1IHGA

Bovine cyclophilin 40, monoclinic form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
364
structure length
364
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin 40
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
total genus 130
structure length 364
sequence length 364
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ihgA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1ihgA01
2HQ6A 3UCHA 5KUWA 4GA1A 3Q4AB 5CCLA 2XGYB 2X7KA 1CWFA 1XNFA 1CYNA 4YUHA 3Q47B 3BEEA 2Z6WA 4JHRA 1QNGA 3Q5MA 3BO7A 4N3BA 1M9XA 2FF4A 4J5EX 1YA0A 1IHGA 2OOEA 4G25A 1FGLA 3RDAX 3K0QA 4YNDA 1ELRA 2X25B 3MMLA 2CFEA 2K7NA 2CYHA 1PC2A 4WNGA 4GYOA 1J2AA 1ZBPA 2KCVA 1KT1A 5CHEE 1XWNA 1CLHA 3AS4A 2XGMA 3OXLA 4BTBA 4LEUA 1VAIA 4J5DX 4XIFA 4KBQA 4S1EA 2MHKA 4F3VA 5KV7A 3GZ1A 2MC9A 4J5AX 2LSVA 2UY1A 1TJCA 2QERA 4HY7A 2OJUA 1M9FA 3O7TA 1M9DA 4I9YA 3TGOA 3ASGA 4YVOA 3RO3A 2X2DB 2KC7A 3EOVA 1W8LA 5CCMA 1WM5A 5BNWA 3GZ2A 2VQ2A 4N5CA 2NULA 4HOUA 4FRVA 3S7FA 4N1OA 2XEVA 5KUQA 3GYZA 4YULA 4CGVA 2R5SA 1BCKA 2C2LA 5ARFA 4H7YA 3CVNA 3R49A 3ZN3A 4YUGA 4DGBA 1A17A 3RIBA 3CYSA 3RKVA 1E3BA 3JB9d 3EDTB 3QYUA 3S6MA 1NMKA 5D0QD 1FCHA 4JL0A 5KJMA 4EQFA 1VBTA 4XI0A 5KV3A 1CWAA 4GA2A 2KCLA 3CK7A 4WUYA 4WNEA 4AY5A 1CWOA 4W9RA 2QFCA 2YQ8A 4IN3B 4BT9A 1V9TA 3UPVA 4GPKA 2RMAA 5KUVA 2HAQA 1W8MA 1QZ2A 2HE9A 3RCKX 4I9EA 1CWJA 2GW2A 2PQRA 5CCNA 5JJTA 5LCWC 4AIFA 3K0RA 4I9CA 5CCSX 3ZHEB 3U4TA 4N39A 4YUPA 4CDRA 3AS5A 2JLBA 1ZKFA 2X83B 5FT9A 3CKBA 3VA7A 4GA0A 3S7BA 5KV0A 2RS4A 3LYAA 2FEZA 5G05J 4U0SA 4HORA 4A1SA 4ABNA 1W74A 3RDBA 4FRUA 3QKYA 4UI9C 4GYWA 1W3BA 2IGWA 1MIKA 3BKPA 3ASHA 1HXIA 5FZRA 2XPIA 3IEGA 3RCIX 2BUGA 2B71A 3R4GA 1IIPA 4BWRA 5BT1A 4YUMA 2L6JA 2WFJA 1CWLA 4O8HA 3ZGQA 5C1DA 2GW1A 1QNHA 1VBSA 4AY6A 1B89A 2ONDA 4EYVA 3RCFA 3ASFA 4U0ZA 2X2CK 4UQXA 4HOTA 1CWHA 2MVZA 2YHCA 3K0NA 4APOA 3CVPA 3UQ3A 3FP3A 3PMPA 1YNDA 5FZQA 5KUOA 4J0UA 5DUDA 2NC9A 1AWTA 3OEPA 3ODLA 4J5CX 3RD9X 2XGSA 4YUIA 4HOQA 2ZP2A 3K0OA 4O8IA 1ZU2A 4I17A 5FTPA 3OPFA 2VGXB 5G04C 3CK8A 1AWQA 3OXGA 4O6FA 4HOSA 5CBTA 3TAXA 3ULQA 5KV6A 4J59A 4G23A 4I2WA 1CWCA 1OCAA 4G2VA 3Q15A 2V5FA 1NA3A 2VGYA 4DGCA 2Y4UA 4H7XA 5CBUA 3LKUA 2FBNA 4E1QA 2KATA 1H0PA 2VSNA 5KV4A 2RMCA 4GCOA 5KJKA 2ALFA 1QOIA 3CKCA 5EX0A 5JJ6A 4NRHB 3RU0A 1QQEA 2Q7FA 1A58A 4J8EA 1AWRA 3CV0A 1AWUA 4B94A 4GCNA 1M9YA 2WQHA 4AM9A 2HR2A 4GZ3A 2J9QA 3NF1A 5FJYA 1AK4A 2WLWA 3ZFWA 2IGVA 2RMBA 3PDNA 2IFUA 2I6HA 1LOPA 4YUJA 1Z81A 3R57A 4JA9A 1NZNA 2FU0A 3PE3A 3S7JA 5M72A 3KS2A 3OXFA 4UI9K 1CWMA 2A2NA 3URZA 4R3EA 4NQ0A 2PLUA 4CGWA 3RJVA 3R56A 3K9IA 5LCWJ 3LPZA 2POEA 4ZSCA 3MMLB 4XI9A 5EKQD 3QWWA 3BT8A 1XYHA 4N1RA 4YUKA 3HYMB 3CEQA 1XO7A 4RG6A 2ESLA 4N2SA 4J5BA 3T1UA 1KT0A 4UI9J 4GZ6A 2XCCA 5KJLA 3ESKA 3R9AB 5JHEA 2BIUX 1DYWA 1A33A 2UY1B 3KD7A 3RFYA 4JCPA 5KULA 3GW4A 3RDDA 3LY8A 3VTYA 2OK3A 4RG9A 1P5QA 4YUNA 3ODIA 2R99A 2P0OA 5BW8C 3MV2B 4N1MA 2CK1A 3QOUA 1WAO1 4Y6CA 4N1NA 1W8VA 1E8KA 3RCLA 4YUOA 3TG4A 3AS8A 2CPLA 4TOTA 5DIZA 2E2EA 1OUVA 4U07A 2XGOA 3N71A 5FZSA 4N2QA 3ICHA 2WFIA 3RO2A 3PE4A 3O48A 4ZSDA 5EX3A 2CMTA 4UQYA 1VDNA 4N1SA 5CCQA 3CK9A 4DGDA 3R59A 4S1JA 2X2AA 4N3AA 2DBAA 5G04J 1C5FA 2AVPA 2LNIA 2FO7A 1Y8MA 3ZHEA 2HYZA 1CWBA 5KV5A 1M9EA 3LY7A 3RDCA 4G26A 3LCAA 5HQ8A 2MS4A 5KUSA 3CVLA 2PZIA 3QWVA 1AWSA 5HI7A 3SZ7A 3SF4A 5JJ7A 3CYHA 3JYSA 4DGEA 4G24A 1X7FA 4GZ5A 4R3FA 5A7DB 2FI7A 3K2CA 3OREA 2OSEA 3LY9A 3MKRA 1HZ4A 1XQ7A 3K0PA 1ZMFA 5KUZA 4JJMA 5A0EA 1CWIA 5KJNA 5CBVA 2IF4A 4I1AA 2C3BA 2LSUA 5DBKA 3ICIA 2PL2A 3TG5A 5KV2A 3VTXA 2PQNA 3ZPJA 2XCBA 2HQJA 5CYHA 4YVQC 2KCKA 3RCGA 5CCRA 4BTAA 4ME2A 4N1PA 2UWJG 4XNCA 5CBWA 3FFLA 1ZKCA 2Y4TA 4JA7A 1AWVA 5KV1A 5D0OD 3WXXA 4CYHA 4J8FA 2VGXA 3MEKA 4J8DA 1MF8C 3R54A 4N3CA 5A6CA 4WNDA 3QDNA 4J58A 4I2ZA 4U0UA 3MA5A 3Q49B 1MZWA 4IPZA 3CVQA 5KUNA 3S7DA 3ASDA 5LUDA 2C0LA 2POYA 1ISTA 2VSYA 3QWPA 2N0TA 1CWKA 2C0MA 3FWVA 4LQWA 3E4BA 4UQZA 5F66A 3K0MA 3UUXA 1IYGA 1M63C 4KXKB 3KAEA 4U04A 2WPVA 4N1QA 3MV3B 1ELWA 4KYOB 2BITX 1NA0A 5ARGA 5G05C 2P58C 4GYYA 3U3WA 1E96B 2HO1A 5AYWD 4WNFA 4DGAA 1RMHA 1HH8A 4BT8A 2PHCB 4Y6WA 2VYIA 5KURA 1KLXA 2MZUA 5KUUA 4G1TA 1M9CA
chains in the Genus database with same CATH superfamily
1LD8A 3FUFA 1CWFA 3SGHA 4YUHA 4ANVA 4DLOA 4JHRA 1QNGA 4BSXA 3DSUA 4GZDA 2WXPA 2BF0X 1M9XA 4GMLA 2FF4A 1XGWA 1YA0A 5T8IA 4G25A 4CT0A 4GMJA 3UT8A 4YNDA 4A1GA 1K1AA 5CECB 1PC2A 4WNGA 4EECA 2BEDA 1XWNA 1CLHA 5FQ7A 4LNBA 3UKUG 3C3OA 1VAIA 5AQ9A 3D9OA 4S1EA 2WXNA 3CHOA 2LSVA 3BG0B 1M9FA 4IYPA 3U66A 1E8WA 1FT1A 1KZOA 3DXMG 1TN6A 3FUIA 2BKGA 4FRVA 3S7FA 3PVLA 4NIKA 4N1OA 2XEVA 1V55E 3MZLB 1BCKA 3LXUX 5ARFA 4H7YA 3FDHA 1HFAA 1TJFA 3G2UA 4BEPA 3R49A 4YUGA 4DGBA 3FEYA 2ETAA 2I1JA 5JMND 3RSEG 1Z3YA 1TNYA 4LNUD 4JEHA 4GTRA 4CT4A 4XI0A 2MRIA 5KV3A 4WUYA 1OCOE 3D9IA 2QYUA 2WXIA 1G3NB 2BKKB 2GRQB 2XEEA 3DSTA 1QBQA 1W8MA 1QZ2A 4I9EA 1CWJA 4FLHA 3CSTA 3ONLA 1WY6A 2H6HA 4DX2A 5CCSX 2IONA 4CDRA 2GRPB 2EILE 4BERA 3TWXA 4GA0A 5KV0A 5G05J 4U0SA 3PNTB 1JCQA 3RDBA 4FRUA 1E7VA 4GYWA 5ANLA 2QY7A 1UG3A 1MIKA 3G2WA 3RCIX 1U2VG 3EIJA 2WXHA 4HQDA 3FH8A 4KZ0A 1CWLA 2PM6A 4AP2A 3MGBA 3TWTA 1QNHA 1VBSA 4AY6A 1B89A 3ZUVB 2XRYA 4EYVA 1OWNA 3RCFA 4MKTA 4U0ZA 2X2CK 3QC1A 4J8SA 4KVMA 3EU9A 3PZ2A 3C72A 4APOA 5BPPA 4OAUC 1YNDA 2KBXA 4J0UA 3CSFA 1AWTA 3OEPA 4J5CX 5CMWA 1EDUA 2ZP2A 3K0OA 1H6PA 2A5UA 4B0ZA 3OPFA 3FTXA 5G04C 2VSXE 3B7SA 1AWQA 3ZU7B 4PH4B 3ULQA 3ZXSA 3Q15A 2ETBA 2Y4UA 3LKUA 2FBNA 1H0PA 5KV4A 1FT2A 5AN8A 2F0YA 3UT7A 2XRZA 5JJ6A 3B7TA 4NRHB 3RU0A 1IKND 1A58A 3PZDA 4J8EA 1AWRA 2WB2A 4B94A 2WQHA 3I5PA 4AM9A 1BI8B 3NF1A 3W9GA 4RSYA 3T5VA 1JPLA 3DPDA 1LOPA 4HLEA 1FVHA 3R57A 3Q73A 1NZNA 4TXQA 4C48B 5AQBA 3BG1B 2KZTA 5B1BE 2ZGDA 4JXTA 3R56A 5LCWJ 4ZSCA 5AJLA 4J7WA 3QWWA 2J4BA 1XYHA 4YUKA 1XO7A 4O1PA 2ESLA 4MLPA 4AOFA 3UINC 1KT0A 4L2LA 4GZ6A 2XCCA 3FY4A 2BIUX 1A33A 3KD7A 4I6EA 4JB8P 4JCPA 2KXPC 1SZAA 2RFMA 3VTYA 4YUNA 3MV2B 4N1MA 4M7CA 3MYVA 2P9LG 4I43A 4YUOA 4QFVA 3AS8A 3CVXA 4U07A 2Y69E 3APFA 1E8XA 4PS8A 4C9BB 2WFIA 4RLYA 4G11A 3G2VA 4MS6A 2WXFA 2ILRA 3V2XA 5CCQA 3CK9A 4A55A 4U7EB 2EQXA 4N3AA 2DBAA 1OWOA 2VGEA 2H6IA 5BV1A 4ANXA 4PUCA 2HYZA 4KMOA 1CWBA 4HNAD 1TYQG 2X6KA 2PZIA 2XS1A 2DZOA 4F7AA 3D3MA 1N4SA 1X7FA 1K1BA 3RRMB 5A7DB 2FI7A 3UM0A 4UWLA 2F37A 3RK6A 3HHMA 1MX6A 2J07A 4GPMA 4MBGA 1HX8A 3ESLA 5KJNA 1SZ9A 3B7BA 4E85A 2GROB 5DBKA 3EHQA 2PL2A 3TG5A 2XCBA 2CG2A 5EDSA 2YHEA 4YVQC 4BTAA 2OVBA 3V79K 1ZKCA 1D9SA 3U9WA 2Y4TA 5KV1A 3J5PA 3ZYMA 5FQ6A 5KNHD 1MF8C 3R54A 1INZA 3AAAC 4U0UA 3Q49B 3CVQA 3Q9UC 3MKQB 4G8KA 2AWIA 4K03A 2N0TA 1SA4A 3E32A 3FWVA 2L0IA 4F53A 4LQWA 3K0MA 3DRAA 3UUXA 4OYSA 1M63C 4IULA 3MV3B 4GYYA 3U3WA 4XZ4A 4DUIA 2HO1A 4WNFA 4F1SA 3AG4E 4GAAA 4BT8A 5KUUA 1KLXA 3EJNA 3VLDA 1M9CA 2EINE 5BV0A 1A5EA 2PNNA 2HQ6A 3UCHA 4KT6B 1OY3D 4AEZC 1XNFA 3APCA 2WQ6A 2AXZA 1AWCB 3Q5MA 3R7QA 1OWLA 3DSVA 4N3BA 1TNBA 2XQ0A 3CLJA 1MX4A 4XKBA 3KEAA 2FO1E 1S64A 3ZYQA 2X25B 3MMLA 2YNQA 2CFEA 1J2AA 1ZBPA 5CHEE 3AS4A 4BTBA 3SNXA 4LEUA 2J09A 4HFGA 4J5DX 4XIFA 2I2OA 4LCTA 4F3VA 2VJ8A 2MC9A 2UY1A 2CHZA 3DSWA 3G2SA 4I9YA 3RO3A 4YVOA 4M3OA 4Q96A 2X2DB 1W8LA 5E76A 2XEHA 5BNWA 4DX6D 3LVQE 3NZSA 2VQ2A 2NULA 2WM9A 4X8QA 3PS6A 3R9MA 1O1TA 3I4RB 3HXFA 4CGVA 2C2LA 5KBAA 2H6FA 3ZN3A 4BY6A 4MRUA 4GZCA 5LOZA 3S6MA 5J08A 4DX5D 1SQMA 3ZNGA 5D0QD 1Z3XA 3JQ1A 4JL0A 1VBTA 3RRUA 4WNEA 4FHKA 1CWOA 4BT9A 2YQ8A 3ZKJA 1SA5A 3UPVA 2RMAA 5KUVA 4F6RD 3JUIA 2PQRA 2X6FA 3W9FA 4I9CA 3ZHEB 5A23A 4YUPA 3AS5A 2JLBA 1N0QA 5EILA 3AG2E 4BFRA 2RS4A 2GRNB 1JCSA 3L17A 1ZB1A 1X5BA 3QKYA 3P2BA 3CHQA 4UI9C 1W3BA 4ACKA 4AXHA 3BKPA 2J4DA 4NURA 2V8SE 3PREA 2WXJA 1SW6A 5FZRA 3IKOB 4O60A 2CG3A 1K3ZD 4QQIA 1IIPA 4BWRA 5BT1A 3NB2A 2WFJA 4EZKA 4O8HA 2XPZA 1MZCA 1H19A 1TNOA 1UOHA 2ONDA 2Y1LE 3ASFA 5CRVA 4GTQA 4HOTA 2YHCA 4HRNA 5DUDA 2WXRA 2XGSA 4HOQA 4O8IA 1X81A 4C0EA 3AG1E 4I17A 2VGXB 2XZDG 3CK8A 3EHRA 5KV6A 3L9TA 3ZW3A 3NAWA 4HB5A 4G2VA 1N94A 4DGCA 4XKCA 3PNLB 4H7XA 2XS8A 3ABME 4E6HA 1O1RA 2VSNA 5KJKA 3CKCA 5EX0A 1MQSA 1NL4A 4ATZD 4B8CB 4JHKA 1FPPA 2AXUA 3FEXA 1EYHA 4GZ3A 5FJYA 3B95A 3ZFWA 2IGVA 3PDNA 3HVEA 3NQPA 1BPOA 3PE3A 3S7JA 3FU6A 3OXFA 1TNUA 3FUHA 5ENSD 4R7LA 3URZA 3G2TA 4R3EA 4NQ0A 4GU5A 2I9CA 3C3QA 4CGWA 1UN8A 3SBSA 3SHFA 4AV7A 1H2TC 1OCZE 4JD2G 3DXKG 4XI9A 1HG2A 1N0RA 3HYMB 4RG6A 4OVUA 4J5BA 3T5XA 2CFUA 3SO8A 2XPYA 3R9AB 5KULA 3SFYA 2OK3A 2F8YA 3ODIA 2R99A 5ENOD 4L2YA 4ATGA 2CK1A 3QOUA 3ULEG 1HS6A 4DI4A 3ML9A 3ZEFA 1W8VA 3RCLA 3TG4A 4TOTA 1HO8A 5IY5E 3JXJA 2IO3C 2XGOA 3O4ZA 3IBEA 3L13A 3PE4A 3RO2A 4BX8A 3O48A 1OCCE 4PDXA 1VDNA 5EYPF 2NXPA 1N4RA 3R59A 3HVEB 2X2AA 4S1JA 3Q7FA 3CVUA 1C5FA 3QK0A 2RG8A 4DPRA 3F6QA 5G2NA 2FO7A 1Y8MA 4JVSA 2RFAA 3D9JA 3Q78A 1M9EA 3LY7A 3RAUA 2DVWA 3ENEA 2MS4A 3CVLA 3ZXPA 4KVOA 2A4ZA 3SF4A 4HS2A 4RVBA 1TEZA 2OEVA 4IRUA 1JCRA 2P9IG 4UWGA 1E8YA 1H2UA 3K2CA 1LD7A 3DPYA 2OSEA 2P2CP 3MKRA 1JUQA 4BSZB 3FH7A 5A0EA 5CEAA 5CBVA 3P1UA 5FINA 2LSUA 3ICIA 1NP7A 1SVXA 3SD5A 3VTXA 4U95D 5CBNA 5CYHA 3EHMA 4LSZE 2CHWA 2J49A 2AW6A 4N1PA 2UWJG 4XNCA 5ENPD 4JA7A 4XX5A 1AWVA 5LX8A 4CYHA 4YDOA 1EPUA 4JW1A 5A6CA 2R03A 1OT8A 4URKA 5CBOA 3MA5A 3D9HA 4DRXE 1RW2A 5KUNA 3S7DA 3ASDA 4FULA 5EIDA 3HXDA 2C0MA 4JZYA 3E4BA 5F66A 1IYGA 1VDYA 4I1OB 4U04A 2WPVA 1UJKA 4HBDA 1Q2ZA 4KYOB 2BITX 2P9NG 1NA0A 5G05C 4DX1A 4APFA 2H6GA 4ILGA 1IQRA 1HH8A 2PHCB 1NI1A 5KURA 4TUUA 5EYLA 2ZGGA 4ANWA 4XE0A 1U3DA 3ZIMA 5KUWA 2V0PA 2XGYB 2P9UG 2R02A 2IOLA 3PUKA 3Q47B 2DYRE 1TN7A 4ZHBA 3LS8A 3PH0C 4U8VD 3BO7A 4UWFA 3PUJA 2P9SG 3MJWA 2KM4A 3JCKC 3V30A 3PZ1A 4ACLA 1FGLA 3RDAX 1ELRA 3L6AA 5CERB 1OWMA 2CYHA 2KCVA 1KT1A 3OXLA 1H6OA 2KZTB 3FTWA 1N54A 4JPSA 2MHKA 5KV7A 4J5AX 1Z5SC 2AXVA 1M9DA 3TGOA 3WG7E 2KC7A 3EOVA 3TWSA 5CCMA 4LUNU 3FUDA 4ZFHA 4J8YA 3CHRA 4B89A 4DLQA 1TNZA 5KUQA 3ASNE 3GYZA 1ZX8A 4GMRA 2RD0A 3CVNA 2ZIRA 1DC2A 1A17A 3C3RA 2GRLA 4K5CA 3JB9d 3EDTB 2ZISA 1HF8A 1IQUA 1NMKA 3OAWA 3LJ3A 5KJMA 1E90A 2DZNA 4CYMD 2ZXWE 4W9RA 3V31A 1V9TA 2ETCA 4GPKA 3NOCD 2HAQA 3RRNB 2HE9A 2GW2A 1RZ4A 3IHVA 1S0PA 3FULA 5LCWC 3TWUA 4AIFA 3K0RA 4TRQA 3U4TA 4UUCA 2BTDA 3HG0D 5FT9A 3CKBA 3VA7A 3S7BA 1D8EA 1HE8A 2X3MA 3Q7AA 4HRLA 4HORA 4A1SA 4ABNA 4Q94A 5ENQD 3FUNA 2IGWA 3ASHA 1HXIA 5HKPA 2XPIA 4EPZA 4FHJA 3R4GA 1DCEA 3HIZA 3EIQC 3E37A 4YUMA 3J5QB 1OCRE 3ZGQA 3DEOA 2GW1A 1KZPA 3B7RL 1QYMA 1FVFA 2NNZA 2VSOE 3CVWA 1IXVA 1CWHA 2MVZA 3K0NA 3PMPA 4AJWA 5FQ4A 2NC9A 3ODLA 1DCQA 4CZ2D 3EU5A 1N52A 1ZU2A 4JEUA 5E75A 3DSXA 5FIOA 4G8LA 4HOSA 5CBTA 4J59A 3PRZA 2EIME 3FTZA 3L54A 1OCAA 4I6JA 2OV8A 2VGYA 2MOWA 1D8DA 3QAQA 2CFZA 3R7RA 3TWRA 3GZSA 2RMCA 2V5QC 4GCOA 1BI7B 3T8KA 2EIKE 1QOIA 4AVXA 3OTNA 2Q7FA 3ZVVA 4EHMA 5AIJA 1AWUA 1M9YA 2R59A 5EIBE 1K8KG 1AK4A 2WLWA 1OXJA 4ANUA 5FQ8A 2RMBA 1TR4A 2IFUA 3BQOA 3UM3A 3IXEA 4YUJA 4CRWA 4I6GA 2FU0A 2WXGA 5M72A 1CWMA 4WWOA 5CEDB 2IY0C 4CDNA 3FTSA 2DYSE 3K9IA 2POEA 3MMLB 3FUKA 4EZJA 2QYJA 3AJIA 3FUEA 2LXLA 3CEQA 4BESA 3QARA 4N2SA 2XENA 3T1UA 3UIOC 1JWGA 5KJLA 3ESKA 5JHEA 4TUMA 2OCCE 1UJJA 2UY1B 3RDDA 3LY8A 3ABLE 5HS0A 1P5QA 2IO2C 5BW8C 4A63B 3UM2A 2GGFA 3UIPC 3ISMC 1WAO1 4Y6CA 4N1NA 3I4GA 3X27A 3SI5A 3HXEA 2CPLA 2CHXA 4JC8A 5DIZA 4XEIG 3EUVA 3E30A 3N71A 4PS3A 4N5QA 3ICHA 2HM8A 1IHBA 3ONKA 4ZSDA 2JABA 5EX3A 5C2YA 2ZU6B 3UXGA 4N1SA 2VTBA 3KSQA 5G04J 2WXQA 3PEUB 2AVPA 2JEKA 2MYOA 3UT4A 3QNKA 3NOGD 3SQVA 3LCAA 2OEWA 2LXMA 5KUSA 2LAIA 5HI7A 3ZRHA 2DIWA 3SZ7A 3QJZA 5JJ7A 3FHEA 4Z68A 3E33A 3UKRG 2WMOA 3JYSA 4WAFA 4DGEA 1DVPA 4G24A 4R3FA 4GZ5A 3D9NA 3I3NA 1YCSB 1PY1A 4Q69A 3OREA 3LDZA 3LY9A 3CVYA 4L1BA 4D10C 5JHBA 1HZ4A 2IJGX 1XQ7A 3K0PA 1CWIA 2C3BA 1H2VC 4DK5A 1PAQA 5KV2A 2PQNA 1AP7A 1V54E 1NFIE 3CR3A 4FP7A 4NACA 3LJNA 2KCKA 3RCGA 5ITZF 5ENTD 2YINA 5CBWA 2IEJA 2AJAA 3MEKA 4J8DA 4V3IA 4N3CA 4WNDA 4J58A 3E34A 4YDEA 5LUDA 1OWPA 2VTBB 2POYA 1ISTA 3LVRE 3QWPA 4HXIA 2WXOA 1CWKA 2V4LA 4CDMA 4CCAA 3PEVB 4KXKB 3KAEA 4I1MA 3TWQA 1MX2A 1ELWA 4FC8A 1O5MA 5JA4D 5ARGA 3CHSA 3FU5A 1N11A 4DGAA 2GRRB 1RMHA 1BLXB 4ILIA 4WWNA 5D2MC 2L0TB 2MZUA 4G1TA 4CEMA 1Z6TA 4PS7A 4GA1A 3Q4AB 5CCLA 5T4YA 1N4QA 2X7KA 4L23A 1O1SA 1CYNA 3BEEA 2Z6WA 4OAVB 4LNGA 4U63A 4TXRA 3SBTB 4J5EX 2B6CA 1IHGA 2OOEA 1E7UA 2J8SD 3K0QA 5BUZA 4C0MA 1S63A 3ZYLA 3KSLA 3MCXA 2K7NA 4GYOA 4TV3A 4HLLA 2XGMA 3NBNB 1GW6A 5CRUA 4KBQA 4K0RA 3TJPA 3ABKE 3GZ1A 3FTUA 1TJCA 2QERA 3L16A 4LERA 3D9MA 4JHJA 2OJUA 4HY7A 3O7TA 4P29A 3ASGA 3AU4A 4YDWA 3EHNA 1WM5A 3DSSA 3GZ2A 3CGHA 4N5CA 1LF8A 4UWHA 4HOUA 2L6BA 4YULA 2WQ7A 2R5SA 4U8HA 3FTYA 5J90A 3CHMA 1E8ZA 5LFAA 2L9BA 3RIBA 3CYSA 3RKVA 1E3BA 4B8AA 3C98A 5KNGA 3QYUA 4KZCA 2QC9A 5ENRD 1FCHA 4EQFA 2FULA 4EBAG 1CWAA 4GA2A 5ENNA 2KCLA 2Y3AA 3CK7A 3BUAA 4HVBA 4EZLA 4AY5A 1L5JA 1WG0A 2QFCA 4IN3B 3UI2A 4L7TA 4L9PA 3CHPA 4O1OA 5FWQA 3Q79A 4LG6A 3RCKX 2WXMA 4FADA 5CCNA 5JJTA 1YMPA 4N39A 1ZKFA 2X83B 4HI8A 3L22A 3LYAA 2FEZA 1N4PA 5B3SE 1H6KA 1W74A 3FU0A 3CQCB 2P9PG 2F8XK 3VLEA 3X2QE 4FJZA 3MX3A 3T9KA 3IEGA 5B1AE 5AQ7A 2BUGA 3ZYKA 3PZ4A 2A5EA 2B71A 1H0AA 4FLBA 3NZUA 1WDYA 2KA0A 2L6JA 4B93B 3DBSA 3VLFA 5C1DA 2LAHA 5LP0A 3HXCA 5H7PA 3FUMA 4K5AB 2NYJA 4UQXA 4TXPA 3CVPA 5CMYA 3UQ3A 3FP3A 3APDA 4WWPA 5FZQA 5G55A 5KUOA 3RD9X 3ULYA 3MKQA 5KWDA 4YUIA 3KOPA 4GB9A 2R2LA 5FTPA 2DCPA 3OXGA 4O6FA 4DJAA 3TAXA 1BD8A 4G23A 4I2WA 4GTSA 1CWCA 4UWKA 1HG5A 4FA6A 2GRMA 2V5FA 4EBAA 1NA3A 3V2OA 2WXLA 5CBUA 4A3VA 1Y6IA 5ANRA 5HRYA 3ASOE 2KATA 4E1QA 3T8MA 5BXUA 2ALFA 1QQEA 2PM7A 4DX7D 3CV0A 2QZAA 3LEWA 4GCNA 1N9AA 4GTMA 4FU3A 3SFZA 4ILHB 2HR2A 2J9QA 4DI3A 2OVFA 1HU3A 2B0OE 2I6HA 1KPSB 1Z81A 4JA9A 3Q75A 3KS2A 4UI9K 2A2NA 1TN8A 3SY2A 2PLUA 2V4HC 3UX4A 3RJVA 3UMVA 3JQ0A 2J08A 3LPZA 3HXBA 5EKQD 3BT8A 5AAOA 3CVVA 4FJYA 4N1RA 2X6JA 2XZTG 3UTMA 4LRZA 5KCMA 4GTOA 4UI9J 3Q9NC 3D9KA 3D9PA 2X6HA 3ML8A 4A3TA 1DYWA 1ELKA 3RFYA 3GW4A 3B13A 5D66A 2RKKA 4RG9A 3TWVA 2P0OA 1JWFA 4YDYA 3HDXA 1E8KA 5AJDA 3TXMA 3JUEA 4GTVA 2E2EA 1DNPA 1OUVA 3HRAA 3IV0A 4U8YD 3DEPA 5FZSA 4N2QA 2E0IA 2CMTA 4UQYA 2NSZA 2XHEA 4DGDA 1MJ0A 1BU9A 3D9LA 3BU8A 2LNIA 1N95A 1MHQA 3ZHEA 5KV5A 2P9KG 2R17C 1U3CA 3UM1A 3FTVA 4F1PA 3RDCA 3QB2A 5AARA 4G26A 5HQ8A 3CIAA 3QWVA 1AWSA 2M63A 5AENA 3CYHA 3AU5A 1YYHA 2R05A 4J6IA 3TL5A 4RQIA 5EN5D 3TWWA 5BXOA 3FUJA 4HRMB 1S70B 2X38A 1QNFA 2LUHA 1ZMFA 3L82A 4U96D 5KUZA 3AG3E 4JJMA 2DWZA 3L08A 2IF4A 3CQGB 3IHYA 4I1AA 2IQCA 3DWLG 3SFXA 2IU1A 3ZPJA 2HQJA 5T3RA 1LTXA 2WMNA 5CCRA 3B7UX 4ME2A 2LO6A 4K5BA 3FFLA 4BETA 1MYOA 5D0OD 3WXXA 2EIJE 4J8FA 2VGXA 2IOSA 2X6IA 2I1KA 3QDNA 4I2ZA 1MZWA 3TXNA 4IPZA 2C0LA 1EF1C 2VSYA 4BX9A 3S2AA 4UQZA 2HE0A 2WXKA 1UN9A 4GTPA 3JXIA 5AQAA 3C5RA 2WVIA 4OVVA 4N1QA 1UW4B 3U64A 2P58C 1E96B 5AYWD 4GTTA 3KEZA 3FH5A 3PZ3A 4HI9A 2Y0BG 3FU3A 4Y6WA 2VYIA 5JHAA
chains in the Genus database with same CATH topology
5BV0A 4CEMA 1U3DA 1Z6TA 3ZIMA 2HQ6A 4PS7A 3UCHA 4KT6B 5KUWA 4GA1A 3Q4AB 5CCLA 2V0PA 5T4YA 2XGYB 4AEZC 3FUFA 2X7KA 4L23A 1XNFA 3APCA 1CWFA 2IOLA 2WQ6A 3PUKA 1CYNA 3SGHA 2AXZA 3Q47B 3BEEA 4YUHA 2Z6WA 4ANVA 4DLOA 3LS8A 4JHRA 1QNGA 3PH0C 3Q5MA 3R7QA 1OWLA 4N3BA 4UWFA 3BO7A 4BSXA 3PUJA 4GZDA 2XQ0A 2WXPA 2BF0X 3CLJA 4U63A 3MJWA 4GMLA 1M9XA 2KM4A 2FF4A 3SBTB 4XKBA 4J5EX 1XGWA 1YA0A 3JCKC 1IHGA 5T8IA 2OOEA 4ACLA 4G25A 1FGLA 3RDAX 4CT0A 1E7UA 3K0QA 4GMJA 3UT8A 4YNDA 4C0MA 5BUZA 4A1GA 3ZYQA 1ELRA 3MCXA 2YNQA 3ZYLA 2X25B 2CFEA 2K7NA 3L6AA 1PC2A 1OWMA 4GYOA 4WNGA 1ZBPA 2KCVA 4EECA 1J2AA 2CYHA 1KT1A 4TV3A 5CHEE 1XWNA 1CLHA 3AS4A 2XGMA 5FQ7A 3OXLA 2KZTB 4BTBA 3FTWA 3SNXA 4LEUA 2J09A 1GW6A 1N54A 4HFGA 4JPSA 1VAIA 4J5DX 3D9OA 4XIFA 2I2OA 4K0RA 2MHKA 4KBQA 4LCTA 3TJPA 4F3VA 4S1EA 5KV7A 2VJ8A 3GZ1A 2WXNA 2MC9A 3CHOA 4J5AX 3FTUA 2LSVA 3BG0B 1TJCA 2CHZA 2UY1A 2AXVA 3D9MA 3L16A 3G2SA 4JHJA 4LERA 1M9FA 2OJUA 4HY7A 4IYPA 3O7TA 4P29A 1M9DA 4I9YA 3TGOA 3ASGA 4YVOA 3RO3A 3U66A 4M3OA 4Q96A 2X2DB 2KC7A 3EOVA 1W8LA 3AU4A 4LUNU 5CCMA 3EHNA 5E76A 1E8WA 1WM5A 5BNWA 3FUDA 3CHRA 3GZ2A 3CGHA 3LVQE 3NZSA 2VQ2A 4N5CA 3FUIA 4B89A 4DLQA 1LF8A 4UWHA 2NULA 2WM9A 4HOUA 3PS6A 4FRVA 3S7FA 3PVLA 4N1OA 2XEVA 5KUQA 3GYZA 3I4RB 4YULA 4CGVA 2R5SA 2WQ7A 3MZLB 1BCKA 4U8HA 2C2LA 3LXUX 5ARFA 2RD0A 3FTYA 4H7YA 5J90A 3CVNA 3CHMA 3FDHA 1HFAA 1TJFA 3G2UA 1E8ZA 3R49A 3ZN3A 4YUGA 5LFAA 4DGBA 1A17A 2L9BA 3FEYA 2GRLA 3RIBA 4BY6A 3CYSA 2I1JA 3RKVA 4MRUA 1E3BA 3JB9d 1Z3YA 3EDTB 4B8AA 4GZCA 3C98A 3QYUA 1HF8A 5LOZA 3S6MA 4KZCA 5J08A 1IQUA 1NMKA 4JEHA 1SQMA 3OAWA 3LJ3A 1Z3XA 5D0QD 1FCHA 3JQ1A 4JL0A 4CT4A 4EQFA 1E90A 4XI0A 5KJMA 2FULA 4EBAG 1VBTA 2MRIA 1CWAA 5KV3A 4GA2A 5ENNA 2KCLA 2Y3AA 3CK7A 4WUYA 3RRUA 4HVBA 4EZLA 4WNEA 4AY5A 4FHKA 1L5JA 3D9IA 2WXIA 4W9RA 1CWOA 2QFCA 2YQ8A 4IN3B 4L7TA 4BT9A 3CHPA 1V9TA 5FWQA 3UPVA 4GPKA 2RMAA 5KUVA 2HAQA 3JUIA 3RRNB 1QZ2A 1W8MA 2HE9A 3RCKX 4I9EA 1CWJA 2GW2A 4FLHA 2WXMA 4FADA 3CSTA 3ONLA 2PQRA 1WY6A 5CCNA 2X6FA 3IHVA 5JJTA 1S0PA 3FULA 3MMLA 5LCWC 4AIFA 3K0RA 4I9CA 5CCSX 3ZHEB 5A23A 4TRQA 3U4TA 4N39A 2IONA 4YUPA 4CDRA 3AS5A 2JLBA 1ZKFA 2X83B 2BTDA 5FT9A 3CKBA 4BFRA 3VA7A 3L22A 4GA0A 3S7BA 5KV0A 2RS4A 3LYAA 2FEZA 5G05J 1HE8A 2X3MA 4U0SA 4HORA 1H6KA 3PNTB 3L17A 4A1SA 4ABNA 4Q94A 1W74A 3RDBA 1X5BA 3FU0A 3QKYA 1E7VA 3CHQA 3P2BA 4GYWA 4UI9C 3CQCB 4FRUA 1W3BA 5ANLA 2QY7A 4ACKA 1UG3A 3FUNA 4AXHA 2IGWA 1MIKA 3BKPA 2J4DA 3ASHA 2V8SE 4NURA 3PREA 1HXIA 2WXJA 4FJZA 3G2WA 3MX3A 2XPIA 3IEGA 4FHJA 5FZRA 3VLEA 4EPZA 3IKOB 3RCIX 2BUGA 3ZYKA 2CG3A 3EIJA 2B71A 3R4GA 3HIZA 1H0AA 2WXHA 3EIQC 1IIPA 4FLBA 4BWRA 3NZUA 5BT1A 4YUMA 3FH8A 2L6JA 4KZ0A 2WFJA 3DBSA 4EZKA 3VLFA 1CWLA 2PM6A 3ZGQA 4AP2A 4O8HA 2XPZA 5C1DA 3MGBA 2GW1A 2LAHA 1QNHA 5LP0A 1H19A 4AY6A 1VBSA 1B89A 2ONDA 3B7RL 2XRYA 4EYVA 1OWNA 1FVFA 3FUMA 3RCFA 3ASFA 4MKTA 4U0ZA 2X2CK 3QC1A 4UQXA 4J8SA 4KVMA 2VSOE 3CVWA 4HOTA 1CWHA 2MVZA 2YHCA 3K0NA 3CVPA 4APOA 5CMYA 3UQ3A 5BPPA 3FP3A 3PMPA 4AJWA 5FQ4A 1YNDA 3APDA 4WWPA 5FZQA 5G55A 5KUOA 4J0UA 3CSFA 5DUDA 2NC9A 1AWTA 3OEPA 3ODLA 4J5CX 3RD9X 2WXRA 2XGSA 3MKQA 5CMWA 4YUIA 1EDUA 4HOQA 2ZP2A 3K0OA 4O8IA 4C0EA 4GB9A 1N52A 1ZU2A 2A5UA 4I17A 5FTPA 4JEUA 4B0ZA 3OPFA 5E75A 2VGXB 3FTXA 3CK8A 5G04C 2VSXE 3B7SA 1AWQA 2DCPA 3OXGA 4O6FA 4HOSA 5CBTA 4PH4B 4DJAA 3TAXA 3ULQA 5KV6A 4J59A 4G23A 4I2WA 3PRZA 3ZXSA 3FTZA 3L54A 1CWCA 4UWKA 1OCAA 1HG5A 3ZW3A 4I6JA 2OV8A 2GRMA 4G2VA 4FA6A 3Q15A 2V5FA 4EBAA 1NA3A 2VGYA 2MOWA 4DGCA 4XKCA 2WXLA 3PNLB 2Y4UA 4H7XA 5CBUA 3QAQA 4A3VA 3LKUA 1Y6IA 2FBNA 2CFZA 5ANRA 3R7RA 4E6HA 2KATA 4E1QA 1H0PA 2VSNA 3GZSA 3T8MA 2RMCA 5KV4A 4GCOA 5KJKA 2ALFA 1QOIA 3CKCA 3UT7A 5EX0A 4AVXA 1MQSA 3OTNA 5JJ6A 3B7TA 2XRZA 4NRHB 3RU0A 1QQEA 2Q7FA 1A58A 2PM7A 3PZDA 4J8EA 3ZVVA 1AWRA 3CV0A 5AIJA 1AWUA 2WB2A 3LEWA 4B94A 4GCNA 4B8CB 4JHKA 1M9YA 2R59A 2AXUA 3FEXA 4FU3A 3SFZA 2WQHA 3I5PA 4ILHB 1EYHA 4AM9A 2HR2A 4GZ3A 2J9QA 3NF1A 5FJYA 4DI3A 1AK4A 2WLWA 3ZFWA 2OVFA 2IGVA 4ANUA 4RSYA 5FQ8A 2RMBA 1HU3A 3PDNA 3HVEA 3NQPA 3T5VA 1BPOA 1JPLA 2IFUA 3DPDA 2I6HA 1LOPA 4YUJA 4HLEA 1FVHA 1Z81A 4CRWA 3R57A 4JA9A 1NZNA 4I6GA 2FU0A 3PE3A 3S7JA 2WXGA 5M72A 3FU6A 3KS2A 3OXFA 4UI9K 4WWOA 1CWMA 3FUHA 4R7LA 2A2NA 3URZA 3BG1B 3G2TA 4R3EA 4NQ0A 4CDNA 2KZTA 3FTSA 4GU5A 2I9CA 2PLUA 4CGWA 3UX4A 1UN8A 3RJVA 4JXTA 3SBSA 3SHFA 3R56A 3K9IA 3UMVA 3JQ0A 2J08A 3LPZA 5LCWJ 5AJLA 2POEA 4ZSCA 4AV7A 3MMLB 1H2TC 3FUKA 4XI9A 5EKQD 3QWWA 4EZJA 3BT8A 2J4BA 1HG2A 3FUEA 4FJYA 3CVVA 1XYHA 4N1RA 4YUKA 3HYMB 3CEQA 1XO7A 2X6JA 4RG6A 4OVUA 3QARA 2ESLA 4LRZA 5KCMA 3T5XA 4MLPA 2CFUA 4AOFA 4N2SA 1KT0A 4J5BA 1JWGA 3T1UA 4L2LA 4UI9J 4GZ6A 2XCCA 5KJLA 2XPYA 3D9KA 3ESKA 3R9AB 3D9PA 2X6HA 3FY4A 3ML8A 4A3TA 1A33A 1DYWA 2BIUX 5JHEA 1ELKA 1UJJA 2UY1B 3KD7A 4I6EA 4JCPA 3RFYA 5KULA 1SZAA 3GW4A 3B13A 3RDDA 3LY8A 3VLDA 3VTYA 2OK3A 4RG9A 1P5QA 4YUNA 3ODIA 2R99A 2P0OA 5BW8C 1JWFA 4L2YA 4ATGA 3MV2B 4N1MA 2CK1A 3QOUA 2GGFA 1HS6A 3HDXA 3MYVA 4DI4A 1WAO1 4Y6CA 4N1NA 3ML9A 4I43A 3ZEFA 1E8KA 1W8VA 5AJDA 3I4GA 3RCLA 3SI5A 3TXMA 4YUOA 3TG4A 4QFVA 3AS8A 1HO8A 2CHXA 4JC8A 3CVXA 5DIZA 2CPLA 4TOTA 2E2EA 1DNPA 1OUVA 4U07A 3APFA 1E8XA 2XGOA 3IV0A 3N71A 4PS3A 5FZSA 4N2QA 3ICHA 3O4ZA 4PS8A 4C9BB 2HM8A 3IBEA 3L13A 3PE4A 3RO2A 2WFIA 3ONKA 3G2VA 3O48A 4G11A 4BX8A 4ZSDA 5EX3A 2E0IA 5C2YA 4MS6A 2CMTA 2ZU6B 4PDXA 4UQYA 2WXFA 1VDNA 2ILRA 4N1SA 2VTBA 2NSZA 5CCQA 2XHEA 3CK9A 2NXPA 4A55A 4DGDA 3D9LA 2EQXA 3R59A 3HVEB 2X2AA 4S1JA 4N3AA 2DBAA 1OWOA 5G04J 2WXQA 3CVUA 1C5FA 3QK0A 3PEUB 2RG8A 4DPRA 2AVPA 2LNIA 5G2NA 2JEKA 3UT4A 5BV1A 4ANXA 2FO7A 4PUCA 1Y8MA 1MHQA 3ZHEA 2HYZA 4KMOA 4JVSA 1CWBA 5KV5A 3D9JA 2R17C 1U3CA 1M9EA 3QNKA 3FTVA 3LY7A 3RDCA 3QB2A 4G26A 3LCAA 2X6KA 5HQ8A 3ENEA 3CIAA 2MS4A 5KUSA 3CVLA 2PZIA 3QWVA 1AWSA 2LAIA 4KVOA 2M63A 2A4ZA 5HI7A 3ZRHA 2DIWA 3SZ7A 3SF4A 3QJZA 4HS2A 4F7AA 3D3MA 3FHEA 4RVBA 3AU5A 5AENA 5JJ7A 3CYHA 1TEZA 2WMOA 3JYSA 4WAFA 4DGEA 1DVPA 4G24A 4IRUA 4GZ5A 1X7FA 3D9NA 3I3NA 4J6IA 4R3FA 2QERA 1PY1A 3TL5A 3RRMB 5A7DB 2FI7A 4UWGA 1E8YA 1H2UA 4UWLA 4Q69A 3K2CA 3RK6A 3OREA 3HHMA 3LDZA 3FUJA 2OSEA 3LY9A 2J07A 3MKRA 4L1BA 4D10C 5JHBA 1HZ4A 2IJGX 2X38A 1JUQA 3CVYA 1XQ7A 1QNFA 1ZMFA 3K0PA 3FH7A 5KUZA 4JJMA 5A0EA 1HX8A 3ESLA 5KJNA 3L08A 1CWIA 5CBVA 2IF4A 3CQGB 3IHYA 1SZ9A 4I1AA 2C3BA 2IQCA 1H2VC 3P1UA 4E85A 2LSUA 5DBKA 3ICIA 1NP7A 2PL2A 3TG5A 4DK5A 1PAQA 5KV2A 3SD5A 3VTXA 2IU1A 2PQNA 3ZPJA 2XCBA 3CR3A 2HQJA 4FP7A 2CG2A 5T3RA 3EHMA 5EDSA 5JHAA 5CYHA 2YHEA 4NACA 4YVQC 2CHWA 2J49A 2KCKA 3RCGA 2WMNA 5CCRA 2AW6A 4BTAA 3B7UX 4ME2A 4N1PA 2OVBA 2UWJG 2YINA 2LO6A 4XNCA 5CBWA 3FFLA 1ZKCA 3U9WA 2Y4TA 4JA7A 4XX5A 1AWVA 5KV1A 5D0OD 3WXXA 5LX8A 4CYHA 3ZYMA 4J8FA 5FQ6A 2VGXA 1EPUA 3MEKA 4J8DA 4JW1A 2IOSA 4V3IA 1MF8C 3R54A 4N3CA 5A6CA 1INZA 2X6IA 4WNDA 2I1KA 3QDNA 4J58A 4I2ZA 4URKA 4U0UA 3MA5A 3Q49B 1MZWA 3TXNA 4IPZA 3CVQA 5KUNA 3S7DA 3ASDA 5LUDA 3MKQB 4FULA 2C0LA 1OWPA 2VTBB 2POYA 1EF1C 3LVRE 1ISTA 2VSYA 3QWPA 2AWIA 4HXIA 4K03A 2N0TA 2WXOA 1CWKA 2C0MA 4BX9A 4JZYA 3FWVA 2L0IA 3S2AA 3E4BA 2WXKA 4UQZA 4F53A 4LQWA 2V4LA 4CDMA 3K0MA 5F66A 3UUXA 4OYSA 1UN9A 1IYGA 1VDYA 4I1OB 1M63C 4CCAA 3PEVB 4KXKB 3KAEA 2WVIA 4I1MA 2WPVA 4IULA 1UJKA 4OVVA 4U04A 1UW4B 3MV3B 4N1QA 1ELWA 4KYOB 4FC8A 2BITX 3U64A 1NA0A 3CHSA 5ARGA 5G05C 2P58C 4GYYA 3U3WA 3FU5A 4XZ4A 1E96B 4APFA 2HO1A 5AYWD 4WNFA 4DGAA 4F1SA 3KEZA 3FH5A 4ILGA 1RMHA 4GAAA 1IQRA 4ILIA 4WWNA 1HH8A 4BT8A 2PHCB 3FU3A 4Y6WA 2VYIA 5KURA 1KLXA 2L0TB 4TUUA 2MZUA 5KUUA 3EJNA 4G1TA 1M9CA 4ANWA 4XE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQ6 A;  3UCH A;  5KUW A;  4GA1 A;  3Q4A B;  5CCL A;  2XGY B;  2X7K A;  1CWF A;  1XNF A;  1CYN A;  4YUH A;  3Q47 B;  3BEE A;  2Z6W A;  4JHR A;  1QNG A;  3Q5M A;  3BO7 A;  4N3B A;  1M9X A;  2FF4 A;  4J5E X;  1YA0 A;  1IHG A;  2OOE A;  4G25 A;  1FGL A;  3RDA X;  3K0Q A;  4YND A;  1ELR A;  2X25 B;  3MML A;  2CFE A;  2K7N A;  2CYH A;  1PC2 A;  4WNG A;  4GYO A;  1J2A A;  1ZBP A;  2KCV A;  1KT1 A;  5CHE E;  1XWN A;  1CLH A;  3AS4 A;  2XGM A;  3OXL A;  4BTB A;  4LEU A;  1VAI A;  4J5D X;  4XIF A;  4KBQ A;  4S1E A;  2MHK A;  4F3V A;  5KV7 A;  3GZ1 A;  2MC9 A;  4J5A X;  2LSV A;  2UY1 A;  1TJC A;  2QER A;  4HY7 A;  2OJU A;  1M9F A;  3O7T A;  1M9D A;  4I9Y A;  3TGO A;  3ASG A;  4YVO A;  3RO3 A;  2X2D B;  2KC7 A;  3EOV A;  1W8L A;  5CCM A;  1WM5 A;  5BNW A;  3GZ2 A;  2VQ2 A;  4N5C A;  2NUL A;  4HOU A;  4FRV A;  3S7F A;  4N1O A;  2XEV A;  5KUQ A;  3GYZ A;  4YUL A;  4CGV A;  2R5S A;  1BCK A;  2C2L A;  5ARF A;  4H7Y A;  3CVN A;  3R49 A;  3ZN3 A;  4YUG A;  4DGB A;  1A17 A;  3RIB A;  3CYS A;  3RKV A;  1E3B A;  3JB9 d;  3EDT B;  3QYU A;  3S6M A;  1NMK A;  5D0Q D;  1FCH A;  4JL0 A;  5KJM A;  4EQF A;  1VBT A;  4XI0 A;  5KV3 A;  1CWA A;  4GA2 A;  2KCL A;  3CK7 A;  4WUY A;  4WNE A;  4AY5 A;  1CWO A;  4W9R A;  2QFC A;  2YQ8 A;  4IN3 B;  4BT9 A;  1V9T A;  3UPV A;  4GPK A;  2RMA A;  5KUV A;  2HAQ A;  1W8M A;  1QZ2 A;  2HE9 A;  3RCK X;  4I9E A;  1CWJ A;  2GW2 A;  2PQR A;  5CCN A;  5JJT A;  5LCW C;  4AIF A;  3K0R A;  4I9C A;  5CCS X;  3ZHE B;  3U4T A;  4N39 A;  4YUP A;  4CDR A;  3AS5 A;  2JLB A;  1ZKF A;  2X83 B;  5FT9 A;  3CKB A;  3VA7 A;  4GA0 A;  3S7B A;  5KV0 A;  2RS4 A;  3LYA A;  2FEZ A;  5G05 J;  4U0S A;  4HOR A;  4A1S A;  4ABN A;  1W74 A;  3RDB A;  4FRU A;  3QKY A;  4UI9 C;  4GYW A;  1W3B A;  2IGW A;  1MIK A;  3BKP A;  3ASH A;  1HXI A;  5FZR A;  2XPI A;  3IEG A;  3RCI X;  2BUG A;  2B71 A;  3R4G A;  1IIP A;  4BWR A;  5BT1 A;  4YUM A;  2L6J A;  2WFJ A;  1CWL A;  4O8H A;  3ZGQ A;  5C1D A;  2GW1 A;  1QNH A;  1VBS A;  4AY6 A;  1B89 A;  2OND A;  4EYV A;  3RCF A;  3ASF A;  4U0Z A;  2X2C K;  4UQX A;  4HOT A;  1CWH A;  2MVZ A;  2YHC A;  3K0N A;  4APO A;  3CVP A;  3UQ3 A;  3FP3 A;  3PMP A;  1YND A;  5FZQ A;  5KUO A;  4J0U A;  5DUD A;  2NC9 A;  1AWT A;  3OEP A;  3ODL A;  4J5C X;  3RD9 X;  2XGS A;  4YUI A;  4HOQ A;  2ZP2 A;  3K0O A;  4O8I A;  1ZU2 A;  4I17 A;  5FTP A;  3OPF A;  2VGX B;  5G04 C;  3CK8 A;  1AWQ A;  3OXG A;  4O6F A;  4HOS A;  5CBT A;  3TAX A;  3ULQ A;  5KV6 A;  4J59 A;  4G23 A;  4I2W A;  1CWC A;  1OCA A;  4G2V A;  3Q15 A;  2V5F A;  1NA3 A;  2VGY A;  4DGC A;  2Y4U A;  4H7X A;  5CBU A;  3LKU A;  2FBN A;  4E1Q A;  2KAT A;  1H0P A;  2VSN A;  5KV4 A;  2RMC A;  4GCO A;  5KJK A;  2ALF A;  1QOI A;  3CKC A;  5EX0 A;  5JJ6 A;  4NRH B;  3RU0 A;  1QQE A;  2Q7F A;  1A58 A;  4J8E A;  1AWR A;  3CV0 A;  1AWU A;  4B94 A;  4GCN A;  1M9Y A;  2WQH A;  4AM9 A;  2HR2 A;  4GZ3 A;  2J9Q A;  3NF1 A;  5FJY A;  1AK4 A;  2WLW A;  3ZFW A;  2IGV A;  2RMB A;  3PDN A;  2IFU A;  2I6H A;  1LOP A;  4YUJ A;  1Z81 A;  3R57 A;  4JA9 A;  1NZN A;  2FU0 A;  3PE3 A;  3S7J A;  5M72 A;  3KS2 A;  3OXF A;  4UI9 K;  1CWM A;  2A2N A;  3URZ A;  4R3E A;  4NQ0 A;  2PLU A;  4CGW A;  3RJV A;  3R56 A;  3K9I A;  5LCW J;  3LPZ A;  2POE A;  4ZSC A;  3MML B;  4XI9 A;  5EKQ D;  3QWW A;  3BT8 A;  1XYH A;  4N1R A;  4YUK A;  3HYM B;  3CEQ A;  1XO7 A;  4RG6 A;  2ESL A;  4N2S A;  4J5B A;  3T1U A;  1KT0 A;  4UI9 J;  4GZ6 A;  2XCC A;  5KJL A;  3ESK A;  3R9A B;  5JHE A;  2BIU X;  1DYW A;  1A33 A;  2UY1 B;  3KD7 A;  3RFY A;  4JCP A;  5KUL A;  3GW4 A;  3RDD A;  3LY8 A;  3VTY A;  2OK3 A;  4RG9 A;  1P5Q A;  4YUN A;  3ODI A;  2R99 A;  2P0O A;  5BW8 C;  3MV2 B;  4N1M A;  2CK1 A;  3QOU A;  1WAO 1;  4Y6C A;  4N1N A;  1W8V A;  1E8K A;  3RCL A;  4YUO A;  3TG4 A;  3AS8 A;  2CPL A;  4TOT A;  5DIZ A;  2E2E A;  1OUV A;  4U07 A;  2XGO A;  3N71 A;  5FZS A;  4N2Q A;  3ICH A;  2WFI A;  3RO2 A;  3PE4 A;  3O48 A;  4ZSD A;  5EX3 A;  2CMT A;  4UQY A;  1VDN A;  4N1S A;  5CCQ A;  3CK9 A;  4DGD A;  3R59 A;  4S1J A;  2X2A A;  4N3A A;  2DBA A;  5G04 J;  1C5F A;  2AVP A;  2LNI A;  2FO7 A;  1Y8M A;  3ZHE A;  2HYZ A;  1CWB A;  5KV5 A;  1M9E A;  3LY7 A;  3RDC A;  4G26 A;  3LCA A;  5HQ8 A;  2MS4 A;  5KUS A;  3CVL A;  2PZI A;  3QWV A;  1AWS A;  5HI7 A;  3SZ7 A;  3SF4 A;  5JJ7 A;  3CYH A;  3JYS A;  4DGE A;  4G24 A;  1X7F A;  4GZ5 A;  4R3F A;  5A7D B;  2FI7 A;  3K2C A;  3ORE A;  2OSE A;  3LY9 A;  3MKR A;  1HZ4 A;  1XQ7 A;  3K0P A;  1ZMF A;  5KUZ A;  4JJM A;  5A0E A;  1CWI A;  5KJN A;  5CBV A;  2IF4 A;  4I1A A;  2C3B A;  2LSU A;  5DBK A;  3ICI A;  2PL2 A;  3TG5 A;  5KV2 A;  3VTX A;  2PQN A;  3ZPJ A;  2XCB A;  2HQJ A;  5CYH A;  4YVQ C;  2KCK A;  3RCG A;  5CCR A;  4BTA A;  4ME2 A;  4N1P A;  2UWJ G;  4XNC A;  5CBW A;  3FFL A;  1ZKC A;  2Y4T A;  4JA7 A;  1AWV A;  5KV1 A;  5D0O D;  3WXX A;  4CYH A;  4J8F A;  2VGX A;  3MEK A;  4J8D A;  1MF8 C;  3R54 A;  4N3C A;  5A6C A;  4WND A;  3QDN A;  4J58 A;  4I2Z A;  4U0U A;  3MA5 A;  3Q49 B;  1MZW A;  4IPZ A;  3CVQ A;  5KUN A;  3S7D A;  3ASD A;  5LUD A;  2C0L A;  2POY A;  1IST A;  2VSY A;  3QWP A;  2N0T A;  1CWK A;  2C0M A;  3FWV A;  4LQW A;  3E4B A;  4UQZ A;  5F66 A;  3K0M A;  3UUX A;  1IYG A;  1M63 C;  4KXK B;  3KAE A;  4U04 A;  2WPV A;  4N1Q A;  3MV3 B;  1ELW A;  4KYO B;  2BIT X;  1NA0 A;  5ARG A;  5G05 C;  2P58 C;  4GYY A;  3U3W A;  1E96 B;  2HO1 A;  5AYW D;  4WNF A;  4DGA A;  1RMH A;  1HH8 A;  4BT8 A;  2PHC B;  4Y6W A;  2VYI A;  5KUR A;  1KLX A;  2MZU A;  5KUU A;  4G1T A;  1M9C A; 
#chains in the Genus database with same CATH topology
 1LD8 A;  3FUF A;  1CWF A;  3SGH A;  4YUH A;  4ANV A;  4DLO A;  4JHR A;  1QNG A;  4BSX A;  3DSU A;  4GZD A;  2WXP A;  2BF0 X;  1M9X A;  4GML A;  2FF4 A;  1XGW A;  1YA0 A;  5T8I A;  4G25 A;  4CT0 A;  4GMJ A;  3UT8 A;  4YND A;  4A1G A;  1K1A A;  5CEC B;  1PC2 A;  4WNG A;  4EEC A;  2BED A;  1XWN A;  1CLH A;  5FQ7 A;  4LNB A;  3UKU G;  3C3O A;  1VAI A;  5AQ9 A;  3D9O A;  4S1E A;  2WXN A;  3CHO A;  2LSV A;  3BG0 B;  1M9F A;  4IYP A;  3U66 A;  1E8W A;  1FT1 A;  1KZO A;  3DXM G;  1TN6 A;  3FUI A;  2BKG A;  4FRV A;  3S7F A;  3PVL A;  4NIK A;  4N1O A;  2XEV A;  1V55 E;  3MZL B;  1BCK A;  3LXU X;  5ARF A;  4H7Y A;  3FDH A;  1HFA A;  1TJF A;  3G2U A;  4BEP A;  3R49 A;  4YUG A;  4DGB A;  3FEY A;  2ETA A;  2I1J A;  5JMN D;  3RSE G;  1Z3Y A;  1TNY A;  4LNU D;  4JEH A;  4GTR A;  4CT4 A;  4XI0 A;  2MRI A;  5KV3 A;  4WUY A;  1OCO E;  3D9I A;  2QYU A;  2WXI A;  1G3N B;  2BKK B;  2GRQ B;  2XEE A;  3DST A;  1QBQ A;  1W8M A;  1QZ2 A;  4I9E A;  1CWJ A;  4FLH A;  3CST A;  3ONL A;  1WY6 A;  2H6H A;  4DX2 A;  5CCS X;  2ION A;  4CDR A;  2GRP B;  2EIL E;  4BER A;  3TWX A;  4GA0 A;  5KV0 A;  5G05 J;  4U0S A;  3PNT B;  1JCQ A;  3RDB A;  4FRU A;  1E7V A;  4GYW A;  5ANL A;  2QY7 A;  1UG3 A;  1MIK A;  3G2W A;  3RCI X;  1U2V G;  3EIJ A;  2WXH A;  4HQD A;  3FH8 A;  4KZ0 A;  1CWL A;  2PM6 A;  4AP2 A;  3MGB A;  3TWT A;  1QNH A;  1VBS A;  4AY6 A;  1B89 A;  3ZUV B;  2XRY A;  4EYV A;  1OWN A;  3RCF A;  4MKT A;  4U0Z A;  2X2C K;  3QC1 A;  4J8S A;  4KVM A;  3EU9 A;  3PZ2 A;  3C72 A;  4APO A;  5BPP A;  4OAU C;  1YND A;  2KBX A;  4J0U A;  3CSF A;  1AWT A;  3OEP A;  4J5C X;  5CMW A;  1EDU A;  2ZP2 A;  3K0O A;  1H6P A;  2A5U A;  4B0Z A;  3OPF A;  3FTX A;  5G04 C;  2VSX E;  3B7S A;  1AWQ A;  3ZU7 B;  4PH4 B;  3ULQ A;  3ZXS A;  3Q15 A;  2ETB A;  2Y4U A;  3LKU A;  2FBN A;  1H0P A;  5KV4 A;  1FT2 A;  5AN8 A;  2F0Y A;  3UT7 A;  2XRZ A;  5JJ6 A;  3B7T A;  4NRH B;  3RU0 A;  1IKN D;  1A58 A;  3PZD A;  4J8E A;  1AWR A;  2WB2 A;  4B94 A;  2WQH A;  3I5P A;  4AM9 A;  1BI8 B;  3NF1 A;  3W9G A;  4RSY A;  3T5V A;  1JPL A;  3DPD A;  1LOP A;  4HLE A;  1FVH A;  3R57 A;  3Q73 A;  1NZN A;  4TXQ A;  4C48 B;  5AQB A;  3BG1 B;  2KZT A;  5B1B E;  2ZGD A;  4JXT A;  3R56 A;  5LCW J;  4ZSC A;  5AJL A;  4J7W A;  3QWW A;  2J4B A;  1XYH A;  4YUK A;  1XO7 A;  4O1P A;  2ESL A;  4MLP A;  4AOF A;  3UIN C;  1KT0 A;  4L2L A;  4GZ6 A;  2XCC A;  3FY4 A;  2BIU X;  1A33 A;  3KD7 A;  4I6E A;  4JB8 P;  4JCP A;  2KXP C;  1SZA A;  2RFM A;  3VTY A;  4YUN A;  3MV2 B;  4N1M A;  4M7C A;  3MYV A;  2P9L G;  4I43 A;  4YUO A;  4QFV A;  3AS8 A;  3CVX A;  4U07 A;  2Y69 E;  3APF A;  1E8X A;  4PS8 A;  4C9B B;  2WFI A;  4RLY A;  4G11 A;  3G2V A;  4MS6 A;  2WXF A;  2ILR A;  3V2X A;  5CCQ A;  3CK9 A;  4A55 A;  4U7E B;  2EQX A;  4N3A A;  2DBA A;  1OWO A;  2VGE A;  2H6I A;  5BV1 A;  4ANX A;  4PUC A;  2HYZ A;  4KMO A;  1CWB A;  4HNA D;  1TYQ G;  2X6K A;  2PZI A;  2XS1 A;  2DZO A;  4F7A A;  3D3M A;  1N4S A;  1X7F A;  1K1B A;  3RRM B;  5A7D B;  2FI7 A;  3UM0 A;  4UWL A;  2F37 A;  3RK6 A;  3HHM A;  1MX6 A;  2J07 A;  4GPM A;  4MBG A;  1HX8 A;  3ESL A;  5KJN A;  1SZ9 A;  3B7B A;  4E85 A;  2GRO B;  5DBK A;  3EHQ A;  2PL2 A;  3TG5 A;  2XCB A;  2CG2 A;  5EDS A;  2YHE A;  4YVQ C;  4BTA A;  2OVB A;  3V79 K;  1ZKC A;  1D9S A;  3U9W A;  2Y4T A;  5KV1 A;  3J5P A;  3ZYM A;  5FQ6 A;  5KNH D;  1MF8 C;  3R54 A;  1INZ A;  3AAA C;  4U0U A;  3Q49 B;  3CVQ A;  3Q9U C;  3MKQ B;  4G8K A;  2AWI A;  4K03 A;  2N0T A;  1SA4 A;  3E32 A;  3FWV A;  2L0I A;  4F53 A;  4LQW A;  3K0M A;  3DRA A;  3UUX A;  4OYS A;  1M63 C;  4IUL A;  3MV3 B;  4GYY A;  3U3W A;  4XZ4 A;  4DUI A;  2HO1 A;  4WNF A;  4F1S A;  3AG4 E;  4GAA A;  4BT8 A;  5KUU A;  1KLX A;  3EJN A;  3VLD A;  1M9C A;  2EIN E;  5BV0 A;  1A5E A;  2PNN A;  2HQ6 A;  3UCH A;  4KT6 B;  1OY3 D;  4AEZ C;  1XNF A;  3APC A;  2WQ6 A;  2AXZ A;  1AWC B;  3Q5M A;  3R7Q A;  1OWL A;  3DSV A;  4N3B A;  1TNB A;  2XQ0 A;  3CLJ A;  1MX4 A;  4XKB A;  3KEA A;  2FO1 E;  1S64 A;  3ZYQ A;  2X25 B;  3MML A;  2YNQ A;  2CFE A;  1J2A A;  1ZBP A;  5CHE E;  3AS4 A;  4BTB A;  3SNX A;  4LEU A;  2J09 A;  4HFG A;  4J5D X;  4XIF A;  2I2O A;  4LCT A;  4F3V A;  2VJ8 A;  2MC9 A;  2UY1 A;  2CHZ A;  3DSW A;  3G2S A;  4I9Y A;  3RO3 A;  4YVO A;  4M3O A;  4Q96 A;  2X2D B;  1W8L A;  5E76 A;  2XEH A;  5BNW A;  4DX6 D;  3LVQ E;  3NZS A;  2VQ2 A;  2NUL A;  2WM9 A;  4X8Q A;  3PS6 A;  3R9M A;  1O1T A;  3I4R B;  3HXF A;  4CGV A;  2C2L A;  5KBA A;  2H6F A;  3ZN3 A;  4BY6 A;  4MRU A;  4GZC A;  5LOZ A;  3S6M A;  5J08 A;  4DX5 D;  1SQM A;  3ZNG A;  5D0Q D;  1Z3X A;  3JQ1 A;  4JL0 A;  1VBT A;  3RRU A;  4WNE A;  4FHK A;  1CWO A;  4BT9 A;  2YQ8 A;  3ZKJ A;  1SA5 A;  3UPV A;  2RMA A;  5KUV A;  4F6R D;  3JUI A;  2PQR A;  2X6F A;  3W9F A;  4I9C A;  3ZHE B;  5A23 A;  4YUP A;  3AS5 A;  2JLB A;  1N0Q A;  5EIL A;  3AG2 E;  4BFR A;  2RS4 A;  2GRN B;  1JCS A;  3L17 A;  1ZB1 A;  1X5B A;  3QKY A;  3P2B A;  3CHQ A;  4UI9 C;  1W3B A;  4ACK A;  4AXH A;  3BKP A;  2J4D A;  4NUR A;  2V8S E;  3PRE A;  2WXJ A;  1SW6 A;  5FZR A;  3IKO B;  4O60 A;  2CG3 A;  1K3Z D;  4QQI A;  1IIP A;  4BWR A;  5BT1 A;  3NB2 A;  2WFJ A;  4EZK A;  4O8H A;  2XPZ A;  1MZC A;  1H19 A;  1TNO A;  1UOH A;  2OND A;  2Y1L E;  3ASF A;  5CRV A;  4GTQ A;  4HOT A;  2YHC A;  4HRN A;  5DUD A;  2WXR A;  2XGS A;  4HOQ A;  4O8I A;  1X81 A;  4C0E A;  3AG1 E;  4I17 A;  2VGX B;  2XZD G;  3CK8 A;  3EHR A;  5KV6 A;  3L9T A;  3ZW3 A;  3NAW A;  4HB5 A;  4G2V A;  1N94 A;  4DGC A;  4XKC A;  3PNL B;  4H7X A;  2XS8 A;  3ABM E;  4E6H A;  1O1R A;  2VSN A;  5KJK A;  3CKC A;  5EX0 A;  1MQS A;  1NL4 A;  4ATZ D;  4B8C B;  4JHK A;  1FPP A;  2AXU A;  3FEX A;  1EYH A;  4GZ3 A;  5FJY A;  3B95 A;  3ZFW A;  2IGV A;  3PDN A;  3HVE A;  3NQP A;  1BPO A;  3PE3 A;  3S7J A;  3FU6 A;  3OXF A;  1TNU A;  3FUH A;  5ENS D;  4R7L A;  3URZ A;  3G2T A;  4R3E A;  4NQ0 A;  4GU5 A;  2I9C A;  3C3Q A;  4CGW A;  1UN8 A;  3SBS A;  3SHF A;  4AV7 A;  1H2T C;  1OCZ E;  4JD2 G;  3DXK G;  4XI9 A;  1HG2 A;  1N0R A;  3HYM B;  4RG6 A;  4OVU A;  4J5B A;  3T5X A;  2CFU A;  3SO8 A;  2XPY A;  3R9A B;  5KUL A;  3SFY A;  2OK3 A;  2F8Y A;  3ODI A;  2R99 A;  5ENO D;  4L2Y A;  4ATG A;  2CK1 A;  3QOU A;  3ULE G;  1HS6 A;  4DI4 A;  3ML9 A;  3ZEF A;  1W8V A;  3RCL A;  3TG4 A;  4TOT A;  1HO8 A;  5IY5 E;  3JXJ A;  2IO3 C;  2XGO A;  3O4Z A;  3IBE A;  3L13 A;  3PE4 A;  3RO2 A;  4BX8 A;  3O48 A;  1OCC E;  4PDX A;  1VDN A;  5EYP F;  2NXP A;  1N4R A;  3R59 A;  3HVE B;  2X2A A;  4S1J A;  3Q7F A;  3CVU A;  1C5F A;  3QK0 A;  2RG8 A;  4DPR A;  3F6Q A;  5G2N A;  2FO7 A;  1Y8M A;  4JVS A;  2RFA A;  3D9J A;  3Q78 A;  1M9E A;  3LY7 A;  3RAU A;  2DVW A;  3ENE A;  2MS4 A;  3CVL A;  3ZXP A;  4KVO A;  2A4Z A;  3SF4 A;  4HS2 A;  4RVB A;  1TEZ A;  2OEV A;  4IRU A;  1JCR A;  2P9I G;  4UWG A;  1E8Y A;  1H2U A;  3K2C A;  1LD7 A;  3DPY A;  2OSE A;  2P2C P;  3MKR A;  1JUQ A;  4BSZ B;  3FH7 A;  5A0E A;  5CEA A;  5CBV A;  3P1U A;  5FIN A;  2LSU A;  3ICI A;  1NP7 A;  1SVX A;  3SD5 A;  3VTX A;  4U95 D;  5CBN A;  5CYH A;  3EHM A;  4LSZ E;  2CHW A;  2J49 A;  2AW6 A;  4N1P A;  2UWJ G;  4XNC A;  5ENP D;  4JA7 A;  4XX5 A;  1AWV A;  5LX8 A;  4CYH A;  4YDO A;  1EPU A;  4JW1 A;  5A6C A;  2R03 A;  1OT8 A;  4URK A;  5CBO A;  3MA5 A;  3D9H A;  4DRX E;  1RW2 A;  5KUN A;  3S7D A;  3ASD A;  4FUL A;  5EID A;  3HXD A;  2C0M A;  4JZY A;  3E4B A;  5F66 A;  1IYG A;  1VDY A;  4I1O B;  4U04 A;  2WPV A;  1UJK A;  4HBD A;  1Q2Z A;  4KYO B;  2BIT X;  2P9N G;  1NA0 A;  5G05 C;  4DX1 A;  4APF A;  2H6G A;  4ILG A;  1IQR A;  1HH8 A;  2PHC B;  1NI1 A;  5KUR A;  4TUU A;  5EYL A;  2ZGG A;  4ANW A;  4XE0 A;  1U3D A;  3ZIM A;  5KUW A;  2V0P A;  2XGY B;  2P9U G;  2R02 A;  2IOL A;  3PUK A;  3Q47 B;  2DYR E;  1TN7 A;  4ZHB A;  3LS8 A;  3PH0 C;  4U8V D;  3BO7 A;  4UWF A;  3PUJ A;  2P9S G;  3MJW A;  2KM4 A;  3JCK C;  3V30 A;  3PZ1 A;  4ACL A;  1FGL A;  3RDA X;  1ELR A;  3L6A A;  5CER B;  1OWM A;  2CYH A;  2KCV A;  1KT1 A;  3OXL A;  1H6O A;  2KZT B;  3FTW A;  1N54 A;  4JPS A;  2MHK A;  5KV7 A;  4J5A X;  1Z5S C;  2AXV A;  1M9D A;  3TGO A;  3WG7 E;  2KC7 A;  3EOV A;  3TWS A;  5CCM A;  4LUN U;  3FUD A;  4ZFH A;  4J8Y A;  3CHR A;  4B89 A;  4DLQ A;  1TNZ A;  5KUQ A;  3ASN E;  3GYZ A;  1ZX8 A;  4GMR A;  2RD0 A;  3CVN A;  2ZIR A;  1DC2 A;  1A17 A;  3C3R A;  2GRL A;  4K5C A;  3JB9 d;  3EDT B;  2ZIS A;  1HF8 A;  1IQU A;  1NMK A;  3OAW A;  3LJ3 A;  5KJM A;  1E90 A;  2DZN A;  4CYM D;  2ZXW E;  4W9R A;  3V31 A;  1V9T A;  2ETC A;  4GPK A;  3NOC D;  2HAQ A;  3RRN B;  2HE9 A;  2GW2 A;  1RZ4 A;  3IHV A;  1S0P A;  3FUL A;  5LCW C;  3TWU A;  4AIF A;  3K0R A;  4TRQ A;  3U4T A;  4UUC A;  2BTD A;  3HG0 D;  5FT9 A;  3CKB A;  3VA7 A;  3S7B A;  1D8E A;  1HE8 A;  2X3M A;  3Q7A A;  4HRL A;  4HOR A;  4A1S A;  4ABN A;  4Q94 A;  5ENQ D;  3FUN A;  2IGW A;  3ASH A;  1HXI A;  5HKP A;  2XPI A;  4EPZ A;  4FHJ A;  3R4G A;  1DCE A;  3HIZ A;  3EIQ C;  3E37 A;  4YUM A;  3J5Q B;  1OCR E;  3ZGQ A;  3DEO A;  2GW1 A;  1KZP A;  3B7R L;  1QYM A;  1FVF A;  2NNZ A;  2VSO E;  3CVW A;  1IXV A;  1CWH A;  2MVZ A;  3K0N A;  3PMP A;  4AJW A;  5FQ4 A;  2NC9 A;  3ODL A;  1DCQ A;  4CZ2 D;  3EU5 A;  1N52 A;  1ZU2 A;  4JEU A;  5E75 A;  3DSX A;  5FIO A;  4G8L A;  4HOS A;  5CBT A;  4J59 A;  3PRZ A;  2EIM E;  3FTZ A;  3L54 A;  1OCA A;  4I6J A;  2OV8 A;  2VGY A;  2MOW A;  1D8D A;  3QAQ A;  2CFZ A;  3R7R A;  3TWR A;  3GZS A;  2RMC A;  2V5Q C;  4GCO A;  1BI7 B;  3T8K A;  2EIK E;  1QOI A;  4AVX A;  3OTN A;  2Q7F A;  3ZVV A;  4EHM A;  5AIJ A;  1AWU A;  1M9Y A;  2R59 A;  5EIB E;  1K8K G;  1AK4 A;  2WLW A;  1OXJ A;  4ANU A;  5FQ8 A;  2RMB A;  1TR4 A;  2IFU A;  3BQO A;  3UM3 A;  3IXE A;  4YUJ A;  4CRW A;  4I6G A;  2FU0 A;  2WXG A;  5M72 A;  1CWM A;  4WWO A;  5CED B;  2IY0 C;  4CDN A;  3FTS A;  2DYS E;  3K9I A;  2POE A;  3MML B;  3FUK A;  4EZJ A;  2QYJ A;  3AJI A;  3FUE A;  2LXL A;  3CEQ A;  4BES A;  3QAR A;  4N2S A;  2XEN A;  3T1U A;  3UIO C;  1JWG A;  5KJL A;  3ESK A;  5JHE A;  4TUM A;  2OCC E;  1UJJ A;  2UY1 B;  3RDD A;  3LY8 A;  3ABL E;  5HS0 A;  1P5Q A;  2IO2 C;  5BW8 C;  4A63 B;  3UM2 A;  2GGF A;  3UIP C;  3ISM C;  1WAO 1;  4Y6C A;  4N1N A;  3I4G A;  3X27 A;  3SI5 A;  3HXE A;  2CPL A;  2CHX A;  4JC8 A;  5DIZ A;  4XEI G;  3EUV A;  3E30 A;  3N71 A;  4PS3 A;  4N5Q A;  3ICH A;  2HM8 A;  1IHB A;  3ONK A;  4ZSD A;  2JAB A;  5EX3 A;  5C2Y A;  2ZU6 B;  3UXG A;  4N1S A;  2VTB A;  3KSQ A;  5G04 J;  2WXQ A;  3PEU B;  2AVP A;  2JEK A;  2MYO A;  3UT4 A;  3QNK A;  3NOG D;  3SQV A;  3LCA A;  2OEW A;  2LXM A;  5KUS A;  2LAI A;  5HI7 A;  3ZRH A;  2DIW A;  3SZ7 A;  3QJZ A;  5JJ7 A;  3FHE A;  4Z68 A;  3E33 A;  3UKR G;  2WMO A;  3JYS A;  4WAF A;  4DGE A;  1DVP A;  4G24 A;  4R3F A;  4GZ5 A;  3D9N A;  3I3N A;  1YCS B;  1PY1 A;  4Q69 A;  3ORE A;  3LDZ A;  3LY9 A;  3CVY A;  4L1B A;  4D10 C;  5JHB A;  1HZ4 A;  2IJG X;  1XQ7 A;  3K0P A;  1CWI A;  2C3B A;  1H2V C;  4DK5 A;  1PAQ A;  5KV2 A;  2PQN A;  1AP7 A;  1V54 E;  1NFI E;  3CR3 A;  4FP7 A;  4NAC A;  3LJN A;  2KCK A;  3RCG A;  5ITZ F;  5ENT D;  2YIN A;  5CBW A;  2IEJ A;  2AJA A;  3MEK A;  4J8D A;  4V3I A;  4N3C A;  4WND A;  4J58 A;  3E34 A;  4YDE A;  5LUD A;  1OWP A;  2VTB B;  2POY A;  1IST A;  3LVR E;  3QWP A;  4HXI A;  2WXO A;  1CWK A;  2V4L A;  4CDM A;  4CCA A;  3PEV B;  4KXK B;  3KAE A;  4I1M A;  3TWQ A;  1MX2 A;  1ELW A;  4FC8 A;  1O5M A;  5JA4 D;  5ARG A;  3CHS A;  3FU5 A;  1N11 A;  4DGA A;  2GRR B;  1RMH A;  1BLX B;  4ILI A;  4WWN A;  5D2M C;  2L0T B;  2MZU A;  4G1T A;  4CEM A;  1Z6T A;  4PS7 A;  4GA1 A;  3Q4A B;  5CCL A;  5T4Y A;  1N4Q A;  2X7K A;  4L23 A;  1O1S A;  1CYN A;  3BEE A;  2Z6W A;  4OAV B;  4LNG A;  4U63 A;  4TXR A;  3SBT B;  4J5E X;  2B6C A;  1IHG A;  2OOE A;  1E7U A;  2J8S D;  3K0Q A;  5BUZ A;  4C0M A;  1S63 A;  3ZYL A;  3KSL A;  3MCX A;  2K7N A;  4GYO A;  4TV3 A;  4HLL A;  2XGM A;  3NBN B;  1GW6 A;  5CRU A;  4KBQ A;  4K0R A;  3TJP A;  3ABK E;  3GZ1 A;  3FTU A;  1TJC A;  2QER A;  3L16 A;  4LER A;  3D9M A;  4JHJ A;  2OJU A;  4HY7 A;  3O7T A;  4P29 A;  3ASG A;  3AU4 A;  4YDW A;  3EHN A;  1WM5 A;  3DSS A;  3GZ2 A;  3CGH A;  4N5C A;  1LF8 A;  4UWH A;  4HOU A;  2L6B A;  4YUL A;  2WQ7 A;  2R5S A;  4U8H A;  3FTY A;  5J90 A;  3CHM A;  1E8Z A;  5LFA A;  2L9B A;  3RIB A;  3CYS A;  3RKV A;  1E3B A;  4B8A A;  3C98 A;  5KNG A;  3QYU A;  4KZC A;  2QC9 A;  5ENR D;  1FCH A;  4EQF A;  2FUL A;  4EBA G;  1CWA A;  4GA2 A;  5ENN A;  2KCL A;  2Y3A A;  3CK7 A;  3BUA A;  4HVB A;  4EZL A;  4AY5 A;  1L5J A;  1WG0 A;  2QFC A;  4IN3 B;  3UI2 A;  4L7T A;  4L9P A;  3CHP A;  4O1O A;  5FWQ A;  3Q79 A;  4LG6 A;  3RCK X;  2WXM A;  4FAD A;  5CCN A;  5JJT A;  1YMP A;  4N39 A;  1ZKF A;  2X83 B;  4HI8 A;  3L22 A;  3LYA A;  2FEZ A;  1N4P A;  5B3S E;  1H6K A;  1W74 A;  3FU0 A;  3CQC B;  2P9P G;  2F8X K;  3VLE A;  3X2Q E;  4FJZ A;  3MX3 A;  3T9K A;  3IEG A;  5B1A E;  5AQ7 A;  2BUG A;  3ZYK A;  3PZ4 A;  2A5E A;  2B71 A;  1H0A A;  4FLB A;  3NZU A;  1WDY A;  2KA0 A;  2L6J A;  4B93 B;  3DBS A;  3VLF A;  5C1D A;  2LAH A;  5LP0 A;  3HXC A;  5H7P A;  3FUM A;  4K5A B;  2NYJ A;  4UQX A;  4TXP A;  3CVP A;  5CMY A;  3UQ3 A;  3FP3 A;  3APD A;  4WWP A;  5FZQ A;  5G55 A;  5KUO A;  3RD9 X;  3ULY A;  3MKQ A;  5KWD A;  4YUI A;  3KOP A;  4GB9 A;  2R2L A;  5FTP A;  2DCP A;  3OXG A;  4O6F A;  4DJA A;  3TAX A;  1BD8 A;  4G23 A;  4I2W A;  4GTS A;  1CWC A;  4UWK A;  1HG5 A;  4FA6 A;  2GRM A;  2V5F A;  4EBA A;  1NA3 A;  3V2O A;  2WXL A;  5CBU A;  4A3V A;  1Y6I A;  5ANR A;  5HRY A;  3ASO E;  2KAT A;  4E1Q A;  3T8M A;  5BXU A;  2ALF A;  1QQE A;  2PM7 A;  4DX7 D;  3CV0 A;  2QZA A;  3LEW A;  4GCN A;  1N9A A;  4GTM A;  4FU3 A;  3SFZ A;  4ILH B;  2HR2 A;  2J9Q A;  4DI3 A;  2OVF A;  1HU3 A;  2B0O E;  2I6H A;  1KPS B;  1Z81 A;  4JA9 A;  3Q75 A;  3KS2 A;  4UI9 K;  2A2N A;  1TN8 A;  3SY2 A;  2PLU A;  2V4H C;  3UX4 A;  3RJV A;  3UMV A;  3JQ0 A;  2J08 A;  3LPZ A;  3HXB A;  5EKQ D;  3BT8 A;  5AAO A;  3CVV A;  4FJY A;  4N1R A;  2X6J A;  2XZT G;  3UTM A;  4LRZ A;  5KCM A;  4GTO A;  4UI9 J;  3Q9N C;  3D9K A;  3D9P A;  2X6H A;  3ML8 A;  4A3T A;  1DYW A;  1ELK A;  3RFY A;  3GW4 A;  3B13 A;  5D66 A;  2RKK A;  4RG9 A;  3TWV A;  2P0O A;  1JWF A;  4YDY A;  3HDX A;  1E8K A;  5AJD A;  3TXM A;  3JUE A;  4GTV A;  2E2E A;  1DNP A;  1OUV A;  3HRA A;  3IV0 A;  4U8Y D;  3DEP A;  5FZS A;  4N2Q A;  2E0I A;  2CMT A;  4UQY A;  2NSZ A;  2XHE A;  4DGD A;  1MJ0 A;  1BU9 A;  3D9L A;  3BU8 A;  2LNI A;  1N95 A;  1MHQ A;  3ZHE A;  5KV5 A;  2P9K G;  2R17 C;  1U3C A;  3UM1 A;  3FTV A;  4F1P A;  3RDC A;  3QB2 A;  5AAR A;  4G26 A;  5HQ8 A;  3CIA A;  3QWV A;  1AWS A;  2M63 A;  5AEN A;  3CYH A;  3AU5 A;  1YYH A;  2R05 A;  4J6I A;  3TL5 A;  4RQI A;  5EN5 D;  3TWW A;  5BXO A;  3FUJ A;  4HRM B;  1S70 B;  2X38 A;  1QNF A;  2LUH A;  1ZMF A;  3L82 A;  4U96 D;  5KUZ A;  3AG3 E;  4JJM A;  2DWZ A;  3L08 A;  2IF4 A;  3CQG B;  3IHY A;  4I1A A;  2IQC A;  3DWL G;  3SFX A;  2IU1 A;  3ZPJ A;  2HQJ A;  5T3R A;  1LTX A;  2WMN A;  5CCR A;  3B7U X;  4ME2 A;  2LO6 A;  4K5B A;  3FFL A;  4BET A;  1MYO A;  5D0O D;  3WXX A;  2EIJ E;  4J8F A;  2VGX A;  2IOS A;  2X6I A;  2I1K A;  3QDN A;  4I2Z A;  1MZW A;  3TXN A;  4IPZ A;  2C0L A;  1EF1 C;  2VSY A;  4BX9 A;  3S2A A;  4UQZ A;  2HE0 A;  2WXK A;  1UN9 A;  4GTP A;  3JXI A;  5AQA A;  3C5R A;  2WVI A;  4OVV A;  4N1Q A;  1UW4 B;  3U64 A;  2P58 C;  1E96 B;  5AYW D;  4GTT A;  3KEZ A;  3FH5 A;  3PZ3 A;  4HI9 A;  2Y0B G;  3FU3 A;  4Y6W A;  2VYI A;  5JHA A; 
#chains in the Genus database with same CATH homology
 5BV0 A;  4CEM A;  1U3D A;  1Z6T A;  3ZIM A;  2HQ6 A;  4PS7 A;  3UCH A;  4KT6 B;  5KUW A;  4GA1 A;  3Q4A B;  5CCL A;  2V0P A;  5T4Y A;  2XGY B;  4AEZ C;  3FUF A;  2X7K A;  4L23 A;  1XNF A;  3APC A;  1CWF A;  2IOL A;  2WQ6 A;  3PUK A;  1CYN A;  3SGH A;  2AXZ A;  3Q47 B;  3BEE A;  4YUH A;  2Z6W A;  4ANV A;  4DLO A;  3LS8 A;  4JHR A;  1QNG A;  3PH0 C;  3Q5M A;  3R7Q A;  1OWL A;  4N3B A;  4UWF A;  3BO7 A;  4BSX A;  3PUJ A;  4GZD A;  2XQ0 A;  2WXP A;  2BF0 X;  3CLJ A;  4U63 A;  3MJW A;  4GML A;  1M9X A;  2KM4 A;  2FF4 A;  3SBT B;  4XKB A;  4J5E X;  1XGW A;  1YA0 A;  3JCK C;  1IHG A;  5T8I A;  2OOE A;  4ACL A;  4G25 A;  1FGL A;  3RDA X;  4CT0 A;  1E7U A;  3K0Q A;  4GMJ A;  3UT8 A;  4YND A;  4C0M A;  5BUZ A;  4A1G A;  3ZYQ A;  1ELR A;  3MCX A;  2YNQ A;  3ZYL A;  2X25 B;  2CFE A;  2K7N A;  3L6A A;  1PC2 A;  1OWM A;  4GYO A;  4WNG A;  1ZBP A;  2KCV A;  4EEC A;  1J2A A;  2CYH A;  1KT1 A;  4TV3 A;  5CHE E;  1XWN A;  1CLH A;  3AS4 A;  2XGM A;  5FQ7 A;  3OXL A;  2KZT B;  4BTB A;  3FTW A;  3SNX A;  4LEU A;  2J09 A;  1GW6 A;  1N54 A;  4HFG A;  4JPS A;  1VAI A;  4J5D X;  3D9O A;  4XIF A;  2I2O A;  4K0R A;  2MHK A;  4KBQ A;  4LCT A;  3TJP A;  4F3V A;  4S1E A;  5KV7 A;  2VJ8 A;  3GZ1 A;  2WXN A;  2MC9 A;  3CHO A;  4J5A X;  3FTU A;  2LSV A;  3BG0 B;  1TJC A;  2CHZ A;  2UY1 A;  2AXV A;  3D9M A;  3L16 A;  3G2S A;  4JHJ A;  4LER A;  1M9F A;  2OJU A;  4HY7 A;  4IYP A;  3O7T A;  4P29 A;  1M9D A;  4I9Y A;  3TGO A;  3ASG A;  4YVO A;  3RO3 A;  3U66 A;  4M3O A;  4Q96 A;  2X2D B;  2KC7 A;  3EOV A;  1W8L A;  3AU4 A;  4LUN U;  5CCM A;  3EHN A;  5E76 A;  1E8W A;  1WM5 A;  5BNW A;  3FUD A;  3CHR A;  3GZ2 A;  3CGH A;  3LVQ E;  3NZS A;  2VQ2 A;  4N5C A;  3FUI A;  4B89 A;  4DLQ A;  1LF8 A;  4UWH A;  2NUL A;  2WM9 A;  4HOU A;  3PS6 A;  4FRV A;  3S7F A;  3PVL A;  4N1O A;  2XEV A;  5KUQ A;  3GYZ A;  3I4R B;  4YUL A;  4CGV A;  2R5S A;  2WQ7 A;  3MZL B;  1BCK A;  4U8H A;  2C2L A;  3LXU X;  5ARF A;  2RD0 A;  3FTY A;  4H7Y A;  5J90 A;  3CVN A;  3CHM A;  3FDH A;  1HFA A;  1TJF A;  3G2U A;  1E8Z A;  3R49 A;  3ZN3 A;  4YUG A;  5LFA A;  4DGB A;  1A17 A;  2L9B A;  3FEY A;  2GRL A;  3RIB A;  4BY6 A;  3CYS A;  2I1J A;  3RKV A;  4MRU A;  1E3B A;  3JB9 d;  1Z3Y A;  3EDT B;  4B8A A;  4GZC A;  3C98 A;  3QYU A;  1HF8 A;  5LOZ A;  3S6M A;  4KZC A;  5J08 A;  1IQU A;  1NMK A;  4JEH A;  1SQM A;  3OAW A;  3LJ3 A;  1Z3X A;  5D0Q D;  1FCH A;  3JQ1 A;  4JL0 A;  4CT4 A;  4EQF A;  1E90 A;  4XI0 A;  5KJM A;  2FUL A;  4EBA G;  1VBT A;  2MRI A;  1CWA A;  5KV3 A;  4GA2 A;  5ENN A;  2KCL A;  2Y3A A;  3CK7 A;  4WUY A;  3RRU A;  4HVB A;  4EZL A;  4WNE A;  4AY5 A;  4FHK A;  1L5J A;  3D9I A;  2WXI A;  4W9R A;  1CWO A;  2QFC A;  2YQ8 A;  4IN3 B;  4L7T A;  4BT9 A;  3CHP A;  1V9T A;  5FWQ A;  3UPV A;  4GPK A;  2RMA A;  5KUV A;  2HAQ A;  3JUI A;  3RRN B;  1QZ2 A;  1W8M A;  2HE9 A;  3RCK X;  4I9E A;  1CWJ A;  2GW2 A;  4FLH A;  2WXM A;  4FAD A;  3CST A;  3ONL A;  2PQR A;  1WY6 A;  5CCN A;  2X6F A;  3IHV A;  5JJT A;  1S0P A;  3FUL A;  3MML A;  5LCW C;  4AIF A;  3K0R A;  4I9C A;  5CCS X;  3ZHE B;  5A23 A;  4TRQ A;  3U4T A;  4N39 A;  2ION A;  4YUP A;  4CDR A;  3AS5 A;  2JLB A;  1ZKF A;  2X83 B;  2BTD A;  5FT9 A;  3CKB A;  4BFR A;  3VA7 A;  3L22 A;  4GA0 A;  3S7B A;  5KV0 A;  2RS4 A;  3LYA A;  2FEZ A;  5G05 J;  1HE8 A;  2X3M A;  4U0S A;  4HOR A;  1H6K A;  3PNT B;  3L17 A;  4A1S A;  4ABN A;  4Q94 A;  1W74 A;  3RDB A;  1X5B A;  3FU0 A;  3QKY A;  1E7V A;  3CHQ A;  3P2B A;  4GYW A;  4UI9 C;  3CQC B;  4FRU A;  1W3B A;  5ANL A;  2QY7 A;  4ACK A;  1UG3 A;  3FUN A;  4AXH A;  2IGW A;  1MIK A;  3BKP A;  2J4D A;  3ASH A;  2V8S E;  4NUR A;  3PRE A;  1HXI A;  2WXJ A;  4FJZ A;  3G2W A;  3MX3 A;  2XPI A;  3IEG A;  4FHJ A;  5FZR A;  3VLE A;  4EPZ A;  3IKO B;  3RCI X;  2BUG A;  3ZYK A;  2CG3 A;  3EIJ A;  2B71 A;  3R4G A;  3HIZ A;  1H0A A;  2WXH A;  3EIQ C;  1IIP A;  4FLB A;  4BWR A;  3NZU A;  5BT1 A;  4YUM A;  3FH8 A;  2L6J A;  4KZ0 A;  2WFJ A;  3DBS A;  4EZK A;  3VLF A;  1CWL A;  2PM6 A;  3ZGQ A;  4AP2 A;  4O8H A;  2XPZ A;  5C1D A;  3MGB A;  2GW1 A;  2LAH A;  1QNH A;  5LP0 A;  1H19 A;  4AY6 A;  1VBS A;  1B89 A;  2OND A;  3B7R L;  2XRY A;  4EYV A;  1OWN A;  1FVF A;  3FUM A;  3RCF A;  3ASF A;  4MKT A;  4U0Z A;  2X2C K;  3QC1 A;  4UQX A;  4J8S A;  4KVM A;  2VSO E;  3CVW A;  4HOT A;  1CWH A;  2MVZ A;  2YHC A;  3K0N A;  3CVP A;  4APO A;  5CMY A;  3UQ3 A;  5BPP A;  3FP3 A;  3PMP A;  4AJW A;  5FQ4 A;  1YND A;  3APD A;  4WWP A;  5FZQ A;  5G55 A;  5KUO A;  4J0U A;  3CSF A;  5DUD A;  2NC9 A;  1AWT A;  3OEP A;  3ODL A;  4J5C X;  3RD9 X;  2WXR A;  2XGS A;  3MKQ A;  5CMW A;  4YUI A;  1EDU A;  4HOQ A;  2ZP2 A;  3K0O A;  4O8I A;  4C0E A;  4GB9 A;  1N52 A;  1ZU2 A;  2A5U A;  4I17 A;  5FTP A;  4JEU A;  4B0Z A;  3OPF A;  5E75 A;  2VGX B;  3FTX A;  3CK8 A;  5G04 C;  2VSX E;  3B7S A;  1AWQ A;  2DCP A;  3OXG A;  4O6F A;  4HOS A;  5CBT A;  4PH4 B;  4DJA A;  3TAX A;  3ULQ A;  5KV6 A;  4J59 A;  4G23 A;  4I2W A;  3PRZ A;  3ZXS A;  3FTZ A;  3L54 A;  1CWC A;  4UWK A;  1OCA A;  1HG5 A;  3ZW3 A;  4I6J A;  2OV8 A;  2GRM A;  4G2V A;  4FA6 A;  3Q15 A;  2V5F A;  4EBA A;  1NA3 A;  2VGY A;  2MOW A;  4DGC A;  4XKC A;  2WXL A;  3PNL B;  2Y4U A;  4H7X A;  5CBU A;  3QAQ A;  4A3V A;  3LKU A;  1Y6I A;  2FBN A;  2CFZ A;  5ANR A;  3R7R A;  4E6H A;  2KAT A;  4E1Q A;  1H0P A;  2VSN A;  3GZS A;  3T8M A;  2RMC A;  5KV4 A;  4GCO A;  5KJK A;  2ALF A;  1QOI A;  3CKC A;  3UT7 A;  5EX0 A;  4AVX A;  1MQS A;  3OTN A;  5JJ6 A;  3B7T A;  2XRZ A;  4NRH B;  3RU0 A;  1QQE A;  2Q7F A;  1A58 A;  2PM7 A;  3PZD A;  4J8E A;  3ZVV A;  1AWR A;  3CV0 A;  5AIJ A;  1AWU A;  2WB2 A;  3LEW A;  4B94 A;  4GCN A;  4B8C B;  4JHK A;  1M9Y A;  2R59 A;  2AXU A;  3FEX A;  4FU3 A;  3SFZ A;  2WQH A;  3I5P A;  4ILH B;  1EYH A;  4AM9 A;  2HR2 A;  4GZ3 A;  2J9Q A;  3NF1 A;  5FJY A;  4DI3 A;  1AK4 A;  2WLW A;  3ZFW A;  2OVF A;  2IGV A;  4ANU A;  4RSY A;  5FQ8 A;  2RMB A;  1HU3 A;  3PDN A;  3HVE A;  3NQP A;  3T5V A;  1BPO A;  1JPL A;  2IFU A;  3DPD A;  2I6H A;  1LOP A;  4YUJ A;  4HLE A;  1FVH A;  1Z81 A;  4CRW A;  3R57 A;  4JA9 A;  1NZN A;  4I6G A;  2FU0 A;  3PE3 A;  3S7J A;  2WXG A;  5M72 A;  3FU6 A;  3KS2 A;  3OXF A;  4UI9 K;  4WWO A;  1CWM A;  3FUH A;  4R7L A;  2A2N A;  3URZ A;  3BG1 B;  3G2T A;  4R3E A;  4NQ0 A;  4CDN A;  2KZT A;  3FTS A;  4GU5 A;  2I9C A;  2PLU A;  4CGW A;  3UX4 A;  1UN8 A;  3RJV A;  4JXT A;  3SBS A;  3SHF A;  3R56 A;  3K9I A;  3UMV A;  3JQ0 A;  2J08 A;  3LPZ A;  5LCW J;  5AJL A;  2POE A;  4ZSC A;  4AV7 A;  3MML B;  1H2T C;  3FUK A;  4XI9 A;  5EKQ D;  3QWW A;  4EZJ A;  3BT8 A;  2J4B A;  1HG2 A;  3FUE A;  4FJY A;  3CVV A;  1XYH A;  4N1R A;  4YUK A;  3HYM B;  3CEQ A;  1XO7 A;  2X6J A;  4RG6 A;  4OVU A;  3QAR A;  2ESL A;  4LRZ A;  5KCM A;  3T5X A;  4MLP A;  2CFU A;  4AOF A;  4N2S A;  1KT0 A;  4J5B A;  1JWG A;  3T1U A;  4L2L A;  4UI9 J;  4GZ6 A;  2XCC A;  5KJL A;  2XPY A;  3D9K A;  3ESK A;  3R9A B;  3D9P A;  2X6H A;  3FY4 A;  3ML8 A;  4A3T A;  1A33 A;  1DYW A;  2BIU X;  5JHE A;  1ELK A;  1UJJ A;  2UY1 B;  3KD7 A;  4I6E A;  4JCP A;  3RFY A;  5KUL A;  1SZA A;  3GW4 A;  3B13 A;  3RDD A;  3LY8 A;  3VLD A;  3VTY A;  2OK3 A;  4RG9 A;  1P5Q A;  4YUN A;  3ODI A;  2R99 A;  2P0O A;  5BW8 C;  1JWF A;  4L2Y A;  4ATG A;  3MV2 B;  4N1M A;  2CK1 A;  3QOU A;  2GGF A;  1HS6 A;  3HDX A;  3MYV A;  4DI4 A;  1WAO 1;  4Y6C A;  4N1N A;  3ML9 A;  4I43 A;  3ZEF A;  1E8K A;  1W8V A;  5AJD A;  3I4G A;  3RCL A;  3SI5 A;  3TXM A;  4YUO A;  3TG4 A;  4QFV A;  3AS8 A;  1HO8 A;  2CHX A;  4JC8 A;  3CVX A;  5DIZ A;  2CPL A;  4TOT A;  2E2E A;  1DNP A;  1OUV A;  4U07 A;  3APF A;  1E8X A;  2XGO A;  3IV0 A;  3N71 A;  4PS3 A;  5FZS A;  4N2Q A;  3ICH A;  3O4Z A;  4PS8 A;  4C9B B;  2HM8 A;  3IBE A;  3L13 A;  3PE4 A;  3RO2 A;  2WFI A;  3ONK A;  3G2V A;  3O48 A;  4G11 A;  4BX8 A;  4ZSD A;  5EX3 A;  2E0I A;  5C2Y A;  4MS6 A;  2CMT A;  2ZU6 B;  4PDX A;  4UQY A;  2WXF A;  1VDN A;  2ILR A;  4N1S A;  2VTB A;  2NSZ A;  5CCQ A;  2XHE A;  3CK9 A;  2NXP A;  4A55 A;  4DGD A;  3D9L A;  2EQX A;  3R59 A;  3HVE B;  2X2A A;  4S1J A;  4N3A A;  2DBA A;  1OWO A;  5G04 J;  2WXQ A;  3CVU A;  1C5F A;  3QK0 A;  3PEU B;  2RG8 A;  4DPR A;  2AVP A;  2LNI A;  5G2N A;  2JEK A;  3UT4 A;  5BV1 A;  4ANX A;  2FO7 A;  4PUC A;  1Y8M A;  1MHQ A;  3ZHE A;  2HYZ A;  4KMO A;  4JVS A;  1CWB A;  5KV5 A;  3D9J A;  2R17 C;  1U3C A;  1M9E A;  3QNK A;  3FTV A;  3LY7 A;  3RDC A;  3QB2 A;  4G26 A;  3LCA A;  2X6K A;  5HQ8 A;  3ENE A;  3CIA A;  2MS4 A;  5KUS A;  3CVL A;  2PZI A;  3QWV A;  1AWS A;  2LAI A;  4KVO A;  2M63 A;  2A4Z A;  5HI7 A;  3ZRH A;  2DIW A;  3SZ7 A;  3SF4 A;  3QJZ A;  4HS2 A;  4F7A A;  3D3M A;  3FHE A;  4RVB A;  3AU5 A;  5AEN A;  5JJ7 A;  3CYH A;  1TEZ A;  2WMO A;  3JYS A;  4WAF A;  4DGE A;  1DVP A;  4G24 A;  4IRU A;  4GZ5 A;  1X7F A;  3D9N A;  3I3N A;  4J6I A;  4R3F A;  2QER A;  1PY1 A;  3TL5 A;  3RRM B;  5A7D B;  2FI7 A;  4UWG A;  1E8Y A;  1H2U A;  4UWL A;  4Q69 A;  3K2C A;  3RK6 A;  3ORE A;  3HHM A;  3LDZ A;  3FUJ A;  2OSE A;  3LY9 A;  2J07 A;  3MKR A;  4L1B A;  4D10 C;  5JHB A;  1HZ4 A;  2IJG X;  2X38 A;  1JUQ A;  3CVY A;  1XQ7 A;  1QNF A;  1ZMF A;  3K0P A;  3FH7 A;  5KUZ A;  4JJM A;  5A0E A;  1HX8 A;  3ESL A;  5KJN A;  3L08 A;  1CWI A;  5CBV A;  2IF4 A;  3CQG B;  3IHY A;  1SZ9 A;  4I1A A;  2C3B A;  2IQC A;  1H2V C;  3P1U A;  4E85 A;  2LSU A;  5DBK A;  3ICI A;  1NP7 A;  2PL2 A;  3TG5 A;  4DK5 A;  1PAQ A;  5KV2 A;  3SD5 A;  3VTX A;  2IU1 A;  2PQN A;  3ZPJ A;  2XCB A;  3CR3 A;  2HQJ A;  4FP7 A;  2CG2 A;  5T3R A;  3EHM A;  5EDS A;  5JHA A;  5CYH A;  2YHE A;  4NAC A;  4YVQ C;  2CHW A;  2J49 A;  2KCK A;  3RCG A;  2WMN A;  5CCR A;  2AW6 A;  4BTA A;  3B7U X;  4ME2 A;  4N1P A;  2OVB A;  2UWJ G;  2YIN A;  2LO6 A;  4XNC A;  5CBW A;  3FFL A;  1ZKC A;  3U9W A;  2Y4T A;  4JA7 A;  4XX5 A;  1AWV A;  5KV1 A;  5D0O D;  3WXX A;  5LX8 A;  4CYH A;  3ZYM A;  4J8F A;  5FQ6 A;  2VGX A;  1EPU A;  3MEK A;  4J8D A;  4JW1 A;  2IOS A;  4V3I A;  1MF8 C;  3R54 A;  4N3C A;  5A6C A;  1INZ A;  2X6I A;  4WND A;  2I1K A;  3QDN A;  4J58 A;  4I2Z A;  4URK A;  4U0U A;  3MA5 A;  3Q49 B;  1MZW A;  3TXN A;  4IPZ A;  3CVQ A;  5KUN A;  3S7D A;  3ASD A;  5LUD A;  3MKQ B;  4FUL A;  2C0L A;  1OWP A;  2VTB B;  2POY A;  1EF1 C;  3LVR E;  1IST A;  2VSY A;  3QWP A;  2AWI A;  4HXI A;  4K03 A;  2N0T A;  2WXO A;  1CWK A;  2C0M A;  4BX9 A;  4JZY A;  3FWV A;  2L0I A;  3S2A A;  3E4B A;  2WXK A;  4UQZ A;  4F53 A;  4LQW A;  2V4L A;  4CDM A;  3K0M A;  5F66 A;  3UUX A;  4OYS A;  1UN9 A;  1IYG A;  1VDY A;  4I1O B;  1M63 C;  4CCA A;  3PEV B;  4KXK B;  3KAE A;  2WVI A;  4I1M A;  2WPV A;  4IUL A;  1UJK A;  4OVV A;  4U04 A;  1UW4 B;  3MV3 B;  4N1Q A;  1ELW A;  4KYO B;  4FC8 A;  2BIT X;  3U64 A;  1NA0 A;  3CHS A;  5ARG A;  5G05 C;  2P58 C;  4GYY A;  3U3W A;  3FU5 A;  4XZ4 A;  1E96 B;  4APF A;  2HO1 A;  5AYW D;  4WNF A;  4DGA A;  4F1S A;  3KEZ A;  3FH5 A;  4ILG A;  1RMH A;  4GAA A;  1IQR A;  4ILI A;  4WWN A;  1HH8 A;  4BT8 A;  2PHC B;  3FU3 A;  4Y6W A;  2VYI A;  5KUR A;  1KLX A;  2L0T B;  4TUU A;  2MZU A;  5KUU A;  3EJN A;  4G1T A;  1M9C A;  4ANW A;  4XE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...