1IHGA

Bovine cyclophilin 40, monoclinic form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
364
structure length
364
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Cyclophilin 40
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
total genus 130
structure length 364
sequence length 364
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ihgA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1ihgA01
3EOVA 1AWSA 4J5EX 2GW1A 2OK3A 5DIZA 2IGWA 3VA7A 3K2CA 3QWWA 5LCWC 3UPVA 4J5DX 3U4TA 4APOA 5KJNA 3U3WA 1VBTA 5KV5A 4FRUA 1CWFA 5JJ6A 4YUOA 3ICHA 2NC9A 1DYWA 3KAEA 5JHEA 3OEPA 4I9EA 3BT8A 3ODIA 2X2CK 4I1AA 3ZHEB 5CCMA 3OXGA 3EDTB 3LPZA 3LCAA 3K9IA 2B71A 3ZGQA 4BT9A 3TAXA 2PHCB 2FO7A 1OCAA 4N1OA 5F66A 5EX0A 5CBVA 4KBQA 4WNFA 3ZHEA 1M63C 1HZ4A 4WNGA 1CWHA 3OREA 1XQ7A 4J5AX 1NA3A 3ZPJA 2X2DB 1ELRA 3VTXA 1M9FA 1IHGA 4N3AA 2WFJA 2P0OA 1ZMFA 1AK4A 2V5FA 2N0TA 5KV7A 4YUPA 1CWBA 4NQ0A 4ZSCA 1XNFA 2DBAA 5KUQA 3WXXA 3ESKA 3R9AB 3N71A 5KV3A 2FEZA 4AY6A 2CMTA 3CYHA 2PQRA 4YVQC 1Y8MA 4KYOB 2C0LA 4UQXA 2ESLA 1E8KA 3ASFA 2WFIA 1CYNA 3K0MA 3O48A 2HQ6A 3Q4AB 4H7XA 2PQNA 4GYOA 5FTPA 1AWVA 1E96B 4G23A 4U0ZA 2GW2A 4JHRA 5JJ7A 3UCHA 1KT1A 2VSYA 3UUXA 2K7NA 2LNIA 3TGOA 4J59A 4N1MA 5KULA 3LYAA 1OUVA 1VDNA 3RFYA 3PE4A 4I9CA 4YULA 5DUDA 4N1PA 4N3BA 4G25A 5KJMA 4O6FA 3RCLA 5AYWD 2XGMA 5CBUA 4JL0A 2UWJG 3O7TA 3JB9d 4BTAA 2PLUA 1CWLA 2HO1A 1IYGA 2LSVA 3FFLA 2CPLA 4DGBA 4YUKA 3RCIX 3CK7A 5EKQD 3K0QA 2XGSA 3RO3A 4JCPA 3GZ2A 3LKUA 2HAQA 3R54A 4J5BA 4N1SA 5KV4A 2BUGA 1H0PA 4G24A 1CLHA 3T1UA 1A33A 4HY7A 2Q7FA 2R5SA 3RJVA 3TG4A 2I6HA 5G05J 1XWNA 5KUVA 4N2SA 3R4GA 2UY1B 3K0NA 4N2QA 3QWVA 3PMPA 4DGCA 3CK8A 4GPKA 4YNDA 3OPFA 4N3CA 1QNGA 2VGYA 5FZQA 1FCHA 3LY7A 5KUNA 1P5QA 1W74A 2A2NA 5CCSX 1V9TA 2R99A 2UY1A 2IFUA 2C0MA 2VQ2A 4GA0A 3BEEA 3R56A 3QOUA 4CGWA 3JYSA 1ISTA 1QOIA 5CCRA 2BIUX 3K0RA 2MZUA 5BNWA 5KURA 2Y4TA 5EX3A 1HH8A 4J8DA 4KXKB 3SF4A 1W8VA 5BW8C 1WAO1 3QYUA 4G1TA 3ZN3A 3CVPA 5LCWJ 4J8EA 2FI7A 4AIFA 3CVNA 3CVLA 2XCBA 1J2AA 1X7FA 3AS4A 3ASGA 2KCVA 4DGEA 5DBKA 2MS4A 4CGVA 2RS4A 4LEUA 3NF1A 4Y6CA 3BKPA 4I17A 4XI9A 4YUGA 3OXLA 4HOTA 5KJLA 4U07A 1NMKA 3RIBA 5KJKA 5G04C 3OXFA 4N1RA 1NA0A 1W8LA 4JA9A 4HOUA 4XNCA 5D0OD 2OSEA 5KUSA 2OOEA 4U0UA 3ODLA 2PL2A 3ASHA 3RCKX 3Q5MA 2Y4UA 1AWRA 5KUZA 3CVQA 4G26A 3RCGA 2X2AA 3RD9X 1CWMA 1CWKA 1YNDA 1MIKA 4O8HA 4RG6A 3BO7A 4UI9C 4I2WA 3CEQA 3MMLB 4NRHB 4XI0A 3CKCA 3R57A 4W9RA 4GZ6A 2XGYB 2VSNA 2KCKA 4R3FA 4G2VA 2ALFA 2L6JA 4GZ3A 5FJYA 3CK9A 3MMLA 2WQHA 3RDDA 4UI9K 2MHKA 2QFCA 5KV6A 5FZSA 4Y6WA 5M72A 1FGLA 2HE9A 2X7KA 2ONDA 2P58C 1QZ2A 2X83B 4J58A 1M9XA 3LY9A 5D0QD 4R3EA 4EQFA 4N1QA 5HQ8A 2C2LA 2KATA 3S7FA 5A6CA 4GZ5A 3S7JA 2RMAA 5A0EA 4AY5A 3ULQA 2CK1A 2IGVA 4RG9A 3R59A 4H7YA 1Z81A 4I9YA 3RDBA 2RMCA 4ABNA 1QQEA 2XPIA 3AS8A 2CYHA 4E1QA 3RDAX 4ME2A 4EYVA 1AWUA 3RU0A 3SZ7A 2LSUA 4GCNA 2JLBA 4CDRA 1M9EA 5FT9A 3KD7A 4UQZA 2E2EA 2FBNA 3CYSA 2AVPA 3ICIA 1VBSA 2WPVA 4IPZA 2XGOA 2BITX 2IF4A 4LQWA 5CCNA 4WNDA 4S1JA 5KUOA 4YUJA 2KC7A 4BTBA 3QKYA 3RKVA 4YUMA 1MF8C 4J8FA 3PDNA 1VAIA 3UQ3A 3MV2B 1IIPA 4I2ZA 3URZA 5C1DA 4CYHA 5CBTA 3CKBA 5CYHA 1NZNA 1LOPA 5CCQA 1ZKFA 1C5FA 5CBWA 4WUYA 2MC9A 1TJCA 3S7BA 3GZ1A 3R49A 1CWAA 2POYA 4YUHA 3ASDA 3QDNA 4N5CA 5KV2A 4N39A 1XO7A 3S6MA 1CWIA 2HQJA 4GA1A 4J0UA 1YA0A 2XCCA 3Q15A 2OJUA 1A17A 2Z6WA 4GYYA 4HORA 3MA5A 4A1SA 1AWTA 4IN3B 1BCKA 1XYHA 1KT0A 4YUIA 5CHEE 4HOQA 1WM5A 4B94A 4DGDA 1M9YA 2WLWA 4JA7A 3K0OA 3S7DA 5CCLA 2J9QA 2VGXB 3AS5A 2QERA 3CV0A 3VTYA 5G04J 3LY8A 1CWOA 1CWJA 1CWCA 1QNHA 2FU0A 4BT8A 1PC2A 4S1EA 3TG5A 2CFEA 1W8MA 2VGXA 4TOTA 4DGAA 4ZSDA 3MV3B 4GCOA 1W3BA 2NULA 1ZBPA 1M9CA 3K0PA 2X25B 5ARFA 5KUUA 3FWVA 4JJMA 4XIFA 4YVOA 4FRVA 5BT1A 4N1NA 2KCLA 3ZFWA 3GYZA 5KV0A 1B89A 4UI9J 2HYZA 4J5CX 2FF4A 3MEKA 4GA2A 3RO2A 4O8IA 4F3VA 2RMBA 4U04A 1AWQA 3E4BA 1HXIA 1M9DA 3KS2A 1KLXA 1A58A 5KUWA 2MVZA 3Q49B 1MZWA 2HR2A 5KV1A 2PZIA 3HYMB 4YUNA 2C3BA 3PE3A 5HI7A 1ZU2A 2ZP2A 5G05C 3IEGA 1RMHA 3FP3A 3MKRA 4UQYA 3QWPA 1E3BA 4WNEA 2YHCA 5JJTA 2POEA 5A7DB 1ELWA 1ZKCA 3RCFA 5LUDA 3GW4A 5ARGA 4GYWA 3RDCA 4U0SA 2YQ8A 3Q47B 4AM9A 2XEVA 2VYIA 5FZRA 4HOSA 4BWRA
chains in the Genus database with same CATH superfamily
4RSYA 1AP7A 1JPLA 2XQ0A 2CHWA 5LP0A 1NI1A 3DBSA 4OAVB 5ANRA 3U4TA 2LAHA 3R7RA 3U3WA 4TXRA 4ACLA 3OEPA 1OWLA 3UIOC 5CCMA 3OXGA 1HF8A 5BXOA 3PREA 3LPZA 3LCAA 4MS6A 2B71A 4BT9A 4GMRA 1H19A 2FO7A 2ETBA 1M63C 4GAAA 5CEAA 4BSXA 3FUMA 2WXHA 1UN8A 3SI5A 1CWHA 5BV1A 2BF0X 3CSFA 3TXNA 4HI8A 3BUAA 4J5AX 4U96D 1H2TC 4BERA 3U66A 1TNZA 5HRYA 1ZMFA 4EZLA 3DSVA 2V4HC 2BTDA 1CWBA 4NQ0A 1OCRE 3PEUB 5KUQA 2FEZA 2XS8A 1IXVA 4TUUA 2C0LA 3ASFA 3TXMA 2WFIA 1CYNA 3HDXA 3Q4AB 4CZ2D 4H7XA 2PQNA 4XKCA 1JUQA 5FTPA 1E96B 4G23A 2GW2A 3FUIA 3DPDA 5JJ7A 4MBGA 3UUXA 4N1MA 3TGOA 5KULA 3O4ZA 1OUVA 1IQUA 1VDNA 3OTNA 4HLEA 1OCCE 5DUDA 4G25A 5KJMA 4AXHA 4CDMA 4JL0A 2UWJG 3FULA 3JB9d 4BTAA 1ZB1A 1SVXA 3EHMA 1E7UA 3FFLA 3L9TA 2R59A 2NNZA 3RCIX 1E8WA 2H6GA 5EKQD 3SFXA 4JCPA 3GZ2A 3R54A 4G24A 1DVPA 4HY7A 2AJAA 3TG4A 5G05J 4R7LA 1XWNA 3U9WA 3UT7A 3UKUG 4YNDA 4GTOA 4N3CA 1QNGA 4TXQA 1FCHA 1W74A 4MKTA 2UY1A 2VQ2A 2GRRB 2IONA 4GA0A 2RFMA 3QOUA 1UOHA 4U7EB 4F1SA 1IQRA 1HH8A 4J8DA 1NL4A 3QYUA 1WAO1 4G1TA 3D9IA 3ZUVB 4WWPA 5LCWJ 4J8EA 3B7BA 3CVLA 3HG0D 1X7FA 1J2AA 3ASGA 5DBKA 1N4PA 1BU9A 4XI9A 4PS7A 5KJLA 1N94A 1W8LA 3ABKE 2XRYA 4XE0A 5KUSA 3B95A 2DWZA 4ANWA 1LD7A 4FHKA 3NOGD 2Y4UA 1E8YA 5CMWA 1AWRA 3FUKA 3CVQA 4G26A 4GZCA 2XEEA 3FUJA 2X2AA 5CMYA 2AXZA 1CWMA 4FLBA 4HRLA 4O8HA 4I2WA 3MMLB 3R57A 4W9RA 2XGYB 1FPPA 3JXJA 2ALFA 4FADA 2L6JA 1UN9A 3QNKA 2WQHA 2QFCA 5KV6A 2IO3C 1FGLA 2HE9A 1WG0A 2X6JA 3E30A 2MRIA 4R3EA 4B89A 4EQFA 5HQ8A 3EIQC 1S0PA 1NP7A 3S7JA 1KZOA 3UI2A 2KM4A 2DYRE 4U95D 3FH8A 2CK1A 4L7TA 1Z3YA 1Z81A 2BEDA 4I9YA 3RDBA 4AP2A 4ATGA 2XPIA 2V5QC 4E1QA 4ME2A 2L6BA 4HI9A 4FULA 3SZ7A 2JLBA 4IYPA 3JQ0A 3T8MA 2R2LA 3PNTB 2E2EA 2I1JA 2FBNA 3ICIA 3X27A 1SZ9A 5KCMA 4IPZA 2BITX 4LQWA 4S1JA 5AQAA 2WXJA 2KC7A 1TNOA 3QKYA 2YHEA 3B7UX 3SBTB 1VAIA 2IOLA 3DSUA 3MV2B 2ZXWE 3BQOA 2WXKA 4CYHA 5CBTA 1NZNA 1ZKFA 1C5FA 4GTPA 1BD8A 2KZTB 5LOZA 2I2OA 1TYQG 3ASDA 3QDNA 3HVEB 4CT4A 3ZW3A 5D66A 2WXGA 5EN5D 4J0UA 1YYHA 3UT4A 5E75A 4WWNA 4A1SA 5FQ4A 1XYHA 2EQXA 3ZNGA 4GPMA 1QYMA 1EF1C 3DSXA 5CBOA 2BKKB 1FVFA 4RLYA 4DGDA 2F8YA 3L22A 2J9QA 2QERA 4A55A 4KVMA 3LY8A 1CWOA 2WXRA 2FU0A 3FU5A 5IY5E 4ZSDA 3MV3B 1W3BA 2NULA 1X5BA 4GMJA 4J7WA 1M9CA 3K0PA 1MX6A 5ARFA 5KBAA 4FHJA 4FRVA 2P9KG 3ASNE 5BT1A 4N1NA 1UJKA 1B89A 3TWVA 4HRNA 2FF4A 3FHEA 3MEKA 4GA2A 4U04A 1KLXA 1A58A 3FTSA 5KV1A 2PZIA 3HYMB 4YUNA 2C3BA 3PE3A 5HI7A 3DXKG 4C0MA 3TJPA 4JXTA 4RVBA 1HE8A 5AIJA 2IY0C 3PS6A 2IJGX 2B0OE 5JJTA 3GW4A 4GYWA 3RDCA 3Q7AA 1N4SA 2YQ8A 2PM7A 4AM9A 2XEVA 2VYIA 5FZRA 5EILA 3C5RA 3U64A 3PH0C 2GW1A 2H6IA 3C3QA 4L23A 3SHFA 3L6AA 3LJNA 4U63A 2QZAA 4APOA 1VBTA 1UJJA 4JW1A 2LXLA 3IV0A 4AJWA 5KV5A 1D9SA 5JHBA 3ICHA 3LJ3A 2F8XK 3KAEA 1DNPA 5JHEA 4ILIA 4I1AA 3TWWA 3ZHEB 3EDTB 4O1PA 3TWRA 4EPZA 2PNNA 2PHCB 3C98A 1KPSB 1OCAA 5CBVA 5EX0A 4KBQA 4WNFA 1EYHA 1HZ4A 4DI3A 3JXIA 2OEVA 3OREA 1DC2A 1NA3A 3PZ2A 3B7RL 1IHGA 1N4RA 2J08A 1AK4A 4M7CA 5KV7A 1SA4A 2XPYA 2HM8A 4GTSA 1SZAA 4V3IA 5BUZA 2DBAA 4NIKA 4I6GA 2XZDG 3WXXA 1OY3D 3N71A 3LXUX 5ENRD 3L17A 2CMTA 4XX5A 5CRUA 2PQRA 1E7VA 2J4BA 4ANVA 1OWOA 2ESLA 4OVVA 3PZDA 5EYLA 3K0MA 3O48A 1HG5A 5FQ6A 3ASOE 4ILGA 4GYOA 3I5PA 2VGEA 3P2BA 3RRUA 2YNQA 1KT1A 4NURA 1N4QA 3ZXSA 3LYAA 1MHQA 3D9LA 4ZHBA 4I9CA 4EZJA 1K3ZD 3BU8A 2X6KA 2IEJA 1HFAA 1SQMA 4CCAA 4O6FA 5AYWD 1S64A 2LXMA 1O5MA 1IYGA 5E76A 2LSVA 4XZ4A 3G2WA 4YDYA 4CT0A 4DGBA 3CK7A 3ML9A 2XGSA 4N1SA 4HLLA 4LSZE 2HAQA 3WG7E 4J5BA 2BUGA 2GGFA 1H0PA 3E37A 1A33A 2QYJA 5ENNA 2Q7FA 5H7PA 3ZRHA 4BX8A 2I6HA 1LF8A 4PS3A 2AXUA 4EZKA 5KUVA 3R4GA 3DPYA 4I1OB 3QWVA 4A3VA 3PMPA 2CHXA 5BPPA 3OPFA 1Z3XA 5FZQA 4HB5A 1GW6A 2A2NA 4AV7A 3FU3A 1JCRA 1V9TA 1MX4A 3QJZA 2IFUA 2C0MA 4HFGA 4K5CA 2HE0A 5ANLA 4CGWA 4CEMA 1QOIA 4HVBA 4GMLA 5BV0A 1H6PA 5LX8A 5EIBE 3K0RA 1G3NB 2Y4TA 3D9KA 3QAQA 3KSQA 3MZLB 5BW8C 2EINE 2X6FA 3PRZA 4AIFA 2XCBA 3AAAC 2WXLA 4Y6CA 2YINA 3BKPA 3CHSA 3ZYKA 4DJAA 4DPRA 3OXLA 5FIOA 1NMKA 5G04C 3OXFA 3CQGB 4B8AA 2FULA 2WXQA 5D0OD 2OSEA 2OOEA 2XS1A 5AENA 2V4LA 3RCKX 3W9GA 2NXPA 2ZISA 3L13A 3RCGA 2R02A 3C3OA 1OWNA 1HX8A 2BKGA 2GRLA 1JWFA 5T3RA 2AXVA 1MIKA 3BO7A 4P29A 4UI9C 4NRHB 1Z6TA 3DSSA 3Q73A 1OWMA 4GZ6A 2L9BA 4R3FA 2Y0BG 4UWFA 3CK9A 2P9LG 3GZSA 5FZSA 2A4ZA 3UTMA 5M72A 3J5PA 2ZIRA 4E85A 1H6OA 3NOCD 4N1QA 3CIAA 3UM2A 3G2TA 5A6CA 4URKA 3CVXA 3ULQA 4F1PA 2P2CP 4HQDA 4RG9A 3DSTA 3G2SA 1Q2ZA 4H7YA 3FUFA 4O60A 2RMCA 3AS8A 5AAOA 3I4GA 3V31A 4FA6A 5CECB 5KWDA 2Y69E 1AWUA 3SQVA 4GCNA 3D9HA 3FU0A 4WAFA 3FEXA 1M9EA 3C3RA 2AVPA 2XEHA 2LO6A 4WNDA 3HXEA 4CRWA 2GRNB 4FC8A 3PEVB 3QB2A 5EIDA 3RKVA 3UKRG 4J8FA 1MX2A 4F6RD 3T9KA 3UQ3A 2H6HA 4GTVA 3E33A 3MJWA 4EHMA 4UWHA 3CHOA 1HG2A 2R17C 4HNAD 2MC9A 4LCTA 4JZYA 3I3NA 1TJCA 3FH5A 3GZ1A 4YUHA 5KV2A 4LNBA 4N39A 2P9SG 3S6MA 1CWIA 4GA1A 1YA0A 3D9JA 3QARA 4HS2A 1K1AA 5JMND 4C0EA 3MA5A 2A5UA 3IBEA 4YUIA 4HOQA 4B94A 2M63A 1E8XA 2ZGDA 4I6EA 2GRQB 4J8SA 3MCXA 4JA7A 5G55A 3S7DA 3K0OA 1D8EA 3LEWA 3VTYA 5ENOD 1CWCA 1PC2A 4YDWA 4DX7D 2RFAA 2VGXA 3UMVA 2VTBA 2WXFA 4TOTA 4DGAA 4GCOA 3DRAA 4BSZB 1AWCB 5CBNA 5ENSD 4JJMA 4YVOA 1SW6A 4N5QA 1OXJA 4E6HA 3TWQA 3CVUA 4DI4A 3RO2A 3E4BA 1HXIA 2J07A 5KUWA 2MVZA 1H0AA 3Q49B 3Q79A 3SD5A 1ZU2A 3MKQA 3CLJA 5BXUA 3BG0B 3KEZA 3FTVA 3ZU7B 3QWPA 4PUCA 4KT6B 4ACKA 2JEKA 2X3MA 3D3MA 3R9MA 2YHCA 5A7DB 1FVHA 1MQSA 5LUDA 5ARGA 4HXIA 4K5BA 3Q47B 4FU3A 4J5EX 3PVLA 2IGWA 3K2CA 3EIJA 3QWWA 3LDZA 2H6FA 4J5DX 1MZCA 4RQIA 1CWFA 4YUOA 1DYWA 3R7QA 3NZUA 2J49A 2WXIA 3BT8A 3W9FA 4G8KA 3ODIA 2WMOA 3CGHA 3ZGQA 4F7AA 2XPZA 1V54E 3TAXA 5F66A 3SY2A 2X6HA 2AW6A 1TR4A 1OWPA 4XEIG 1TNYA 4WNGA 4EECA 1S70B 3D9NA 1XQ7A 1EPUA 3VLDA 2X2DB 4X8QA 1ELRA 4KMOA 4N3AA 3L16A 3EHRA 4YUPA 1FT1A 4ZSCA 1XGWA 1XNFA 3EUVA 2WVIA 1QBQA 3L82A 3FEYA 1RW2A 3ESKA 3CHMA 3R9AB 3CYHA 4YVQC 1Y8MA 4OYSA 3CSTA 4OVUA 4UQXA 4B0ZA 1V55E 3FUNA 2P9PG 2HQ6A 4K0RA 2CFZA 4TRQA 1A5EA 3PZ4A 4JHRA 2LNIA 4J59A 4UWLA 4YULA 4N3BA 2IU1A 3BG1B 3RCLA 3B7TA 2XGMA 4D10C 3O7TA 2PLUA 2HO1A 3APCA 3FUHA 4J6IA 1HO8A 2CPLA 5JA4D 3TL5A 5T8IA 1FT2A 3AG1E 3K0QA 3HXBA 3AU5A 1CLHA 3T1UA 2ZGGA 4AVXA 3CVVA 2JABA 3RJVA 2GRPB 3UX4A 4BETA 2NYJA 3V2XA 2AWIA 2UY1B 3I4RB 5FQ8A 3KSLA 2WMNA 4LERA 4TV3A 4GPKA 4FJZA 3LY7A 5KUNA 1HS6A 3ABLE 5CCSX 4L2LA 2P9NG 1N52A 3FDHA 4K03A 2RG8A 3T5VA 1ISTA 2EILE 4JEUA 5CCRA 2BIUX 5BNWA 1E90A 5KURA 4ANXA 2EIME 5EX3A 3ZN3A 4LNUD 2IOSA 3LVRE 5ENPD 3RAUA 3AS4A 2KCVA 4DGEA 4YDEA 2VSXE 3FUEA 4CGVA 4LEUA 3NF1A 4Q94A 1TJFA 2OCCE 4HOTA 4U07A 5EDSA 3RIBA 5KJKA 2Y3AA 4DX1A 2B6CA 4HOUA 5LFAA 3ZYQA 3MGBA 3D9MA 3NAWA 4U0UA 2PL2A 3AG3E 4JHJA 3ASHA 3DXMG 3LVQE 4KZCA 1INZA 3KOPA 3Q5MA 4GZDA 4DLQA 5KUZA 3RD9X 4ZFHA 3ZXPA 3UM1A 3DSWA 3MYVA 3CEQA 3AJIA 2QY7A 3CKCA 3VLEA 3LS8A 1JCQA 2VSNA 2KCKA 4G2VA 3V79K 2OEWA 4GZ3A 3MMLA 4UI9K 4Y6WA 3PZ3A 5AQ7A 5ENTD 4IULA 2X7KA 2ONDA 2R05A 1QZ2A 4L9PA 2X83B 3NBNB 1M9XA 3IXEA 3LY9A 1MJ0A 5EYPF 4GZ5A 1ELKA 4AEZC 3UM3A 3ZIMA 3EU9A 2LAIA 1O1TA 4CDNA 5AJLA 4ABNA 4DX5D 2QC9A 3FY4A 1EDUA 4B93B 5AJDA 3TWTA 5AARA 1BPOA 3D9PA 3FTUA 4EYVA 4XKBA 2LSUA 3EHNA 5ITZF 4CDRA 4A3TA 2F37A 1LD8A 2WB2A 3X2QE 3CYSA 3CHPA 4ANUA 1VBSA 3CHQA 4KVOA 5CCNA 3ULEG 2IO2C 4YUJA 1UW4B 2L0IA 4NACA 3PDNA 4Z68A 1IIPA 4I2ZA 4QQIA 2EIKE 5C1DA 2EIJE 3CKBA 5CYHA 1LOPA 5CCQA 3D9OA 4U8HA 3PNLB 3B7SA 3JUEA 2ZU6B 3EU5A 3S7BA 3AG4E 1CWAA 3ENEA 2POYA 4APFA 4G11A 4DX2A 3RSEG 2DIWA 1XO7A 1U2VG 2WXOA 2CG2A 2HQJA 2DYSE 2KZTA 5CERB 1OT8A 2GRMA 3HVEA 4FP7A 2Z6WA 4HORA 4GTQA 1KT0A 5CHEE 1WM5A 2RKKA 4O1OA 2DZOA 4J8YA 1M9YA 4GB9A 4ILHB 5CCLA 5T4YA 3AS5A 3CV0A 1MYOA 5AN8A 5G04J 2F0YA 1CWJA 5C2YA 1QNHA 1OCZE 4BT8A 3TG5A 4PH4B 3Q75A 1HU3A 1W8MA 3CQCB 3TWXA 4DRXE 4DX6D 2X25B 5AQBA 5J08A 3DEOA 3ZFWA 1IHBA 3JQ1A 3GYZA 5KV0A 1X81A 2VJ8A 4UI9J 3T8KA 5HKPA 5FQ7A 4GTRA 4LUNU 3Q9NC 4LG6A 4F3VA 3RRNB 1AWQA 3E32A 1M9DA 4YDOA 5A23A 3UINC 2KA0A 3E34A 3ISMC 5G05C 3V30A 3ESLA 4IRUA 4UQYA 1E3BA 3APDA 1U3CA 2I1KA 1ELWA 1OCOE 1ZKCA 3V2OA 4AOFA 2J8SD 3ZYMA 4HOSA 4U8VD 4BWRA 3EOVA 1N95A 1AWSA 5B1AE 2OK3A 5DIZA 2WQ6A 3VA7A 1PY1A 5LCWC 1Z5SC 2I9CA 3S2AA 3UPVA 5KJNA 4GTMA 3J5QB 4G8LA 4FRUA 1N9AA 5JJ6A 4A1GA 3CHRA 2NC9A 1SA5A 4UWGA 2KBXA 3IHYA 2ETAA 4I9EA 5HS0A 1BLXB 2X2CK 4A63B 3HXFA 3K9IA 1E8ZA 5B3SE 5FWQA 4N1OA 3FTYA 5G2NA 4CYMD 3ZHEA 3ONLA 3OAWA 3ZPJA 2XENA 1M9FA 3VTXA 2V0PA 2WFJA 2P0OA 3APFA 1WY6A 2V5FA 4C9BB 2N0TA 3CR3A 2QYUA 4EBAA 5ENQD 2RD0A 5CEDB 1N0RA 3SNXA 1Y6IA 3SBSA 3HRAA 2IQCA 3CVYA 5KV3A 4AY6A 1JWGA 4DLOA 3FUDA 4KYOB 2MOWA 5B1BE 4DUIA 1E8KA 4KZ0A 5FINA 1WDYA 1AWVA 4U0ZA 3UCHA 2VSYA 3SFYA 2K7NA 3RFYA 3PE4A 4N1PA 3L54A 3G2UA 4I43A 2XRZA 4JHKA 1KZPA 5CBUA 3EJNA 4HRMB 3SGHA 1CWLA 4YUKA 4BESA 4QFVA 3RO3A 3LKUA 3QK0A 4MLPA 5KV4A 2PM6A 3HHMA 4K5AB 2J09A 4JVSA 2R5SA 4FLHA 2CG3A 4N2SA 3JUIA 3K0NA 2ETCA 4N2QA 3RRMB 3UIPC 4DGCA 3CK8A 2VGYA 3Q78A 1P5QA 2R99A 3HIZA 3ZKJA 3RK6A 3BEEA 3R56A 3JYSA 1QNFA 2OVBA 2LUHA 3ULYA 2MZUA 4JPSA 1N54A 3HXCA 4KXKB 3SF4A 1W8VA 3FTXA 1LTXA 3CVPA 2KXPC 3L08A 2FI7A 4GU5A 3CVNA 2OV8A 1D8DA 4OAUC 3NB2A 4BEPA 2MS4A 2RS4A 1PAQA 4I17A 4UWKA 4YUGA 2CHZA 1U3DA 4I1MA 4N1RA 1TN6A 4I6JA 1NA0A 3T5XA 4JA9A 4XNCA 1S63A 2X6IA 1TN7A 3AU4A 3SO8A 2DCPA 3ODLA 3KEAA 4C48B 2WM9A 1UG3A 1N11A 4JEHA 5J90A 3TWSA 1O1SA 1CWKA 4UUCA 1YNDA 4L1BA 4RG6A 3MX3A 3Q7FA 4XI0A 5AQ9A 3FU6A 1BI8B 2V8SE 5FJYA 3RDDA 2MHKA 2E0IA 2WXNA 3NQPA 2ILRA 3AG2E 2P58C 5D2MC 4J58A 5D0QD 1YMPA 2X38A 2C2LA 2KATA 1K1BA 3JCKC 2WQ7A 3S7FA 1H2VC 3TWUA 2RMAA 3FTZA 5A0EA 4AY5A 1BI7B 2IGVA 1YCSB 4F53A 3R59A 4BX9A 3HXDA 1ZX8A 1H6KA 2XHEA 1N0QA 1QQEA 2GROB 2CYHA 3EHQA 2DZNA 3UXGA 3RDAX 1RZ4A 3G2VA 3RU0A 4Q69A 1TNUA 2NSZA 4BY6A 1O1RA 1TN8A 2P9IG 5FT9A 3KD7A 2P9UG 4UQZA 3Q9UC 2J4DA 4LRZA 4L2YA 3IKOB 2WPVA 2XGOA 2IF4A 5KUOA 2WXMA 3ZVVA 3UT8A 4BTBA 5JHAA 4YUMA 1DCQA 1MF8C 4JC8A 4M3OA 3URZA 2A5EA 1H2UA 4WWOA 3QC1A 5CBWA 4WUYA 2CFUA 1DCEA 3R49A 3FTWA 3CVWA 4N5CA 4DK5A 3UM0A 2XCCA 3Q15A 2OJUA 4TUMA 1A17A 3VLFA 4ATZD 4GYYA 2L0TB 4BFRA 1AWTA 4IN3B 1BCKA 1TEZA 4PS8A 1IKND 3F6QA 5KNHD 4Q96A 2WLWA 3P1UA 2VSOE 2VGXB 2DVWA 2VTBB 3FH7A 4PDXA 3IHVA 1JCSA 4LNGA 4MRUA 4S1EA 2CFEA 4TXPA 1NFIE 3ZEFA 1ZBPA 3ML8A 4JB8P 5KUUA 3FWVA 3DWLG 4XIFA 3PUJA 1K8KG 1TNBA 2OVFA 2KCLA 2MYOA 4FJYA 4EBAG 1L5JA 3ONKA 2WXPA 2HYZA 3PZ1A 4J5CX 4GTTA 3ABME 4O8IA 2XZTG 2RMBA 3MKQB 4JD2G 3SFZA 3C72A 3KS2A 3ZYLA 1MZWA 2HR2A 2Y1LE 5KNGA 2ZP2A 3IEGA 5CRVA 1RMHA 3FP3A 3MKRA 2FO1E 4HBDA 4U8YD 3B13A 1VDYA 4WNEA 2POEA 3RCFA 4B8CB 4U0SA 3NZSA 3DEPA 2R03A 3PUKA
chains in the Genus database with same CATH topology
3EOVA 4FU3A 4RSYA 1AWSA 4J5EX 3U64A 1JPLA 3PH0C 2GW1A 2OK3A 2XQ0A 3PVLA 2CHWA 5DIZA 5LP0A 2IGWA 2WQ6A 4L23A 3SHFA 3VA7A 3K2CA 1PY1A 3EIJA 3QWWA 3LDZA 5LCWC 2I9CA 3S2AA 3UPVA 4J5DX 3L6AA 3DBSA 4U63A 5ANRA 3U4TA 2LAHA 4APOA 5KJNA 3R7RA 3U3WA 1VBTA 1UJJA 4JW1A 3IV0A 4AJWA 5KV5A 4FRUA 1CWFA 5JJ6A 4A1GA 5JHBA 4YUOA 3CHRA 2NC9A 3LJ3A 1DYWA 3ICHA 3KAEA 1DNPA 4UWGA 5JHEA 4ACLA 3OEPA 3IHYA 3NZUA 3R7QA 2J49A 4ILIA 2WXIA 4I9EA 3BT8A 1OWLA 3ODIA 2X2CK 4I1AA 3ZHEB 5CCMA 3OXGA 1HF8A 3EDTB 3PREA 3LPZA 2WMOA 3LCAA 4MS6A 4EPZA 3K9IA 2B71A 1E8ZA 3CGHA 3ZGQA 2XPZA 4BT9A 4F7AA 1H19A 3TAXA 2FO7A 3C98A 5FWQA 3FTYA 5EX0A 5G2NA 1OCAA 2PHCB 4N1OA 5F66A 2X6HA 2AW6A 4KBQA 4WNFA 3ZHEA 1M63C 1OWPA 4GAAA 3ONLA 1EYHA 4BSXA 1HZ4A 3FUMA 2WXHA 4WNGA 1UN8A 4EECA 3SI5A 4DI3A 1CWHA 5BV1A 2BF0X 3D9NA 3CSFA 3TXNA 1XQ7A 3OREA 1EPUA 3OAWA 4J5AX 1NA3A 3ZPJA 1H2TC 3VLDA 3B7RL 3U66A 2X2DB 1ELRA 3VTXA 1M9FA 1IHGA 4KMOA 4N3AA 2V0PA 2WFJA 2P0OA 1ZMFA 3L16A 4EZLA 3APFA 2J08A 1WY6A 1AK4A 2V5FA 4C9BB 2N0TA 2BTDA 2XPYA 4YUPA 5KV7A 1CWBA 4NQ0A 2HM8A 3CR3A 4ZSCA 1SZAA 1XGWA 3PEUB 4V3IA 4EBAA 5BUZA 1XNFA 2DBAA 2WVIA 2RD0A 4I6GA 3SNXA 5KUQA 3FEYA 1Y6IA 3SBSA 3WXXA 3ESKA 2IQCA 3CHMA 3R9AB 3N71A 3LXUX 3CVYA 5KV3A 2FEZA 4AY6A 3L17A 2CMTA 4XX5A 1JWGA 3CYHA 2PQRA 4YVQC 1E7VA 1Y8MA 2J4BA 4DLOA 3FUDA 3CSTA 2MOWA 4KYOB 4OYSA 4TUUA 4OVUA 2C0LA 4ANVA 1OWOA 4UQXA 2ESLA 4OVVA 3PZDA 3ASFA 3TXMA 1E8KA 2WFIA 1CYNA 4KZ0A 4B0ZA 3O48A 3K0MA 3FUNA 2HQ6A 1HG5A 5FQ6A 3HDXA 3Q4AB 4H7XA 4ILGA 2PQNA 4K0RA 2CFZA 4GYOA 4TRQA 4XKCA 3I5PA 1JUQA 5FTPA 1E96B 1AWVA 3P2BA 3RRUA 4G23A 4U0ZA 2GW2A 2YNQA 3FUIA 3DPDA 4JHRA 5JJ7A 1KT1A 2VSYA 3UUXA 4NURA 2LNIA 3TGOA 2K7NA 4J59A 4N1MA 5KULA 3ZXSA 3LYAA 1MHQA 1OUVA 1IQUA 3O4ZA 3D9LA 4UWLA 1VDNA 3RFYA 3PE4A 3OTNA 4I9CA 4EZJA 4HLEA 4YULA 5DUDA 4N1PA 2X6KA 3L54A 4N3BA 1HFAA 2IU1A 1SQMA 3G2UA 4G25A 4CCAA 4I43A 5KJMA 3BG1B 4O6FA 2XRZA 4JHKA 3RCLA 3B7TA 5AYWD 2XGMA 4AXHA 5CBUA 3EJNA 4CDMA 4JL0A 3SGHA 2UWJG 3FULA 4D10C 3O7TA 3JB9d 4BTAA 2PLUA 1CWLA 2HO1A 3APCA 3FUHA 1IYGA 3UCHA 5E76A 3EHMA 2LSVA 1E7UA 1HO8A 3FFLA 3G2WA 4J6IA 4XZ4A 4CT0A 2CPLA 4DGBA 4YUKA 2R59A 3RCIX 3CK7A 3TL5A 4QFVA 3ML9A 5T8IA 1E8WA 5EKQD 3K0QA 2XGSA 3RO3A 4JCPA 3GZ2A 3LKUA 3QK0A 4MLPA 2HAQA 3R54A 4J5BA 2BUGA 2GGFA 5KV4A 1H0PA 3AU5A 4G24A 1CLHA 1DVPA 3T1UA 2PM6A 3HHMA 1A33A 4AVXA 4HY7A 5ENNA 2Q7FA 3CVVA 2J09A 4JVSA 3ZRHA 2R5SA 4FLHA 3RJVA 4BX8A 3TG4A 2I6HA 5G05J 1LF8A 4PS3A 4R7LA 2AXUA 3U9WA 2CG3A 3UX4A 4EZKA 1XWNA 5KUVA 3UT7A 2AWIA 3JUIA 4N2SA 3R4GA 2UY1B 3I4RB 3K0NA 5FQ8A 4I1OB 2WMNA 3QWVA 4A3VA 4N2QA 3PMPA 3RRMB 4LERA 4TV3A 4DGCA 3CK8A 2CHXA 4GPKA 4YNDA 5BPPA 3OPFA 4N3CA 1Z3XA 2VGYA 5FZQA 1FCHA 4FJZA 1QNGA 3LY7A 1GW6A 5KUNA 1P5QA 1HS6A 4MKTA 4AV7A 3FU3A 1W74A 4L2LA 1V9TA 2A2NA 2R99A 5CCSX 3HIZA 3QJZA 1N52A 2UY1A 2IFUA 2C0MA 4HFGA 3RK6A 2VQ2A 3FDHA 4K03A 2IONA 4GA0A 5ANLA 3BEEA 3R56A 3QOUA 2RG8A 4CGWA 3JYSA 5CBVA 3T5VA 4CEMA 1ISTA 1QNFA 1QOIA 4HVBA 4JEUA 2OVBA 5CCRA 4GMLA 5BV0A 5LX8A 2BIUX 3K0RA 2MZUA 5BNWA 4JPSA 1E90A 4F1SA 2Y4TA 1N54A 3D9KA 3QAQA 4ANXA 5EX3A 1IQRA 1HH8A 4J8DA 4KXKB 3MZLB 3SF4A 5BW8C 1WAO1 1W8VA 4G1TA 3FTXA 3QYUA 3D9IA 3ZN3A 2X6FA 2IOSA 3PRZA 3CVPA 4WWPA 3LVRE 3L08A 4J8EA 5LCWJ 2FI7A 4GU5A 4AIFA 3CVNA 2OV8A 3CVLA 2XCBA 1J2AA 1X7FA 3AS4A 3ASGA 2KCVA 2WXLA 4DGEA 5DBKA 2VSXE 2MS4A 3FUEA 4CGVA 4LEUA 2RS4A 3NF1A 4Q94A 4Y6CA 2YINA 1TJFA 3BKPA 3CHSA 1PAQA 3ZYKA 4I17A 4PS7A 4XI9A 4UWKA 4DJAA 4YUGA 4DPRA 2CHZA 3OXLA 1U3DA 4HOTA 5KJLA 4U07A 1NMKA 4I1MA 3RIBA 5EDSA 5KJKA 5G04C 2Y3AA 3CQGB 3OXFA 1NA0A 2FULA 2WXQA 4I6JA 3T5XA 4B8AA 1W8LA 2XRYA 4JA9A 4HOUA 5LFAA 4XNCA 4XE0A 5D0OD 3ZYQA 3MGBA 2X6IA 3AU4A 3D9MA 2OOEA 2OSEA 5KUSA 4U0UA 5AENA 2DCPA 3ODLA 2PL2A 4JHJA 2V4LA 3ASHA 3RCKX 4ANWA 4FHKA 3LVQE 4KZCA 1INZA 2WM9A 3Q5MA 1UG3A 2Y4UA 1E8YA 4GZDA 5CMWA 1AWRA 2NXPA 4JEHA 5J90A 4DLQA 5KUZA 3FUKA 3CVQA 3L13A 4G26A 4GZCA 3RCGA 3FUJA 1OWNA 5CMYA 2AXZA 1HX8A 2X2AA 3RD9X 1CWMA 1CWKA 2GRLA 1JWFA 4FLBA 5T3RA 1YNDA 4L1BA 2AXVA 1MIKA 4O8HA 4RG6A 3BO7A 3MX3A 3MYVA 4P29A 4I2WA 3CEQA 4UI9C 3MMLB 4NRHB 4XI0A 1Z6TA 2QY7A 3CKCA 1OWMA 3R57A 4W9RA 4GZ6A 3VLEA 2XGYB 3LS8A 2L9BA 2VSNA 2KCKA 3FU6A 4R3FA 4G2VA 2ALFA 4FADA 2L6JA 4GZ3A 1UN9A 2V8SE 4UWFA 5FJYA 3CK9A 3QNKA 2WQHA 3MMLA 4UI9K 2MHKA 3GZSA 2E0IA 2QFCA 3RDDA 5KV6A 5FZSA 2A4ZA 4Y6WA 5M72A 1FGLA 2WXNA 3NQPA 2HE9A 4IULA 2ILRA 2ONDA 2X7KA 2P58C 1QZ2A 2X83B 4J58A 2X6JA 4E85A 2MRIA 1M9XA 3LY9A 5D0QD 4R3EA 4B89A 4EQFA 4N1QA 5HQ8A 3EIQC 1S0PA 2X38A 1NP7A 3CIAA 3G2TA 2C2LA 2KATA 3JCKC 2WQ7A 3S7FA 5A6CA 4URKA 1H2VC 4GZ5A 3S7JA 2RMAA 3FTZA 2KM4A 1ELKA 4AY5A 5A0EA 3CVXA 3ULQA 3FH8A 4AEZC 3ZIMA 4N1RA 2CK1A 2IGVA 2LAIA 4F53A 4L7TA 4RG9A 3R59A 3G2SA 1Z3YA 4H7YA 4BX9A 3FUFA 4CDNA 1Z81A 1H6KA 4I9YA 3RDBA 5AJLA 2XHEA 4AP2A 2RMCA 4ABNA 4ATGA 1QQEA 2XPIA 3AS8A 2CYHA 3FY4A 4E1QA 1EDUA 5AJDA 3I4GA 3RDAX 4ME2A 1BPOA 4FA6A 3D9PA 3FTUA 4EYVA 3G2VA 1AWUA 3RU0A 4XKBA 4Q69A 4FULA 3SZ7A 2NSZA 2LSUA 4GCNA 2JLBA 3EHNA 3JQ0A 4IYPA 3T8MA 4BY6A 4CDRA 3FU0A 4WAFA 3FEXA 1M9EA 4A3TA 5FT9A 3KD7A 4UQZA 3PNTB 2E2EA 2I1JA 2WB2A 2FBNA 3CYSA 2AVPA 2J4DA 3CHPA 4LRZA 4L2YA 4ANUA 3IKOB 1SZ9A 2WPVA 3CHQA 5KCMA 1VBSA 2LO6A 4KVOA 4IPZA 2XGOA 2BITX 2IF4A 4LQWA 5CCNA 4WNDA 4S1JA 5KUOA 4YUJA 2WXMA 1UW4B 2KC7A 2WXJA 4FC8A 3UT8A 3ZVVA 4BTBA 3QKYA 4CRWA 2YHEA 3PEVB 3QB2A 3RKVA 5JHAA 2L0IA 3B7UX 4NACA 4YUMA 1MF8C 4J8FA 3SBTB 3PDNA 1VAIA 4JC8A 2IOLA 3UQ3A 4M3OA 3MV2B 1IIPA 4I2ZA 3URZA 3ICIA 5C1DA 2WXKA 4CYHA 5CBTA 3CKBA 5CYHA 1NZNA 1H2UA 1LOPA 4WWOA 5CCQA 3D9OA 3QC1A 1ZKFA 4U8HA 1C5FA 3MJWA 4UWHA 3CHOA 5CBWA 1HG2A 2R17C 2CFUA 4WUYA 4LCTA 3PNLB 2MC9A 3B7SA 4JZYA 3I3NA 1TJCA 2KZTB 2ZU6B 5LOZA 3FH5A 3FTWA 3GZ1A 2I2OA 3S7BA 3CVWA 1CWAA 3ENEA 3R49A 2POYA 4APFA 4G11A 3ASDA 3QDNA 3HVEB 4N5CA 5KV2A 4CT4A 4DK5A 4YUHA 2DIWA 4N39A 3ZW3A 1XO7A 3S6MA 2WXOA 2CG2A 1CWIA 2HQJA 2WXGA 4GA1A 4J0UA 1YA0A 2KZTA 3D9JA 3QARA 4HS2A 2XCCA 3UT4A 3Q15A 2OJUA 5E75A 2GRMA 3HVEA 4FP7A 1A17A 2Z6WA 3VLFA 4WWNA 4GYYA 2L0TB 4C0EA 3MA5A 4BFRA 4HORA 4A1SA 1AWTA 5FQ4A 4IN3B 1BCKA 1TEZA 2A5UA 2EQXA 1KT0A 3IBEA 1XYHA 4PS8A 4HOQA 5CHEE 1EF1C 4YUIA 1WM5A 4B94A 2M63A 1E8XA 1FVFA 4I6EA 4J8SA 3MCXA 4Q96A 1M9YA 4DGDA 2WLWA 3P1UA 4GB9A 3L22A 4ILHB 4JA7A 2VSOE 5G55A 3S7DA 5CCLA 3K0OA 2J9QA 2VGXB 5T4YA 3AS5A 2VTBB 3CV0A 2QERA 3LEWA 3FH7A 3VTYA 5G04J 4PDXA 4KVMA 4A55A 3IHVA 3LY8A 1CWOA 2WXRA 1CWJA 1CWCA 5C2YA 1QNHA 2FU0A 4MRUA 4BT8A 1PC2A 3FU5A 4S1EA 3TG5A 2CFEA 4PH4B 1HU3A 3UMVA 2VGXA 1W8MA 2VTBA 2WXFA 3CQCB 4DGAA 4TOTA 4ZSDA 3MV3B 4GCOA 1W3BA 3ZEFA 2NULA 1ZBPA 3ML8A 1X5BA 4GMJA 1M9CA 3K0PA 2X25B 5ARFA 5KUUA 3FWVA 4JJMA 4XIFA 4FHJA 4YVOA 3PUJA 5J08A 4FRVA 5BT1A 4N1NA 2OVFA 2KCLA 3ZFWA 4FJYA 4EBAG 1UJKA 3JQ1A 3GYZA 5KV0A 1L5JA 3ONKA 2WXPA 1B89A 2VJ8A 4UI9J 2HYZA 4E6HA 4J5CX 5FQ7A 2FF4A 3FHEA 3MEKA 3CVUA 4LUNU 4DI4A 4N1SA 4GA2A 3RO2A 4O8IA 4F3VA 2RMBA 3MKQB 4U04A 3RRNB 1AWQA 3E4BA 1HXIA 1M9DA 2J07A 3SFZA 3KS2A 1KLXA 3ZYLA 1A58A 5A23A 3FTSA 2MVZA 5KUWA 1H0AA 3Q49B 1MZWA 2HR2A 5KV1A 3SD5A 2PZIA 3HYMB 4YUNA 2C3BA 3PE3A 5HI7A 1ZU2A 3MKQA 3CLJA 4C0MA 2ZP2A 5G05C 3TJPA 3ESLA 4JXTA 3BG0B 3IEGA 3KEZA 1HE8A 4IRUA 4RVBA 3FTVA 5AIJA 1RMHA 3FP3A 3MKRA 3PS6A 4UQYA 3QWPA 4PUCA 2IJGX 4KT6B 2JEKA 2X3MA 4ACKA 1E3BA 3APDA 1U3CA 3D3MA 3B13A 1VDYA 4WNEA 2YHCA 5JJTA 2POEA 2I1KA 1ELWA 5A7DB 1FVHA 1ZKCA 3RCFA 1MQSA 5LUDA 3GW4A 5ARGA 4AOFA 4GYWA 4B8CB 3RDCA 4HXIA 4U0SA 3NZSA 2YQ8A 2PM7A 3ZYMA 3Q47B 4AM9A 2XEVA 2VYIA 5FZRA 4HOSA 4BWRA 5KURA 3PUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOV A;  1AWS A;  4J5E X;  2GW1 A;  2OK3 A;  5DIZ A;  2IGW A;  3VA7 A;  3K2C A;  3QWW A;  5LCW C;  3UPV A;  4J5D X;  3U4T A;  4APO A;  5KJN A;  3U3W A;  1VBT A;  5KV5 A;  4FRU A;  1CWF A;  5JJ6 A;  4YUO A;  3ICH A;  2NC9 A;  1DYW A;  3KAE A;  5JHE A;  3OEP A;  4I9E A;  3BT8 A;  3ODI A;  2X2C K;  4I1A A;  3ZHE B;  5CCM A;  3OXG A;  3EDT B;  3LPZ A;  3LCA A;  3K9I A;  2B71 A;  3ZGQ A;  4BT9 A;  3TAX A;  2PHC B;  2FO7 A;  1OCA A;  4N1O A;  5F66 A;  5EX0 A;  5CBV A;  4KBQ A;  4WNF A;  3ZHE A;  1M63 C;  1HZ4 A;  4WNG A;  1CWH A;  3ORE A;  1XQ7 A;  4J5A X;  1NA3 A;  3ZPJ A;  2X2D B;  1ELR A;  3VTX A;  1M9F A;  1IHG A;  4N3A A;  2WFJ A;  2P0O A;  1ZMF A;  1AK4 A;  2V5F A;  2N0T A;  5KV7 A;  4YUP A;  1CWB A;  4NQ0 A;  4ZSC A;  1XNF A;  2DBA A;  5KUQ A;  3WXX A;  3ESK A;  3R9A B;  3N71 A;  5KV3 A;  2FEZ A;  4AY6 A;  2CMT A;  3CYH A;  2PQR A;  4YVQ C;  1Y8M A;  4KYO B;  2C0L A;  4UQX A;  2ESL A;  1E8K A;  3ASF A;  2WFI A;  1CYN A;  3K0M A;  3O48 A;  2HQ6 A;  3Q4A B;  4H7X A;  2PQN A;  4GYO A;  5FTP A;  1AWV A;  1E96 B;  4G23 A;  4U0Z A;  2GW2 A;  4JHR A;  5JJ7 A;  3UCH A;  1KT1 A;  2VSY A;  3UUX A;  2K7N A;  2LNI A;  3TGO A;  4J59 A;  4N1M A;  5KUL A;  3LYA A;  1OUV A;  1VDN A;  3RFY A;  3PE4 A;  4I9C A;  4YUL A;  5DUD A;  4N1P A;  4N3B A;  4G25 A;  5KJM A;  4O6F A;  3RCL A;  5AYW D;  2XGM A;  5CBU A;  4JL0 A;  2UWJ G;  3O7T A;  3JB9 d;  4BTA A;  2PLU A;  1CWL A;  2HO1 A;  1IYG A;  2LSV A;  3FFL A;  2CPL A;  4DGB A;  4YUK A;  3RCI X;  3CK7 A;  5EKQ D;  3K0Q A;  2XGS A;  3RO3 A;  4JCP A;  3GZ2 A;  3LKU A;  2HAQ A;  3R54 A;  4J5B A;  4N1S A;  5KV4 A;  2BUG A;  1H0P A;  4G24 A;  1CLH A;  3T1U A;  1A33 A;  4HY7 A;  2Q7F A;  2R5S A;  3RJV A;  3TG4 A;  2I6H A;  5G05 J;  1XWN A;  5KUV A;  4N2S A;  3R4G A;  2UY1 B;  3K0N A;  4N2Q A;  3QWV A;  3PMP A;  4DGC A;  3CK8 A;  4GPK A;  4YND A;  3OPF A;  4N3C A;  1QNG A;  2VGY A;  5FZQ A;  1FCH A;  3LY7 A;  5KUN A;  1P5Q A;  1W74 A;  2A2N A;  5CCS X;  1V9T A;  2R99 A;  2UY1 A;  2IFU A;  2C0M A;  2VQ2 A;  4GA0 A;  3BEE A;  3R56 A;  3QOU A;  4CGW A;  3JYS A;  1IST A;  1QOI A;  5CCR A;  2BIU X;  3K0R A;  2MZU A;  5BNW A;  5KUR A;  2Y4T A;  5EX3 A;  1HH8 A;  4J8D A;  4KXK B;  3SF4 A;  1W8V A;  5BW8 C;  1WAO 1;  3QYU A;  4G1T A;  3ZN3 A;  3CVP A;  5LCW J;  4J8E A;  2FI7 A;  4AIF A;  3CVN A;  3CVL A;  2XCB A;  1J2A A;  1X7F A;  3AS4 A;  3ASG A;  2KCV A;  4DGE A;  5DBK A;  2MS4 A;  4CGV A;  2RS4 A;  4LEU A;  3NF1 A;  4Y6C A;  3BKP A;  4I17 A;  4XI9 A;  4YUG A;  3OXL A;  4HOT A;  5KJL A;  4U07 A;  1NMK A;  3RIB A;  5KJK A;  5G04 C;  3OXF A;  4N1R A;  1NA0 A;  1W8L A;  4JA9 A;  4HOU A;  4XNC A;  5D0O D;  2OSE A;  5KUS A;  2OOE A;  4U0U A;  3ODL A;  2PL2 A;  3ASH A;  3RCK X;  3Q5M A;  2Y4U A;  1AWR A;  5KUZ A;  3CVQ A;  4G26 A;  3RCG A;  2X2A A;  3RD9 X;  1CWM A;  1CWK A;  1YND A;  1MIK A;  4O8H A;  4RG6 A;  3BO7 A;  4UI9 C;  4I2W A;  3CEQ A;  3MML B;  4NRH B;  4XI0 A;  3CKC A;  3R57 A;  4W9R A;  4GZ6 A;  2XGY B;  2VSN A;  2KCK A;  4R3F A;  4G2V A;  2ALF A;  2L6J A;  4GZ3 A;  5FJY A;  3CK9 A;  3MML A;  2WQH A;  3RDD A;  4UI9 K;  2MHK A;  2QFC A;  5KV6 A;  5FZS A;  4Y6W A;  5M72 A;  1FGL A;  2HE9 A;  2X7K A;  2OND A;  2P58 C;  1QZ2 A;  2X83 B;  4J58 A;  1M9X A;  3LY9 A;  5D0Q D;  4R3E A;  4EQF A;  4N1Q A;  5HQ8 A;  2C2L A;  2KAT A;  3S7F A;  5A6C A;  4GZ5 A;  3S7J A;  2RMA A;  5A0E A;  4AY5 A;  3ULQ A;  2CK1 A;  2IGV A;  4RG9 A;  3R59 A;  4H7Y A;  1Z81 A;  4I9Y A;  3RDB A;  2RMC A;  4ABN A;  1QQE A;  2XPI A;  3AS8 A;  2CYH A;  4E1Q A;  3RDA X;  4ME2 A;  4EYV A;  1AWU A;  3RU0 A;  3SZ7 A;  2LSU A;  4GCN A;  2JLB A;  4CDR A;  1M9E A;  5FT9 A;  3KD7 A;  4UQZ A;  2E2E A;  2FBN A;  3CYS A;  2AVP A;  3ICI A;  1VBS A;  2WPV A;  4IPZ A;  2XGO A;  2BIT X;  2IF4 A;  4LQW A;  5CCN A;  4WND A;  4S1J A;  5KUO A;  4YUJ A;  2KC7 A;  4BTB A;  3QKY A;  3RKV A;  4YUM A;  1MF8 C;  4J8F A;  3PDN A;  1VAI A;  3UQ3 A;  3MV2 B;  1IIP A;  4I2Z A;  3URZ A;  5C1D A;  4CYH A;  5CBT A;  3CKB A;  5CYH A;  1NZN A;  1LOP A;  5CCQ A;  1ZKF A;  1C5F A;  5CBW A;  4WUY A;  2MC9 A;  1TJC A;  3S7B A;  3GZ1 A;  3R49 A;  1CWA A;  2POY A;  4YUH A;  3ASD A;  3QDN A;  4N5C A;  5KV2 A;  4N39 A;  1XO7 A;  3S6M A;  1CWI A;  2HQJ A;  4GA1 A;  4J0U A;  1YA0 A;  2XCC A;  3Q15 A;  2OJU A;  1A17 A;  2Z6W A;  4GYY A;  4HOR A;  3MA5 A;  4A1S A;  1AWT A;  4IN3 B;  1BCK A;  1XYH A;  1KT0 A;  4YUI A;  5CHE E;  4HOQ A;  1WM5 A;  4B94 A;  4DGD A;  1M9Y A;  2WLW A;  4JA7 A;  3K0O A;  3S7D A;  5CCL A;  2J9Q A;  2VGX B;  3AS5 A;  2QER A;  3CV0 A;  3VTY A;  5G04 J;  3LY8 A;  1CWO A;  1CWJ A;  1CWC A;  1QNH A;  2FU0 A;  4BT8 A;  1PC2 A;  4S1E A;  3TG5 A;  2CFE A;  1W8M A;  2VGX A;  4TOT A;  4DGA A;  4ZSD A;  3MV3 B;  4GCO A;  1W3B A;  2NUL A;  1ZBP A;  1M9C A;  3K0P A;  2X25 B;  5ARF A;  5KUU A;  3FWV A;  4JJM A;  4XIF A;  4YVO A;  4FRV A;  5BT1 A;  4N1N A;  2KCL A;  3ZFW A;  3GYZ A;  5KV0 A;  1B89 A;  4UI9 J;  2HYZ A;  4J5C X;  2FF4 A;  3MEK A;  4GA2 A;  3RO2 A;  4O8I A;  4F3V A;  2RMB A;  4U04 A;  1AWQ A;  3E4B A;  1HXI A;  1M9D A;  3KS2 A;  1KLX A;  1A58 A;  5KUW A;  2MVZ A;  3Q49 B;  1MZW A;  2HR2 A;  5KV1 A;  2PZI A;  3HYM B;  4YUN A;  2C3B A;  3PE3 A;  5HI7 A;  1ZU2 A;  2ZP2 A;  5G05 C;  3IEG A;  1RMH A;  3FP3 A;  3MKR A;  4UQY A;  3QWP A;  1E3B A;  4WNE A;  2YHC A;  5JJT A;  2POE A;  5A7D B;  1ELW A;  1ZKC A;  3RCF A;  5LUD A;  3GW4 A;  5ARG A;  4GYW A;  3RDC A;  4U0S A;  2YQ8 A;  3Q47 B;  4AM9 A;  2XEV A;  2VYI A;  5FZR A;  4HOS A;  4BWR A; 
#chains in the Genus database with same CATH topology
 4RSY A;  1AP7 A;  1JPL A;  2XQ0 A;  2CHW A;  5LP0 A;  1NI1 A;  3DBS A;  4OAV B;  5ANR A;  3U4T A;  2LAH A;  3R7R A;  3U3W A;  4TXR A;  4ACL A;  3OEP A;  1OWL A;  3UIO C;  5CCM A;  3OXG A;  1HF8 A;  5BXO A;  3PRE A;  3LPZ A;  3LCA A;  4MS6 A;  2B71 A;  4BT9 A;  4GMR A;  1H19 A;  2FO7 A;  2ETB A;  1M63 C;  4GAA A;  5CEA A;  4BSX A;  3FUM A;  2WXH A;  1UN8 A;  3SI5 A;  1CWH A;  5BV1 A;  2BF0 X;  3CSF A;  3TXN A;  4HI8 A;  3BUA A;  4J5A X;  4U96 D;  1H2T C;  4BER A;  3U66 A;  1TNZ A;  5HRY A;  1ZMF A;  4EZL A;  3DSV A;  2V4H C;  2BTD A;  1CWB A;  4NQ0 A;  1OCR E;  3PEU B;  5KUQ A;  2FEZ A;  2XS8 A;  1IXV A;  4TUU A;  2C0L A;  3ASF A;  3TXM A;  2WFI A;  1CYN A;  3HDX A;  3Q4A B;  4CZ2 D;  4H7X A;  2PQN A;  4XKC A;  1JUQ A;  5FTP A;  1E96 B;  4G23 A;  2GW2 A;  3FUI A;  3DPD A;  5JJ7 A;  4MBG A;  3UUX A;  4N1M A;  3TGO A;  5KUL A;  3O4Z A;  1OUV A;  1IQU A;  1VDN A;  3OTN A;  4HLE A;  1OCC E;  5DUD A;  4G25 A;  5KJM A;  4AXH A;  4CDM A;  4JL0 A;  2UWJ G;  3FUL A;  3JB9 d;  4BTA A;  1ZB1 A;  1SVX A;  3EHM A;  1E7U A;  3FFL A;  3L9T A;  2R59 A;  2NNZ A;  3RCI X;  1E8W A;  2H6G A;  5EKQ D;  3SFX A;  4JCP A;  3GZ2 A;  3R54 A;  4G24 A;  1DVP A;  4HY7 A;  2AJA A;  3TG4 A;  5G05 J;  4R7L A;  1XWN A;  3U9W A;  3UT7 A;  3UKU G;  4YND A;  4GTO A;  4N3C A;  1QNG A;  4TXQ A;  1FCH A;  1W74 A;  4MKT A;  2UY1 A;  2VQ2 A;  2GRR B;  2ION A;  4GA0 A;  2RFM A;  3QOU A;  1UOH A;  4U7E B;  4F1S A;  1IQR A;  1HH8 A;  4J8D A;  1NL4 A;  3QYU A;  1WAO 1;  4G1T A;  3D9I A;  3ZUV B;  4WWP A;  5LCW J;  4J8E A;  3B7B A;  3CVL A;  3HG0 D;  1X7F A;  1J2A A;  3ASG A;  5DBK A;  1N4P A;  1BU9 A;  4XI9 A;  4PS7 A;  5KJL A;  1N94 A;  1W8L A;  3ABK E;  2XRY A;  4XE0 A;  5KUS A;  3B95 A;  2DWZ A;  4ANW A;  1LD7 A;  4FHK A;  3NOG D;  2Y4U A;  1E8Y A;  5CMW A;  1AWR A;  3FUK A;  3CVQ A;  4G26 A;  4GZC A;  2XEE A;  3FUJ A;  2X2A A;  5CMY A;  2AXZ A;  1CWM A;  4FLB A;  4HRL A;  4O8H A;  4I2W A;  3MML B;  3R57 A;  4W9R A;  2XGY B;  1FPP A;  3JXJ A;  2ALF A;  4FAD A;  2L6J A;  1UN9 A;  3QNK A;  2WQH A;  2QFC A;  5KV6 A;  2IO3 C;  1FGL A;  2HE9 A;  1WG0 A;  2X6J A;  3E30 A;  2MRI A;  4R3E A;  4B89 A;  4EQF A;  5HQ8 A;  3EIQ C;  1S0P A;  1NP7 A;  3S7J A;  1KZO A;  3UI2 A;  2KM4 A;  2DYR E;  4U95 D;  3FH8 A;  2CK1 A;  4L7T A;  1Z3Y A;  1Z81 A;  2BED A;  4I9Y A;  3RDB A;  4AP2 A;  4ATG A;  2XPI A;  2V5Q C;  4E1Q A;  4ME2 A;  2L6B A;  4HI9 A;  4FUL A;  3SZ7 A;  2JLB A;  4IYP A;  3JQ0 A;  3T8M A;  2R2L A;  3PNT B;  2E2E A;  2I1J A;  2FBN A;  3ICI A;  3X27 A;  1SZ9 A;  5KCM A;  4IPZ A;  2BIT X;  4LQW A;  4S1J A;  5AQA A;  2WXJ A;  2KC7 A;  1TNO A;  3QKY A;  2YHE A;  3B7U X;  3SBT B;  1VAI A;  2IOL A;  3DSU A;  3MV2 B;  2ZXW E;  3BQO A;  2WXK A;  4CYH A;  5CBT A;  1NZN A;  1ZKF A;  1C5F A;  4GTP A;  1BD8 A;  2KZT B;  5LOZ A;  2I2O A;  1TYQ G;  3ASD A;  3QDN A;  3HVE B;  4CT4 A;  3ZW3 A;  5D66 A;  2WXG A;  5EN5 D;  4J0U A;  1YYH A;  3UT4 A;  5E75 A;  4WWN A;  4A1S A;  5FQ4 A;  1XYH A;  2EQX A;  3ZNG A;  4GPM A;  1QYM A;  1EF1 C;  3DSX A;  5CBO A;  2BKK B;  1FVF A;  4RLY A;  4DGD A;  2F8Y A;  3L22 A;  2J9Q A;  2QER A;  4A55 A;  4KVM A;  3LY8 A;  1CWO A;  2WXR A;  2FU0 A;  3FU5 A;  5IY5 E;  4ZSD A;  3MV3 B;  1W3B A;  2NUL A;  1X5B A;  4GMJ A;  4J7W A;  1M9C A;  3K0P A;  1MX6 A;  5ARF A;  5KBA A;  4FHJ A;  4FRV A;  2P9K G;  3ASN E;  5BT1 A;  4N1N A;  1UJK A;  1B89 A;  3TWV A;  4HRN A;  2FF4 A;  3FHE A;  3MEK A;  4GA2 A;  4U04 A;  1KLX A;  1A58 A;  3FTS A;  5KV1 A;  2PZI A;  3HYM B;  4YUN A;  2C3B A;  3PE3 A;  5HI7 A;  3DXK G;  4C0M A;  3TJP A;  4JXT A;  4RVB A;  1HE8 A;  5AIJ A;  2IY0 C;  3PS6 A;  2IJG X;  2B0O E;  5JJT A;  3GW4 A;  4GYW A;  3RDC A;  3Q7A A;  1N4S A;  2YQ8 A;  2PM7 A;  4AM9 A;  2XEV A;  2VYI A;  5FZR A;  5EIL A;  3C5R A;  3U64 A;  3PH0 C;  2GW1 A;  2H6I A;  3C3Q A;  4L23 A;  3SHF A;  3L6A A;  3LJN A;  4U63 A;  2QZA A;  4APO A;  1VBT A;  1UJJ A;  4JW1 A;  2LXL A;  3IV0 A;  4AJW A;  5KV5 A;  1D9S A;  5JHB A;  3ICH A;  3LJ3 A;  2F8X K;  3KAE A;  1DNP A;  5JHE A;  4ILI A;  4I1A A;  3TWW A;  3ZHE B;  3EDT B;  4O1P A;  3TWR A;  4EPZ A;  2PNN A;  2PHC B;  3C98 A;  1KPS B;  1OCA A;  5CBV A;  5EX0 A;  4KBQ A;  4WNF A;  1EYH A;  1HZ4 A;  4DI3 A;  3JXI A;  2OEV A;  3ORE A;  1DC2 A;  1NA3 A;  3PZ2 A;  3B7R L;  1IHG A;  1N4R A;  2J08 A;  1AK4 A;  4M7C A;  5KV7 A;  1SA4 A;  2XPY A;  2HM8 A;  4GTS A;  1SZA A;  4V3I A;  5BUZ A;  2DBA A;  4NIK A;  4I6G A;  2XZD G;  3WXX A;  1OY3 D;  3N71 A;  3LXU X;  5ENR D;  3L17 A;  2CMT A;  4XX5 A;  5CRU A;  2PQR A;  1E7V A;  2J4B A;  4ANV A;  1OWO A;  2ESL A;  4OVV A;  3PZD A;  5EYL A;  3K0M A;  3O48 A;  1HG5 A;  5FQ6 A;  3ASO E;  4ILG A;  4GYO A;  3I5P A;  2VGE A;  3P2B A;  3RRU A;  2YNQ A;  1KT1 A;  4NUR A;  1N4Q A;  3ZXS A;  3LYA A;  1MHQ A;  3D9L A;  4ZHB A;  4I9C A;  4EZJ A;  1K3Z D;  3BU8 A;  2X6K A;  2IEJ A;  1HFA A;  1SQM A;  4CCA A;  4O6F A;  5AYW D;  1S64 A;  2LXM A;  1O5M A;  1IYG A;  5E76 A;  2LSV A;  4XZ4 A;  3G2W A;  4YDY A;  4CT0 A;  4DGB A;  3CK7 A;  3ML9 A;  2XGS A;  4N1S A;  4HLL A;  4LSZ E;  2HAQ A;  3WG7 E;  4J5B A;  2BUG A;  2GGF A;  1H0P A;  3E37 A;  1A33 A;  2QYJ A;  5ENN A;  2Q7F A;  5H7P A;  3ZRH A;  4BX8 A;  2I6H A;  1LF8 A;  4PS3 A;  2AXU A;  4EZK A;  5KUV A;  3R4G A;  3DPY A;  4I1O B;  3QWV A;  4A3V A;  3PMP A;  2CHX A;  5BPP A;  3OPF A;  1Z3X A;  5FZQ A;  4HB5 A;  1GW6 A;  2A2N A;  4AV7 A;  3FU3 A;  1JCR A;  1V9T A;  1MX4 A;  3QJZ A;  2IFU A;  2C0M A;  4HFG A;  4K5C A;  2HE0 A;  5ANL A;  4CGW A;  4CEM A;  1QOI A;  4HVB A;  4GML A;  5BV0 A;  1H6P A;  5LX8 A;  5EIB E;  3K0R A;  1G3N B;  2Y4T A;  3D9K A;  3QAQ A;  3KSQ A;  3MZL B;  5BW8 C;  2EIN E;  2X6F A;  3PRZ A;  4AIF A;  2XCB A;  3AAA C;  2WXL A;  4Y6C A;  2YIN A;  3BKP A;  3CHS A;  3ZYK A;  4DJA A;  4DPR A;  3OXL A;  5FIO A;  1NMK A;  5G04 C;  3OXF A;  3CQG B;  4B8A A;  2FUL A;  2WXQ A;  5D0O D;  2OSE A;  2OOE A;  2XS1 A;  5AEN A;  2V4L A;  3RCK X;  3W9G A;  2NXP A;  2ZIS A;  3L13 A;  3RCG A;  2R02 A;  3C3O A;  1OWN A;  1HX8 A;  2BKG A;  2GRL A;  1JWF A;  5T3R A;  2AXV A;  1MIK A;  3BO7 A;  4P29 A;  4UI9 C;  4NRH B;  1Z6T A;  3DSS A;  3Q73 A;  1OWM A;  4GZ6 A;  2L9B A;  4R3F A;  2Y0B G;  4UWF A;  3CK9 A;  2P9L G;  3GZS A;  5FZS A;  2A4Z A;  3UTM A;  5M72 A;  3J5P A;  2ZIR A;  4E85 A;  1H6O A;  3NOC D;  4N1Q A;  3CIA A;  3UM2 A;  3G2T A;  5A6C A;  4URK A;  3CVX A;  3ULQ A;  4F1P A;  2P2C P;  4HQD A;  4RG9 A;  3DST A;  3G2S A;  1Q2Z A;  4H7Y A;  3FUF A;  4O60 A;  2RMC A;  3AS8 A;  5AAO A;  3I4G A;  3V31 A;  4FA6 A;  5CEC B;  5KWD A;  2Y69 E;  1AWU A;  3SQV A;  4GCN A;  3D9H A;  3FU0 A;  4WAF A;  3FEX A;  1M9E A;  3C3R A;  2AVP A;  2XEH A;  2LO6 A;  4WND A;  3HXE A;  4CRW A;  2GRN B;  4FC8 A;  3PEV B;  3QB2 A;  5EID A;  3RKV A;  3UKR G;  4J8F A;  1MX2 A;  4F6R D;  3T9K A;  3UQ3 A;  2H6H A;  4GTV A;  3E33 A;  3MJW A;  4EHM A;  4UWH A;  3CHO A;  1HG2 A;  2R17 C;  4HNA D;  2MC9 A;  4LCT A;  4JZY A;  3I3N A;  1TJC A;  3FH5 A;  3GZ1 A;  4YUH A;  5KV2 A;  4LNB A;  4N39 A;  2P9S G;  3S6M A;  1CWI A;  4GA1 A;  1YA0 A;  3D9J A;  3QAR A;  4HS2 A;  1K1A A;  5JMN D;  4C0E A;  3MA5 A;  2A5U A;  3IBE A;  4YUI A;  4HOQ A;  4B94 A;  2M63 A;  1E8X A;  2ZGD A;  4I6E A;  2GRQ B;  4J8S A;  3MCX A;  4JA7 A;  5G55 A;  3S7D A;  3K0O A;  1D8E A;  3LEW A;  3VTY A;  5ENO D;  1CWC A;  1PC2 A;  4YDW A;  4DX7 D;  2RFA A;  2VGX A;  3UMV A;  2VTB A;  2WXF A;  4TOT A;  4DGA A;  4GCO A;  3DRA A;  4BSZ B;  1AWC B;  5CBN A;  5ENS D;  4JJM A;  4YVO A;  1SW6 A;  4N5Q A;  1OXJ A;  4E6H A;  3TWQ A;  3CVU A;  4DI4 A;  3RO2 A;  3E4B A;  1HXI A;  2J07 A;  5KUW A;  2MVZ A;  1H0A A;  3Q49 B;  3Q79 A;  3SD5 A;  1ZU2 A;  3MKQ A;  3CLJ A;  5BXU A;  3BG0 B;  3KEZ A;  3FTV A;  3ZU7 B;  3QWP A;  4PUC A;  4KT6 B;  4ACK A;  2JEK A;  2X3M A;  3D3M A;  3R9M A;  2YHC A;  5A7D B;  1FVH A;  1MQS A;  5LUD A;  5ARG A;  4HXI A;  4K5B A;  3Q47 B;  4FU3 A;  4J5E X;  3PVL A;  2IGW A;  3K2C A;  3EIJ A;  3QWW A;  3LDZ A;  2H6F A;  4J5D X;  1MZC A;  4RQI A;  1CWF A;  4YUO A;  1DYW A;  3R7Q A;  3NZU A;  2J49 A;  2WXI A;  3BT8 A;  3W9F A;  4G8K A;  3ODI A;  2WMO A;  3CGH A;  3ZGQ A;  4F7A A;  2XPZ A;  1V54 E;  3TAX A;  5F66 A;  3SY2 A;  2X6H A;  2AW6 A;  1TR4 A;  1OWP A;  4XEI G;  1TNY A;  4WNG A;  4EEC A;  1S70 B;  3D9N A;  1XQ7 A;  1EPU A;  3VLD A;  2X2D B;  4X8Q A;  1ELR A;  4KMO A;  4N3A A;  3L16 A;  3EHR A;  4YUP A;  1FT1 A;  4ZSC A;  1XGW A;  1XNF A;  3EUV A;  2WVI A;  1QBQ A;  3L82 A;  3FEY A;  1RW2 A;  3ESK A;  3CHM A;  3R9A B;  3CYH A;  4YVQ C;  1Y8M A;  4OYS A;  3CST A;  4OVU A;  4UQX A;  4B0Z A;  1V55 E;  3FUN A;  2P9P G;  2HQ6 A;  4K0R A;  2CFZ A;  4TRQ A;  1A5E A;  3PZ4 A;  4JHR A;  2LNI A;  4J59 A;  4UWL A;  4YUL A;  4N3B A;  2IU1 A;  3BG1 B;  3RCL A;  3B7T A;  2XGM A;  4D10 C;  3O7T A;  2PLU A;  2HO1 A;  3APC A;  3FUH A;  4J6I A;  1HO8 A;  2CPL A;  5JA4 D;  3TL5 A;  5T8I A;  1FT2 A;  3AG1 E;  3K0Q A;  3HXB A;  3AU5 A;  1CLH A;  3T1U A;  2ZGG A;  4AVX A;  3CVV A;  2JAB A;  3RJV A;  2GRP B;  3UX4 A;  4BET A;  2NYJ A;  3V2X A;  2AWI A;  2UY1 B;  3I4R B;  5FQ8 A;  3KSL A;  2WMN A;  4LER A;  4TV3 A;  4GPK A;  4FJZ A;  3LY7 A;  5KUN A;  1HS6 A;  3ABL E;  5CCS X;  4L2L A;  2P9N G;  1N52 A;  3FDH A;  4K03 A;  2RG8 A;  3T5V A;  1IST A;  2EIL E;  4JEU A;  5CCR A;  2BIU X;  5BNW A;  1E90 A;  5KUR A;  4ANX A;  2EIM E;  5EX3 A;  3ZN3 A;  4LNU D;  2IOS A;  3LVR E;  5ENP D;  3RAU A;  3AS4 A;  2KCV A;  4DGE A;  4YDE A;  2VSX E;  3FUE A;  4CGV A;  4LEU A;  3NF1 A;  4Q94 A;  1TJF A;  2OCC E;  4HOT A;  4U07 A;  5EDS A;  3RIB A;  5KJK A;  2Y3A A;  4DX1 A;  2B6C A;  4HOU A;  5LFA A;  3ZYQ A;  3MGB A;  3D9M A;  3NAW A;  4U0U A;  2PL2 A;  3AG3 E;  4JHJ A;  3ASH A;  3DXM G;  3LVQ E;  4KZC A;  1INZ A;  3KOP A;  3Q5M A;  4GZD A;  4DLQ A;  5KUZ A;  3RD9 X;  4ZFH A;  3ZXP A;  3UM1 A;  3DSW A;  3MYV A;  3CEQ A;  3AJI A;  2QY7 A;  3CKC A;  3VLE A;  3LS8 A;  1JCQ A;  2VSN A;  2KCK A;  4G2V A;  3V79 K;  2OEW A;  4GZ3 A;  3MML A;  4UI9 K;  4Y6W A;  3PZ3 A;  5AQ7 A;  5ENT D;  4IUL A;  2X7K A;  2OND A;  2R05 A;  1QZ2 A;  4L9P A;  2X83 B;  3NBN B;  1M9X A;  3IXE A;  3LY9 A;  1MJ0 A;  5EYP F;  4GZ5 A;  1ELK A;  4AEZ C;  3UM3 A;  3ZIM A;  3EU9 A;  2LAI A;  1O1T A;  4CDN A;  5AJL A;  4ABN A;  4DX5 D;  2QC9 A;  3FY4 A;  1EDU A;  4B93 B;  5AJD A;  3TWT A;  5AAR A;  1BPO A;  3D9P A;  3FTU A;  4EYV A;  4XKB A;  2LSU A;  3EHN A;  5ITZ F;  4CDR A;  4A3T A;  2F37 A;  1LD8 A;  2WB2 A;  3X2Q E;  3CYS A;  3CHP A;  4ANU A;  1VBS A;  3CHQ A;  4KVO A;  5CCN A;  3ULE G;  2IO2 C;  4YUJ A;  1UW4 B;  2L0I A;  4NAC A;  3PDN A;  4Z68 A;  1IIP A;  4I2Z A;  4QQI A;  2EIK E;  5C1D A;  2EIJ E;  3CKB A;  5CYH A;  1LOP A;  5CCQ A;  3D9O A;  4U8H A;  3PNL B;  3B7S A;  3JUE A;  2ZU6 B;  3EU5 A;  3S7B A;  3AG4 E;  1CWA A;  3ENE A;  2POY A;  4APF A;  4G11 A;  4DX2 A;  3RSE G;  2DIW A;  1XO7 A;  1U2V G;  2WXO A;  2CG2 A;  2HQJ A;  2DYS E;  2KZT A;  5CER B;  1OT8 A;  2GRM A;  3HVE A;  4FP7 A;  2Z6W A;  4HOR A;  4GTQ A;  1KT0 A;  5CHE E;  1WM5 A;  2RKK A;  4O1O A;  2DZO A;  4J8Y A;  1M9Y A;  4GB9 A;  4ILH B;  5CCL A;  5T4Y A;  3AS5 A;  3CV0 A;  1MYO A;  5AN8 A;  5G04 J;  2F0Y A;  1CWJ A;  5C2Y A;  1QNH A;  1OCZ E;  4BT8 A;  3TG5 A;  4PH4 B;  3Q75 A;  1HU3 A;  1W8M A;  3CQC B;  3TWX A;  4DRX E;  4DX6 D;  2X25 B;  5AQB A;  5J08 A;  3DEO A;  3ZFW A;  1IHB A;  3JQ1 A;  3GYZ A;  5KV0 A;  1X81 A;  2VJ8 A;  4UI9 J;  3T8K A;  5HKP A;  5FQ7 A;  4GTR A;  4LUN U;  3Q9N C;  4LG6 A;  4F3V A;  3RRN B;  1AWQ A;  3E32 A;  1M9D A;  4YDO A;  5A23 A;  3UIN C;  2KA0 A;  3E34 A;  3ISM C;  5G05 C;  3V30 A;  3ESL A;  4IRU A;  4UQY A;  1E3B A;  3APD A;  1U3C A;  2I1K A;  1ELW A;  1OCO E;  1ZKC A;  3V2O A;  4AOF A;  2J8S D;  3ZYM A;  4HOS A;  4U8V D;  4BWR A;  3EOV A;  1N95 A;  1AWS A;  5B1A E;  2OK3 A;  5DIZ A;  2WQ6 A;  3VA7 A;  1PY1 A;  5LCW C;  1Z5S C;  2I9C A;  3S2A A;  3UPV A;  5KJN A;  4GTM A;  3J5Q B;  4G8L A;  4FRU A;  1N9A A;  5JJ6 A;  4A1G A;  3CHR A;  2NC9 A;  1SA5 A;  4UWG A;  2KBX A;  3IHY A;  2ETA A;  4I9E A;  5HS0 A;  1BLX B;  2X2C K;  4A63 B;  3HXF A;  3K9I A;  1E8Z A;  5B3S E;  5FWQ A;  4N1O A;  3FTY A;  5G2N A;  4CYM D;  3ZHE A;  3ONL A;  3OAW A;  3ZPJ A;  2XEN A;  1M9F A;  3VTX A;  2V0P A;  2WFJ A;  2P0O A;  3APF A;  1WY6 A;  2V5F A;  4C9B B;  2N0T A;  3CR3 A;  2QYU A;  4EBA A;  5ENQ D;  2RD0 A;  5CED B;  1N0R A;  3SNX A;  1Y6I A;  3SBS A;  3HRA A;  2IQC A;  3CVY A;  5KV3 A;  4AY6 A;  1JWG A;  4DLO A;  3FUD A;  4KYO B;  2MOW A;  5B1B E;  4DUI A;  1E8K A;  4KZ0 A;  5FIN A;  1WDY A;  1AWV A;  4U0Z A;  3UCH A;  2VSY A;  3SFY A;  2K7N A;  3RFY A;  3PE4 A;  4N1P A;  3L54 A;  3G2U A;  4I43 A;  2XRZ A;  4JHK A;  1KZP A;  5CBU A;  3EJN A;  4HRM B;  3SGH A;  1CWL A;  4YUK A;  4BES A;  4QFV A;  3RO3 A;  3LKU A;  3QK0 A;  4MLP A;  5KV4 A;  2PM6 A;  3HHM A;  4K5A B;  2J09 A;  4JVS A;  2R5S A;  4FLH A;  2CG3 A;  4N2S A;  3JUI A;  3K0N A;  2ETC A;  4N2Q A;  3RRM B;  3UIP C;  4DGC A;  3CK8 A;  2VGY A;  3Q78 A;  1P5Q A;  2R99 A;  3HIZ A;  3ZKJ A;  3RK6 A;  3BEE A;  3R56 A;  3JYS A;  1QNF A;  2OVB A;  2LUH A;  3ULY A;  2MZU A;  4JPS A;  1N54 A;  3HXC A;  4KXK B;  3SF4 A;  1W8V A;  3FTX A;  1LTX A;  3CVP A;  2KXP C;  3L08 A;  2FI7 A;  4GU5 A;  3CVN A;  2OV8 A;  1D8D A;  4OAU C;  3NB2 A;  4BEP A;  2MS4 A;  2RS4 A;  1PAQ A;  4I17 A;  4UWK A;  4YUG A;  2CHZ A;  1U3D A;  4I1M A;  4N1R A;  1TN6 A;  4I6J A;  1NA0 A;  3T5X A;  4JA9 A;  4XNC A;  1S63 A;  2X6I A;  1TN7 A;  3AU4 A;  3SO8 A;  2DCP A;  3ODL A;  3KEA A;  4C48 B;  2WM9 A;  1UG3 A;  1N11 A;  4JEH A;  5J90 A;  3TWS A;  1O1S A;  1CWK A;  4UUC A;  1YND A;  4L1B A;  4RG6 A;  3MX3 A;  3Q7F A;  4XI0 A;  5AQ9 A;  3FU6 A;  1BI8 B;  2V8S E;  5FJY A;  3RDD A;  2MHK A;  2E0I A;  2WXN A;  3NQP A;  2ILR A;  3AG2 E;  2P58 C;  5D2M C;  4J58 A;  5D0Q D;  1YMP A;  2X38 A;  2C2L A;  2KAT A;  1K1B A;  3JCK C;  2WQ7 A;  3S7F A;  1H2V C;  3TWU A;  2RMA A;  3FTZ A;  5A0E A;  4AY5 A;  1BI7 B;  2IGV A;  1YCS B;  4F53 A;  3R59 A;  4BX9 A;  3HXD A;  1ZX8 A;  1H6K A;  2XHE A;  1N0Q A;  1QQE A;  2GRO B;  2CYH A;  3EHQ A;  2DZN A;  3UXG A;  3RDA X;  1RZ4 A;  3G2V A;  3RU0 A;  4Q69 A;  1TNU A;  2NSZ A;  4BY6 A;  1O1R A;  1TN8 A;  2P9I G;  5FT9 A;  3KD7 A;  2P9U G;  4UQZ A;  3Q9U C;  2J4D A;  4LRZ A;  4L2Y A;  3IKO B;  2WPV A;  2XGO A;  2IF4 A;  5KUO A;  2WXM A;  3ZVV A;  3UT8 A;  4BTB A;  5JHA A;  4YUM A;  1DCQ A;  1MF8 C;  4JC8 A;  4M3O A;  3URZ A;  2A5E A;  1H2U A;  4WWO A;  3QC1 A;  5CBW A;  4WUY A;  2CFU A;  1DCE A;  3R49 A;  3FTW A;  3CVW A;  4N5C A;  4DK5 A;  3UM0 A;  2XCC A;  3Q15 A;  2OJU A;  4TUM A;  1A17 A;  3VLF A;  4ATZ D;  4GYY A;  2L0T B;  4BFR A;  1AWT A;  4IN3 B;  1BCK A;  1TEZ A;  4PS8 A;  1IKN D;  3F6Q A;  5KNH D;  4Q96 A;  2WLW A;  3P1U A;  2VSO E;  2VGX B;  2DVW A;  2VTB B;  3FH7 A;  4PDX A;  3IHV A;  1JCS A;  4LNG A;  4MRU A;  4S1E A;  2CFE A;  4TXP A;  1NFI E;  3ZEF A;  1ZBP A;  3ML8 A;  4JB8 P;  5KUU A;  3FWV A;  3DWL G;  4XIF A;  3PUJ A;  1K8K G;  1TNB A;  2OVF A;  2KCL A;  2MYO A;  4FJY A;  4EBA G;  1L5J A;  3ONK A;  2WXP A;  2HYZ A;  3PZ1 A;  4J5C X;  4GTT A;  3ABM E;  4O8I A;  2XZT G;  2RMB A;  3MKQ B;  4JD2 G;  3SFZ A;  3C72 A;  3KS2 A;  3ZYL A;  1MZW A;  2HR2 A;  2Y1L E;  5KNG A;  2ZP2 A;  3IEG A;  5CRV A;  1RMH A;  3FP3 A;  3MKR A;  2FO1 E;  4HBD A;  4U8Y D;  3B13 A;  1VDY A;  4WNE A;  2POE A;  3RCF A;  4B8C B;  4U0S A;  3NZS A;  3DEP A;  2R03 A;  3PUK A; 
#chains in the Genus database with same CATH homology
 3EOV A;  4FU3 A;  4RSY A;  1AWS A;  4J5E X;  3U64 A;  1JPL A;  3PH0 C;  2GW1 A;  2OK3 A;  2XQ0 A;  3PVL A;  2CHW A;  5DIZ A;  5LP0 A;  2IGW A;  2WQ6 A;  4L23 A;  3SHF A;  3VA7 A;  3K2C A;  1PY1 A;  3EIJ A;  3QWW A;  3LDZ A;  5LCW C;  2I9C A;  3S2A A;  3UPV A;  4J5D X;  3L6A A;  3DBS A;  4U63 A;  5ANR A;  3U4T A;  2LAH A;  4APO A;  5KJN A;  3R7R A;  3U3W A;  1VBT A;  1UJJ A;  4JW1 A;  3IV0 A;  4AJW A;  5KV5 A;  4FRU A;  1CWF A;  5JJ6 A;  4A1G A;  5JHB A;  4YUO A;  3CHR A;  2NC9 A;  3LJ3 A;  1DYW A;  3ICH A;  3KAE A;  1DNP A;  4UWG A;  5JHE A;  4ACL A;  3OEP A;  3IHY A;  3NZU A;  3R7Q A;  2J49 A;  4ILI A;  2WXI A;  4I9E A;  3BT8 A;  1OWL A;  3ODI A;  2X2C K;  4I1A A;  3ZHE B;  5CCM A;  3OXG A;  1HF8 A;  3EDT B;  3PRE A;  3LPZ A;  2WMO A;  3LCA A;  4MS6 A;  4EPZ A;  3K9I A;  2B71 A;  1E8Z A;  3CGH A;  3ZGQ A;  2XPZ A;  4BT9 A;  4F7A A;  1H19 A;  3TAX A;  2FO7 A;  3C98 A;  5FWQ A;  3FTY A;  5EX0 A;  5G2N A;  1OCA A;  2PHC B;  4N1O A;  5F66 A;  2X6H A;  2AW6 A;  4KBQ A;  4WNF A;  3ZHE A;  1M63 C;  1OWP A;  4GAA A;  3ONL A;  1EYH A;  4BSX A;  1HZ4 A;  3FUM A;  2WXH A;  4WNG A;  1UN8 A;  4EEC A;  3SI5 A;  4DI3 A;  1CWH A;  5BV1 A;  2BF0 X;  3D9N A;  3CSF A;  3TXN A;  1XQ7 A;  3ORE A;  1EPU A;  3OAW A;  4J5A X;  1NA3 A;  3ZPJ A;  1H2T C;  3VLD A;  3B7R L;  3U66 A;  2X2D B;  1ELR A;  3VTX A;  1M9F A;  1IHG A;  4KMO A;  4N3A A;  2V0P A;  2WFJ A;  2P0O A;  1ZMF A;  3L16 A;  4EZL A;  3APF A;  2J08 A;  1WY6 A;  1AK4 A;  2V5F A;  4C9B B;  2N0T A;  2BTD A;  2XPY A;  4YUP A;  5KV7 A;  1CWB A;  4NQ0 A;  2HM8 A;  3CR3 A;  4ZSC A;  1SZA A;  1XGW A;  3PEU B;  4V3I A;  4EBA A;  5BUZ A;  1XNF A;  2DBA A;  2WVI A;  2RD0 A;  4I6G A;  3SNX A;  5KUQ A;  3FEY A;  1Y6I A;  3SBS A;  3WXX A;  3ESK A;  2IQC A;  3CHM A;  3R9A B;  3N71 A;  3LXU X;  3CVY A;  5KV3 A;  2FEZ A;  4AY6 A;  3L17 A;  2CMT A;  4XX5 A;  1JWG A;  3CYH A;  2PQR A;  4YVQ C;  1E7V A;  1Y8M A;  2J4B A;  4DLO A;  3FUD A;  3CST A;  2MOW A;  4KYO B;  4OYS A;  4TUU A;  4OVU A;  2C0L A;  4ANV A;  1OWO A;  4UQX A;  2ESL A;  4OVV A;  3PZD A;  3ASF A;  3TXM A;  1E8K A;  2WFI A;  1CYN A;  4KZ0 A;  4B0Z A;  3O48 A;  3K0M A;  3FUN A;  2HQ6 A;  1HG5 A;  5FQ6 A;  3HDX A;  3Q4A B;  4H7X A;  4ILG A;  2PQN A;  4K0R A;  2CFZ A;  4GYO A;  4TRQ A;  4XKC A;  3I5P A;  1JUQ A;  5FTP A;  1E96 B;  1AWV A;  3P2B A;  3RRU A;  4G23 A;  4U0Z A;  2GW2 A;  2YNQ A;  3FUI A;  3DPD A;  4JHR A;  5JJ7 A;  1KT1 A;  2VSY A;  3UUX A;  4NUR A;  2LNI A;  3TGO A;  2K7N A;  4J59 A;  4N1M A;  5KUL A;  3ZXS A;  3LYA A;  1MHQ A;  1OUV A;  1IQU A;  3O4Z A;  3D9L A;  4UWL A;  1VDN A;  3RFY A;  3PE4 A;  3OTN A;  4I9C A;  4EZJ A;  4HLE A;  4YUL A;  5DUD A;  4N1P A;  2X6K A;  3L54 A;  4N3B A;  1HFA A;  2IU1 A;  1SQM A;  3G2U A;  4G25 A;  4CCA A;  4I43 A;  5KJM A;  3BG1 B;  4O6F A;  2XRZ A;  4JHK A;  3RCL A;  3B7T A;  5AYW D;  2XGM A;  4AXH A;  5CBU A;  3EJN A;  4CDM A;  4JL0 A;  3SGH A;  2UWJ G;  3FUL A;  4D10 C;  3O7T A;  3JB9 d;  4BTA A;  2PLU A;  1CWL A;  2HO1 A;  3APC A;  3FUH A;  1IYG A;  3UCH A;  5E76 A;  3EHM A;  2LSV A;  1E7U A;  1HO8 A;  3FFL A;  3G2W A;  4J6I A;  4XZ4 A;  4CT0 A;  2CPL A;  4DGB A;  4YUK A;  2R59 A;  3RCI X;  3CK7 A;  3TL5 A;  4QFV A;  3ML9 A;  5T8I A;  1E8W A;  5EKQ D;  3K0Q A;  2XGS A;  3RO3 A;  4JCP A;  3GZ2 A;  3LKU A;  3QK0 A;  4MLP A;  2HAQ A;  3R54 A;  4J5B A;  2BUG A;  2GGF A;  5KV4 A;  1H0P A;  3AU5 A;  4G24 A;  1CLH A;  1DVP A;  3T1U A;  2PM6 A;  3HHM A;  1A33 A;  4AVX A;  4HY7 A;  5ENN A;  2Q7F A;  3CVV A;  2J09 A;  4JVS A;  3ZRH A;  2R5S A;  4FLH A;  3RJV A;  4BX8 A;  3TG4 A;  2I6H A;  5G05 J;  1LF8 A;  4PS3 A;  4R7L A;  2AXU A;  3U9W A;  2CG3 A;  3UX4 A;  4EZK A;  1XWN A;  5KUV A;  3UT7 A;  2AWI A;  3JUI A;  4N2S A;  3R4G A;  2UY1 B;  3I4R B;  3K0N A;  5FQ8 A;  4I1O B;  2WMN A;  3QWV A;  4A3V A;  4N2Q A;  3PMP A;  3RRM B;  4LER A;  4TV3 A;  4DGC A;  3CK8 A;  2CHX A;  4GPK A;  4YND A;  5BPP A;  3OPF A;  4N3C A;  1Z3X A;  2VGY A;  5FZQ A;  1FCH A;  4FJZ A;  1QNG A;  3LY7 A;  1GW6 A;  5KUN A;  1P5Q A;  1HS6 A;  4MKT A;  4AV7 A;  3FU3 A;  1W74 A;  4L2L A;  1V9T A;  2A2N A;  2R99 A;  5CCS X;  3HIZ A;  3QJZ A;  1N52 A;  2UY1 A;  2IFU A;  2C0M A;  4HFG A;  3RK6 A;  2VQ2 A;  3FDH A;  4K03 A;  2ION A;  4GA0 A;  5ANL A;  3BEE A;  3R56 A;  3QOU A;  2RG8 A;  4CGW A;  3JYS A;  5CBV A;  3T5V A;  4CEM A;  1IST A;  1QNF A;  1QOI A;  4HVB A;  4JEU A;  2OVB A;  5CCR A;  4GML A;  5BV0 A;  5LX8 A;  2BIU X;  3K0R A;  2MZU A;  5BNW A;  4JPS A;  1E90 A;  4F1S A;  2Y4T A;  1N54 A;  3D9K A;  3QAQ A;  4ANX A;  5EX3 A;  1IQR A;  1HH8 A;  4J8D A;  4KXK B;  3MZL B;  3SF4 A;  5BW8 C;  1WAO 1;  1W8V A;  4G1T A;  3FTX A;  3QYU A;  3D9I A;  3ZN3 A;  2X6F A;  2IOS A;  3PRZ A;  3CVP A;  4WWP A;  3LVR E;  3L08 A;  4J8E A;  5LCW J;  2FI7 A;  4GU5 A;  4AIF A;  3CVN A;  2OV8 A;  3CVL A;  2XCB A;  1J2A A;  1X7F A;  3AS4 A;  3ASG A;  2KCV A;  2WXL A;  4DGE A;  5DBK A;  2VSX E;  2MS4 A;  3FUE A;  4CGV A;  4LEU A;  2RS4 A;  3NF1 A;  4Q94 A;  4Y6C A;  2YIN A;  1TJF A;  3BKP A;  3CHS A;  1PAQ A;  3ZYK A;  4I17 A;  4PS7 A;  4XI9 A;  4UWK A;  4DJA A;  4YUG A;  4DPR A;  2CHZ A;  3OXL A;  1U3D A;  4HOT A;  5KJL A;  4U07 A;  1NMK A;  4I1M A;  3RIB A;  5EDS A;  5KJK A;  5G04 C;  2Y3A A;  3CQG B;  3OXF A;  1NA0 A;  2FUL A;  2WXQ A;  4I6J A;  3T5X A;  4B8A A;  1W8L A;  2XRY A;  4JA9 A;  4HOU A;  5LFA A;  4XNC A;  4XE0 A;  5D0O D;  3ZYQ A;  3MGB A;  2X6I A;  3AU4 A;  3D9M A;  2OOE A;  2OSE A;  5KUS A;  4U0U A;  5AEN A;  2DCP A;  3ODL A;  2PL2 A;  4JHJ A;  2V4L A;  3ASH A;  3RCK X;  4ANW A;  4FHK A;  3LVQ E;  4KZC A;  1INZ A;  2WM9 A;  3Q5M A;  1UG3 A;  2Y4U A;  1E8Y A;  4GZD A;  5CMW A;  1AWR A;  2NXP A;  4JEH A;  5J90 A;  4DLQ A;  5KUZ A;  3FUK A;  3CVQ A;  3L13 A;  4G26 A;  4GZC A;  3RCG A;  3FUJ A;  1OWN A;  5CMY A;  2AXZ A;  1HX8 A;  2X2A A;  3RD9 X;  1CWM A;  1CWK A;  2GRL A;  1JWF A;  4FLB A;  5T3R A;  1YND A;  4L1B A;  2AXV A;  1MIK A;  4O8H A;  4RG6 A;  3BO7 A;  3MX3 A;  3MYV A;  4P29 A;  4I2W A;  3CEQ A;  4UI9 C;  3MML B;  4NRH B;  4XI0 A;  1Z6T A;  2QY7 A;  3CKC A;  1OWM A;  3R57 A;  4W9R A;  4GZ6 A;  3VLE A;  2XGY B;  3LS8 A;  2L9B A;  2VSN A;  2KCK A;  3FU6 A;  4R3F A;  4G2V A;  2ALF A;  4FAD A;  2L6J A;  4GZ3 A;  1UN9 A;  2V8S E;  4UWF A;  5FJY A;  3CK9 A;  3QNK A;  2WQH A;  3MML A;  4UI9 K;  2MHK A;  3GZS A;  2E0I A;  2QFC A;  3RDD A;  5KV6 A;  5FZS A;  2A4Z A;  4Y6W A;  5M72 A;  1FGL A;  2WXN A;  3NQP A;  2HE9 A;  4IUL A;  2ILR A;  2OND A;  2X7K A;  2P58 C;  1QZ2 A;  2X83 B;  4J58 A;  2X6J A;  4E85 A;  2MRI A;  1M9X A;  3LY9 A;  5D0Q D;  4R3E A;  4B89 A;  4EQF A;  4N1Q A;  5HQ8 A;  3EIQ C;  1S0P A;  2X38 A;  1NP7 A;  3CIA A;  3G2T A;  2C2L A;  2KAT A;  3JCK C;  2WQ7 A;  3S7F A;  5A6C A;  4URK A;  1H2V C;  4GZ5 A;  3S7J A;  2RMA A;  3FTZ A;  2KM4 A;  1ELK A;  4AY5 A;  5A0E A;  3CVX A;  3ULQ A;  3FH8 A;  4AEZ C;  3ZIM A;  4N1R A;  2CK1 A;  2IGV A;  2LAI A;  4F53 A;  4L7T A;  4RG9 A;  3R59 A;  3G2S A;  1Z3Y A;  4H7Y A;  4BX9 A;  3FUF A;  4CDN A;  1Z81 A;  1H6K A;  4I9Y A;  3RDB A;  5AJL A;  2XHE A;  4AP2 A;  2RMC A;  4ABN A;  4ATG A;  1QQE A;  2XPI A;  3AS8 A;  2CYH A;  3FY4 A;  4E1Q A;  1EDU A;  5AJD A;  3I4G A;  3RDA X;  4ME2 A;  1BPO A;  4FA6 A;  3D9P A;  3FTU A;  4EYV A;  3G2V A;  1AWU A;  3RU0 A;  4XKB A;  4Q69 A;  4FUL A;  3SZ7 A;  2NSZ A;  2LSU A;  4GCN A;  2JLB A;  3EHN A;  3JQ0 A;  4IYP A;  3T8M A;  4BY6 A;  4CDR A;  3FU0 A;  4WAF A;  3FEX A;  1M9E A;  4A3T A;  5FT9 A;  3KD7 A;  4UQZ A;  3PNT B;  2E2E A;  2I1J A;  2WB2 A;  2FBN A;  3CYS A;  2AVP A;  2J4D A;  3CHP A;  4LRZ A;  4L2Y A;  4ANU A;  3IKO B;  1SZ9 A;  2WPV A;  3CHQ A;  5KCM A;  1VBS A;  2LO6 A;  4KVO A;  4IPZ A;  2XGO A;  2BIT X;  2IF4 A;  4LQW A;  5CCN A;  4WND A;  4S1J A;  5KUO A;  4YUJ A;  2WXM A;  1UW4 B;  2KC7 A;  2WXJ A;  4FC8 A;  3UT8 A;  3ZVV A;  4BTB A;  3QKY A;  4CRW A;  2YHE A;  3PEV B;  3QB2 A;  3RKV A;  5JHA A;  2L0I A;  3B7U X;  4NAC A;  4YUM A;  1MF8 C;  4J8F A;  3SBT B;  3PDN A;  1VAI A;  4JC8 A;  2IOL A;  3UQ3 A;  4M3O A;  3MV2 B;  1IIP A;  4I2Z A;  3URZ A;  3ICI A;  5C1D A;  2WXK A;  4CYH A;  5CBT A;  3CKB A;  5CYH A;  1NZN A;  1H2U A;  1LOP A;  4WWO A;  5CCQ A;  3D9O A;  3QC1 A;  1ZKF A;  4U8H A;  1C5F A;  3MJW A;  4UWH A;  3CHO A;  5CBW A;  1HG2 A;  2R17 C;  2CFU A;  4WUY A;  4LCT A;  3PNL B;  2MC9 A;  3B7S A;  4JZY A;  3I3N A;  1TJC A;  2KZT B;  2ZU6 B;  5LOZ A;  3FH5 A;  3FTW A;  3GZ1 A;  2I2O A;  3S7B A;  3CVW A;  1CWA A;  3ENE A;  3R49 A;  2POY A;  4APF A;  4G11 A;  3ASD A;  3QDN A;  3HVE B;  4N5C A;  5KV2 A;  4CT4 A;  4DK5 A;  4YUH A;  2DIW A;  4N39 A;  3ZW3 A;  1XO7 A;  3S6M A;  2WXO A;  2CG2 A;  1CWI A;  2HQJ A;  2WXG A;  4GA1 A;  4J0U A;  1YA0 A;  2KZT A;  3D9J A;  3QAR A;  4HS2 A;  2XCC A;  3UT4 A;  3Q15 A;  2OJU A;  5E75 A;  2GRM A;  3HVE A;  4FP7 A;  1A17 A;  2Z6W A;  3VLF A;  4WWN A;  4GYY A;  2L0T B;  4C0E A;  3MA5 A;  4BFR A;  4HOR A;  4A1S A;  1AWT A;  5FQ4 A;  4IN3 B;  1BCK A;  1TEZ A;  2A5U A;  2EQX A;  1KT0 A;  3IBE A;  1XYH A;  4PS8 A;  4HOQ A;  5CHE E;  1EF1 C;  4YUI A;  1WM5 A;  4B94 A;  2M63 A;  1E8X A;  1FVF A;  4I6E A;  4J8S A;  3MCX A;  4Q96 A;  1M9Y A;  4DGD A;  2WLW A;  3P1U A;  4GB9 A;  3L22 A;  4ILH B;  4JA7 A;  2VSO E;  5G55 A;  3S7D A;  5CCL A;  3K0O A;  2J9Q A;  2VGX B;  5T4Y A;  3AS5 A;  2VTB B;  3CV0 A;  2QER A;  3LEW A;  3FH7 A;  3VTY A;  5G04 J;  4PDX A;  4KVM A;  4A55 A;  3IHV A;  3LY8 A;  1CWO A;  2WXR A;  1CWJ A;  1CWC A;  5C2Y A;  1QNH A;  2FU0 A;  4MRU A;  4BT8 A;  1PC2 A;  3FU5 A;  4S1E A;  3TG5 A;  2CFE A;  4PH4 B;  1HU3 A;  3UMV A;  2VGX A;  1W8M A;  2VTB A;  2WXF A;  3CQC B;  4DGA A;  4TOT A;  4ZSD A;  3MV3 B;  4GCO A;  1W3B A;  3ZEF A;  2NUL A;  1ZBP A;  3ML8 A;  1X5B A;  4GMJ A;  1M9C A;  3K0P A;  2X25 B;  5ARF A;  5KUU A;  3FWV A;  4JJM A;  4XIF A;  4FHJ A;  4YVO A;  3PUJ A;  5J08 A;  4FRV A;  5BT1 A;  4N1N A;  2OVF A;  2KCL A;  3ZFW A;  4FJY A;  4EBA G;  1UJK A;  3JQ1 A;  3GYZ A;  5KV0 A;  1L5J A;  3ONK A;  2WXP A;  1B89 A;  2VJ8 A;  4UI9 J;  2HYZ A;  4E6H A;  4J5C X;  5FQ7 A;  2FF4 A;  3FHE A;  3MEK A;  3CVU A;  4LUN U;  4DI4 A;  4N1S A;  4GA2 A;  3RO2 A;  4O8I A;  4F3V A;  2RMB A;  3MKQ B;  4U04 A;  3RRN B;  1AWQ A;  3E4B A;  1HXI A;  1M9D A;  2J07 A;  3SFZ A;  3KS2 A;  1KLX A;  3ZYL A;  1A58 A;  5A23 A;  3FTS A;  2MVZ A;  5KUW A;  1H0A A;  3Q49 B;  1MZW A;  2HR2 A;  5KV1 A;  3SD5 A;  2PZI A;  3HYM B;  4YUN A;  2C3B A;  3PE3 A;  5HI7 A;  1ZU2 A;  3MKQ A;  3CLJ A;  4C0M A;  2ZP2 A;  5G05 C;  3TJP A;  3ESL A;  4JXT A;  3BG0 B;  3IEG A;  3KEZ A;  1HE8 A;  4IRU A;  4RVB A;  3FTV A;  5AIJ A;  1RMH A;  3FP3 A;  3MKR A;  3PS6 A;  4UQY A;  3QWP A;  4PUC A;  2IJG X;  4KT6 B;  2JEK A;  2X3M A;  4ACK A;  1E3B A;  3APD A;  1U3C A;  3D3M A;  3B13 A;  1VDY A;  4WNE A;  2YHC A;  5JJT A;  2POE A;  2I1K A;  1ELW A;  5A7D B;  1FVH A;  1ZKC A;  3RCF A;  1MQS A;  5LUD A;  3GW4 A;  5ARG A;  4AOF A;  4GYW A;  4B8C B;  3RDC A;  4HXI A;  4U0S A;  3NZS A;  2YQ8 A;  2PM7 A;  3ZYM A;  3Q47 B;  4AM9 A;  2XEV A;  2VYI A;  5FZR A;  4HOS A;  4BWR A;  5KUR A;  3PUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...