7RL 4UQZA 4FRUA 4DGAA 1M9CA 4FC8A 3ASFA 2I1KA 4LUNU 2LAIA 4BX9A 3Q5MA 1OWMA 3QARA 4AVXA 3PRZA 4J5AX 1VDNA 5CYHA 4H7XA 4AV7A 4E6HA 1AWTA 5BV1A 1CYNA 3S7BA 1QZ2A 1E8ZA 5G05C 2WQ7A 4CDMA 4N39A 3ASGA 5EKQD 4URKA 5KUNA 5KV7A 4RG6A 4AEZC 4JA9A 5A7DB 1MF8C 1E90A 3PS6A 1X5BA 3ML9A 2R99A 4I1MA 1IYGA 5FWQA 2HE9A 5KJMA 4G1TA 4AIFA 3BKPA 2OVBA 4YUHA 4ABNA 4GA2A 4GYOA 1VBTA 1E3BA 2VSXE 2VTBB 4NURA 4PS3A 5BT1A 4UI9K 4WAFA 3K0QA 2KCLA 2Z6WA 5FQ8A 5CCLA 1H19A 5JHBA 2RMAA 2A5UA 1UN9A 5JHAA 3RRMB 3RDDA 5C1DA 2WQ6A 1QNGA 3CHSA 4N1QA 3GZ2A 4DGDA 1CWKA 4ANXA 1HG2A 3DBSA 4GA0A 4P29A 4HVBA 2CG2A 3L22A 3LDZA 2FU0A 4ANVA 3I4RB 3O48A 2CHXA 4BSXA 2CFZA 3WXXA 4PH4B 4N3CA 3RCFA 3MMLA 1WM5A 4AOFA 4I2ZA 5G55A 1NZNA 1H2TC 1HE8A 3QWPA 4J59A 3IHVA 4WNEA 4N2SA 4JEUA 4MLPA 2PM6A 1AWSA 3FULA 5F66A 2FULA 2VJ8A 5E75A 4I9CA 3FP3A 1IQUA 3MKQA 3CK7A 4C0EA 2I6HA 4JHJA 3EHNA 3SBTB 4GZ3A 2X3MA 4UWHA 3EOVA 2RS4A 2LAHA 4F7AA 1MIKA 3RO2A 2XRYA 4JHKA 4EZLA 3FEXA 2X6FA 1VAIA 2GW2A 4GZDA 3CHQA 2V4LA 5JJTA 3K9IA 3QNKA 4EBAA 3TG4A 1QOIA 3SNXA 4KXKB 4KYOB 4HOSA 2ZU6B 2HO1A 3MA5A 4G11A 4GMLA 4N2QA 3LS8A 4GYWA 2DIWA 1W8VA 1HG5A 3FUIA 4U0UA 5A23A 3ZGQA 2VYIA 2ESLA 3S2AA 4XZ4A 4JXTA 2WVIA 4B94A 2X6HA 3APCA 2X83B 4DLOA 3FHEA 2PQNA 3IV0A 4BFRA 5LFAA 5JHEA 5EX0A 3ZXSA 1Z3XA 3ZIMA 2OOEA 4IRUA 5KUQA 3VA7A 2I9CA 1C5FA 2BF0X 5T4YA 1EF1C 3TG5A 5KJNA 1A33A 1FGLA 4WUYA 5HQ8A 3D3MA 5BNWA 2IU1A 4FLHA 4R7LA 2PZIA 1ELKA 2IGVA 4BTBA 1CWOA 4DGEA 2UY1A 3RO3A 1SQMA 5CCMA 5LCWJ 1H2VC 3OTNA 2CG3A 3L08A 1E8KA 4R3EA 1X7FA 1ZMFA 2Y4UA 3IEGA 2YQ8A 4UQXA 3UMVA 2NSZA 3CLJA 3ZHEB 3NQPA 3CVNA 4BT9A 2CFEA 1XO7A 1JWGA 3R49A 3GW4A 3QAQA 2CK1A 4K03A 2PQRA 5AJDA 4KZ0A 3CVXA 5FQ7A 3HIZA 2C2LA 5M72A 2VGXA 4G24A 4N1MA 3QYUA 4AJWA 3BT8A 2VGYA 3I5PA 2HYZA 3ULQA 2HQ6A 3CKBA 3D9OA 3QWWA 3ZFWA 3ZYLA 4EECA 3CVYA 5KUWA 4CT0A 3HVEA 2RD0A 3HDXA 2MS4A 4Q96A 3OEPA 4YUMA 2A2NA 2IQCA 2UWJG 3FH7A 3FTZA 5ANRA 2LO6A 5FQ4A 4EYVA 1HH8A 2XCCA 1N52A 2CHZA 4GB9A 4WNGA 3ZVVA 2X6JA 1JPLA 5KURA 1NMKA 5BV0A 3CHOA 2HM8A 2J49A 3FUKA 3LKUA 2WXQA 1AWRA 2J08A 4I6JA 5J08A 1J2AA 4BTAA 1XWNA 4EBAG 4L1BA 5CCQA 3PEVB 4Y6WA 4FA6A 3FEYA 3QK0A 3D9PA 1U3DA 4FULA 4J8FA 2L0IA 3UT7A 4DK5A 5KV4A 2WXHA 3B7SA 3FUDA 3S7JA 1UJKA 3FUEA 3UUXA 5JJ6A 3R57A 4WNDA 4YVOA 3PE4A 5AJLA 1QNFA 4I1AA 3RRUA 3UT4A 1QQEA 3D9KA 3G2TA 5KV0A 5T3RA 3BEEA 1TEZA 2VSOE 4S1JA 4H7YA 1ISTA 2X6KA 1L5JA 2WQHA 1OWPA 3OXFA 3RJVA 1PC2A 1M9FA 4I17A 3FU5A 2R59A 3U66A 2OJUA 1UG3A 3I4GA 5LUDA 3U4TA 3CGHA 5DBKA 2XRZA 1A17A 3BG1B 3ZW3A 2IF4A 2BUGA 5T8IA 4A3TA 4D10C 3CK8A 4I2WA 3Q47B 4I9EA 1E8WA 4XIFA 4F1SA 4ILHB 5A0EA 4CT4A 3NZUA 4GYYA 3TAXA 3ZYQA 1YA0A 3R59A 4J58A 5CMWA 2GRMA 2L6JA 4UI9C 3CV0A 3FDHA 2CHWA 3PREA 2C0LA 4PS7A 3S7FA 3RK6A 3ZPJA 5E76A 1MHQA 3FTYA 1OUVA 3MCXA 3TJPA 2VTBA 4ACLA 3CVUA 2ALFA 3PMPA 4BY6A 1DNPA 3CEQA 3KS2A 2FEZA 2WXFA 4DGBA 2XQ0A 2XCBA 1Y8MA 1HU3A 2MZUA 3FTXA 2WFIA 1EYHA 3EIQC 2WMNA 2Q7FA 3CVPA 4EZJA 1M9DA 3AU5A 2P58C 1WAO1 3BG0B 4KMOA 4WNFA 3VTXA 5DUDA 1JWFA 1W74A 4K0RA 2V5FA 4RG9A 4AM9A 3CK9A 4E85A 3JQ0A 3IBEA 2VSNA 3D9IA 3QDNA 2MC9A 4TOTA 2KC7A 2V8SE 1HS6A 1VDYA 2J4BA 4BWRA 4HOTA 2IOLA 3T1UA 4YUPA 5A6CA 3JCKC 3MV3B 4HY7A 5CCSX 1KLXA 4HXIA 3RD9X 2KZTB 5KUZA 4OYSA 1AWQA 1VBSA 3TXNA 2CPLA 2PM7A 3LVQE 3SGHA 1LF8A 2X2AA 4DPRA 2VQ2A 4B8AA 1H0PA 3MMLB 3Q15A 2POEA 4CGVA 1UJJA 4XNCA 3K0OA 3I3NA 3P2BA 1W3BA 4A1GA 3D9JA 3GZSA 4TRQA 5G05J 3TGOA 2RMCA 3RFYA 3FTVA 2IJGX 4N1NA 3SBSA 4S1EA 3HHMA 2E0IA 3RRNB 4UWFA 3T5XA 3URZA 2OVFA 1E7VA 1DYWA 3CVVA 4U0SA 3MKQB 4ACKA 2YINA 2DBAA 3E4BA 3SD5A 4YUKA 4XX5A 4LERA 4OVUA 2ONDA 3FU0A 3FUNA 2CFUA 3K0MA 2NXPA 3PUJA 3CQGB 4AXHA 3D9NA 2I1JA 1A58A 4IPZA 2PHCB 2MHKA 4U8HA 2R5SA 4I6EA 2XPIA 4UQYA 5HI7A 3R9AB 3UQ3A 3ZN3A 4B89A 1NA3A 3R4GA 4PUCA 1U3CA 4AY6A 3ML8A 3CKCA 3QJZA 1QNHA 5KUOA 4L2LA 4R3FA 1ZU2A 2PL2A 4JC8A 1E7UA 5G04C 4F53A 1OCAA 4O8HA 3GZ1A 3FWVA 1PAQA 3MV2B 3ONKA 3QB2A 2X2DB 1B89A 2WPVA 3CHMA 3RCLA 3OAWA 1PY1A 4GAAA 5LP0A 4M3OA 1ZKCA 2PLUA 2LSUA 3FY4A 1V9TA 5CBUA 3ONLA 2WLWA 1OWLA 4J6IA 5ARGA 4CYHA 4WWNA 2EQXA 1IIPA 4YUIA 3EIJA 2L9BA 3CVQA 5CCRA 5KV3A 1SZAA 3PH0C 4B8CB 3FTWA 2X25B 3SZ7A 3LVRE 5FT9A 4LCTA 2JEKA 5LOZA 1ELRA 1EDUA 3G2VA 1KT1A 3ZHEA 1FVHA 2WXMA 3APFA 4JVSA 4GPKA 3JQ1A 3VLDA 1TJFA 2NULA 2L0TB 1BCKA 3PVLA 4JW1A 2ZP2A 4JL0A 2UY1B 2XHEA 1E8XA 4NRHB 3KD7A 1CWJA 5CBVA 4XKCA 4JHRA 4O6FA 3B7UX 4GZ6A 2Y3AA 4XI0A 5KV5A 1TJCA 3KEZA 5D0OD 1WY6A 4Q94A 1W8LA 3UT8A 4C9BB 3MEKA 3OREA 4JCPA 5J90A 4ZSDA 3Q4AB 5KULA 3ZYKA 2N0TA 1IQRA 2WXOA 3VLFA 3DPDA 4TV3A 5JJ7A 2K7NA 2BIUX 5KCMA 2WXRA 3OXLA 3LCAA 3LXUX 4FP7A 3R7RA 3CVWA 3IKOB 1CWMA 2IFUA 5BUZA 1HFAA 3ICHA 4XE0A 4ANUA 1GW6A 1HF8A 2XPZA 3FUHA 4GCNA 3ICIA 5G2NA 3FUMA 2CMTA 3MX3A 4GA1A 3K0PA 2I2OA 3RIBA 3P1UA 3K0NA 4JPSA 1ZKFA 3TXMA 1XGWA 5CBWA 4CDNA 3LYAA 3AS4A 2C0MA 2QFCA 2JLBA 4A3VA 2AXZA 4WWOA 3QOUA 3SFZA 2GRLA 3OXGA 4U07A 3L17A 5ANLA 3GYZA 1YNDA 2WMOA 2VSYA 4DI4A 1ZBPA 3CSTA 1RMHA 4NACA 4J5EX 3L6AA 1CWHA 1XYHA 2XGSA 4FRVA 2R17C 2FO7A 3C98A 5AYWD 3UX4A 4L23A 1HZ4A 3SI5A 3OPFA 5ARFA 3CYHA 4YNDA 1HO8A 2MOWA 4HOUA 4CCAA 3FFLA 4YUJA 2KCVA 2FF4A 2KCKA 4BT8A 2P0OA 3LY7A 4Y6CA 3G2UA 2J07A 4UWKA 3AS8A 2OV8A 3LPZA 4QFVA 5FJYA 2J9QA 5CCNA 1E8YA 1ELWA 3JUIA 2AXUA 3PDNA 3QKYA 2LSVA 4GU5A 5KUVA 1P5QA 3U9WA 3G2WA 3FTSA 2XGMA 4FJYA 5KV2A 4ILIA 2XEVA 2XPYA 3SF4A 2NC9A 4I43A 4DGCA 1KT0A 3FTUA 4A55A 3U3WA 3PE3A 1NA0A 4J0UA 3JYSA 4AY5A 3CHPA 2QERA 1HXIA 4GMJA 2WFJA 4B0ZA 5C2YA 3MYVA 3T8MA 1AK4A 2CYHA 3T5VA 3PNTB 4N1SA 4J8EA 3ZEFA 2XGYB 4J5DX 4L7TA 4KT6B 2B71A 1AWVA 2YNQA 5BW8C 3APDA 4MS6A 2AW6A 4DJAA 2OSEA 3RKVA 4N3AA 3PZDA 4HLEA 3B13A 3S6MA 3O4ZA 4KZCA 4NQ0A 4HOQA 3S7DA 5LX8A 3B7TA 5KUUA 2Y4TA 5AIJA 3CYSA 5CBTA 3LY9A 4LQWA 3BO7A 4YVQC 4JA7A 1EPUA 4OVVA 5BPPA 4N1OA 3RDBA 2MVZA 2KZTA 4U63A 1W8MA 4FU3A 1Z3YA 4GZCA 4ME2A 4TUUA 5CMYA 4N1PA 3ESLA 5AENA 4GZ5A 4ILGA 3FH5A 4A1SA 4I6GA 4FLBA 3EHMA 4FHJA 5LCWC 4FADA 3CHRA 4CGWA 2IOSA 3VLEA 3UCHA 2C3BA 2WXGA 4V3IA 4GCOA 4KBQA 4ANWA 3CQCB 3Q49B 2WB2A 3EDTB 3R56A 3U64A 3ZRHA 4E1QA 4UWGA 4BX8A 3RU0A 2HAQA 3EJNA 4ZSCA 1OWOA 2BTDA 3MGBA 1H0AA 4L2YA 4G25A 4PDXA 4O8IA 4YUGA 1XNFA 3G2SA 1CWLA 2E2EA 3FUJA 4XKBA 2POYA 1CLHA 4APFA 3RDAX 2V0PA 3PUKA 3FU6A 4RSYA 4UI9J 5FQ6A 1CWFA 1MZWA 2BITX 4N1RA 1N54A 4XI9A 1CWAA 4CDRA 4J5CX 2XGOA 4EQFA 3R7QA 2QY7A 4KVMA 2LNIA 1MQSA 1H2UA 2FBNA 4IN3B 4J5BA 3N71A 1IHGA 3CSFA 4U0ZA 5KUSA 4FJZA 1H6KA 3PNLB 4N5CA 4WWPA 1AWUA 2A4ZA 2IGWA 4MKTA 2FI7A 3JB9d 1M9XA 3CIAA 2AWIA 3MJWA 4YUNA 3SHFA 3LY8A 4IULA 1CWCA 2WXIA 3HYMB 3FUFA 5ENNA 4JJMA 3R54A 5FZRA 2KM4A 2M63A 5EDSA 3UPVA 4G23A 4CEMA 3ASHA 2YHCA 1M9EA 1UN8A 5KJLA 3O7TA 1BPOA 2MRIA 3CR3A 3FU3A 4YULA 3VTYA 2GGFA 3RCGA 2J4DA 4AP2A 3ODIA 2X6IA 3ESKA 4JEHA 2WXPA 2J09A 5D0QD 4KVOA 3MKRA 4UWLA 1NP7A 4YUOA 3ODLA 4APOA 1S0PA 4G2VA 3ZYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK3 A;  4LEU A;  4J8D A;  3NF1 A;  2VGX B;  3K2C A;  2RMB A;  5FZQ A;  3RCI X;  1Z81 A;  3RCK X;  2HR2 A;  5FZS A;  1XQ7 A;  5KV6 A;  4HOR A;  4W9R A;  1M63 C;  5DIZ A;  1CWI A;  3QWV A;  5G04 J;  1E96 B;  3K0R A;  4I9Y A;  3CVL A;  1LOP A;  2AVP A;  3AS5 A;  5FTP A;  3ASD A;  5KJK A;  2X2C K;  2X7K A;  5KV1 A;  1FCH A;  1M9Y A;  1CWB A;  5CHE E;  2KAT A;  5EX3 A;  3RDC A;  2GW1 A;  4F3V A;  2HQJ A;  4U04 A;  3KAE A;  4G26 A;  4N3B A;  4FRU A;  4UQZ A;  1M9C A;  3ASF A;  3Q5M A;  4J5A X;  1VDN A;  5CYH A;  4H7X A;  1AWT A;  1CYN A;  3S7B A;  1QZ2 A;  5G05 C;  4N39 A;  3ASG A;  5EKQ D;  5KUN A;  5KV7 A;  4RG6 A;  4JA9 A;  5A7D B;  1MF8 C;  2R99 A;  1IYG A;  2HE9 A;  5KJM A;  4G1T A;  4AIF A;  3BKP A;  4YUH A;  4ABN A;  4GA2 A;  4GYO A;  1VBT A;  1E3B A;  5BT1 A;  4UI9 K;  3K0Q A;  2KCL A;  2Z6W A;  2RMA A;  5CCL A;  3RDD A;  5C1D A;  1QNG A;  4N1Q A;  3GZ2 A;  4DGD A;  1CWK A;  4GA0 A;  2FU0 A;  3O48 A;  3WXX A;  4N3C A;  3RCF A;  3MML A;  1WM5 A;  4I2Z A;  1NZN A;  3QWP A;  4J59 A;  4WNE A;  4N2S A;  1AWS A;  5F66 A;  4I9C A;  3FP3 A;  3CK7 A;  2I6H A;  4GZ3 A;  3EOV A;  2RS4 A;  1MIK A;  3RO2 A;  1VAI A;  2GW2 A;  5JJT A;  3K9I A;  3TG4 A;  1QOI A;  4KXK B;  4KYO B;  4HOS A;  3MA5 A;  2HO1 A;  4N2Q A;  1W8V A;  4GYW A;  4U0U A;  3ZGQ A;  2VYI A;  2ESL A;  4B94 A;  2X83 B;  2PQN A;  5JHE A;  5EX0 A;  2OOE A;  5KUQ A;  3VA7 A;  1C5F A;  1A33 A;  5KJN A;  3TG5 A;  1FGL A;  4WUY A;  5HQ8 A;  5BNW A;  2PZI A;  2IGV A;  4BTB A;  1CWO A;  4DGE A;  2UY1 A;  3RO3 A;  5LCW J;  5CCM A;  1E8K A;  4R3E A;  1X7F A;  1ZMF A;  2Y4U A;  3IEG A;  2YQ8 A;  4UQX A;  3ZHE B;  4BT9 A;  3CVN A;  2CFE A;  1XO7 A;  3R49 A;  3GW4 A;  2CK1 A;  2PQR A;  2C2L A;  5M72 A;  2VGX A;  4G24 A;  4N1M A;  3QYU A;  3BT8 A;  2VGY A;  3ULQ A;  2HYZ A;  2HQ6 A;  3CKB A;  3ZFW A;  3QWW A;  5KUW A;  2MS4 A;  3OEP A;  4YUM A;  2A2N A;  2UWJ G;  4EYV A;  1HH8 A;  2XCC A;  4WNG A;  5KUR A;  1NMK A;  3LKU A;  1AWR A;  1J2A A;  4BTA A;  1XWN A;  5CCQ A;  4Y6W A;  4J8F A;  5KV4 A;  3S7J A;  3UUX A;  5JJ6 A;  3R57 A;  4WND A;  4YVO A;  3PE4 A;  4I1A A;  1QQE A;  5KV0 A;  3BEE A;  4S1J A;  4H7Y A;  1IST A;  3OXF A;  2WQH A;  3RJV A;  1PC2 A;  1M9F A;  4I17 A;  2OJU A;  5LUD A;  3U4T A;  5DBK A;  1A17 A;  2IF4 A;  2BUG A;  3CK8 A;  4I2W A;  3Q47 B;  4I9E A;  4XIF A;  5A0E A;  4GYY A;  3TAX A;  1YA0 A;  3R59 A;  4J58 A;  2L6J A;  4UI9 C;  3CV0 A;  3S7F A;  2C0L A;  3ZPJ A;  1OUV A;  3PMP A;  2ALF A;  3CEQ A;  3KS2 A;  4DGB A;  2FEZ A;  2XCB A;  1Y8M A;  2MZU A;  2WFI A;  2Q7F A;  3CVP A;  1M9D A;  4WNF A;  1WAO 1;  3VTX A;  2P58 C;  5DUD A;  1W74 A;  2V5F A;  4RG9 A;  4AM9 A;  3CK9 A;  2VSN A;  2MC9 A;  3QDN A;  4TOT A;  2KC7 A;  4BWR A;  3T1U A;  4HOT A;  4YUP A;  5A6C A;  4HY7 A;  3MV3 B;  5CCS X;  1KLX A;  3RD9 X;  5KUZ A;  1AWQ A;  1VBS A;  2CPL A;  2X2A A;  2VQ2 A;  3MML B;  1H0P A;  3Q15 A;  2POE A;  4CGV A;  4XNC A;  3K0O A;  1W3B A;  3TGO A;  5G05 J;  2RMC A;  3RFY A;  4S1E A;  4N1N A;  3URZ A;  1DYW A;  4U0S A;  3E4B A;  2DBA A;  4YUK A;  2OND A;  3K0M A;  1A58 A;  4IPZ A;  2PHC B;  2MHK A;  2R5S A;  2XPI A;  4UQY A;  5HI7 A;  3R9A B;  3UQ3 A;  3ZN3 A;  3R4G A;  1NA3 A;  4AY6 A;  5KUO A;  3CKC A;  1QNH A;  4R3F A;  1ZU2 A;  2PL2 A;  5G04 C;  1OCA A;  4O8H A;  3GZ1 A;  3FWV A;  3MV2 B;  3RCL A;  2X2D B;  1B89 A;  2WPV A;  1ZKC A;  2PLU A;  2LSU A;  1V9T A;  5CBU A;  2WLW A;  5ARG A;  4CYH A;  5KV3 A;  1IIP A;  4YUI A;  3CVQ A;  5CCR A;  2X25 B;  3SZ7 A;  5FT9 A;  1ELR A;  3ZHE A;  1KT1 A;  4GPK A;  2NUL A;  1BCK A;  2ZP2 A;  4JL0 A;  2UY1 B;  4NRH B;  3KD7 A;  1CWJ A;  5CBV A;  4JHR A;  4O6F A;  4GZ6 A;  4XI0 A;  5KV5 A;  1TJC A;  5D0O D;  1W8L A;  3MEK A;  3ORE A;  4JCP A;  4ZSD A;  3Q4A B;  5KUL A;  2N0T A;  5JJ7 A;  2K7N A;  2BIU X;  3OXL A;  3LCA A;  1CWM A;  2IFU A;  3ICH A;  3ICI A;  4GCN A;  2CMT A;  4GA1 A;  3K0P A;  3RIB A;  3K0N A;  1ZKF A;  5CBW A;  3LYA A;  3AS4 A;  2C0M A;  2QFC A;  2JLB A;  3QOU A;  3OXG A;  4U07 A;  1YND A;  3GYZ A;  2VSY A;  1ZBP A;  4J5E X;  1RMH A;  1CWH A;  1XYH A;  2XGS A;  4FRV A;  2FO7 A;  5AYW D;  1HZ4 A;  3OPF A;  5ARF A;  3CYH A;  4YND A;  4HOU A;  4YUJ A;  3FFL A;  2KCV A;  2FF4 A;  2KCK A;  4BT8 A;  2P0O A;  3LY7 A;  4Y6C A;  5FJY A;  3AS8 A;  3LPZ A;  2J9Q A;  5CCN A;  1ELW A;  5KUV A;  3PDN A;  3QKY A;  2LSV A;  1P5Q A;  5KV2 A;  2XGM A;  2XEV A;  3SF4 A;  2NC9 A;  4DGC A;  1KT0 A;  3U3W A;  3PE3 A;  1NA0 A;  4J0U A;  3JYS A;  4AY5 A;  2QER A;  1HXI A;  2WFJ A;  2CYH A;  1AK4 A;  4N1S A;  4J8E A;  4J5D X;  2XGY B;  2B71 A;  1AWV A;  5BW8 C;  2OSE A;  3RKV A;  4N3A A;  3S6M A;  4NQ0 A;  4HOQ A;  3S7D A;  5KUU A;  2Y4T A;  3CYS A;  5CBT A;  3LY9 A;  4LQW A;  3BO7 A;  4YVQ C;  4JA7 A;  4N1O A;  3RDB A;  2MVZ A;  1W8M A;  4ME2 A;  4N1P A;  4DGA A;  4GZ5 A;  4E1Q A;  4A1S A;  5LCW C;  4CGW A;  3UCH A;  2C3B A;  4GCO A;  4KBQ A;  3Q49 B;  3EDT B;  3R56 A;  3RU0 A;  2HAQ A;  4ZSC A;  4O8I A;  4G25 A;  4YUG A;  1XNF A;  1CWL A;  2E2E A;  2POY A;  1CLH A;  3RDA X;  1MZW A;  2BIT X;  4UI9 J;  4N1R A;  1CWF A;  4XI9 A;  1CWA A;  4CDR A;  4J5C X;  2XGO A;  4EQF A;  2LNI A;  4IN3 B;  2FBN A;  4J5B A;  3N71 A;  1IHG A;  4U0Z A;  5KUS A;  4N5C A;  1AWU A;  2IGW A;  2FI7 A;  3JB9 d;  1M9X A;  4YUN A;  3LY8 A;  1CWC A;  3HYM B;  4JJM A;  3R54 A;  5FZR A;  3UPV A;  4G23 A;  3ASH A;  2YHC A;  1M9E A;  5KJL A;  3O7T A;  4YUL A;  3VTY A;  3RCG A;  3ODI A;  3ESK A;  5D0Q D;  3MKR A;  4YUO A;  3ODL A;  4APO A;  4G2V A; 
#chains in the Genus database with same CATH topology
 4DLQ A;  3L16 A;  2VGX B;  5ITZ F;  2WXJ A;  4C0M A;  3LEW A;  1HX8 A;  3HVE B;  3RCI X;  1OWN A;  3ZU7 B;  1XQ7 A;  1OCO E;  1Y6I A;  1M63 C;  4HRM B;  3LJN A;  4J8S A;  3D9L A;  4UUC A;  1DVP A;  1LOP A;  2WXK A;  2AVP A;  3D9M A;  2DYR E;  3ASD A;  4F1P A;  4GTV A;  5HKP A;  1INZ A;  1FCH A;  1SZ9 A;  4XEI G;  5CHE E;  5EX3 A;  3SFX A;  4OAU C;  3V2O A;  2HQJ A;  1A5E A;  4LUN U;  2R05 A;  5ENP D;  5BV1 A;  3S7B A;  4YDO A;  2WQ7 A;  4CDM A;  3ASG A;  3BQO A;  4AEZ C;  5A7D B;  1MF8 C;  2R99 A;  4I1M A;  1IYG A;  4AIF A;  1E3B A;  2VSX E;  4NUR A;  4PS3 A;  3K0Q A;  5CCL A;  3RRM B;  3L22 A;  1YYH A;  4PH4 B;  1WM5 A;  4AOF A;  1NZN A;  4N2S A;  4MLP A;  2P9L G;  2P9P G;  2VJ8 A;  4C0E A;  2I6H A;  3SBT B;  4GZ3 A;  2HE0 A;  3BU8 A;  2X6F A;  1VAI A;  2P9S G;  1K1A A;  2GW2 A;  2JAB A;  4LNB A;  4OAV B;  3K9I A;  1QOI A;  4KXK B;  3V31 A;  4GML A;  1W8V A;  4G11 A;  3LS8 A;  5EYL A;  1HG5 A;  4N5Q A;  4XZ4 A;  2WVI A;  2X6H A;  3APC A;  2X83 B;  2PQN A;  5LFA A;  4HQD A;  3ZXS A;  3ZIM A;  2R02 A;  2I9C A;  1C5F A;  1EF1 C;  4WUY A;  5CEA A;  2IU1 A;  2DZO A;  4GTP A;  3RO3 A;  5LCW J;  2CG3 A;  1X7F A;  3ZHE B;  2CFE A;  4G8L A;  3RSE G;  5FQ7 A;  2HYZ A;  3D9O A;  3E34 A;  2RD0 A;  3HDX A;  3PZ3 A;  3OEP A;  3FTZ A;  5ANR A;  1KPS B;  2XCC A;  2CHZ A;  1JPL A;  1NMK A;  5BV0 A;  3CHO A;  2J49 A;  1OY3 D;  1J2A A;  4HBD A;  3QK0 A;  4DK5 A;  1U3D A;  3PZ1 A;  2L0I A;  1DCE A;  3UUX A;  5JJ6 A;  2QYU A;  3F6Q A;  1BI7 B;  4M7C A;  1N4P A;  1QNF A;  2IO2 C;  3D9K A;  3BEE A;  3OXF A;  2WQH A;  1OWP A;  4LSZ E;  3U66 A;  2OJU A;  1UG3 A;  3I4G A;  5LUD A;  1A17 A;  3BG1 B;  1QYM A;  5T8I A;  4D10 C;  3Q47 B;  4F1S A;  4ILH B;  3ZYQ A;  3R59 A;  4J58 A;  3CV0 A;  2EIJ E;  3RK6 A;  1MHQ A;  3PMP A;  4DGB A;  2WXF A;  2XCB A;  3FTX A;  2Q7F A;  1YMP A;  1RW2 A;  4WNF A;  1WAO 1;  4KMO A;  3VTX A;  5DUD A;  1JWF A;  1VDY A;  4BWR A;  1V55 E;  2GRQ B;  4HY7 A;  5KUZ A;  2H6I A;  3LVQ E;  3UM2 A;  1W3B A;  3GZS A;  3TGO A;  5G05 J;  2EIM E;  2Y0B G;  2AJA A;  3FTV A;  4S1E A;  3HHM A;  2E0I A;  5CRV A;  1DYW A;  3CVV A;  3E4B A;  2DBA A;  3SD5 A;  4OVU A;  2I1J A;  2PHC B;  4U8H A;  1ZB1 A;  2XPI A;  3UQ3 A;  4B89 A;  1U3C A;  4AY6 A;  1BLX B;  1QNH A;  5G04 C;  4O8H A;  3ONK A;  3QB2 A;  4CYH A;  1LTX A;  1OWL A;  4J6I A;  3EIJ A;  3DPY A;  3Q78 A;  4B8C B;  3SZ7 A;  1EDU A;  4JD2 G;  1SW6 A;  4GPK A;  3JQ1 A;  3PVL A;  2ZP2 A;  4JHR A;  4O6F A;  4U95 D;  5D0O D;  4JCP A;  1D8D A;  3DST A;  3DPD A;  3C72 A;  4GTT A;  1TN6 A;  1X81 A;  1CWM A;  3L82 A;  3IXE A;  5BUZ A;  3ICH A;  3DSU A;  5AQ9 A;  1NL4 A;  4J7W A;  3K0P A;  3ABM E;  3P1U A;  5CBW A;  3LYA A;  3JXI A;  2AXZ A;  4WWO A;  5ANL A;  3OXG A;  1AWC B;  4J5E X;  3PZ4 A;  2XGS A;  1S70 B;  3UX4 A;  1HZ4 A;  3SI5 A;  3UI2 A;  3TWR A;  2QYJ A;  1HO8 A;  2MOW A;  4HOU A;  2KCV A;  1N0Q A;  5ENT D;  2OV8 A;  1O1T A;  3JUI A;  3ZNG A;  5KV2 A;  2XGM A;  2XPY A;  2NC9 A;  1FPP A;  4DGC A;  1KT0 A;  4J0U A;  4GMJ A;  3ZEF A;  4DX7 D;  3APD A;  4MS6 A;  4N3A A;  3B13 A;  4KZC A;  5LX8 A;  3B7T A;  5CBT A;  3LY9 A;  4LQW A;  4N1O A;  4OVV A;  1W8M A;  1Z3Y A;  4DGA A;  3ESL A;  5AEN A;  1MJ0 A;  4K5C A;  1SA5 A;  3CHR A;  4CGW A;  4V3I A;  3UIN C;  3R56 A;  4UWG A;  1XNF A;  3G2S A;  1MX6 A;  2E2E A;  3FUJ A;  2POY A;  1N54 A;  4J5C X;  4KVM A;  2LNI A;  3N71 A;  1IHG A;  1H6K A;  4N5C A;  4WWP A;  2IGW A;  2FI7 A;  3JB9 d;  3FUF A;  4JJM A;  2XZT G;  5FZR A;  1MX4 A;  2XEN A;  4HNA D;  2YHC A;  5KJL A;  1BPO A;  3VTY A;  2GGF A;  3HXF A;  4AP2 A;  2J09 A;  1YCS B;  2ETC A;  4APO A;  1S0P A;  5CER B;  4J8D A;  2ILR A;  3K2C A;  2DCP A;  3RCK X;  4PS8 A;  5JA4 D;  4HS2 A;  4U96 D;  5KV6 A;  4HOR A;  3C3R A;  3AU4 A;  2XEH A;  3K0R A;  3HXE A;  4I9Y A;  1JUQ A;  3CVL A;  5ENQ D;  3AS5 A;  4U7E B;  4MRU A;  4HFG A;  5KJK A;  4EPZ A;  2X7K A;  2P9K G;  4Q69 A;  2GW1 A;  4F6R D;  3MZL B;  4U04 A;  2WXL A;  4DX2 A;  3B7R L;  4UQZ A;  4FRU A;  3ZUV B;  1M9C A;  3ASF A;  4BX9 A;  3Q5M A;  1VDN A;  5CYH A;  4H7X A;  4AV7 A;  1AWT A;  1QZ2 A;  1WG0 A;  4ABN A;  2VTB B;  5AAR A;  1N94 A;  1H19 A;  5JHA A;  1O1R A;  4DUI A;  4ANX A;  4GA0 A;  5CEC B;  3O48 A;  2CHX A;  4BSX A;  1BI8 B;  4LG6 A;  4N3C A;  1TN7 A;  2BED A;  3IHV A;  5AQ7 A;  2BKK B;  1TR4 A;  2PM6 A;  1OCC E;  4O1P A;  3C3Q A;  1IQU A;  3CK7 A;  3ULY A;  2X3M A;  2LAH A;  1MIK A;  4JHK A;  3FEX A;  3B95 A;  3QNK A;  1G3N B;  3EU9 A;  3J5P A;  3TG4 A;  2ZU6 B;  4GYW A;  3FUI A;  2VYI A;  2ESL A;  4JXT A;  2DWZ A;  3ASN E;  3X2Q E;  3IV0 A;  2V4H C;  5EX0 A;  1Z3X A;  5FIN A;  4IRU A;  3VA7 A;  1A33 A;  5KJN A;  3TG5 A;  4NIK A;  4FLH A;  4R7L A;  2PZI A;  2IGV A;  3B7B A;  2UY1 A;  3L08 A;  4BER A;  4L9P A;  2Y4U A;  2NSZ A;  4BT9 A;  1XO7 A;  1JWG A;  3R49 A;  4K03 A;  3W9F A;  1OCZ E;  3HIZ A;  5M72 A;  4G24 A;  4N1M A;  3QYU A;  3BT8 A;  3ULQ A;  2HQ6 A;  3CKB A;  3ZYL A;  3QWW A;  3ZFW A;  4EEC A;  4Q96 A;  2A2N A;  3FH7 A;  2RKK A;  1HH8 A;  4GB9 A;  4WNG A;  2HM8 A;  2WXQ A;  2J08 A;  4BTA A;  1XWN A;  5CCQ A;  3PEV B;  4Y6W A;  3FEY A;  3D9P A;  3B7S A;  3ABK E;  4RQI A;  5AJL A;  4BET A;  4I1A A;  4ZHB A;  5T3R A;  1TEZ A;  4H7Y A;  2X6K A;  1PC2 A;  2R59 A;  3U4T A;  2XRZ A;  2P9I G;  3ZW3 A;  4GMR A;  2IF4 A;  4A3T A;  4I2W A;  5A0E A;  3UM0 A;  3HRA A;  3TAX A;  2V5Q C;  3TWU A;  5CMW A;  4UI9 C;  3S7F A;  5E76 A;  3FTY A;  3CVU A;  1IXV A;  4BY6 A;  1DNP A;  1HU3 A;  2WFI A;  2KBX A;  3RAU A;  1M9D A;  3AU5 A;  1U2V G;  1W74 A;  3CK9 A;  4HRN A;  3JQ0 A;  3IBE A;  3QDN A;  2KC7 A;  2OCC E;  2J8S D;  3SFY A;  4YUP A;  5FIO A;  5A6C A;  5CCS X;  4HXI A;  1BU9 A;  5EIB E;  1VBS A;  3TXN A;  1LD8 A;  1LF8 A;  4DPR A;  2VQ2 A;  4B8A A;  1UJJ A;  3K0O A;  3I3N A;  1N4Q A;  2B0O E;  2RMC A;  4G8K A;  1D8E A;  4UWF A;  3EUV A;  3RRN B;  2OVF A;  4ACK A;  2YIN A;  4LER A;  2OND A;  3FU0 A;  3K0M A;  1JCR A;  3UKU G;  4UQY A;  3R9A B;  3ZN3 A;  5H7P A;  4L2L A;  4R3F A;  2PL2 A;  2P9N G;  1E7U A;  3RCL A;  2X2D B;  5KNG A;  3CHM A;  2WPV A;  3OAW A;  1ZKC A;  1O5M A;  3E33 A;  1LD7 A;  1MZC A;  4WWN A;  5KV3 A;  4YUI A;  3HXC A;  3CVQ A;  5EN5 D;  3LVR E;  4LCT A;  1RZ4 A;  1KT1 A;  2WXM A;  4JW1 A;  2UY1 B;  2XHE A;  1MX2 A;  4XKC A;  2XZD G;  3Q73 A;  4HB5 A;  4Q94 A;  4HRL A;  3ORE A;  5J90 A;  4ZSD A;  2XEE A;  3DSS A;  1IQR A;  2WXO A;  4TV3 A;  2LXM A;  3LCA A;  3LXU X;  3DEO A;  1HF8 A;  1JCQ A;  2CMT A;  3RIB A;  1NFI E;  1XGW A;  3AS4 A;  2QFC A;  2JLB A;  2DVW A;  4U07 A;  1YND A;  2VSY A;  4DI4 A;  5EYP F;  2R17 C;  3C98 A;  5AYW D;  4L23 A;  3CYH A;  4DX6 D;  4CCA A;  1S64 A;  3FFL A;  4JB8 P;  2P0O A;  4Y6C A;  5CCN A;  3HG0 D;  2BKG A;  4LNU D;  2QC9 A;  1NA0 A;  5AAO A;  1TNY A;  3AAA C;  2WFJ A;  3MYV A;  3T5V A;  4J5D X;  4KT6 B;  2AW6 A;  4GTS A;  2H6F A;  3S7D A;  5KUU A;  2Y4T A;  1EPU A;  3RDB A;  2MVZ A;  2KZT A;  4FU3 A;  4HLL A;  4E1Q A;  4A1S A;  3FH5 A;  2IY0 C;  4FHJ A;  4I6G A;  4FAD A;  3VLE A;  4KBQ A;  4ANW A;  3CQC B;  3Q49 B;  3U64 A;  3ZRH A;  4BX8 A;  1OXJ A;  3RU0 A;  4YUG A;  2V0P A;  3PUK A;  3FU6 A;  5FQ6 A;  1CWA A;  1H6P A;  4EQF A;  2NNZ A;  3UM3 A;  1MQS A;  1H2U A;  2FBN A;  4FJZ A;  3WG7 E;  2GRR B;  2A4Z A;  4MKT A;  1OCR E;  1FT2 A;  3CIA A;  3MJW A;  4YUN A;  3HYM B;  5ENN A;  3UPV A;  3ASH A;  1M9E A;  4DRX E;  1UN8 A;  3O7T A;  3FU3 A;  3KOP A;  3RCG A;  3ODI A;  4JEH A;  5AN8 A;  4BES A;  3MKR A;  1NP7 A;  4G2V A;  4LEU A;  2X38 A;  3NF1 A;  2RMB A;  1IHB A;  5FZQ A;  4DI3 A;  5D2M C;  3LJ3 A;  3UKR G;  1Z81 A;  1AP7 A;  4CRW A;  2HR2 A;  4FHK A;  3TL5 A;  2NYJ A;  4B93 B;  4I1O B;  1CWI A;  3ZXP A;  4LRZ A;  5G04 J;  4ATG A;  3TWS A;  4DX5 D;  2X2C K;  5KV1 A;  2KAT A;  2ION A;  1KZP A;  1TNU A;  1FVF A;  4G26 A;  3SQV A;  2LAI A;  3QAR A;  4J5A X;  4TXQ A;  1N11 A;  4E6H A;  1CYN A;  4N39 A;  4URK A;  5AQA A;  5KUN A;  4RG6 A;  2P2C P;  3ISM C;  1X5B A;  3ML9 A;  5B3S E;  5KJM A;  4YUH A;  3UTM A;  4GA2 A;  4GYO A;  1VBT A;  5BT1 A;  1JCS A;  3DEP A;  3UIO C;  2Z6W A;  5FQ8 A;  2RMA A;  2A5U A;  5C1D A;  1QNG A;  3Q7A A;  4N1Q A;  1HG2 A;  3E37 A;  4P29 A;  4HVB A;  3ULE G;  3I4R B;  3WXX A;  3RCF A;  1HE8 A;  4WNE A;  1K8K G;  5E75 A;  1TN8 A;  3FP3 A;  4JHJ A;  2RS4 A;  4F7A A;  3RO2 A;  3V79 K;  2XRY A;  4EZL A;  2DZN A;  4GZD A;  3CHQ A;  5JJT A;  4Z68 A;  4KYO B;  2HO1 A;  4N2Q A;  1H6O A;  1SVX A;  3ZGQ A;  2ZGD A;  4DX1 A;  4B94 A;  3FHE A;  4BFR A;  5JHE A;  5AQB A;  3KEA A;  3W9G A;  2OOE A;  5KUQ A;  1ZX8 A;  2BF0 X;  5HQ8 A;  3D3M A;  5BNW A;  3NAW A;  1ELK A;  5CED B;  1CWO A;  1SQM A;  5CCM A;  3IEG A;  4UQX A;  3NQP A;  2LUH A;  2B6C A;  5B1B E;  4CZ2 D;  3GW4 A;  2CK1 A;  2PQR A;  5AJD A;  3CVX A;  2VGX A;  2VGY A;  3NBN B;  5KUW A;  3HVE A;  2DYS E;  4YUM A;  2H6G A;  2IQC A;  2UWJ G;  2LO6 A;  5FQ4 A;  1N52 A;  5KUR A;  2X6J A;  1N95 A;  2R03 A;  4I6J A;  5J08 A;  4EBA G;  4L1B A;  3UT7 A;  4FUL A;  4J8F A;  2IEJ A;  2WXH A;  3S7J A;  2RFM A;  4K5A B;  4WND A;  3PE4 A;  3SY2 A;  3RRU A;  5KV0 A;  1IST A;  1L5J A;  3RJV A;  1M9F A;  4I17 A;  3FU5 A;  3CGH A;  3Q79 A;  3CK8 A;  4I9E A;  1E8W A;  5KNH D;  4QQI A;  4CT4 A;  2GRM A;  2CHW A;  4PS7 A;  3TJP A;  3CEQ A;  3KS2 A;  4GTR A;  2FEZ A;  2XQ0 A;  2MZU A;  1EYH A;  3V30 A;  3AJI A;  2P58 C;  4K0R A;  4RG9 A;  4LNG A;  4RLY A;  4TOT A;  1HS6 A;  3T1U A;  5CRU A;  3MV3 B;  4TXP A;  1KZO A;  4OYS A;  1AWQ A;  1OT8 A;  2CPL A;  2X2A A;  2F8X K;  1H0P A;  3Q15 A;  2POE A;  4CGV A;  4XNC A;  3P2B A;  4HI9 A;  2ZIR A;  3D9J A;  4A1G A;  4TRQ A;  3DRA A;  4N1N A;  3T9K A;  3T5X A;  3URZ A;  2LXL A;  4U0S A;  3AG4 E;  4YUK A;  1O1S A;  2CFU A;  3PUJ A;  3CQG B;  1A58 A;  2R5S A;  4I6E A;  3AG2 E;  2EIN E;  4PUC A;  3CKC A;  4F53 A;  1PAQ A;  1PY1 A;  4GAA A;  5LP0 A;  4M3O A;  2PLU A;  2L6B A;  3ONL A;  2WLW A;  5ARG A;  1IIP A;  2L9B A;  4ATZ D;  5IY5 E;  2X25 B;  5FT9 A;  5LOZ A;  3G2V A;  3ZHE A;  4U8V D;  1FVH A;  3APF A;  4JVS A;  3TWW A;  3R9M A;  2L0T B;  1BCK A;  1E8X A;  4NRH B;  3KD7 A;  1CWJ A;  5CBV A;  3B7U X;  4GZ6 A;  2Y3A A;  5KV5 A;  1NI1 A;  2F0Y A;  3MEK A;  2ZXW E;  1DCQ A;  3NB2 A;  3Q4A B;  2N0T A;  3VLF A;  3DSW A;  2K7N A;  2BIU X;  5KCM A;  2WXR A;  3OXL A;  4FP7 A;  1BD8 A;  3IKO B;  1HFA A;  3TWX A;  4XE0 A;  2XPZ A;  3FUM A;  3K0N A;  1ZKF A;  2OEV A;  4CDN A;  1K3Z D;  2C0M A;  3QOU A;  2H6H A;  3SFZ A;  1TNZ A;  2GRL A;  3L17 A;  2F37 A;  3JXJ A;  1ZBP A;  3CST A;  1RMH A;  4NAC A;  3L6A A;  4FRV A;  4J8Y A;  3BUA A;  1Q2Z A;  5ARF A;  4YND A;  3DXM G;  4BT8 A;  4UWK A;  3Q9N C;  2J9Q A;  1E8Y A;  5KUV A;  2AXU A;  3FTS A;  5B1A E;  4ILI A;  2XEV A;  2OEW A;  3L9T A;  4I43 A;  3FTU A;  4A55 A;  3PE3 A;  1TNB A;  3JYS A;  4AY5 A;  2QER A;  2Y1L E;  4B0Z A;  2CYH A;  1AK4 A;  4N1S A;  3PNT B;  4J8E A;  4HLE A;  3V2X A;  3O4Z A;  4HOQ A;  3CYS A;  3BO7 A;  4C48 B;  4JA7 A;  5BPP A;  4U63 A;  4GZC A;  5CMY A;  4GZ5 A;  4ILG A;  4K5B A;  4FLB A;  1IKN D;  4X8Q A;  5LCW C;  2IOS A;  3UCH A;  2C3B A;  2WXG A;  4GCO A;  2WB2 A;  4BEP A;  2HAQ A;  1OWO A;  2BTD A;  3MGB A;  4O8I A;  4G25 A;  4PDX A;  4APF A;  3RDA X;  4RSY A;  2BIT X;  4UI9 J;  4N1R A;  4XI9 A;  4CDR A;  2XGO A;  3HXD A;  4GTQ A;  4IN3 B;  2GRP B;  3CSF A;  4U0Z A;  5KUS A;  3PNL B;  1UOH A;  2QZA A;  3Q7F A;  1V54 E;  5D66 A;  3SHF A;  3LY8 A;  2KM4 A;  2M63 A;  2RFA A;  4G23 A;  2MRI A;  3CR3 A;  4YUL A;  2X6I A;  1N0R A;  4I9C A;  2OK3 A;  2RG8 A;  2XS8 A;  2ZIS A;  2WXN A;  2WM9 A;  3L54 A;  4O60 A;  1Z5S C;  3FH8 A;  3QC1 A;  5FZS A;  3PEU B;  1UW4 B;  4W9R A;  5DIZ A;  2IO3 C;  3QWV A;  3IHY A;  3NZS A;  1Z6T A;  1E96 B;  3L13 A;  2EIK E;  4EZK A;  5FTP A;  3JUE A;  3ZKJ A;  4RVB A;  4IYP A;  2YHE A;  1M9Y A;  1CWB A;  3RDC A;  3X27 A;  4YDY A;  1WDY A;  4F3V A;  5ENR D;  3ENE A;  3KAE A;  5EID A;  2AXV A;  4JZY A;  4N3B A;  4FC8 A;  2I1K A;  4AVX A;  1OWM A;  3PRZ A;  1E8Z A;  5G05 C;  5EKQ D;  5KV7 A;  4JA9 A;  1E90 A;  3PS6 A;  4O1O A;  5FWQ A;  2HE9 A;  4G1T A;  5HRY A;  3BKP A;  2OVB A;  3SO8 A;  2Y69 E;  3D9H A;  4UI9 K;  4WAF A;  2KCL A;  5JHB A;  1UN9 A;  3RDD A;  2WQ6 A;  3CHS A;  3GZ2 A;  4DGD A;  1CWK A;  3DBS A;  2CG2 A;  2FU0 A;  3LDZ A;  3TWV A;  4GTM A;  4ANV A;  2CFZ A;  3MML A;  4I2Z A;  5G55 A;  2GRO B;  1H2T C;  3QWP A;  4J59 A;  4JEU A;  1AWS A;  3FUL A;  5F66 A;  2FUL A;  3MKQ A;  3EHN A;  3PZ2 A;  4UWH A;  3EOV A;  4GTO A;  2V4L A;  4EBA A;  3SNX A;  4HOS A;  3MA5 A;  2DIW A;  4U0U A;  5A23 A;  3S2A A;  4DLO A;  5CBN A;  5T4Y A;  1FGL A;  4BTB A;  4CYM D;  4DGE A;  2MYO A;  1H2V C;  3OTN A;  1E8K A;  4R3E A;  1ZMF A;  3UMV A;  2YQ8 A;  3CLJ A;  3CVN A;  1N4S A;  3TWT A;  3QAQ A;  2ETB A;  4KZ0 A;  2C2L A;  4AJW A;  3I5P A;  5JMN D;  3CVY A;  4CT0 A;  2MS4 A;  2VGE A;  4EYV A;  3ZVV A;  3FUK A;  3LKU A;  1AWR A;  4FA6 A;  4GPM A;  5KV4 A;  3FUD A;  3E30 A;  1UJK A;  3FUE A;  3R57 A;  4EHM A;  4YVO A;  3KSL A;  3UT4 A;  1N4R A;  1QQE A;  3G2T A;  1SA4 A;  2VSO E;  4S1J A;  5KWD A;  5CBO A;  4YDE A;  5DBK A;  2BUG A;  1QBQ A;  4XIF A;  4ZFH A;  3NZU A;  4GYY A;  3C5R A;  1YA0 A;  2L6J A;  2EIL E;  3E32 A;  3FDH A;  3PRE A;  3ZPJ A;  2C0L A;  4TXR A;  1OUV A;  3MCX A;  2VTB A;  4ACL A;  2ALF A;  1Y8M A;  2PNN A;  3EIQ C;  2WMN A;  3CVP A;  4EZJ A;  3BG0 B;  2V5F A;  4AM9 A;  4E85 A;  4MBG A;  2VSN A;  3D9I A;  2MC9 A;  4A63 B;  2V8S E;  4TUM A;  2J4B A;  4HOT A;  2IOL A;  3JCK C;  1KLX A;  3RD9 X;  2KZT B;  2PM7 A;  3SGH A;  3C3O A;  3MML B;  3RFY A;  2IJG X;  3NOG D;  3SBS A;  1E7V A;  3ASO E;  2FO1 E;  3MKQ B;  3UIP C;  4XX5 A;  1S63 A;  3FUN A;  2NXP A;  4AXH A;  3D9N A;  4IPZ A;  4HI8 A;  2MHK A;  5HI7 A;  3R4G A;  1NA3 A;  5KUO A;  3ML8 A;  3QJZ A;  1ZU2 A;  1OCA A;  4JC8 A;  3GZ1 A;  3EHR A;  3FWV A;  3MV2 B;  1DC2 A;  1B89 A;  2LSU A;  3FY4 A;  1V9T A;  5CBU A;  2EQX A;  1N9A A;  5CCR A;  1SZA A;  3PH0 C;  3FTW A;  2JEK A;  3TWQ A;  1ELR A;  5EIL A;  3VLD A;  2KA0 A;  1TJF A;  2NUL A;  4JL0 A;  4XI0 A;  1TJC A;  3KEZ A;  1WY6 A;  1W8L A;  3UT8 A;  4C9B B;  5HS0 A;  5KUL A;  3ZYK A;  5JJ7 A;  4BSZ B;  3R7R A;  3CVW A;  2GRN B;  2IFU A;  4ANU A;  3ICI A;  1GW6 A;  3FUH A;  4GCN A;  5G2N A;  1MYO A;  3MX3 A;  4GA1 A;  2I2O A;  4JPS A;  3TXM A;  4A3V A;  2F8Y A;  3GYZ A;  2WMO A;  3DSX A;  1CWH A;  1XYH A;  2FO7 A;  3OPF A;  2XS1 A;  3Q9U C;  4YUJ A;  1FT1 A;  5KBA A;  2FF4 A;  2KCK A;  3LY7 A;  3G2U A;  2J07 A;  3EHQ A;  3AS8 A;  3LPZ A;  5FJY A;  4QFV A;  1ELW A;  4GU5 A;  3PDN A;  3QKY A;  2LSV A;  1P5Q A;  3U9W A;  3G2W A;  4FJY A;  3SF4 A;  3U3W A;  3CHP A;  1HXI A;  2KXP C;  1TYQ G;  3KSQ A;  5C2Y A;  3T8M A;  3Q75 A;  1K1B A;  3NOC D;  2XGY B;  4L7T A;  2B71 A;  2ZGG A;  1AWV A;  2YNQ A;  5BW8 C;  4DJA A;  2OSE A;  3RKV A;  2ETA A;  3J5Q B;  3PZD A;  3S6M A;  4U8Y D;  3T8K A;  4NQ0 A;  5AIJ A;  3DSV A;  4YVQ C;  1TNO A;  5ENO D;  4ME2 A;  4N1P A;  4TUU A;  3EHM A;  5BXO A;  3DXK G;  1D9S A;  3EDT B;  3AG1 E;  4YDW A;  3EJN A;  4ZSC A;  1H0A A;  4L2Y A;  3ABL E;  1CWL A;  4XKB A;  1CLH A;  3HXB A;  1MZW A;  1CWF A;  2P9U G;  3R7Q A;  2QY7 A;  3UM1 A;  4J5B A;  1AWU A;  3UXG A;  2R2L A;  1M9X A;  3DWL G;  2AWI A;  3EU5 A;  1CWC A;  4IUL A;  2WXI A;  3R54 A;  5EDS A;  2A5E A;  4CEM A;  5ENS D;  5BXU A;  2J4D A;  3ESK A;  2WXP A;  5D0Q D;  4KVO A;  3AG3 E;  4UWL A;  4YUO A;  3ODL A;  3ZYM A; 
#chains in the Genus database with same CATH homology
 2OK3 A;  4LEU A;  4J8D A;  2ILR A;  2X38 A;  3NF1 A;  2RG8 A;  4DLQ A;  2WXN A;  3L16 A;  2VGX B;  2WM9 A;  3K2C A;  2RMB A;  2DCP A;  2WXJ A;  5FZQ A;  4C0M A;  4DI3 A;  3L54 A;  3LJ3 A;  3LEW A;  1HX8 A;  3HVE B;  1Z81 A;  3RCI X;  3RCK X;  1OWN A;  4CRW A;  4PS8 A;  4HS2 A;  2HR2 A;  3FH8 A;  3QC1 A;  4FHK A;  3TL5 A;  5FZS A;  1XQ7 A;  1Y6I A;  5KV6 A;  3PEU B;  1UW4 B;  4HOR A;  4W9R A;  4I1O B;  1M63 C;  5DIZ A;  1CWI A;  3AU4 A;  3QWV A;  3IHY A;  3NZS A;  1Z6T A;  4LRZ A;  5G04 J;  4ATG A;  1E96 B;  3L13 A;  4J8S A;  3K0R A;  3D9L A;  4I9Y A;  1JUQ A;  3CVL A;  1DVP A;  1LOP A;  4EZK A;  2WXK A;  2AVP A;  3AS5 A;  3D9M A;  5FTP A;  4MRU A;  3ASD A;  4HFG A;  5KJK A;  4EPZ A;  2X2C K;  4RVB A;  4IYP A;  1INZ A;  2YHE A;  2X7K A;  5KV1 A;  1FCH A;  1SZ9 A;  1M9Y A;  4Q69 A;  1CWB A;  5CHE E;  2KAT A;  5EX3 A;  3RDC A;  2ION A;  2GW1 A;  3MZL B;  4F3V A;  1FVF A;  2HQJ A;  4U04 A;  3ENE A;  3KAE A;  2WXL A;  2AXV A;  4G26 A;  4JZY A;  4N3B A;  3B7R L;  4UQZ A;  4FRU A;  4DGA A;  1M9C A;  4FC8 A;  3ASF A;  2I1K A;  4LUN U;  2LAI A;  4BX9 A;  3Q5M A;  1OWM A;  3QAR A;  4AVX A;  3PRZ A;  4J5A X;  1VDN A;  5CYH A;  4H7X A;  4AV7 A;  4E6H A;  1AWT A;  5BV1 A;  1CYN A;  3S7B A;  1QZ2 A;  1E8Z A;  5G05 C;  2WQ7 A;  4CDM A;  4N39 A;  3ASG A;  5EKQ D;  4URK A;  5KUN A;  5KV7 A;  4RG6 A;  4AEZ C;  4JA9 A;  5A7D B;  1MF8 C;  1E90 A;  3PS6 A;  1X5B A;  3ML9 A;  2R99 A;  4I1M A;  1IYG A;  5FWQ A;  2HE9 A;  5KJM A;  4G1T A;  4AIF A;  3BKP A;  2OVB A;  4YUH A;  4ABN A;  4GA2 A;  4GYO A;  1VBT A;  1E3B A;  2VSX E;  2VTB B;  4NUR A;  4PS3 A;  5BT1 A;  4UI9 K;  4WAF A;  3K0Q A;  2KCL A;  2Z6W A;  5FQ8 A;  5CCL A;  1H19 A;  5JHB A;  2RMA A;  2A5U A;  1UN9 A;  5JHA A;  3RRM B;  3RDD A;  5C1D A;  2WQ6 A;  1QNG A;  3CHS A;  4N1Q A;  3GZ2 A;  4DGD A;  1CWK A;  4ANX A;  1HG2 A;  3DBS A;  4GA0 A;  4P29 A;  4HVB A;  2CG2 A;  3L22 A;  3LDZ A;  2FU0 A;  4ANV A;  3I4R B;  3O48 A;  2CHX A;  4BSX A;  2CFZ A;  3WXX A;  4PH4 B;  4N3C A;  3RCF A;  3MML A;  1WM5 A;  4AOF A;  4I2Z A;  5G55 A;  1NZN A;  1H2T C;  1HE8 A;  3QWP A;  4J59 A;  3IHV A;  4WNE A;  4N2S A;  4JEU A;  4MLP A;  2PM6 A;  1AWS A;  3FUL A;  5F66 A;  2FUL A;  2VJ8 A;  5E75 A;  4I9C A;  3FP3 A;  1IQU A;  3MKQ A;  3CK7 A;  4C0E A;  2I6H A;  4JHJ A;  3EHN A;  3SBT B;  4GZ3 A;  2X3M A;  4UWH A;  3EOV A;  2RS4 A;  2LAH A;  4F7A A;  1MIK A;  3RO2 A;  2XRY A;  4JHK A;  4EZL A;  3FEX A;  2X6F A;  1VAI A;  2GW2 A;  4GZD A;  3CHQ A;  2V4L A;  5JJT A;  3K9I A;  3QNK A;  4EBA A;  3TG4 A;  1QOI A;  3SNX A;  4KXK B;  4KYO B;  4HOS A;  2ZU6 B;  2HO1 A;  3MA5 A;  4G11 A;  4GML A;  4N2Q A;  3LS8 A;  4GYW A;  2DIW A;  1W8V A;  1HG5 A;  3FUI A;  4U0U A;  5A23 A;  3ZGQ A;  2VYI A;  2ESL A;  3S2A A;  4XZ4 A;  4JXT A;  2WVI A;  4B94 A;  2X6H A;  3APC A;  2X83 B;  4DLO A;  3FHE A;  2PQN A;  3IV0 A;  4BFR A;  5LFA A;  5JHE A;  5EX0 A;  3ZXS A;  1Z3X A;  3ZIM A;  2OOE A;  4IRU A;  5KUQ A;  3VA7 A;  2I9C A;  1C5F A;  2BF0 X;  5T4Y A;  1EF1 C;  3TG5 A;  5KJN A;  1A33 A;  1FGL A;  4WUY A;  5HQ8 A;  3D3M A;  5BNW A;  2IU1 A;  4FLH A;  4R7L A;  2PZI A;  1ELK A;  2IGV A;  4BTB A;  1CWO A;  4DGE A;  2UY1 A;  3RO3 A;  1SQM A;  5CCM A;  5LCW J;  1H2V C;  3OTN A;  2CG3 A;  3L08 A;  1E8K A;  4R3E A;  1X7F A;  1ZMF A;  2Y4U A;  3IEG A;  2YQ8 A;  4UQX A;  3UMV A;  2NSZ A;  3CLJ A;  3ZHE B;  3NQP A;  3CVN A;  4BT9 A;  2CFE A;  1XO7 A;  1JWG A;  3R49 A;  3GW4 A;  3QAQ A;  2CK1 A;  4K03 A;  2PQR A;  5AJD A;  4KZ0 A;  3CVX A;  5FQ7 A;  3HIZ A;  2C2L A;  5M72 A;  2VGX A;  4G24 A;  4N1M A;  3QYU A;  4AJW A;  3BT8 A;  2VGY A;  3I5P A;  2HYZ A;  3ULQ A;  2HQ6 A;  3CKB A;  3D9O A;  3QWW A;  3ZFW A;  3ZYL A;  4EEC A;  3CVY A;  5KUW A;  4CT0 A;  3HVE A;  2RD0 A;  3HDX A;  2MS4 A;  4Q96 A;  3OEP A;  4YUM A;  2A2N A;  2IQC A;  2UWJ G;  3FH7 A;  3FTZ A;  5ANR A;  2LO6 A;  5FQ4 A;  4EYV A;  1HH8 A;  2XCC A;  1N52 A;  2CHZ A;  4GB9 A;  4WNG A;  3ZVV A;  2X6J A;  1JPL A;  5KUR A;  1NMK A;  5BV0 A;  3CHO A;  2HM8 A;  2J49 A;  3FUK A;  3LKU A;  2WXQ A;  1AWR A;  2J08 A;  4I6J A;  5J08 A;  1J2A A;  4BTA A;  1XWN A;  4EBA G;  4L1B A;  5CCQ A;  3PEV B;  4Y6W A;  4FA6 A;  3FEY A;  3QK0 A;  3D9P A;  1U3D A;  4FUL A;  4J8F A;  2L0I A;  3UT7 A;  4DK5 A;  5KV4 A;  2WXH A;  3B7S A;  3FUD A;  3S7J A;  1UJK A;  3FUE A;  3UUX A;  5JJ6 A;  3R57 A;  4WND A;  4YVO A;  3PE4 A;  5AJL A;  1QNF A;  4I1A A;  3RRU A;  3UT4 A;  1QQE A;  3D9K A;  3G2T A;  5KV0 A;  5T3R A;  3BEE A;  1TEZ A;  2VSO E;  4S1J A;  4H7Y A;  1IST A;  2X6K A;  1L5J A;  2WQH A;  1OWP A;  3OXF A;  3RJV A;  1PC2 A;  1M9F A;  4I17 A;  3FU5 A;  2R59 A;  3U66 A;  2OJU A;  1UG3 A;  3I4G A;  5LUD A;  3U4T A;  3CGH A;  5DBK A;  2XRZ A;  1A17 A;  3BG1 B;  3ZW3 A;  2IF4 A;  2BUG A;  5T8I A;  4A3T A;  4D10 C;  3CK8 A;  4I2W A;  3Q47 B;  4I9E A;  1E8W A;  4XIF A;  4F1S A;  4ILH B;  5A0E A;  4CT4 A;  3NZU A;  4GYY A;  3TAX A;  3ZYQ A;  1YA0 A;  3R59 A;  4J58 A;  5CMW A;  2GRM A;  2L6J A;  4UI9 C;  3CV0 A;  3FDH A;  2CHW A;  3PRE A;  2C0L A;  4PS7 A;  3S7F A;  3RK6 A;  3ZPJ A;  5E76 A;  1MHQ A;  3FTY A;  1OUV A;  3MCX A;  3TJP A;  2VTB A;  4ACL A;  3CVU A;  2ALF A;  3PMP A;  4BY6 A;  1DNP A;  3CEQ A;  3KS2 A;  2FEZ A;  2WXF A;  4DGB A;  2XQ0 A;  2XCB A;  1Y8M A;  1HU3 A;  2MZU A;  3FTX A;  2WFI A;  1EYH A;  3EIQ C;  2WMN A;  2Q7F A;  3CVP A;  4EZJ A;  1M9D A;  3AU5 A;  2P58 C;  1WAO 1;  3BG0 B;  4KMO A;  4WNF A;  3VTX A;  5DUD A;  1JWF A;  1W74 A;  4K0R A;  2V5F A;  4RG9 A;  4AM9 A;  3CK9 A;  4E85 A;  3JQ0 A;  3IBE A;  2VSN A;  3D9I A;  3QDN A;  2MC9 A;  4TOT A;  2KC7 A;  2V8S E;  1HS6 A;  1VDY A;  2J4B A;  4BWR A;  4HOT A;  2IOL A;  3T1U A;  4YUP A;  5A6C A;  3JCK C;  3MV3 B;  4HY7 A;  5CCS X;  1KLX A;  4HXI A;  3RD9 X;  2KZT B;  5KUZ A;  4OYS A;  1AWQ A;  1VBS A;  3TXN A;  2CPL A;  2PM7 A;  3LVQ E;  3SGH A;  1LF8 A;  2X2A A;  4DPR A;  2VQ2 A;  4B8A A;  1H0P A;  3MML B;  3Q15 A;  2POE A;  4CGV A;  1UJJ A;  4XNC A;  3K0O A;  3I3N A;  3P2B A;  1W3B A;  4A1G A;  3D9J A;  3GZS A;  4TRQ A;  5G05 J;  3TGO A;  2RMC A;  3RFY A;  3FTV A;  2IJG X;  4N1N A;  3SBS A;  4S1E A;  3HHM A;  2E0I A;  3RRN B;  4UWF A;  3T5X A;  3URZ A;  2OVF A;  1E7V A;  1DYW A;  3CVV A;  4U0S A;  3MKQ B;  4ACK A;  2YIN A;  2DBA A;  3E4B A;  3SD5 A;  4YUK A;  4XX5 A;  4LER A;  4OVU A;  2OND A;  3FU0 A;  3FUN A;  2CFU A;  3K0M A;  2NXP A;  3PUJ A;  3CQG B;  4AXH A;  3D9N A;  2I1J A;  1A58 A;  4IPZ A;  2PHC B;  2MHK A;  4U8H A;  2R5S A;  4I6E A;  2XPI A;  4UQY A;  5HI7 A;  3R9A B;  3UQ3 A;  3ZN3 A;  4B89 A;  1NA3 A;  3R4G A;  4PUC A;  1U3C A;  4AY6 A;  3ML8 A;  3CKC A;  3QJZ A;  1QNH A;  5KUO A;  4L2L A;  4R3F A;  1ZU2 A;  2PL2 A;  4JC8 A;  1E7U A;  5G04 C;  4F53 A;  1OCA A;  4O8H A;  3GZ1 A;  3FWV A;  1PAQ A;  3MV2 B;  3ONK A;  3QB2 A;  2X2D B;  1B89 A;  2WPV A;  3CHM A;  3RCL A;  3OAW A;  1PY1 A;  4GAA A;  5LP0 A;  4M3O A;  1ZKC A;  2PLU A;  2LSU A;  3FY4 A;  1V9T A;  5CBU A;  3ONL A;  2WLW A;  1OWL A;  4J6I A;  5ARG A;  4CYH A;  4WWN A;  2EQX A;  1IIP A;  4YUI A;  3EIJ A;  2L9B A;  3CVQ A;  5CCR A;  5KV3 A;  1SZA A;  3PH0 C;  4B8C B;  3FTW A;  2X25 B;  3SZ7 A;  3LVR E;  5FT9 A;  4LCT A;  2JEK A;  5LOZ A;  1ELR A;  1EDU A;  3G2V A;  1KT1 A;  3ZHE A;  1FVH A;  2WXM A;  3APF A;  4JVS A;  4GPK A;  3JQ1 A;  3VLD A;  1TJF A;  2NUL A;  2L0T B;  1BCK A;  3PVL A;  4JW1 A;  2ZP2 A;  4JL0 A;  2UY1 B;  2XHE A;  1E8X A;  4NRH B;  3KD7 A;  1CWJ A;  5CBV A;  4XKC A;  4JHR A;  4O6F A;  3B7U X;  4GZ6 A;  2Y3A A;  4XI0 A;  5KV5 A;  1TJC A;  3KEZ A;  5D0O D;  1WY6 A;  4Q94 A;  1W8L A;  3UT8 A;  4C9B B;  3MEK A;  3ORE A;  4JCP A;  5J90 A;  4ZSD A;  3Q4A B;  5KUL A;  3ZYK A;  2N0T A;  1IQR A;  2WXO A;  3VLF A;  3DPD A;  4TV3 A;  5JJ7 A;  2K7N A;  2BIU X;  5KCM A;  2WXR A;  3OXL A;  3LCA A;  3LXU X;  4FP7 A;  3R7R A;  3CVW A;  3IKO B;  1CWM A;  2IFU A;  5BUZ A;  1HFA A;  3ICH A;  4XE0 A;  4ANU A;  1GW6 A;  1HF8 A;  2XPZ A;  3FUH A;  4GCN A;  3ICI A;  5G2N A;  3FUM A;  2CMT A;  3MX3 A;  4GA1 A;  3K0P A;  2I2O A;  3RIB A;  3P1U A;  3K0N A;  4JPS A;  1ZKF A;  3TXM A;  1XGW A;  5CBW A;  4CDN A;  3LYA A;  3AS4 A;  2C0M A;  2QFC A;  2JLB A;  4A3V A;  2AXZ A;  4WWO A;  3QOU A;  3SFZ A;  2GRL A;  3OXG A;  4U07 A;  3L17 A;  5ANL A;  3GYZ A;  1YND A;  2WMO A;  2VSY A;  4DI4 A;  1ZBP A;  3CST A;  1RMH A;  4NAC A;  4J5E X;  3L6A A;  1CWH A;  1XYH A;  2XGS A;  4FRV A;  2R17 C;  2FO7 A;  3C98 A;  5AYW D;  3UX4 A;  4L23 A;  1HZ4 A;  3SI5 A;  3OPF A;  5ARF A;  3CYH A;  4YND A;  1HO8 A;  2MOW A;  4HOU A;  4CCA A;  3FFL A;  4YUJ A;  2KCV A;  2FF4 A;  2KCK A;  4BT8 A;  2P0O A;  3LY7 A;  4Y6C A;  3G2U A;  2J07 A;  4UWK A;  3AS8 A;  2OV8 A;  3LPZ A;  4QFV A;  5FJY A;  2J9Q A;  5CCN A;  1E8Y A;  1ELW A;  3JUI A;  2AXU A;  3PDN A;  3QKY A;  2LSV A;  4GU5 A;  5KUV A;  1P5Q A;  3U9W A;  3G2W A;  3FTS A;  2XGM A;  4FJY A;  5KV2 A;  4ILI A;  2XEV A;  2XPY A;  3SF4 A;  2NC9 A;  4I43 A;  4DGC A;  1KT0 A;  3FTU A;  4A55 A;  3U3W A;  3PE3 A;  1NA0 A;  4J0U A;  3JYS A;  4AY5 A;  3CHP A;  2QER A;  1HXI A;  4GMJ A;  2WFJ A;  4B0Z A;  5C2Y A;  3MYV A;  3T8M A;  1AK4 A;  2CYH A;  3T5V A;  3PNT B;  4N1S A;  4J8E A;  3ZEF A;  2XGY B;  4J5D X;  4L7T A;  4KT6 B;  2B71 A;  1AWV A;  2YNQ A;  5BW8 C;  3APD A;  4MS6 A;  2AW6 A;  4DJA A;  2OSE A;  3RKV A;  4N3A A;  3PZD A;  4HLE A;  3B13 A;  3S6M A;  3O4Z A;  4KZC A;  4NQ0 A;  4HOQ A;  3S7D A;  5LX8 A;  3B7T A;  5KUU A;  2Y4T A;  5AIJ A;  3CYS A;  5CBT A;  3LY9 A;  4LQW A;  3BO7 A;  4YVQ C;  4JA7 A;  1EPU A;  4OVV A;  5BPP A;  4N1O A;  3RDB A;  2MVZ A;  2KZT A;  4U63 A;  1W8M A;  4FU3 A;  1Z3Y A;  4GZC A;  4ME2 A;  4TUU A;  5CMY A;  4N1P A;  3ESL A;  5AEN A;  4GZ5 A;  4ILG A;  3FH5 A;  4A1S A;  4I6G A;  4FLB A;  3EHM A;  4FHJ A;  5LCW C;  4FAD A;  3CHR A;  4CGW A;  2IOS A;  3VLE A;  3UCH A;  2C3B A;  2WXG A;  4V3I A;  4GCO A;  4KBQ A;  4ANW A;  3CQC B;  3Q49 B;  2WB2 A;  3EDT B;  3R56 A;  3U64 A;  3ZRH A;  4E1Q A;  4UWG A;  4BX8 A;  3RU0 A;  2HAQ A;  3EJN A;  4ZSC A;  1OWO A;  2BTD A;  3MGB A;  1H0A A;  4L2Y A;  4G25 A;  4PDX A;  4O8I A;  4YUG A;  1XNF A;  3G2S A;  1CWL A;  2E2E A;  3FUJ A;  4XKB A;  2POY A;  1CLH A;  4APF A;  3RDA X;  2V0P A;  3PUK A;  3FU6 A;  4RSY A;  4UI9 J;  5FQ6 A;  1CWF A;  1MZW A;  2BIT X;  4N1R A;  1N54 A;  4XI9 A;  1CWA A;  4CDR A;  4J5C X;  2XGO A;  4EQF A;  3R7Q A;  2QY7 A;  4KVM A;  2LNI A;  1MQS A;  1H2U A;  2FBN A;  4IN3 B;  4J5B A;  3N71 A;  1IHG A;  3CSF A;  4U0Z A;  5KUS A;  4FJZ A;  1H6K A;  3PNL B;  4N5C A;  4WWP A;  1AWU A;  2A4Z A;  2IGW A;  4MKT A;  2FI7 A;  3JB9 d;  1M9X A;  3CIA A;  2AWI A;  3MJW A;  4YUN A;  3SHF A;  3LY8 A;  4IUL A;  1CWC A;  2WXI A;  3HYM B;  3FUF A;  5ENN A;  4JJM A;  3R54 A;  5FZR A;  2KM4 A;  2M63 A;  5EDS A;  3UPV A;  4G23 A;  4CEM A;  3ASH A;  2YHC A;  1M9E A;  1UN8 A;  5KJL A;  3O7T A;  1BPO A;  2MRI A;  3CR3 A;  3FU3 A;  4YUL A;  3VTY A;  2GGF A;  3RCG A;  2J4D A;  4AP2 A;  3ODI A;  2X6I A;  3ESK A;  4JEH A;  2WXP A;  2J09 A;  5D0Q D;  4KVO A;  3MKR A;  4UWL A;  1NP7 A;  4YUO A;  3ODL A;  4APO A;  1S0P A;  4G2V A;  3ZYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...