1IHGA

Bovine cyclophilin 40, monoclinic form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
364
structure length
364
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
molecule keywords Cyclophilin 40
total genus 130
structure length 364
sequence length 364
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ihgA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1ihgA01
1ZKCA 4I9YA 3OXGA 4HY7A 4J5EX 4AY6A 4YULA 1AWRA 2MHKA 1AWQA 3QWVA 5CBWA 4GYOA 2PL2A 1NZNA 3OXFA 5EX3A 1AWSA 4YUMA 2VQ2A 2RS4A 3K0QA 5A6CA 5A0EA 5D0OD 1P5QA 4DGEA 5G04C 1W8LA 3FP3A 3T1UA 4J8FA 3ASGA 4HOSA 2HAQA 2V5FA 4BTBA 3O48A 4BTAA 3BT8A 3QKYA 4CGWA 1M9DA 1OCAA 4ME2A 3GZ1A 3GW4A 4HORA 3IEGA 2NULA 3LYAA 2FU0A 2XGSA 3FFLA 3ULQA 2HR2A 5DUDA 4DGCA 1B89A 4IPZA 4XNCA 4N2SA 2XGOA 4A1SA 3S7FA 2Z6WA 3RCKX 1NMKA 2WLWA 5CBVA 1ZU2A 2Y4UA 4FRVA 2UY1A 3TG4A 4U07A 2ALFA 3CV0A 2HQ6A 3R49A 2XEVA 4GA2A 1RMHA 2IGWA 1QZ2A 2I6HA 5KUUA 3CK8A 2DBAA 5KUVA 2XCCA 3R54A 3RFYA 2J9QA 4ABNA 3CVLA 3ODLA 1NA0A 5CBUA 4N1MA 5JHEA 2FEZA 4N3BA 5M72A 2CYHA 3OREA 4EYVA 1CWFA 2QERA 5KUWA 4BT9A 1M9YA 2VYIA 4N1PA 3O7TA 2OOEA 3ZHEA 3ZPJA 1IHGA 3MMLB 5HQ8A 4HOQA 2MS4A 4IN3B 3BKPA 4R3FA 3MEKA 4W9RA 2LSUA 4RG6A 3GYZA 5ARFA 4WNDA 2PQNA 4YUKA 1A17A 3CYSA 5FT9A 4WUYA 3ASHA 3OXLA 1MZWA 5LUDA 3KAEA 4G24A 1CWJA 5KV7A 1KT0A 3VA7A 4GCOA 1CWCA 5G04J 4N3AA 1VAIA 3QWWA 2PZIA 3U4TA 3Q15A 3HYMB 4JA7A 5KV6A 5FJYA 4UQYA 3CKCA 4O6FA 1KT1A 2HQJA 3ZFWA 3VTXA 4J5AX 3LPZA 5BNWA 3E4BA 3KD7A 2ESLA 1E8KA 4O8HA 3S6MA 4U0UA 3CVNA 1A58A 5KURA 3S7DA 4J8EA 5KUOA 3N71A 4I2WA 2LSVA 4WNGA 2VGXB 2N0TA 4GCNA 2XGYB 2GW2A 3K0OA 2FI7A 4GYWA 4U0ZA 1XQ7A 4XI9A 2ONDA 3RDDA 5KV5A 3BEEA 4JHRA 3S7JA 4GZ6A 2UY1B 3R59A 5CHEE 2RMAA 2X83B 1KLXA 2VSYA 4YUIA 2IF4A 3RCGA 3MV3B 1ELWA 5CCNA 3QOUA 2IFUA 4JJMA 3CVPA 4YVQC 4E1QA 1M9FA 2XPIA 2FO7A 2CPLA 3RO2A 2P0OA 3KS2A 3RCLA 1QNGA 4ZSCA 3R9AB 4GZ5A 3RU0A 2HO1A 1VBSA 1ZKFA 3R57A 4ZSDA 3MKRA 1HXIA 4LQWA 4YUOA 2JLBA 2CMTA 3RDBA 1NA3A 4N1SA 3LKUA 4F3VA 3ICHA 3VTYA 3PDNA 4DGDA 2UWJG 4N1QA 2B71A 3ASFA 4WNFA 3AS5A 3K0RA 3UPVA 2E2EA 1H0PA 3EDTB 3JYSA 3UQ3A 4UI9K 1Y8MA 2CFEA 3TG5A 3S7BA 1W8MA 5KULA 3QYUA 1VDNA 1M9XA 1XYHA 5KUZA 4YUJA 4J58A 3PE3A 1IYGA 1CWHA 4J0UA 2LNIA 1AWUA 4R3EA 1VBTA 2BIUX 3K0PA 3CKBA 4KBQA 1CWAA 4J5BA 2KCKA 5DIZA 1J2AA 2OJUA 1XWNA 4CGVA 2X7KA 4G26A 4DGBA 4WNEA 3TAXA 4XIFA 5CCRA 4I9CA 1M63C 3ODIA 5KV3A 3BO7A 4FRUA 5EX0A 2PHCB 4CDRA 1PC2A 4GYYA 3AS8A 2YHCA 2WPVA 5KUQA 2WFJA 2P58C 4YUNA 5D0QD 4N39A 1DYWA 4G23A 4I1AA 3RCIX 3UCHA 3TGOA 4HOTA 3ASDA 1W8VA 4I17A 5CCQA 2VSNA 2IGVA 1AWTA 4N2QA 1TJCA 4KYOB 4YVOA 1CWMA 1HZ4A 4I9EA 2L6JA 2HYZA 1CWBA 2C3BA 2RMBA 5CYHA 4YUGA 2RMCA 5CCLA 1ZMFA 5KV2A 5A7DB 2MC9A 3OPFA 2KC7A 4GA1A 2NC9A 4AY5A 3K2CA 3U3WA 2VGYA 4H7XA 1WM5A 4G25A 2PQRA 4J5CX 5FZQA 5HI7A 2C2LA 4N1OA 2Y4TA 4LEUA 2KCVA 4XI0A 5BW8C 5KV0A 4G1TA 2FBNA 4I2ZA 1QOIA 5JJ6A 1CWIA 2FF4A 2HE9A 3EOVA 3SZ7A 3R56A 5F66A 1OUVA 3CEQA 5KUSA 5KUNA 2X2DB 3Q49B 4JL0A 5JJ7A 5FZSA 4JCPA 3RKVA 2R99A 2MVZA 3MV2B 5G05C 2QFCA 4GA0A 3ZN3A 3ZHEB 4N3CA 4NQ0A 4Y6WA 1BCKA 1CWOA 1ZBPA 3PMPA 4HOUA 4YNDA 4H7YA 5FZRA 1E96B 2KCLA 4UI9J 4YUHA 2CK1A 5KJMA 4UQZA 2OK3A 3RDAX 1CWKA 2POEA 5LCWC 4U0SA 1MIKA 1QNHA 4BT8A 4TOTA 5JJTA 4DGAA 3OEPA 3NF1A 1CLHA 3MA5A 3R4GA 3QWPA 4S1JA 3PE4A 3URZA 4O8IA 2VGXA 4GPKA 2C0LA 2XGMA 4EQFA 2OSEA 1FGLA 4J5DX 3RCFA 1XNFA 3AS4A 1E3BA 3K0NA 2K7NA 3CK9A 3ESKA 2WQHA 3FWVA 2X25B 1FCHA 4BWRA 4Y6CA 2BITX 5EKQD 1ELRA 5KJLA 5CCSX 4GZ3A 1LOPA 1XO7A 2MZUA 1HH8A 3Q47B 2X2CK 4UQXA 1W74A 1CWLA 4N1NA 4S1EA 2Q7FA 3RO3A 5KV4A 2BUGA 5BT1A 4U04A 5DBKA 4N1RA 3RJVA 1M9CA 4N5CA 4YUPA 2A2NA 2ZP2A 1AK4A 3JB9d 5KJKA 1CYNA 2PLUA 4J8DA 3RIBA 2C0MA 3LY8A 1W3BA 1IIPA 1YA0A 1X7FA 1M9EA 3K0MA 2WFIA 3GZ2A 4AIFA 3MMLA 3WXXA 3ICIA 5LCWJ 1C5FA 1A33A 3Q4AB 5C1DA 5CCMA 3RDCA 5FTPA 2XCBA 4KXKB 5KJNA 4UI9C 3ZGQA 3LY7A 2KATA 4JA9A 5ARGA 3CK7A 4CYHA 2R5SA 3K9IA 1YNDA 3LY9A 1QQEA 1AWVA 1Z81A 3RD9X 4RG9A 3LCAA 3Q5MA 4G2VA 1ISTA 2POYA 5KV1A 2YQ8A 5G05J 1V9TA 2GW1A 3CVQA 4APOA 3CYHA 1WAO1 4B94A 4NRHB 2AVPA 3UUXA 5CBTA 5AYWD 4AM9A 3SF4A 4J59A 2X2AA 1MF8C 3QDNA
chains in the Genus database with same CATH superfamily
1ZKCA 3Q9NC 5AJLA 4AY6A 4YULA 1AWRA 2WXLA 4FHJA 2PL2A 1NI1A 3OXFA 1E90A 1AWSA 2RS4A 5A6CA 3PEUB 1P5QA 4DGEA 1W8LA 3FP3A 4G11A 3AU5A 4CYMD 4AOFA 1INZA 2NULA 1ZB1A 2FU0A 2XGSA 5HRYA 4DLQA 4I1OB 3Q7FA 2XS1A 1KPSB 2HR2A 3DSVA 3BU8A 1KZOA 4N2SA 3PRZA 3FHEA 2Z6WA 3U9WA 2Y3AA 1ZU2A 3L9TA 4HI8A 1OWPA 3PUKA 2ALFA 3R49A 2XEVA 1QZ2A 2L0TB 2OVFA 1NP7A 3CK8A 3LJ3A 4O60A 3R54A 3RFYA 4HRNA 3CVLA 3SO8A 3CVUA 4EYVA 5KUWA 2VYIA 3O7TA 3ZHEA 3ZPJA 3BKPA 4FJYA 2F8YA 3I3NA 4GMRA 3MEKA 4E6HA 3UM2A 2LSUA 1S70B 3ZVVA 3EHQA 4QQIA 3EIJA 1D8DA 2PQNA 4GTVA 1A17A 4WUYA 1Z3XA 2BTDA 4B8CB 1E8YA 3KAEA 4UWLA 3FUKA 3UKUG 1MX6A 2BF0X 3ZEFA 2ETAA 4LNBA 2WXOA 1VAIA 3U4TA 5KV6A 5JA4D 1FT1A 4O6FA 3UM3A 3B7BA 1VDYA 4BSXA 3VTXA 5G2NA 4L9PA 3ZYQA 4JW1A 2ESLA 1FVHA 3KD7A 5EILA 3T5VA 5FQ6A 4C0EA 2P9SG 1FT2A 1N52A 3IKOB 1L5JA 5KUOA 3N71A 4I2WA 3BG1B 4WNGA 4HLEA 3HHMA 4GYWA 3Q9UC 2VTBB 2HE0A 2ONDA 4DI3A 5KV5A 4URKA 4C0MA 4BESA 2UY1B 3UIPC 3JXJA 3ZXPA 2QY7A 1KLXA 2VSYA 3PNTB 4LUNU 3MV3B 5CCNA 3QOUA 1LD8A 1N9AA 4YVQC 1M9FA 2XRZA 4LERA 2L9BA 5ENOD 1IQRA 2V8SE 4GZCA 3RU0A 2WQ7A 3R9MA 2F8XK 3UIOC 1HXIA 4EZJA 4FLHA 3CVVA 4YUOA 2JLBA 2CMTA 3UMVA 3PDNA 3ZYKA 4N1QA 2B71A 5KBAA 3FUMA 3UM0A 4ACKA 1H0PA 3EDTB 2PNNA 3UINC 4Q96A 5BV1A 1TN7A 1N4QA 2XEHA 5EN5D 4DK5A 4XX5A 2J4BA 4K5CA 4YUJA 2WXJA 5KWDA 3UKRG 3OTNA 3PE3A 1IYGA 4J0UA 1SZAA 1SVXA 1TN6A 2RG8A 2P9LG 4ZFHA 4AV7A 5BV0A 4L23A 1VBTA 4J5BA 3NQPA 3JUIA 2LO6A 5ENPD 4DGBA 2CHXA 3D9NA 4B0ZA 4I9CA 3MKQB 5AARA 3BO7A 3B95A 4TRQA 2H6HA 5EX0A 4GYYA 2WPVA 5CMYA 4MRUA 4L7TA 4I1MA 3O4ZA 5D0QD 2DYRE 1DYWA 2MYOA 1E7UA 3ZUVB 4I17A 1WG0A 2GRRB 3L22A 1OCRE 3AG4E 1HZ4A 2L6JA 5CBNA 5CYHA 4K0RA 3ABKE 1OCZE 2V0PA 1ZMFA 2WXGA 4NURA 3DBSA 3AAAC 4AY5A 4PS7A 2X6JA 4G25A 4I43A 1RW2A 2C2LA 4U95D 2KCVA 3CVYA 4XI0A 5KV0A 3ML8A 4I2ZA 2VSXE 1CWIA 3HXCA 3TWRA 2DWZA 5KUSA 1WY6A 5AQ7A 5KUNA 4JCPA 1N0QA 1SQMA 4FULA 5KNGA 4CRWA 2QFCA 3ONKA 4GA0A 2B0OE 3FH8A 5EIDA 4N3CA 1TNZA 4DJAA 1CWOA 4H7YA 4A3TA 1E96B 4UI9J 4GB9A 4MLPA 4UQZA 2OK3A 1HU3A 1K1BA 3CHMA 3E30A 1MIKA 1JUQA 4BSZB 3OEPA 3UTMA 2LAIA 1CLHA 3MA5A 3PE4A 5JHBA 4J5DX 1FGLA 2X38A 3K0NA 3CK9A 4BWRA 4Y6CA 5KJLA 1YCSB 4UQXA 4DX6D 2AXVA 5CEAA 4S1EA 5HKPA 2Q7FA 5KV4A 4FA6A 2BUGA 5BT1A 4UWKA 3RJVA 4DX1A 3FTYA 5LP0A 3JB9d 2PLUA 4F6RD 3UT4A 3JUEA 4J8DA 5ITZF 4OYSA 1W3BA 3I4GA 4WWOA 2XEEA 2X6IA 3CVXA 4AIFA 1JWGA 4BERA 2X3MA 3FTZA 5CCMA 1QYMA 3B7TA 4KXKB 3C3QA 4UI9C 3ZGQA 3LY7A 2IO2C 3FUIA 1FPPA 2R5SA 3K9IA 5CEDB 4RG9A 4LNUD 4J6IA 1ISTA 2R2LA 2POYA 5KV1A 5LX8A 3KEAA 3QNKA 3CVQA 4APOA 1X5BA 3G2VA 1K1AA 2KBXA 3BUAA 5AYWD 4AM9A 1OCOE 4J59A 3TWXA 3CHQA 4U8VD 2X2AA 4MKTA 2P9NG 4ANUA 4ZSDA 4I9YA 3OXGA 3AG2E 5C2YA 3DRAA 3CHOA 2LUHA 4GYOA 4GTTA 4YUMA 3K0QA 4DLOA 3T1UA 4HOSA 2HAQA 4BTBA 3ESLA 4CGWA 2Y1LE 4ME2A 2GRPB 1JPLA 3IEGA 2IO3C 3FFLA 4UWHA 4IPZA 4TUMA 5CBOA 4A1SA 3S7FA 1Z5SC 3DEPA 3VLEA 3LJNA 5BXOA 5J08A 3RCKX 3SBTB 2FO1E 1OT8A 4FRVA 4GTRA 3TG4A 5BPPA 4GA2A 4KZ0A 1EYHA 3V2XA 4PUCA 2VTBA 1DNPA 4F53A 5CBUA 1NA0A 5JHEA 4N1MA 2WXNA 2BKGA 4GTQA 5M72A 4DX2A 3OREA 2H6GA 4DPRA 4HOQA 2CFZA 3QARA 4R3FA 2XHEA 4HXIA 1O5MA 4RQIA 3FUFA 1H6KA 2WXKA 3GYZA 1UG3A 2X6FA 5ARFA 4EHMA 4YUKA 3TWWA 5CRVA 3FTXA 3OXLA 5LUDA 5IY5E 4UWGA 3V2OA 1CWJA 5KV7A 3MX3A 1UN8A 2ZGGA 1CWCA 2HM8A 3QWWA 4EZLA 3Q15A 3HYMB 3Q75A 3CKCA 4HBDA 2HQJA 2EIKE 3SQVA 3ZFWA 3ZKJA 4GZDA 5E76A 4ANXA 3CHRA 2DVWA 1A58A 1XGWA 2OVBA 2LSVA 4M3OA 3K0OA 5CMWA 2IY0C 2YNQA 5LOZA 4U0ZA 1XQ7A 3UXGA 2CHWA 3RDDA 2I1KA 2QC9A 3IXEA 3FTUA 4YUIA 4LCTA 5ENRD 3APFA 3CVPA 1HG5A 2AXUA 3L17A 4E1QA 2XPIA 2FO7A 4DX5D 4JB8P 4O1PA 3RO2A 3FUEA 2P9IG 2WXFA 3MKRA 3FU0A 1FVFA 4TV3A 4LQWA 1SW6A 4F3VA 1HE8A 1JCRA 3VTYA 3ICHA 3HXDA 1OWMA 3UPVA 4JEUA 3C98A 3UQ3A 2BEDA 3ML9A 1Y8MA 4DI4A 2WQ6A 2CFEA 3S7BA 3E37A 3UX4A 2IOLA 1HX8A 3QYUA 1VDNA 3JCKC 3V79K 5A23A 2OCCE 3D9IA 5AQAA 2CG3A 4CDMA 3IHYA 2LNIA 5EDSA 4I6EA 4WWNA 2KCKA 5G55A 1HF8A 3FEYA 2OJUA 1DCQA 1TNUA 4CGVA 3FDHA 3JQ1A 3TAXA 1H2VC 3PZDA 5CCRA 1M63C 2RFAA 4CT0A 3MKQA 3HDXA 3P2BA 4CDRA 1PC2A 2XRYA 3MGBA 2YHCA 4BETA 4HB5A 4M7CA 3L13A 3CLJA 4YUNA 3PZ1A 4ACLA 3EHNA 4I1AA 1PY1A 1QBQA 3W9FA 3TGOA 2VSNA 3IBEA 3D9LA 1AWTA 1N4RA 4N2QA 4ANVA 2WMOA 1CWMA 4FADA 3B7SA 3NB2A 1MZCA 1UJJA 5FQ8A 1CWBA 3SBSA 2RMBA 2ZGDA 3F6QA 5A7DB 1UJKA 2WXPA 4HRMB 2NC9A 3ABLE 2VGYA 1BD8A 1WM5A 2PQRA 3W9GA 5T8IA 4N1OA 2Y4TA 2IEJA 4U7EB 4JXTA 1N95A 2XQ0A 2FF4A 4JPSA 1NL4A 3SZ7A 3R56A 2R02A 3AG1E 1OUVA 2LXLA 4FHKA 5JJ7A 3RKVA 2XPZA 2EQXA 1E8XA 1HG2A 1ZBPA 3PMPA 4YNDA 4NIKA 2KCLA 2NNZA 4JHKA 2ZU6B 4XE0A 3CGHA 5JJTA 3ZYMA 3R4GA 2ZXWE 1H2UA 2WXHA 3QWPA 1MQSA 3URZA 1S0PA 4GPKA 3PH0C 2DIWA 1XNFA 3C5RA 3HVEB 4KMOA 2X25B 3CSFA 2XS8A 4FLBA 2EINE 2NYJA 1MJ0A 4TXQA 1ELRA 2WXRA 3EHRA 4CCAA 2MZUA 1HH8A 3Q47B 2X2CK 1CWLA 4ZHBA 4N1NA 3Q79A 2VSOE 3RO3A 4L1BA 5DBKA 4N1RA 4LSZE 2A2NA 5JHAA 1AK4A 1CYNA 4LG6A 4V3IA 2WXMA 3LY8A 1YA0A 5D2MC 4TXRA 3K0MA 3G2SA 3ZYLA 4B89A 5LCWJ 1C5FA 1A33A 2GGFA 1V55E 5B1AE 5KJNA 4I6JA 2KATA 4HFGA 4EBAG 1YNDA 3LY9A 1AWVA 4FJZA 3Q5MA 1JCSA 3I5PA 5G05J 2GW1A 5AQ9A 4PH4B 3CYHA 3DXMG 4NRHB 3SF4A 3EHMA 2E0IA 4KT6B 5ENNA 1MF8C 4JEHA 1IKND 4HY7A 3CHSA 1SA4A 2MHKA 1A5EA 1AWQA 3QWVA 1NZNA 2GRQB 3HXBA 3DSXA 1N94A 4OVVA 5A0EA 1GW6A 2P9PG 3PUJA 3ASGA 2V5FA 4A63B 3O48A 1HFAA 3BT8A 3TWSA 3QKYA 1M9DA 2P9KG 3FY4A 2EIME 3GZ1A 5CECB 4HORA 4JHJA 2V4LA 3ULQA 5DUDA 2FULA 5FQ7A 3RK6A 4DGCA 1H6OA 4IRUA 3R7RA 2WLWA 2DZNA 3SI5A 5CBVA 1K8KG 1H0AA 2B6CA 2UY1A 1UOHA 2HQ6A 2IGWA 5ENTD 2I6HA 3PS6A 5KUVA 2XCCA 3I4RB 5FWQA 1BPOA 5FINA 4N3BA 5ENSD 4J8YA 2V4HC 1TNYA 2QZAA 2X6KA 4GTSA 4DUIA 2ETBA 4N1PA 2OOEA 4Z68A 3PZ4A 3MMLB 2MS4A 3D9MA 3RSEG 3P1UA 3HG0D 3R7QA 3UT7A 3CQCB 4R7LA 4WNDA 1UN9A 3FUJA 3HRAA 5FIOA 4G24A 3VA7A 1JCQA 1O1TA 4N3AA 3KSLA 3NOCD 3AG3E 3V31A 2J8SD 4HRLA 4JA7A 4JZYA 5FJYA 4UQYA 2CHZA 1KT1A 3J5QB 2R59A 3S2AA 3E4BA 4O8HA 1OWOA 4U0UA 3PEVB 5KURA 4O1OA 4F7AA 3LXUX 4JC8A 5LFAA 4HQDA 3ENEA 4GCNA 4IYPA 2FI7A 4C48B 2WXIA 1OWLA 3DPDA 4L2YA 4WWPA 3BEEA 5J90A 5EYLA 3S7JA 1H2TC 4GZ6A 2L0IA 4LNGA 5CHEE 2X83B 4FC8A 1O1RA 4J8SA 3RCGA 2IFUA 3PREA 1Z6TA 2OEWA 2CPLA 2P0OA 2LXMA 2AJAA 4QFVA 1BI7B 3RCLA 3TXNA 3NAWA 5FQ4A 3R9AB 1TN8A 1VBSA 1ZKFA 3R57A 5ANLA 3ULYA 4XKBA 2R05A 3ASNE 4UUCA 4OAVB 1K3ZD 3RDBA 1NA3A 4N1SA 3LKUA 4F1PA 4DGDA 3CIAA 4CT4A 2UWJG 3X2QE 4K03A 4GPMA 3T5XA 3FUDA 1IQUA 3FTVA 3PZ2A 1SZ9A 3FTSA 1PAQA 1DVPA 5KULA 2H6IA 4J58A 2NSZA 2MRIA 2WMNA 4L2LA 4YDOA 4G8KA 3L16A 2X6HA 5D66A 1CWHA 1AP7A 1N4PA 4KBQA 3FU5A 3QJZA 3E32A 4N5QA 4G26A 4WNEA 4RSYA 4XIFA 3ODIA 5ENQD 1IXVA 1LTXA 4FRUA 3B7RL 3AS8A 2RD0A 4IULA 3FUNA 4HS2A 2XENA 2P58C 1S63A 3RCIX 4U63A 3ASDA 4GTOA 1IHBA 4KVOA 4KYOB 4YVOA 2A4ZA 4OAUC 4I9EA 1E8WA 4ILGA 1D8EA 2BKKB 4YUGA 2AWIA 3SD5A 1U3CA 1O1SA 5KV2A 3OPFA 2JEKA 3X27A 4CZ2D 3K2CA 3U3WA 3E34A 2VJ8A 4LEUA 1TNOA 3U66A 4BEPA 4G8LA 5BW8C 3MYVA 3IV0A 1QOIA 5JJ6A 2QYUA 3TWUA 5F66A 3CEQA 3Q49B 3PZ3A 5FZSA 4AP2A 2J4DA 2XPYA 2MVZA 5G05C 3ISMC 4NQ0A 4APFA 4Y6WA 3TXMA 1BCKA 5BUZA 5FZRA 3FULA 3RAUA 4YUHA 2CK1A 2KXPC 5KJMA 3RDAX 1Z3YA 5KCMA 2POEA 2J07A 5LCWC 4TOTA 4DGAA 1WDYA 1N11A 3NF1A 4K5AB 2VGXA 3MZLB 2R17C 4P29A 3NZSA 3AS4A 1E3BA 2I1JA 1JWFA 2WQHA 3EU9A 4BY6A 1FCHA 2ZIRA 3UM1A 5EKQD 4GZ3A 4B8AA 1ZX8A 1W74A 1OWNA 4KVMA 5AENA 3BQOA 3CR3A 4BX9A 4Q94A 4N5CA 1EPUA 2EILE 4YUPA 2ZP2A 2IJGX 1QNFA 3DSUA 4GMLA 5KJKA 3UI2A 4OVUA 3RIBA 3DWLG 1X7FA 4ANWA 3ONLA 2WFIA 3DXKG 3GZ2A 3WXXA 4CDNA 4RLYA 2L6BA 3LEWA 5C1DA 3RRMB 2WVIA 2XCBA 5BXUA 2XZTG 1SA5A 1N54A 2YINA 3CSTA 1Z81A 3RD9X 2P2CP 3DSTA 3C3OA 3LCAA 3T9KA 4EZKA 2GROB 3JXIA 3RRNB 3FU6A 2YQ8A 3HXFA 3L82A 1V9TA 3EUVA 1WAO1 1MX4A 5CBTA 1TEZA 2I2OA 3T8MA 2EIJE 4GU5A 3QDNA 2J49A 1Y6IA 4J5EX 2RKKA 5CBWA 4HVBA 4GMJA 5EX3A 3G2UA 2VQ2A 3Q73A 5D0OD 4U8YD 2GRNB 5G04C 3BG0B 1V54E 4J8FA 3ZRHA 4MS6A 3Q78A 4BTAA 1OCAA 4GTPA 1MX2A 1EDUA 3GW4A 4DX7D 3LDZA 3LYAA 4J7WA 3ZNGA 1B89A 4PS3A 4XNCA 2J08A 2XGOA 1NMKA 3JQ0A 3SGHA 4EBAA 2Y4UA 2F0YA 3QAQA 1UW4B 4U07A 3CV0A 5B3SE 1RMHA 4BFRA 5KUUA 2DBAA 2OV8A 2J9QA 4ABNA 1DC2A 3ODLA 1HO8A 3ASOE 2FEZA 1YMPA 3DPYA 3GZSA 4XEIG 2CYHA 1CWFA 2QERA 4BT9A 1M9YA 2CG2A 3WG7E 2GRMA 4YDYA 1IHGA 4WAFA 5HQ8A 4IN3B 4NACA 2CFUA 4AVXA 4W9RA 4RG6A 1D9SA 2KZTA 3CYSA 5FT9A 4MBGA 3TWQA 3ASHA 2KM4A 1MZWA 5ANRA 2I9CA 1KT0A 4GCOA 3VLDA 3C3RA 5G04J 2IOSA 3B7UX 3NOGD 1OY3D 2PZIA 4RVBA 4A55A 2KZTB 2J09A 2DZOA 4HLLA 4FU3A 1BU9A 1HS6A 1AWCB 1U2VG 4Q69A 4J5AX 3LPZA 5BNWA 1E8KA 3S6MA 3CVNA 3HVEA 3G2WA 3LVRE 2ETCA 3OAWA 5AQBA 3S7DA 4J8EA 3MCXA 2VGXB 2N0TA 2XGYB 2GW2A 2VGEA 2OEVA 3TWVA 1N0RA 2M63A 4A3VA 4XI9A 3SNXA 3SFXA 3SY2A 3KOPA 4JHRA 2Y69E 3SFZA 3APDA 3DSWA 3PNLB 5HS0A 3R59A 3HIZA 3L6AA 2RMAA 4F1SA 4E85A 1TR4A 1MYOA 2IF4A 1ELWA 4JJMA 2NXPA 1Q2ZA 5AIJA 1E8ZA 3IHVA 3KS2A 4EECA 4FP7A 3D9HA 1QNGA 4ZSCA 4GZ5A 2HO1A 3RRUA 2JABA 2A5UA 4ATZD 2P9UG 2PM6A 4I6GA 4X8QA 1MHQA 3AU4A 3CHPA 2IU1A 3ASFA 1X81A 3VLFA 4WNFA 3UT8A 3AS5A 3CQGB 3K0RA 2E2EA 4YDWA 3JYSA 3LS8A 4UI9K 3TG5A 1W8MA 2H6FA 3QK0A 3ZXSA 3C72A 1M9XA 1XYHA 5KUZA 2PM7A 3NZUA 2WXQA 2V5QC 3KSQA 4LRZA 5H7PA 3FH5A 1AWUA 4R3EA 4XZ4A 2BIUX 3K0PA 3CKBA 1CWAA 3U64A 5DIZA 1J2AA 1XWNA 2X7KA 3ABME 1LD7A 5AN8A 3FH7A 5KV3A 5EIBE 2PHCB 2WB2A 3FUHA 4PDXA 2DCPA 5AJDA 5KUQA 2WFJA 4KZCA 4TUUA 4AJWA 2AW6A 4N39A 1U3DA 4G23A 3TJPA 1BLXB 3UCHA 1BI8B 4HOTA 2MOWA 1W8VA 2KA0A 5CCQA 3FU3A 2IGVA 5E75A 4K5BA 1TJCA 2Y0BG 4TXPA 3HXEA 4HI9A 2HYZA 2C3BA 1LF8A 2A5EA 2RMCA 5CCLA 4XKCA 4AEZC 2MC9A 2KC7A 1OCCE 4GA1A 4H7XA 4UWFA 3SFYA 3DEOA 4CEMA 4ATGA 4J5CX 3FTWA 5FZQA 5HI7A 3TWTA 4B93B 3ZIMA 3NBNB 4ILHB 4G1TA 2FBNA 3ULEG 4DRXE 2AXZA 4JVSA 4C9BB 2HE9A 4BX8A 3EOVA 1KZPA 2WM9A 2X2DB 4JL0A 1YYHA 3L54A 2R99A 4GAAA 3MV2B 3SHFA 3ZN3A 3ZHEB 4HOUA 3QC1A 4D10C 2YHEA 4PS8A 1CWKA 5JMND 1N4SA 4U0SA 1QNHA 1RZ4A 4BT8A 3DSSA 5T4YA 4S1JA 5CERB 4O8IA 3T8KA 2C0LA 2XGMA 4EQFA 2OSEA 3RCFA 2K7NA 3ESKA 2ILRA 3ZU7B 3FWVA 1H6PA 3EJNA 4GTMA 3APCA 2QYJA 1TNBA 3FEXA 2BITX 5CCSX 1LOPA 1NFIE 4ILIA 4A1GA 1XO7A 3TL5A 5AAOA 3J5PA 3ZW3A 1ELKA 1G3NB 1TYQG 4U04A 3D9JA 3EIQC 3D3MA 5KNHD 1M9CA 3V30A 2F37A 3E33A 3MJWA 2GRLA 2C0MA 3AJIA 1IIPA 3EU5A 1OXJA 1M9EA 1E7VA 4HNAD 3G2TA 4U8HA 2XZDG 3MMLA 3CVWA 4U96D 3ICIA 3QB2A 3LVQE 3Q7AA 2DYSE 3RDCA 3Q4AB 5FTPA 4AXHA 2LAHA 3KEZA 4JD2G 1TJFA 1S64A 5T3RA 4JA9A 5ARGA 3CK7A 4CYHA 5B1BE 3D9PA 2IONA 1QQEA 3PVLA 4G2VA 2R03A 2RFMA 1H19A 4EPZA 3B13A 5EYPF 1DCEA 4B94A 5CRUA 2AVPA 3UUXA 2IQCA 3D9KA 3L08A 3D9OA 4YDEA 1EF1C 2ZISA
chains in the Genus database with same CATH topology
1ZKCA 4I9YA 2J49A 3OXGA 4HY7A 3CHSA 1Y6IA 4J5EX 5C2YA 5AJLA 4AY6A 4YULA 1AWRA 2MHKA 2WXLA 1AWQA 3QWVA 3CHOA 4FHJA 5CBWA 4GYOA 2PL2A 4GMJA 4HVBA 1NZNA 3OXFA 1E90A 5EX3A 1AWSA 4YUMA 3G2UA 2VQ2A 4OVVA 2RS4A 3K0QA 5A6CA 5A0EA 5D0OD 3PEUB 1P5QA 4DLOA 4DGEA 5G04C 1W8LA 3FP3A 1GW6A 3T1UA 3BG0B 3PUJA 4J8FA 3ASGA 3ZRHA 4G11A 4HOSA 2HAQA 3AU5A 2V5FA 4MS6A 3O48A 1HFAA 4BTAA 4BTBA 3BT8A 3ESLA 3QKYA 4CGWA 1M9DA 1OCAA 4ME2A 3FY4A 3GZ1A 4AOFA 1EDUA 3GW4A 4HORA 1JPLA 3IEGA 3LDZA 3LYAA 1INZA 2NULA 2FU0A 2XGSA 4DLQA 4I1OB 4JHJA 4UWHA 2V4LA 3FFLA 3ULQA 2HR2A 5DUDA 2FULA 5FQ7A 3RK6A 1B89A 4PS3A 4IPZA 4XNCA 4DGCA 4N2SA 2J08A 2XGOA 3PRZA 4A1SA 3S7FA 3FHEA 4IRUA 3VLEA 5J08A 2Z6WA 3RCKX 3SBTB 3R7RA 1NMKA 2WLWA 3SI5A 5CBVA 3JQ0A 3SGHA 3U9WA 4EBAA 2Y3AA 1H0AA 1ZU2A 2Y4UA 1OWPA 4FRVA 2UY1A 3PUKA 3TG4A 3QAQA 1UW4B 5BPPA 4U07A 2ALFA 3CV0A 2HQ6A 3R49A 2XEVA 4GA2A 1RMHA 2IGWA 1QZ2A 2L0TB 2I6HA 2OVFA 4BFRA 5KUUA 1NP7A 3CK8A 4KZ0A 2DBAA 3LJ3A 1EYHA 3PS6A 4PUCA 5KUVA 2XCCA 2OV8A 2VTBA 3R54A 2J9QA 4ABNA 3I4RB 1DNPA 1BPOA 5FWQA 3RFYA 3CVLA 4F53A 1NA0A 3ODLA 4N1MA 5CBUA 5JHEA 2WXNA 1HO8A 2FEZA 4N3BA 5M72A 3CVUA 3GZSA 2CYHA 3OREA 4EYVA 1CWFA 2QERA 5KUWA 2X6KA 4BT9A 1M9YA 2CG2A 2VYIA 4N1PA 3O7TA 2GRMA 2OOEA 3ZHEA 1IHGA 3ZPJA 4WAFA 4DPRA 5HQ8A 3MMLB 4HOQA 2MS4A 2CFZA 4IN3B 3BKPA 3D9MA 3QARA 3P1UA 4FJYA 3I3NA 4R3FA 4NACA 3MEKA 4E6HA 2CFUA 2XHEA 4HXIA 4AVXA 4W9RA 3R7QA 2LSUA 4RG6A 3UT7A 3CQCB 3FUFA 1H6KA 3ZVVA 2WXKA 3GYZA 4R7LA 1UG3A 2KZTA 1UN9A 2PQNA 2X6FA 3EIJA 1A17A 3FUJA 4WNDA 5ARFA 5FT9A 3CYSA 4YUKA 4WUYA 1Z3XA 2BTDA 4B8CB 3FTXA 3ASHA 1E8YA 2KM4A 3OXLA 1MZWA 3KAEA 4G24A 3FUKA 4UWLA 4UWGA 5ANRA 1CWJA 2BF0X 2I9CA 3MX3A 1KT0A 1UN8A 5KV7A 3VA7A 3ZEFA 4GCOA 4S1JA 1CWCA 3VLDA 5G04J 2IOSA 2HM8A 2WXOA 3B7UX 4N3AA 1VAIA 3QWWA 2PZIA 4RVBA 3U4TA 4EZLA 4A55A 2KZTB 3Q15A 2J09A 3HYMB 4JA7A 4JZYA 5KV6A 5FJYA 4UQYA 4FU3A 3CKCA 4O6FA 2CHZA 1HS6A 5LUDA 1KT1A 2HQJA 1VDYA 4BSXA 3ZFWA 3VTXA 4Q69A 3LPZA 5G2NA 4J5AX 2R59A 3ZYQA 3S2AA 5BNWA 4JW1A 3E4BA 1FVHA 3KD7A 4GZDA 1E8KA 1OWOA 5E76A 2ESLA 3T5VA 4U0UA 4ANXA 4O8HA 3S6MA 5FQ6A 3CVNA 3HVEA 3CHRA 4C0EA 3G2WA 3LVRE 3PEVB 1A58A 1XGWA 1N52A 3IKOB 3OAWA 5KURA 3S7DA 1L5JA 4J8EA 2OVBA 4F7AA 5KUOA 3LXUX 3N71A 4JC8A 2LSVA 4I2WA 5LFAA 3BG1B 3MCXA 4M3OA 2VGXB 4WNGA 4HLEA 3ENEA 3HHMA 2N0TA 4GCNA 4IYPA 2XGYB 2GW2A 3K0OA 2FI7A 4GYWA 5CMWA 2WXIA 2YNQA 1OWLA 2VTBB 5LOZA 4U0ZA 1XQ7A 2M63A 4A3VA 4XI9A 2ONDA 3SNXA 3DPDA 4DI3A 2CHWA 3RDDA 4L2YA 4WWPA 5KV5A 4URKA 3BEEA 2I1KA 5J90A 4JHRA 4C0MA 3S7JA 3SFZA 1H2TC 3APDA 3PNLB 4GZ6A 2UY1B 3R59A 2L0IA 3HIZA 3L6AA 5CHEE 4F1SA 2QY7A 4E85A 2RMAA 2X83B 3FTUA 1KLXA 2VSYA 3PNTB 4FC8A 4LUNU 4YUIA 4LCTA 2IF4A 4J8SA 3MV3B 1ELWA 3RCGA 5CCNA 3QOUA 3APFA 2IFUA 4JJMA 3CVPA 3PREA 1HG5A 2AXUA 3L17A 4YVQC 4E1QA 1M9FA 2XPIA 2XRZA 2FO7A 1Z6TA 4DGDA 2NXPA 5AIJA 1E8ZA 4LERA 3RO2A 2CPLA 2L9BA 3FUEA 2P0OA 1IQRA 4QFVA 3IHVA 2V8SE 3KS2A 3TXNA 4EECA 4FP7A 4GZCA 1QNGA 3RCLA 5FQ4A 3R9AB 4GZ5A 2WXFA 2HO1A 3RU0A 2WQ7A 1VBSA 1ZKFA 3R57A 4ZSDA 3MKRA 5ANLA 4XKBA 3FU0A 3RRUA 1FVFA 1HXIA 4TV3A 2A5UA 4EZJA 4LQWA 4FLHA 3CVVA 4YUOA 2JLBA 2CMTA 3RDBA 1NA3A 4N1SA 3LKUA 2PM6A 1HE8A 4I6GA 3VTYA 4F3VA 3ICHA 3UMVA 1OWMA 1MHQA 3AU4A 3PDNA 3ZYKA 3CIAA 4CT4A 2UWJG 3CHPA 2IU1A 2B71A 3ASFA 3VLFA 4N1QA 4K03A 4WNFA 3FUMA 3UT8A 3AS5A 3CQGB 3T5XA 3FUDA 1IQUA 3UPVA 4JEUA 3C98A 4ACKA 2E2EA 3K0RA 1H0PA 3EDTB 3JYSA 3UQ3A 3LS8A 3ML9A 4Q96A 1Y8MA 4UI9K 4DI4A 5BV1A 3FTVA 2WQ6A 1SZ9A 3FTSA 3S7BA 3TG5A 3QK0A 1W8MA 2CFEA 1PAQA 3UX4A 3ZXSA 1DVPA 2IOLA 1HX8A 4DK5A 5KULA 3QYUA 1VDNA 4XX5A 1M9XA 1XYHA 2J4BA 5KUZA 4YUJA 2PM7A 3JCKC 4J58A 2WXJA 2NSZA 2MRIA 2WMNA 4L2LA 5A23A 3NZUA 3L16A 2X6HA 3D9IA 2WXQA 3OTNA 3PE3A 1IYGA 1CWHA 4J0UA 1SZAA 2CG3A 2RG8A 3IHYA 4CDMA 2LNIA 4LRZA 5EDSA 3FH5A 4AV7A 4I6EA 5BV0A 4L23A 1AWUA 4R3EA 1VBTA 4WWNA 4XZ4A 2BIUX 3K0PA 3CKBA 4KBQA 1CWAA 4J5BA 3FU5A 2KCKA 3QJZA 5G55A 3U64A 1HF8A 3FEYA 5DIZA 1J2AA 2OJUA 3NQPA 1XWNA 4CGVA 3FDHA 3JUIA 2LO6A 4G26A 2X7KA 3RCFA 3JQ1A 4DGBA 4WNEA 3TAXA 2CHXA 3D9NA 4RSYA 4B0ZA 3FH7A 4XIFA 1H2VC 3PZDA 4I9CA 3MKQB 1M63C 4CT0A 3ODIA 5CCRA 5KV3A 3MKQA 3BO7A 4TRQA 4FRUA 3HDXA 5EX0A 2PHCB 3B7RL 3P2BA 4CDRA 1PC2A 2WB2A 3FUHA 4GYYA 2XRYA 3MGBA 3AS8A 2RD0A 2YHCA 4IULA 4PDXA 2WPVA 2DCPA 5CMYA 4MRUA 3FUNA 5AJDA 5KUQA 4HS2A 4L7TA 2WFJA 4I1MA 4KZCA 4TUUA 2P58C 3L13A 4AJWA 3CLJA 3O4ZA 4YUNA 5D0QD 2AW6A 4N39A 4ACLA 1U3DA 3EHNA 4G23A 1PY1A 4I1AA 3TJPA 1DYWA 3RCIX 4U63A 3UCHA 3TGOA 4HOTA 1E7UA 3ASDA 2MOWA 1W8VA 4I17A 4KVOA 5CCQA 2VSNA 3FU3A 2IGVA 3IBEA 3D9LA 5E75A 3L22A 1AWTA 4N2QA 4ANVA 1TJCA 2WMOA 2A4ZA 4KYOB 1HZ4A 3B7SA 4YVOA 4FADA 1CWMA 4I9EA 1UJJA 1E8WA 2HYZA 2L6JA 5FQ8A 3SBSA 1CWBA 4ILGA 1LF8A 2C3BA 2RMBA 5CYHA 4YUGA 2AWIA 4K0RA 3SD5A 1U3CA 2RMCA 5CCLA 2V0PA 4XKCA 1ZMFA 5KV2A 2WXGA 4NURA 5A7DB 1UJKA 4AEZC 3OPFA 2MC9A 2WXPA 2JEKA 2KC7A 3DBSA 2NC9A 4GA1A 4AY5A 3K2CA 3U3WA 2VGYA 4H7XA 4PS7A 4UWFA 2X6JA 1WM5A 4G25A 4I43A 2VJ8A 2PQRA 4ATGA 5T8IA 4CEMA 3FTWA 4J5CX 5FZQA 5HI7A 2C2LA 4N1OA 3ZIMA 2Y4TA 4LEUA 3U66A 3CVYA 2KCVA 4ILHB 4XI0A 5BW8C 3MYVA 4G1TA 5KV0A 2FBNA 3ML8A 4I2ZA 2VSXE 2AXZA 3IV0A 1QOIA 4JXTA 2XQ0A 5JJ6A 4JVSA 4C9BB 1CWIA 2FF4A 4JPSA 2HE9A 4BX8A 3EOVA 3SZ7A 3R56A 2WM9A 5F66A 1OUVA 1WY6A 3CEQA 5KUSA 5KUNA 2X2DB 4FHKA 3Q49B 4JL0A 5JJ7A 5FZSA 4JCPA 4AP2A 3RKVA 2J4DA 3L54A 1SQMA 2XPYA 4FULA 2XPZA 2EQXA 2R99A 4GAAA 3MV2B 5G05C 2QFCA 3ONKA 3SHFA 4GA0A 3ZN3A 4CRWA 2MVZA 1E8XA 1HG2A 3FH8A 3ZHEB 4N3CA 4NQ0A 4APFA 4DJAA 4Y6WA 3TXMA 1BCKA 1CWOA 1ZBPA 3PMPA 4HOUA 3QC1A 4H7YA 4YNDA 5BUZA 5FZRA 3FULA 4A3TA 1E96B 2KCLA 4UI9J 4GB9A 4D10C 4YUHA 4MLPA 2CK1A 2YHEA 5KJMA 4JHKA 4UQZA 2OK3A 4PS8A 3RDAX 2ZU6B 1HU3A 1CWKA 1Z3YA 3CHMA 5KCMA 2POEA 2J07A 5LCWC 4U0SA 1MIKA 1QNHA 4XE0A 4BT8A 3CGHA 4TOTA 5JJTA 1JUQA 3ZYMA 4DGAA 3OEPA 2LAIA 3NF1A 3MA5A 3R4GA 1CLHA 1H2UA 2WXHA 3PE4A 1MQSA 3QWPA 5T4YA 3URZA 1S0PA 2VGXA 2R17C 3MZLB 3PH0C 4GPKA 4O8IA 2C0LA 5JHBA 2XGMA 4EQFA 2OSEA 4P29A 1FGLA 4J5DX 2DIWA 3NZSA 1XNFA 2X38A 3AS4A 1E3BA 3K0NA 2I1JA 2K7NA 3HVEB 4KMOA 1JWFA 3CK9A 3ESKA 2ILRA 2WQHA 3FWVA 4BY6A 2X25B 3EJNA 3CSFA 3APCA 4FLBA 1FCHA 4BWRA 4Y6CA 3FEXA 2BITX 5EKQD 1ELRA 5KJLA 5CCSX 2WXRA 4GZ3A 4ILIA 4B8AA 4A1GA 4CCAA 3TL5A 1LOPA 1XO7A 2MZUA 1HH8A 3Q47B 2X2CK 4UQXA 1W74A 1OWNA 2AXVA 1CWLA 4KVMA 4N1NA 4S1EA 3ZW3A 2Q7FA 1ELKA 2VSOE 5AENA 3RO3A 5KV4A 4FA6A 2BUGA 3CR3A 5BT1A 4ZSCA 4L1BA 4U04A 5DBKA 3D9JA 3EIQC 4UWKA 4BX9A 4N1RA 3RJVA 4Q94A 3D3MA 1M9CA 4N5CA 1EPUA 3FTYA 5LP0A 4YUPA 2A2NA 2ZP2A 5JHAA 1AK4A 2IJGX 3JB9d 1QNFA 4GMLA 5KJKA 1CYNA 2PLUA 3UT4A 4OVUA 3MJWA 4J8DA 3RIBA 4V3IA 4OYSA 2GRLA 2WXMA 2C0MA 3LY8A 1W3BA 1IIPA 1YA0A 3I4GA 1X7FA 4ANWA 4WWOA 1E7VA 1M9EA 3K0MA 3G2TA 3ONLA 2X6IA 4U8HA 3CVXA 2WFIA 3GZ2A 4AIFA 3G2SA 3MMLA 1JWGA 3WXXA 3ZYLA 2X3MA 4B89A 4CDNA 3CVWA 3FTZA 3ICIA 5LCWJ 3QB2A 3LVQE 3LEWA 1C5FA 1A33A 3Q4AB 5C1DA 5CCMA 3RDCA 2GGFA 5FTPA 2WVIA 3RRMB 2XCBA 3B7TA 4AXHA 2LAHA 3KEZA 4KXKB 5KJNA 4UI9C 3ZGQA 1TJFA 3LY7A 4I6JA 1N54A 5T3RA 2KATA 2YINA 3FUIA 4JA9A 5ARGA 4HFGA 3CK7A 4CYHA 2R5SA 4EBAG 3D9PA 3K9IA 1YNDA 2IONA 3LY9A 3CSTA 1QQEA 1AWVA 1Z81A 3RD9X 4FJZA 4RG9A 3LCAA 3PVLA 3Q5MA 4G2VA 4J6IA 1ISTA 2POYA 3I5PA 1H19A 4EZKA 3RRNB 3FU6A 4EPZA 2YQ8A 5KV1A 5G05J 1V9TA 5LX8A 3B13A 2GW1A 3QNKA 3CVQA 4PH4B 4APOA 3CYHA 1WAO1 1X5BA 4B94A 3G2VA 4NRHB 2AVPA 3UUXA 2IQCA 5CBTA 1TEZA 5AYWD 4AM9A 3D9KA 3EHMA 2E0IA 3SF4A 2I2OA 4J59A 3CHQA 3L08A 4KT6B 3T8MA 4GU5A 4MKTA 5ENNA 2X2AA 1MF8C 4ANUA 3D9OA 4JEHA 1EF1C 3QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKC A;  4I9Y A;  3OXG A;  4HY7 A;  4J5E X;  4AY6 A;  4YUL A;  1AWR A;  2MHK A;  1AWQ A;  3QWV A;  5CBW A;  4GYO A;  2PL2 A;  1NZN A;  3OXF A;  5EX3 A;  1AWS A;  4YUM A;  2VQ2 A;  2RS4 A;  3K0Q A;  5A6C A;  5A0E A;  5D0O D;  1P5Q A;  4DGE A;  5G04 C;  1W8L A;  3FP3 A;  3T1U A;  4J8F A;  3ASG A;  4HOS A;  2HAQ A;  2V5F A;  4BTB A;  3O48 A;  4BTA A;  3BT8 A;  3QKY A;  4CGW A;  1M9D A;  1OCA A;  4ME2 A;  3GZ1 A;  3GW4 A;  4HOR A;  3IEG A;  2NUL A;  3LYA A;  2FU0 A;  2XGS A;  3FFL A;  3ULQ A;  2HR2 A;  5DUD A;  4DGC A;  1B89 A;  4IPZ A;  4XNC A;  4N2S A;  2XGO A;  4A1S A;  3S7F A;  2Z6W A;  3RCK X;  1NMK A;  2WLW A;  5CBV A;  1ZU2 A;  2Y4U A;  4FRV A;  2UY1 A;  3TG4 A;  4U07 A;  2ALF A;  3CV0 A;  2HQ6 A;  3R49 A;  2XEV A;  4GA2 A;  1RMH A;  2IGW A;  1QZ2 A;  2I6H A;  5KUU A;  3CK8 A;  2DBA A;  5KUV A;  2XCC A;  3R54 A;  3RFY A;  2J9Q A;  4ABN A;  3CVL A;  3ODL A;  1NA0 A;  5CBU A;  4N1M A;  5JHE A;  2FEZ A;  4N3B A;  5M72 A;  2CYH A;  3ORE A;  4EYV A;  1CWF A;  2QER A;  5KUW A;  4BT9 A;  1M9Y A;  2VYI A;  4N1P A;  3O7T A;  2OOE A;  3ZHE A;  3ZPJ A;  1IHG A;  3MML B;  5HQ8 A;  4HOQ A;  2MS4 A;  4IN3 B;  3BKP A;  4R3F A;  3MEK A;  4W9R A;  2LSU A;  4RG6 A;  3GYZ A;  5ARF A;  4WND A;  2PQN A;  4YUK A;  1A17 A;  3CYS A;  5FT9 A;  4WUY A;  3ASH A;  3OXL A;  1MZW A;  5LUD A;  3KAE A;  4G24 A;  1CWJ A;  5KV7 A;  1KT0 A;  3VA7 A;  4GCO A;  1CWC A;  5G04 J;  4N3A A;  1VAI A;  3QWW A;  2PZI A;  3U4T A;  3Q15 A;  3HYM B;  4JA7 A;  5KV6 A;  5FJY A;  4UQY A;  3CKC A;  4O6F A;  1KT1 A;  2HQJ A;  3ZFW A;  3VTX A;  4J5A X;  3LPZ A;  5BNW A;  3E4B A;  3KD7 A;  2ESL A;  1E8K A;  4O8H A;  3S6M A;  4U0U A;  3CVN A;  1A58 A;  5KUR A;  3S7D A;  4J8E A;  5KUO A;  3N71 A;  4I2W A;  2LSV A;  4WNG A;  2VGX B;  2N0T A;  4GCN A;  2XGY B;  2GW2 A;  3K0O A;  2FI7 A;  4GYW A;  4U0Z A;  1XQ7 A;  4XI9 A;  2OND A;  3RDD A;  5KV5 A;  3BEE A;  4JHR A;  3S7J A;  4GZ6 A;  2UY1 B;  3R59 A;  5CHE E;  2RMA A;  2X83 B;  1KLX A;  2VSY A;  4YUI A;  2IF4 A;  3RCG A;  3MV3 B;  1ELW A;  5CCN A;  3QOU A;  2IFU A;  4JJM A;  3CVP A;  4YVQ C;  4E1Q A;  1M9F A;  2XPI A;  2FO7 A;  2CPL A;  3RO2 A;  2P0O A;  3KS2 A;  3RCL A;  1QNG A;  4ZSC A;  3R9A B;  4GZ5 A;  3RU0 A;  2HO1 A;  1VBS A;  1ZKF A;  3R57 A;  4ZSD A;  3MKR A;  1HXI A;  4LQW A;  4YUO A;  2JLB A;  2CMT A;  3RDB A;  1NA3 A;  4N1S A;  3LKU A;  4F3V A;  3ICH A;  3VTY A;  3PDN A;  4DGD A;  2UWJ G;  4N1Q A;  2B71 A;  3ASF A;  4WNF A;  3AS5 A;  3K0R A;  3UPV A;  2E2E A;  1H0P A;  3EDT B;  3JYS A;  3UQ3 A;  4UI9 K;  1Y8M A;  2CFE A;  3TG5 A;  3S7B A;  1W8M A;  5KUL A;  3QYU A;  1VDN A;  1M9X A;  1XYH A;  5KUZ A;  4YUJ A;  4J58 A;  3PE3 A;  1IYG A;  1CWH A;  4J0U A;  2LNI A;  1AWU A;  4R3E A;  1VBT A;  2BIU X;  3K0P A;  3CKB A;  4KBQ A;  1CWA A;  4J5B A;  2KCK A;  5DIZ A;  1J2A A;  2OJU A;  1XWN A;  4CGV A;  2X7K A;  4G26 A;  4DGB A;  4WNE A;  3TAX A;  4XIF A;  5CCR A;  4I9C A;  1M63 C;  3ODI A;  5KV3 A;  3BO7 A;  4FRU A;  5EX0 A;  2PHC B;  4CDR A;  1PC2 A;  4GYY A;  3AS8 A;  2YHC A;  2WPV A;  5KUQ A;  2WFJ A;  2P58 C;  4YUN A;  5D0Q D;  4N39 A;  1DYW A;  4G23 A;  4I1A A;  3RCI X;  3UCH A;  3TGO A;  4HOT A;  3ASD A;  1W8V A;  4I17 A;  5CCQ A;  2VSN A;  2IGV A;  1AWT A;  4N2Q A;  1TJC A;  4KYO B;  4YVO A;  1CWM A;  1HZ4 A;  4I9E A;  2L6J A;  2HYZ A;  1CWB A;  2C3B A;  2RMB A;  5CYH A;  4YUG A;  2RMC A;  5CCL A;  1ZMF A;  5KV2 A;  5A7D B;  2MC9 A;  3OPF A;  2KC7 A;  4GA1 A;  2NC9 A;  4AY5 A;  3K2C A;  3U3W A;  2VGY A;  4H7X A;  1WM5 A;  4G25 A;  2PQR A;  4J5C X;  5FZQ A;  5HI7 A;  2C2L A;  4N1O A;  2Y4T A;  4LEU A;  2KCV A;  4XI0 A;  5BW8 C;  5KV0 A;  4G1T A;  2FBN A;  4I2Z A;  1QOI A;  5JJ6 A;  1CWI A;  2FF4 A;  2HE9 A;  3EOV A;  3SZ7 A;  3R56 A;  5F66 A;  1OUV A;  3CEQ A;  5KUS A;  5KUN A;  2X2D B;  3Q49 B;  4JL0 A;  5JJ7 A;  5FZS A;  4JCP A;  3RKV A;  2R99 A;  2MVZ A;  3MV2 B;  5G05 C;  2QFC A;  4GA0 A;  3ZN3 A;  3ZHE B;  4N3C A;  4NQ0 A;  4Y6W A;  1BCK A;  1CWO A;  1ZBP A;  3PMP A;  4HOU A;  4YND A;  4H7Y A;  5FZR A;  1E96 B;  2KCL A;  4UI9 J;  4YUH A;  2CK1 A;  5KJM A;  4UQZ A;  2OK3 A;  3RDA X;  1CWK A;  2POE A;  5LCW C;  4U0S A;  1MIK A;  1QNH A;  4BT8 A;  4TOT A;  5JJT A;  4DGA A;  3OEP A;  3NF1 A;  1CLH A;  3MA5 A;  3R4G A;  3QWP A;  4S1J A;  3PE4 A;  3URZ A;  4O8I A;  2VGX A;  4GPK A;  2C0L A;  2XGM A;  4EQF A;  2OSE A;  1FGL A;  4J5D X;  3RCF A;  1XNF A;  3AS4 A;  1E3B A;  3K0N A;  2K7N A;  3CK9 A;  3ESK A;  2WQH A;  3FWV A;  2X25 B;  1FCH A;  4BWR A;  4Y6C A;  2BIT X;  5EKQ D;  1ELR A;  5KJL A;  5CCS X;  4GZ3 A;  1LOP A;  1XO7 A;  2MZU A;  1HH8 A;  3Q47 B;  2X2C K;  4UQX A;  1W74 A;  1CWL A;  4N1N A;  4S1E A;  2Q7F A;  3RO3 A;  5KV4 A;  2BUG A;  5BT1 A;  4U04 A;  5DBK A;  4N1R A;  3RJV A;  1M9C A;  4N5C A;  4YUP A;  2A2N A;  2ZP2 A;  1AK4 A;  3JB9 d;  5KJK A;  1CYN A;  2PLU A;  4J8D A;  3RIB A;  2C0M A;  3LY8 A;  1W3B A;  1IIP A;  1YA0 A;  1X7F A;  1M9E A;  3K0M A;  2WFI A;  3GZ2 A;  4AIF A;  3MML A;  3WXX A;  3ICI A;  5LCW J;  1C5F A;  1A33 A;  3Q4A B;  5C1D A;  5CCM A;  3RDC A;  5FTP A;  2XCB A;  4KXK B;  5KJN A;  4UI9 C;  3ZGQ A;  3LY7 A;  2KAT A;  4JA9 A;  5ARG A;  3CK7 A;  4CYH A;  2R5S A;  3K9I A;  1YND A;  3LY9 A;  1QQE A;  1AWV A;  1Z81 A;  3RD9 X;  4RG9 A;  3LCA A;  3Q5M A;  4G2V A;  1IST A;  2POY A;  5KV1 A;  2YQ8 A;  5G05 J;  1V9T A;  2GW1 A;  3CVQ A;  4APO A;  3CYH A;  1WAO 1;  4B94 A;  4NRH B;  2AVP A;  3UUX A;  5CBT A;  5AYW D;  4AM9 A;  3SF4 A;  4J59 A;  2X2A A;  1MF8 C;  3QDN A; 
#chains in the Genus database with same CATH topology
 1ZKC A;  3Q9N C;  5AJL A;  4AY6 A;  4YUL A;  1AWR A;  2WXL A;  4FHJ A;  2PL2 A;  1NI1 A;  3OXF A;  1E90 A;  1AWS A;  2RS4 A;  5A6C A;  3PEU B;  1P5Q A;  4DGE A;  1W8L A;  3FP3 A;  4G11 A;  3AU5 A;  4CYM D;  4AOF A;  1INZ A;  2NUL A;  1ZB1 A;  2FU0 A;  2XGS A;  5HRY A;  4DLQ A;  4I1O B;  3Q7F A;  2XS1 A;  1KPS B;  2HR2 A;  3DSV A;  3BU8 A;  1KZO A;  4N2S A;  3PRZ A;  3FHE A;  2Z6W A;  3U9W A;  2Y3A A;  1ZU2 A;  3L9T A;  4HI8 A;  1OWP A;  3PUK A;  2ALF A;  3R49 A;  2XEV A;  1QZ2 A;  2L0T B;  2OVF A;  1NP7 A;  3CK8 A;  3LJ3 A;  4O60 A;  3R54 A;  3RFY A;  4HRN A;  3CVL A;  3SO8 A;  3CVU A;  4EYV A;  5KUW A;  2VYI A;  3O7T A;  3ZHE A;  3ZPJ A;  3BKP A;  4FJY A;  2F8Y A;  3I3N A;  4GMR A;  3MEK A;  4E6H A;  3UM2 A;  2LSU A;  1S70 B;  3ZVV A;  3EHQ A;  4QQI A;  3EIJ A;  1D8D A;  2PQN A;  4GTV A;  1A17 A;  4WUY A;  1Z3X A;  2BTD A;  4B8C B;  1E8Y A;  3KAE A;  4UWL A;  3FUK A;  3UKU G;  1MX6 A;  2BF0 X;  3ZEF A;  2ETA A;  4LNB A;  2WXO A;  1VAI A;  3U4T A;  5KV6 A;  5JA4 D;  1FT1 A;  4O6F A;  3UM3 A;  3B7B A;  1VDY A;  4BSX A;  3VTX A;  5G2N A;  4L9P A;  3ZYQ A;  4JW1 A;  2ESL A;  1FVH A;  3KD7 A;  5EIL A;  3T5V A;  5FQ6 A;  4C0E A;  2P9S G;  1FT2 A;  1N52 A;  3IKO B;  1L5J A;  5KUO A;  3N71 A;  4I2W A;  3BG1 B;  4WNG A;  4HLE A;  3HHM A;  4GYW A;  3Q9U C;  2VTB B;  2HE0 A;  2OND A;  4DI3 A;  5KV5 A;  4URK A;  4C0M A;  4BES A;  2UY1 B;  3UIP C;  3JXJ A;  3ZXP A;  2QY7 A;  1KLX A;  2VSY A;  3PNT B;  4LUN U;  3MV3 B;  5CCN A;  3QOU A;  1LD8 A;  1N9A A;  4YVQ C;  1M9F A;  2XRZ A;  4LER A;  2L9B A;  5ENO D;  1IQR A;  2V8S E;  4GZC A;  3RU0 A;  2WQ7 A;  3R9M A;  2F8X K;  3UIO C;  1HXI A;  4EZJ A;  4FLH A;  3CVV A;  4YUO A;  2JLB A;  2CMT A;  3UMV A;  3PDN A;  3ZYK A;  4N1Q A;  2B71 A;  5KBA A;  3FUM A;  3UM0 A;  4ACK A;  1H0P A;  3EDT B;  2PNN A;  3UIN C;  4Q96 A;  5BV1 A;  1TN7 A;  1N4Q A;  2XEH A;  5EN5 D;  4DK5 A;  4XX5 A;  2J4B A;  4K5C A;  4YUJ A;  2WXJ A;  5KWD A;  3UKR G;  3OTN A;  3PE3 A;  1IYG A;  4J0U A;  1SZA A;  1SVX A;  1TN6 A;  2RG8 A;  2P9L G;  4ZFH A;  4AV7 A;  5BV0 A;  4L23 A;  1VBT A;  4J5B A;  3NQP A;  3JUI A;  2LO6 A;  5ENP D;  4DGB A;  2CHX A;  3D9N A;  4B0Z A;  4I9C A;  3MKQ B;  5AAR A;  3BO7 A;  3B95 A;  4TRQ A;  2H6H A;  5EX0 A;  4GYY A;  2WPV A;  5CMY A;  4MRU A;  4L7T A;  4I1M A;  3O4Z A;  5D0Q D;  2DYR E;  1DYW A;  2MYO A;  1E7U A;  3ZUV B;  4I17 A;  1WG0 A;  2GRR B;  3L22 A;  1OCR E;  3AG4 E;  1HZ4 A;  2L6J A;  5CBN A;  5CYH A;  4K0R A;  3ABK E;  1OCZ E;  2V0P A;  1ZMF A;  2WXG A;  4NUR A;  3DBS A;  3AAA C;  4AY5 A;  4PS7 A;  2X6J A;  4G25 A;  4I43 A;  1RW2 A;  2C2L A;  4U95 D;  2KCV A;  3CVY A;  4XI0 A;  5KV0 A;  3ML8 A;  4I2Z A;  2VSX E;  1CWI A;  3HXC A;  3TWR A;  2DWZ A;  5KUS A;  1WY6 A;  5AQ7 A;  5KUN A;  4JCP A;  1N0Q A;  1SQM A;  4FUL A;  5KNG A;  4CRW A;  2QFC A;  3ONK A;  4GA0 A;  2B0O E;  3FH8 A;  5EID A;  4N3C A;  1TNZ A;  4DJA A;  1CWO A;  4H7Y A;  4A3T A;  1E96 B;  4UI9 J;  4GB9 A;  4MLP A;  4UQZ A;  2OK3 A;  1HU3 A;  1K1B A;  3CHM A;  3E30 A;  1MIK A;  1JUQ A;  4BSZ B;  3OEP A;  3UTM A;  2LAI A;  1CLH A;  3MA5 A;  3PE4 A;  5JHB A;  4J5D X;  1FGL A;  2X38 A;  3K0N A;  3CK9 A;  4BWR A;  4Y6C A;  5KJL A;  1YCS B;  4UQX A;  4DX6 D;  2AXV A;  5CEA A;  4S1E A;  5HKP A;  2Q7F A;  5KV4 A;  4FA6 A;  2BUG A;  5BT1 A;  4UWK A;  3RJV A;  4DX1 A;  3FTY A;  5LP0 A;  3JB9 d;  2PLU A;  4F6R D;  3UT4 A;  3JUE A;  4J8D A;  5ITZ F;  4OYS A;  1W3B A;  3I4G A;  4WWO A;  2XEE A;  2X6I A;  3CVX A;  4AIF A;  1JWG A;  4BER A;  2X3M A;  3FTZ A;  5CCM A;  1QYM A;  3B7T A;  4KXK B;  3C3Q A;  4UI9 C;  3ZGQ A;  3LY7 A;  2IO2 C;  3FUI A;  1FPP A;  2R5S A;  3K9I A;  5CED B;  4RG9 A;  4LNU D;  4J6I A;  1IST A;  2R2L A;  2POY A;  5KV1 A;  5LX8 A;  3KEA A;  3QNK A;  3CVQ A;  4APO A;  1X5B A;  3G2V A;  1K1A A;  2KBX A;  3BUA A;  5AYW D;  4AM9 A;  1OCO E;  4J59 A;  3TWX A;  3CHQ A;  4U8V D;  2X2A A;  4MKT A;  2P9N G;  4ANU A;  4ZSD A;  4I9Y A;  3OXG A;  3AG2 E;  5C2Y A;  3DRA A;  3CHO A;  2LUH A;  4GYO A;  4GTT A;  4YUM A;  3K0Q A;  4DLO A;  3T1U A;  4HOS A;  2HAQ A;  4BTB A;  3ESL A;  4CGW A;  2Y1L E;  4ME2 A;  2GRP B;  1JPL A;  3IEG A;  2IO3 C;  3FFL A;  4UWH A;  4IPZ A;  4TUM A;  5CBO A;  4A1S A;  3S7F A;  1Z5S C;  3DEP A;  3VLE A;  3LJN A;  5BXO A;  5J08 A;  3RCK X;  3SBT B;  2FO1 E;  1OT8 A;  4FRV A;  4GTR A;  3TG4 A;  5BPP A;  4GA2 A;  4KZ0 A;  1EYH A;  3V2X A;  4PUC A;  2VTB A;  1DNP A;  4F53 A;  5CBU A;  1NA0 A;  5JHE A;  4N1M A;  2WXN A;  2BKG A;  4GTQ A;  5M72 A;  4DX2 A;  3ORE A;  2H6G A;  4DPR A;  4HOQ A;  2CFZ A;  3QAR A;  4R3F A;  2XHE A;  4HXI A;  1O5M A;  4RQI A;  3FUF A;  1H6K A;  2WXK A;  3GYZ A;  1UG3 A;  2X6F A;  5ARF A;  4EHM A;  4YUK A;  3TWW A;  5CRV A;  3FTX A;  3OXL A;  5LUD A;  5IY5 E;  4UWG A;  3V2O A;  1CWJ A;  5KV7 A;  3MX3 A;  1UN8 A;  2ZGG A;  1CWC A;  2HM8 A;  3QWW A;  4EZL A;  3Q15 A;  3HYM B;  3Q75 A;  3CKC A;  4HBD A;  2HQJ A;  2EIK E;  3SQV A;  3ZFW A;  3ZKJ A;  4GZD A;  5E76 A;  4ANX A;  3CHR A;  2DVW A;  1A58 A;  1XGW A;  2OVB A;  2LSV A;  4M3O A;  3K0O A;  5CMW A;  2IY0 C;  2YNQ A;  5LOZ A;  4U0Z A;  1XQ7 A;  3UXG A;  2CHW A;  3RDD A;  2I1K A;  2QC9 A;  3IXE A;  3FTU A;  4YUI A;  4LCT A;  5ENR D;  3APF A;  3CVP A;  1HG5 A;  2AXU A;  3L17 A;  4E1Q A;  2XPI A;  2FO7 A;  4DX5 D;  4JB8 P;  4O1P A;  3RO2 A;  3FUE A;  2P9I G;  2WXF A;  3MKR A;  3FU0 A;  1FVF A;  4TV3 A;  4LQW A;  1SW6 A;  4F3V A;  1HE8 A;  1JCR A;  3VTY A;  3ICH A;  3HXD A;  1OWM A;  3UPV A;  4JEU A;  3C98 A;  3UQ3 A;  2BED A;  3ML9 A;  1Y8M A;  4DI4 A;  2WQ6 A;  2CFE A;  3S7B A;  3E37 A;  3UX4 A;  2IOL A;  1HX8 A;  3QYU A;  1VDN A;  3JCK C;  3V79 K;  5A23 A;  2OCC E;  3D9I A;  5AQA A;  2CG3 A;  4CDM A;  3IHY A;  2LNI A;  5EDS A;  4I6E A;  4WWN A;  2KCK A;  5G55 A;  1HF8 A;  3FEY A;  2OJU A;  1DCQ A;  1TNU A;  4CGV A;  3FDH A;  3JQ1 A;  3TAX A;  1H2V C;  3PZD A;  5CCR A;  1M63 C;  2RFA A;  4CT0 A;  3MKQ A;  3HDX A;  3P2B A;  4CDR A;  1PC2 A;  2XRY A;  3MGB A;  2YHC A;  4BET A;  4HB5 A;  4M7C A;  3L13 A;  3CLJ A;  4YUN A;  3PZ1 A;  4ACL A;  3EHN A;  4I1A A;  1PY1 A;  1QBQ A;  3W9F A;  3TGO A;  2VSN A;  3IBE A;  3D9L A;  1AWT A;  1N4R A;  4N2Q A;  4ANV A;  2WMO A;  1CWM A;  4FAD A;  3B7S A;  3NB2 A;  1MZC A;  1UJJ A;  5FQ8 A;  1CWB A;  3SBS A;  2RMB A;  2ZGD A;  3F6Q A;  5A7D B;  1UJK A;  2WXP A;  4HRM B;  2NC9 A;  3ABL E;  2VGY A;  1BD8 A;  1WM5 A;  2PQR A;  3W9G A;  5T8I A;  4N1O A;  2Y4T A;  2IEJ A;  4U7E B;  4JXT A;  1N95 A;  2XQ0 A;  2FF4 A;  4JPS A;  1NL4 A;  3SZ7 A;  3R56 A;  2R02 A;  3AG1 E;  1OUV A;  2LXL A;  4FHK A;  5JJ7 A;  3RKV A;  2XPZ A;  2EQX A;  1E8X A;  1HG2 A;  1ZBP A;  3PMP A;  4YND A;  4NIK A;  2KCL A;  2NNZ A;  4JHK A;  2ZU6 B;  4XE0 A;  3CGH A;  5JJT A;  3ZYM A;  3R4G A;  2ZXW E;  1H2U A;  2WXH A;  3QWP A;  1MQS A;  3URZ A;  1S0P A;  4GPK A;  3PH0 C;  2DIW A;  1XNF A;  3C5R A;  3HVE B;  4KMO A;  2X25 B;  3CSF A;  2XS8 A;  4FLB A;  2EIN E;  2NYJ A;  1MJ0 A;  4TXQ A;  1ELR A;  2WXR A;  3EHR A;  4CCA A;  2MZU A;  1HH8 A;  3Q47 B;  2X2C K;  1CWL A;  4ZHB A;  4N1N A;  3Q79 A;  2VSO E;  3RO3 A;  4L1B A;  5DBK A;  4N1R A;  4LSZ E;  2A2N A;  5JHA A;  1AK4 A;  1CYN A;  4LG6 A;  4V3I A;  2WXM A;  3LY8 A;  1YA0 A;  5D2M C;  4TXR A;  3K0M A;  3G2S A;  3ZYL A;  4B89 A;  5LCW J;  1C5F A;  1A33 A;  2GGF A;  1V55 E;  5B1A E;  5KJN A;  4I6J A;  2KAT A;  4HFG A;  4EBA G;  1YND A;  3LY9 A;  1AWV A;  4FJZ A;  3Q5M A;  1JCS A;  3I5P A;  5G05 J;  2GW1 A;  5AQ9 A;  4PH4 B;  3CYH A;  3DXM G;  4NRH B;  3SF4 A;  3EHM A;  2E0I A;  4KT6 B;  5ENN A;  1MF8 C;  4JEH A;  1IKN D;  4HY7 A;  3CHS A;  1SA4 A;  2MHK A;  1A5E A;  1AWQ A;  3QWV A;  1NZN A;  2GRQ B;  3HXB A;  3DSX A;  1N94 A;  4OVV A;  5A0E A;  1GW6 A;  2P9P G;  3PUJ A;  3ASG A;  2V5F A;  4A63 B;  3O48 A;  1HFA A;  3BT8 A;  3TWS A;  3QKY A;  1M9D A;  2P9K G;  3FY4 A;  2EIM E;  3GZ1 A;  5CEC B;  4HOR A;  4JHJ A;  2V4L A;  3ULQ A;  5DUD A;  2FUL A;  5FQ7 A;  3RK6 A;  4DGC A;  1H6O A;  4IRU A;  3R7R A;  2WLW A;  2DZN A;  3SI5 A;  5CBV A;  1K8K G;  1H0A A;  2B6C A;  2UY1 A;  1UOH A;  2HQ6 A;  2IGW A;  5ENT D;  2I6H A;  3PS6 A;  5KUV A;  2XCC A;  3I4R B;  5FWQ A;  1BPO A;  5FIN A;  4N3B A;  5ENS D;  4J8Y A;  2V4H C;  1TNY A;  2QZA A;  2X6K A;  4GTS A;  4DUI A;  2ETB A;  4N1P A;  2OOE A;  4Z68 A;  3PZ4 A;  3MML B;  2MS4 A;  3D9M A;  3RSE G;  3P1U A;  3HG0 D;  3R7Q A;  3UT7 A;  3CQC B;  4R7L A;  4WND A;  1UN9 A;  3FUJ A;  3HRA A;  5FIO A;  4G24 A;  3VA7 A;  1JCQ A;  1O1T A;  4N3A A;  3KSL A;  3NOC D;  3AG3 E;  3V31 A;  2J8S D;  4HRL A;  4JA7 A;  4JZY A;  5FJY A;  4UQY A;  2CHZ A;  1KT1 A;  3J5Q B;  2R59 A;  3S2A A;  3E4B A;  4O8H A;  1OWO A;  4U0U A;  3PEV B;  5KUR A;  4O1O A;  4F7A A;  3LXU X;  4JC8 A;  5LFA A;  4HQD A;  3ENE A;  4GCN A;  4IYP A;  2FI7 A;  4C48 B;  2WXI A;  1OWL A;  3DPD A;  4L2Y A;  4WWP A;  3BEE A;  5J90 A;  5EYL A;  3S7J A;  1H2T C;  4GZ6 A;  2L0I A;  4LNG A;  5CHE E;  2X83 B;  4FC8 A;  1O1R A;  4J8S A;  3RCG A;  2IFU A;  3PRE A;  1Z6T A;  2OEW A;  2CPL A;  2P0O A;  2LXM A;  2AJA A;  4QFV A;  1BI7 B;  3RCL A;  3TXN A;  3NAW A;  5FQ4 A;  3R9A B;  1TN8 A;  1VBS A;  1ZKF A;  3R57 A;  5ANL A;  3ULY A;  4XKB A;  2R05 A;  3ASN E;  4UUC A;  4OAV B;  1K3Z D;  3RDB A;  1NA3 A;  4N1S A;  3LKU A;  4F1P A;  4DGD A;  3CIA A;  4CT4 A;  2UWJ G;  3X2Q E;  4K03 A;  4GPM A;  3T5X A;  3FUD A;  1IQU A;  3FTV A;  3PZ2 A;  1SZ9 A;  3FTS A;  1PAQ A;  1DVP A;  5KUL A;  2H6I A;  4J58 A;  2NSZ A;  2MRI A;  2WMN A;  4L2L A;  4YDO A;  4G8K A;  3L16 A;  2X6H A;  5D66 A;  1CWH A;  1AP7 A;  1N4P A;  4KBQ A;  3FU5 A;  3QJZ A;  3E32 A;  4N5Q A;  4G26 A;  4WNE A;  4RSY A;  4XIF A;  3ODI A;  5ENQ D;  1IXV A;  1LTX A;  4FRU A;  3B7R L;  3AS8 A;  2RD0 A;  4IUL A;  3FUN A;  4HS2 A;  2XEN A;  2P58 C;  1S63 A;  3RCI X;  4U63 A;  3ASD A;  4GTO A;  1IHB A;  4KVO A;  4KYO B;  4YVO A;  2A4Z A;  4OAU C;  4I9E A;  1E8W A;  4ILG A;  1D8E A;  2BKK B;  4YUG A;  2AWI A;  3SD5 A;  1U3C A;  1O1S A;  5KV2 A;  3OPF A;  2JEK A;  3X27 A;  4CZ2 D;  3K2C A;  3U3W A;  3E34 A;  2VJ8 A;  4LEU A;  1TNO A;  3U66 A;  4BEP A;  4G8L A;  5BW8 C;  3MYV A;  3IV0 A;  1QOI A;  5JJ6 A;  2QYU A;  3TWU A;  5F66 A;  3CEQ A;  3Q49 B;  3PZ3 A;  5FZS A;  4AP2 A;  2J4D A;  2XPY A;  2MVZ A;  5G05 C;  3ISM C;  4NQ0 A;  4APF A;  4Y6W A;  3TXM A;  1BCK A;  5BUZ A;  5FZR A;  3FUL A;  3RAU A;  4YUH A;  2CK1 A;  2KXP C;  5KJM A;  3RDA X;  1Z3Y A;  5KCM A;  2POE A;  2J07 A;  5LCW C;  4TOT A;  4DGA A;  1WDY A;  1N11 A;  3NF1 A;  4K5A B;  2VGX A;  3MZL B;  2R17 C;  4P29 A;  3NZS A;  3AS4 A;  1E3B A;  2I1J A;  1JWF A;  2WQH A;  3EU9 A;  4BY6 A;  1FCH A;  2ZIR A;  3UM1 A;  5EKQ D;  4GZ3 A;  4B8A A;  1ZX8 A;  1W74 A;  1OWN A;  4KVM A;  5AEN A;  3BQO A;  3CR3 A;  4BX9 A;  4Q94 A;  4N5C A;  1EPU A;  2EIL E;  4YUP A;  2ZP2 A;  2IJG X;  1QNF A;  3DSU A;  4GML A;  5KJK A;  3UI2 A;  4OVU A;  3RIB A;  3DWL G;  1X7F A;  4ANW A;  3ONL A;  2WFI A;  3DXK G;  3GZ2 A;  3WXX A;  4CDN A;  4RLY A;  2L6B A;  3LEW A;  5C1D A;  3RRM B;  2WVI A;  2XCB A;  5BXU A;  2XZT G;  1SA5 A;  1N54 A;  2YIN A;  3CST A;  1Z81 A;  3RD9 X;  2P2C P;  3DST A;  3C3O A;  3LCA A;  3T9K A;  4EZK A;  2GRO B;  3JXI A;  3RRN B;  3FU6 A;  2YQ8 A;  3HXF A;  3L82 A;  1V9T A;  3EUV A;  1WAO 1;  1MX4 A;  5CBT A;  1TEZ A;  2I2O A;  3T8M A;  2EIJ E;  4GU5 A;  3QDN A;  2J49 A;  1Y6I A;  4J5E X;  2RKK A;  5CBW A;  4HVB A;  4GMJ A;  5EX3 A;  3G2U A;  2VQ2 A;  3Q73 A;  5D0O D;  4U8Y D;  2GRN B;  5G04 C;  3BG0 B;  1V54 E;  4J8F A;  3ZRH A;  4MS6 A;  3Q78 A;  4BTA A;  1OCA A;  4GTP A;  1MX2 A;  1EDU A;  3GW4 A;  4DX7 D;  3LDZ A;  3LYA A;  4J7W A;  3ZNG A;  1B89 A;  4PS3 A;  4XNC A;  2J08 A;  2XGO A;  1NMK A;  3JQ0 A;  3SGH A;  4EBA A;  2Y4U A;  2F0Y A;  3QAQ A;  1UW4 B;  4U07 A;  3CV0 A;  5B3S E;  1RMH A;  4BFR A;  5KUU A;  2DBA A;  2OV8 A;  2J9Q A;  4ABN A;  1DC2 A;  3ODL A;  1HO8 A;  3ASO E;  2FEZ A;  1YMP A;  3DPY A;  3GZS A;  4XEI G;  2CYH A;  1CWF A;  2QER A;  4BT9 A;  1M9Y A;  2CG2 A;  3WG7 E;  2GRM A;  4YDY A;  1IHG A;  4WAF A;  5HQ8 A;  4IN3 B;  4NAC A;  2CFU A;  4AVX A;  4W9R A;  4RG6 A;  1D9S A;  2KZT A;  3CYS A;  5FT9 A;  4MBG A;  3TWQ A;  3ASH A;  2KM4 A;  1MZW A;  5ANR A;  2I9C A;  1KT0 A;  4GCO A;  3VLD A;  3C3R A;  5G04 J;  2IOS A;  3B7U X;  3NOG D;  1OY3 D;  2PZI A;  4RVB A;  4A55 A;  2KZT B;  2J09 A;  2DZO A;  4HLL A;  4FU3 A;  1BU9 A;  1HS6 A;  1AWC B;  1U2V G;  4Q69 A;  4J5A X;  3LPZ A;  5BNW A;  1E8K A;  3S6M A;  3CVN A;  3HVE A;  3G2W A;  3LVR E;  2ETC A;  3OAW A;  5AQB A;  3S7D A;  4J8E A;  3MCX A;  2VGX B;  2N0T A;  2XGY B;  2GW2 A;  2VGE A;  2OEV A;  3TWV A;  1N0R A;  2M63 A;  4A3V A;  4XI9 A;  3SNX A;  3SFX A;  3SY2 A;  3KOP A;  4JHR A;  2Y69 E;  3SFZ A;  3APD A;  3DSW A;  3PNL B;  5HS0 A;  3R59 A;  3HIZ A;  3L6A A;  2RMA A;  4F1S A;  4E85 A;  1TR4 A;  1MYO A;  2IF4 A;  1ELW A;  4JJM A;  2NXP A;  1Q2Z A;  5AIJ A;  1E8Z A;  3IHV A;  3KS2 A;  4EEC A;  4FP7 A;  3D9H A;  1QNG A;  4ZSC A;  4GZ5 A;  2HO1 A;  3RRU A;  2JAB A;  2A5U A;  4ATZ D;  2P9U G;  2PM6 A;  4I6G A;  4X8Q A;  1MHQ A;  3AU4 A;  3CHP A;  2IU1 A;  3ASF A;  1X81 A;  3VLF A;  4WNF A;  3UT8 A;  3AS5 A;  3CQG B;  3K0R A;  2E2E A;  4YDW A;  3JYS A;  3LS8 A;  4UI9 K;  3TG5 A;  1W8M A;  2H6F A;  3QK0 A;  3ZXS A;  3C72 A;  1M9X A;  1XYH A;  5KUZ A;  2PM7 A;  3NZU A;  2WXQ A;  2V5Q C;  3KSQ A;  4LRZ A;  5H7P A;  3FH5 A;  1AWU A;  4R3E A;  4XZ4 A;  2BIU X;  3K0P A;  3CKB A;  1CWA A;  3U64 A;  5DIZ A;  1J2A A;  1XWN A;  2X7K A;  3ABM E;  1LD7 A;  5AN8 A;  3FH7 A;  5KV3 A;  5EIB E;  2PHC B;  2WB2 A;  3FUH A;  4PDX A;  2DCP A;  5AJD A;  5KUQ A;  2WFJ A;  4KZC A;  4TUU A;  4AJW A;  2AW6 A;  4N39 A;  1U3D A;  4G23 A;  3TJP A;  1BLX B;  3UCH A;  1BI8 B;  4HOT A;  2MOW A;  1W8V A;  2KA0 A;  5CCQ A;  3FU3 A;  2IGV A;  5E75 A;  4K5B A;  1TJC A;  2Y0B G;  4TXP A;  3HXE A;  4HI9 A;  2HYZ A;  2C3B A;  1LF8 A;  2A5E A;  2RMC A;  5CCL A;  4XKC A;  4AEZ C;  2MC9 A;  2KC7 A;  1OCC E;  4GA1 A;  4H7X A;  4UWF A;  3SFY A;  3DEO A;  4CEM A;  4ATG A;  4J5C X;  3FTW A;  5FZQ A;  5HI7 A;  3TWT A;  4B93 B;  3ZIM A;  3NBN B;  4ILH B;  4G1T A;  2FBN A;  3ULE G;  4DRX E;  2AXZ A;  4JVS A;  4C9B B;  2HE9 A;  4BX8 A;  3EOV A;  1KZP A;  2WM9 A;  2X2D B;  4JL0 A;  1YYH A;  3L54 A;  2R99 A;  4GAA A;  3MV2 B;  3SHF A;  3ZN3 A;  3ZHE B;  4HOU A;  3QC1 A;  4D10 C;  2YHE A;  4PS8 A;  1CWK A;  5JMN D;  1N4S A;  4U0S A;  1QNH A;  1RZ4 A;  4BT8 A;  3DSS A;  5T4Y A;  4S1J A;  5CER B;  4O8I A;  3T8K A;  2C0L A;  2XGM A;  4EQF A;  2OSE A;  3RCF A;  2K7N A;  3ESK A;  2ILR A;  3ZU7 B;  3FWV A;  1H6P A;  3EJN A;  4GTM A;  3APC A;  2QYJ A;  1TNB A;  3FEX A;  2BIT X;  5CCS X;  1LOP A;  1NFI E;  4ILI A;  4A1G A;  1XO7 A;  3TL5 A;  5AAO A;  3J5P A;  3ZW3 A;  1ELK A;  1G3N B;  1TYQ G;  4U04 A;  3D9J A;  3EIQ C;  3D3M A;  5KNH D;  1M9C A;  3V30 A;  2F37 A;  3E33 A;  3MJW A;  2GRL A;  2C0M A;  3AJI A;  1IIP A;  3EU5 A;  1OXJ A;  1M9E A;  1E7V A;  4HNA D;  3G2T A;  4U8H A;  2XZD G;  3MML A;  3CVW A;  4U96 D;  3ICI A;  3QB2 A;  3LVQ E;  3Q7A A;  2DYS E;  3RDC A;  3Q4A B;  5FTP A;  4AXH A;  2LAH A;  3KEZ A;  4JD2 G;  1TJF A;  1S64 A;  5T3R A;  4JA9 A;  5ARG A;  3CK7 A;  4CYH A;  5B1B E;  3D9P A;  2ION A;  1QQE A;  3PVL A;  4G2V A;  2R03 A;  2RFM A;  1H19 A;  4EPZ A;  3B13 A;  5EYP F;  1DCE A;  4B94 A;  5CRU A;  2AVP A;  3UUX A;  2IQC A;  3D9K A;  3L08 A;  3D9O A;  4YDE A;  1EF1 C;  2ZIS A; 
#chains in the Genus database with same CATH homology
 1ZKC A;  4I9Y A;  2J49 A;  3OXG A;  4HY7 A;  3CHS A;  1Y6I A;  4J5E X;  5C2Y A;  5AJL A;  4AY6 A;  4YUL A;  1AWR A;  2MHK A;  2WXL A;  1AWQ A;  3QWV A;  3CHO A;  4FHJ A;  5CBW A;  4GYO A;  2PL2 A;  4GMJ A;  4HVB A;  1NZN A;  3OXF A;  1E90 A;  5EX3 A;  1AWS A;  4YUM A;  3G2U A;  2VQ2 A;  4OVV A;  2RS4 A;  3K0Q A;  5A6C A;  5A0E A;  5D0O D;  3PEU B;  1P5Q A;  4DLO A;  4DGE A;  5G04 C;  1W8L A;  3FP3 A;  1GW6 A;  3T1U A;  3BG0 B;  3PUJ A;  4J8F A;  3ASG A;  3ZRH A;  4G11 A;  4HOS A;  2HAQ A;  3AU5 A;  2V5F A;  4MS6 A;  3O48 A;  1HFA A;  4BTA A;  4BTB A;  3BT8 A;  3ESL A;  3QKY A;  4CGW A;  1M9D A;  1OCA A;  4ME2 A;  3FY4 A;  3GZ1 A;  4AOF A;  1EDU A;  3GW4 A;  4HOR A;  1JPL A;  3IEG A;  3LDZ A;  3LYA A;  1INZ A;  2NUL A;  2FU0 A;  2XGS A;  4DLQ A;  4I1O B;  4JHJ A;  4UWH A;  2V4L A;  3FFL A;  3ULQ A;  2HR2 A;  5DUD A;  2FUL A;  5FQ7 A;  3RK6 A;  1B89 A;  4PS3 A;  4IPZ A;  4XNC A;  4DGC A;  4N2S A;  2J08 A;  2XGO A;  3PRZ A;  4A1S A;  3S7F A;  3FHE A;  4IRU A;  3VLE A;  5J08 A;  2Z6W A;  3RCK X;  3SBT B;  3R7R A;  1NMK A;  2WLW A;  3SI5 A;  5CBV A;  3JQ0 A;  3SGH A;  3U9W A;  4EBA A;  2Y3A A;  1H0A A;  1ZU2 A;  2Y4U A;  1OWP A;  4FRV A;  2UY1 A;  3PUK A;  3TG4 A;  3QAQ A;  1UW4 B;  5BPP A;  4U07 A;  2ALF A;  3CV0 A;  2HQ6 A;  3R49 A;  2XEV A;  4GA2 A;  1RMH A;  2IGW A;  1QZ2 A;  2L0T B;  2I6H A;  2OVF A;  4BFR A;  5KUU A;  1NP7 A;  3CK8 A;  4KZ0 A;  2DBA A;  3LJ3 A;  1EYH A;  3PS6 A;  4PUC A;  5KUV A;  2XCC A;  2OV8 A;  2VTB A;  3R54 A;  2J9Q A;  4ABN A;  3I4R B;  1DNP A;  1BPO A;  5FWQ A;  3RFY A;  3CVL A;  4F53 A;  1NA0 A;  3ODL A;  4N1M A;  5CBU A;  5JHE A;  2WXN A;  1HO8 A;  2FEZ A;  4N3B A;  5M72 A;  3CVU A;  3GZS A;  2CYH A;  3ORE A;  4EYV A;  1CWF A;  2QER A;  5KUW A;  2X6K A;  4BT9 A;  1M9Y A;  2CG2 A;  2VYI A;  4N1P A;  3O7T A;  2GRM A;  2OOE A;  3ZHE A;  1IHG A;  3ZPJ A;  4WAF A;  4DPR A;  5HQ8 A;  3MML B;  4HOQ A;  2MS4 A;  2CFZ A;  4IN3 B;  3BKP A;  3D9M A;  3QAR A;  3P1U A;  4FJY A;  3I3N A;  4R3F A;  4NAC A;  3MEK A;  4E6H A;  2CFU A;  2XHE A;  4HXI A;  4AVX A;  4W9R A;  3R7Q A;  2LSU A;  4RG6 A;  3UT7 A;  3CQC B;  3FUF A;  1H6K A;  3ZVV A;  2WXK A;  3GYZ A;  4R7L A;  1UG3 A;  2KZT A;  1UN9 A;  2PQN A;  2X6F A;  3EIJ A;  1A17 A;  3FUJ A;  4WND A;  5ARF A;  5FT9 A;  3CYS A;  4YUK A;  4WUY A;  1Z3X A;  2BTD A;  4B8C B;  3FTX A;  3ASH A;  1E8Y A;  2KM4 A;  3OXL A;  1MZW A;  3KAE A;  4G24 A;  3FUK A;  4UWL A;  4UWG A;  5ANR A;  1CWJ A;  2BF0 X;  2I9C A;  3MX3 A;  1KT0 A;  1UN8 A;  5KV7 A;  3VA7 A;  3ZEF A;  4GCO A;  4S1J A;  1CWC A;  3VLD A;  5G04 J;  2IOS A;  2HM8 A;  2WXO A;  3B7U X;  4N3A A;  1VAI A;  3QWW A;  2PZI A;  4RVB A;  3U4T A;  4EZL A;  4A55 A;  2KZT B;  3Q15 A;  2J09 A;  3HYM B;  4JA7 A;  4JZY A;  5KV6 A;  5FJY A;  4UQY A;  4FU3 A;  3CKC A;  4O6F A;  2CHZ A;  1HS6 A;  5LUD A;  1KT1 A;  2HQJ A;  1VDY A;  4BSX A;  3ZFW A;  3VTX A;  4Q69 A;  3LPZ A;  5G2N A;  4J5A X;  2R59 A;  3ZYQ A;  3S2A A;  5BNW A;  4JW1 A;  3E4B A;  1FVH A;  3KD7 A;  4GZD A;  1E8K A;  1OWO A;  5E76 A;  2ESL A;  3T5V A;  4U0U A;  4ANX A;  4O8H A;  3S6M A;  5FQ6 A;  3CVN A;  3HVE A;  3CHR A;  4C0E A;  3G2W A;  3LVR E;  3PEV B;  1A58 A;  1XGW A;  1N52 A;  3IKO B;  3OAW A;  5KUR A;  3S7D A;  1L5J A;  4J8E A;  2OVB A;  4F7A A;  5KUO A;  3LXU X;  3N71 A;  4JC8 A;  2LSV A;  4I2W A;  5LFA A;  3BG1 B;  3MCX A;  4M3O A;  2VGX B;  4WNG A;  4HLE A;  3ENE A;  3HHM A;  2N0T A;  4GCN A;  4IYP A;  2XGY B;  2GW2 A;  3K0O A;  2FI7 A;  4GYW A;  5CMW A;  2WXI A;  2YNQ A;  1OWL A;  2VTB B;  5LOZ A;  4U0Z A;  1XQ7 A;  2M63 A;  4A3V A;  4XI9 A;  2OND A;  3SNX A;  3DPD A;  4DI3 A;  2CHW A;  3RDD A;  4L2Y A;  4WWP A;  5KV5 A;  4URK A;  3BEE A;  2I1K A;  5J90 A;  4JHR A;  4C0M A;  3S7J A;  3SFZ A;  1H2T C;  3APD A;  3PNL B;  4GZ6 A;  2UY1 B;  3R59 A;  2L0I A;  3HIZ A;  3L6A A;  5CHE E;  4F1S A;  2QY7 A;  4E85 A;  2RMA A;  2X83 B;  3FTU A;  1KLX A;  2VSY A;  3PNT B;  4FC8 A;  4LUN U;  4YUI A;  4LCT A;  2IF4 A;  4J8S A;  3MV3 B;  1ELW A;  3RCG A;  5CCN A;  3QOU A;  3APF A;  2IFU A;  4JJM A;  3CVP A;  3PRE A;  1HG5 A;  2AXU A;  3L17 A;  4YVQ C;  4E1Q A;  1M9F A;  2XPI A;  2XRZ A;  2FO7 A;  1Z6T A;  4DGD A;  2NXP A;  5AIJ A;  1E8Z A;  4LER A;  3RO2 A;  2CPL A;  2L9B A;  3FUE A;  2P0O A;  1IQR A;  4QFV A;  3IHV A;  2V8S E;  3KS2 A;  3TXN A;  4EEC A;  4FP7 A;  4GZC A;  1QNG A;  3RCL A;  5FQ4 A;  3R9A B;  4GZ5 A;  2WXF A;  2HO1 A;  3RU0 A;  2WQ7 A;  1VBS A;  1ZKF A;  3R57 A;  4ZSD A;  3MKR A;  5ANL A;  4XKB A;  3FU0 A;  3RRU A;  1FVF A;  1HXI A;  4TV3 A;  2A5U A;  4EZJ A;  4LQW A;  4FLH A;  3CVV A;  4YUO A;  2JLB A;  2CMT A;  3RDB A;  1NA3 A;  4N1S A;  3LKU A;  2PM6 A;  1HE8 A;  4I6G A;  3VTY A;  4F3V A;  3ICH A;  3UMV A;  1OWM A;  1MHQ A;  3AU4 A;  3PDN A;  3ZYK A;  3CIA A;  4CT4 A;  2UWJ G;  3CHP A;  2IU1 A;  2B71 A;  3ASF A;  3VLF A;  4N1Q A;  4K03 A;  4WNF A;  3FUM A;  3UT8 A;  3AS5 A;  3CQG B;  3T5X A;  3FUD A;  1IQU A;  3UPV A;  4JEU A;  3C98 A;  4ACK A;  2E2E A;  3K0R A;  1H0P A;  3EDT B;  3JYS A;  3UQ3 A;  3LS8 A;  3ML9 A;  4Q96 A;  1Y8M A;  4UI9 K;  4DI4 A;  5BV1 A;  3FTV A;  2WQ6 A;  1SZ9 A;  3FTS A;  3S7B A;  3TG5 A;  3QK0 A;  1W8M A;  2CFE A;  1PAQ A;  3UX4 A;  3ZXS A;  1DVP A;  2IOL A;  1HX8 A;  4DK5 A;  5KUL A;  3QYU A;  1VDN A;  4XX5 A;  1M9X A;  1XYH A;  2J4B A;  5KUZ A;  4YUJ A;  2PM7 A;  3JCK C;  4J58 A;  2WXJ A;  2NSZ A;  2MRI A;  2WMN A;  4L2L A;  5A23 A;  3NZU A;  3L16 A;  2X6H A;  3D9I A;  2WXQ A;  3OTN A;  3PE3 A;  1IYG A;  1CWH A;  4J0U A;  1SZA A;  2CG3 A;  2RG8 A;  3IHY A;  4CDM A;  2LNI A;  4LRZ A;  5EDS A;  3FH5 A;  4AV7 A;  4I6E A;  5BV0 A;  4L23 A;  1AWU A;  4R3E A;  1VBT A;  4WWN A;  4XZ4 A;  2BIU X;  3K0P A;  3CKB A;  4KBQ A;  1CWA A;  4J5B A;  3FU5 A;  2KCK A;  3QJZ A;  5G55 A;  3U64 A;  1HF8 A;  3FEY A;  5DIZ A;  1J2A A;  2OJU A;  3NQP A;  1XWN A;  4CGV A;  3FDH A;  3JUI A;  2LO6 A;  4G26 A;  2X7K A;  3RCF A;  3JQ1 A;  4DGB A;  4WNE A;  3TAX A;  2CHX A;  3D9N A;  4RSY A;  4B0Z A;  3FH7 A;  4XIF A;  1H2V C;  3PZD A;  4I9C A;  3MKQ B;  1M63 C;  4CT0 A;  3ODI A;  5CCR A;  5KV3 A;  3MKQ A;  3BO7 A;  4TRQ A;  4FRU A;  3HDX A;  5EX0 A;  2PHC B;  3B7R L;  3P2B A;  4CDR A;  1PC2 A;  2WB2 A;  3FUH A;  4GYY A;  2XRY A;  3MGB A;  3AS8 A;  2RD0 A;  2YHC A;  4IUL A;  4PDX A;  2WPV A;  2DCP A;  5CMY A;  4MRU A;  3FUN A;  5AJD A;  5KUQ A;  4HS2 A;  4L7T A;  2WFJ A;  4I1M A;  4KZC A;  4TUU A;  2P58 C;  3L13 A;  4AJW A;  3CLJ A;  3O4Z A;  4YUN A;  5D0Q D;  2AW6 A;  4N39 A;  4ACL A;  1U3D A;  3EHN A;  4G23 A;  1PY1 A;  4I1A A;  3TJP A;  1DYW A;  3RCI X;  4U63 A;  3UCH A;  3TGO A;  4HOT A;  1E7U A;  3ASD A;  2MOW A;  1W8V A;  4I17 A;  4KVO A;  5CCQ A;  2VSN A;  3FU3 A;  2IGV A;  3IBE A;  3D9L A;  5E75 A;  3L22 A;  1AWT A;  4N2Q A;  4ANV A;  1TJC A;  2WMO A;  2A4Z A;  4KYO B;  1HZ4 A;  3B7S A;  4YVO A;  4FAD A;  1CWM A;  4I9E A;  1UJJ A;  1E8W A;  2HYZ A;  2L6J A;  5FQ8 A;  3SBS A;  1CWB A;  4ILG A;  1LF8 A;  2C3B A;  2RMB A;  5CYH A;  4YUG A;  2AWI A;  4K0R A;  3SD5 A;  1U3C A;  2RMC A;  5CCL A;  2V0P A;  4XKC A;  1ZMF A;  5KV2 A;  2WXG A;  4NUR A;  5A7D B;  1UJK A;  4AEZ C;  3OPF A;  2MC9 A;  2WXP A;  2JEK A;  2KC7 A;  3DBS A;  2NC9 A;  4GA1 A;  4AY5 A;  3K2C A;  3U3W A;  2VGY A;  4H7X A;  4PS7 A;  4UWF A;  2X6J A;  1WM5 A;  4G25 A;  4I43 A;  2VJ8 A;  2PQR A;  4ATG A;  5T8I A;  4CEM A;  3FTW A;  4J5C X;  5FZQ A;  5HI7 A;  2C2L A;  4N1O A;  3ZIM A;  2Y4T A;  4LEU A;  3U66 A;  3CVY A;  2KCV A;  4ILH B;  4XI0 A;  5BW8 C;  3MYV A;  4G1T A;  5KV0 A;  2FBN A;  3ML8 A;  4I2Z A;  2VSX E;  2AXZ A;  3IV0 A;  1QOI A;  4JXT A;  2XQ0 A;  5JJ6 A;  4JVS A;  4C9B B;  1CWI A;  2FF4 A;  4JPS A;  2HE9 A;  4BX8 A;  3EOV A;  3SZ7 A;  3R56 A;  2WM9 A;  5F66 A;  1OUV A;  1WY6 A;  3CEQ A;  5KUS A;  5KUN A;  2X2D B;  4FHK A;  3Q49 B;  4JL0 A;  5JJ7 A;  5FZS A;  4JCP A;  4AP2 A;  3RKV A;  2J4D A;  3L54 A;  1SQM A;  2XPY A;  4FUL A;  2XPZ A;  2EQX A;  2R99 A;  4GAA A;  3MV2 B;  5G05 C;  2QFC A;  3ONK A;  3SHF A;  4GA0 A;  3ZN3 A;  4CRW A;  2MVZ A;  1E8X A;  1HG2 A;  3FH8 A;  3ZHE B;  4N3C A;  4NQ0 A;  4APF A;  4DJA A;  4Y6W A;  3TXM A;  1BCK A;  1CWO A;  1ZBP A;  3PMP A;  4HOU A;  3QC1 A;  4H7Y A;  4YND A;  5BUZ A;  5FZR A;  3FUL A;  4A3T A;  1E96 B;  2KCL A;  4UI9 J;  4GB9 A;  4D10 C;  4YUH A;  4MLP A;  2CK1 A;  2YHE A;  5KJM A;  4JHK A;  4UQZ A;  2OK3 A;  4PS8 A;  3RDA X;  2ZU6 B;  1HU3 A;  1CWK A;  1Z3Y A;  3CHM A;  5KCM A;  2POE A;  2J07 A;  5LCW C;  4U0S A;  1MIK A;  1QNH A;  4XE0 A;  4BT8 A;  3CGH A;  4TOT A;  5JJT A;  1JUQ A;  3ZYM A;  4DGA A;  3OEP A;  2LAI A;  3NF1 A;  3MA5 A;  3R4G A;  1CLH A;  1H2U A;  2WXH A;  3PE4 A;  1MQS A;  3QWP A;  5T4Y A;  3URZ A;  1S0P A;  2VGX A;  2R17 C;  3MZL B;  3PH0 C;  4GPK A;  4O8I A;  2C0L A;  5JHB A;  2XGM A;  4EQF A;  2OSE A;  4P29 A;  1FGL A;  4J5D X;  2DIW A;  3NZS A;  1XNF A;  2X38 A;  3AS4 A;  1E3B A;  3K0N A;  2I1J A;  2K7N A;  3HVE B;  4KMO A;  1JWF A;  3CK9 A;  3ESK A;  2ILR A;  2WQH A;  3FWV A;  4BY6 A;  2X25 B;  3EJN A;  3CSF A;  3APC A;  4FLB A;  1FCH A;  4BWR A;  4Y6C A;  3FEX A;  2BIT X;  5EKQ D;  1ELR A;  5KJL A;  5CCS X;  2WXR A;  4GZ3 A;  4ILI A;  4B8A A;  4A1G A;  4CCA A;  3TL5 A;  1LOP A;  1XO7 A;  2MZU A;  1HH8 A;  3Q47 B;  2X2C K;  4UQX A;  1W74 A;  1OWN A;  2AXV A;  1CWL A;  4KVM A;  4N1N A;  4S1E A;  3ZW3 A;  2Q7F A;  1ELK A;  2VSO E;  5AEN A;  3RO3 A;  5KV4 A;  4FA6 A;  2BUG A;  3CR3 A;  5BT1 A;  4ZSC A;  4L1B A;  4U04 A;  5DBK A;  3D9J A;  3EIQ C;  4UWK A;  4BX9 A;  4N1R A;  3RJV A;  4Q94 A;  3D3M A;  1M9C A;  4N5C A;  1EPU A;  3FTY A;  5LP0 A;  4YUP A;  2A2N A;  2ZP2 A;  5JHA A;  1AK4 A;  2IJG X;  3JB9 d;  1QNF A;  4GML A;  5KJK A;  1CYN A;  2PLU A;  3UT4 A;  4OVU A;  3MJW A;  4J8D A;  3RIB A;  4V3I A;  4OYS A;  2GRL A;  2WXM A;  2C0M A;  3LY8 A;  1W3B A;  1IIP A;  1YA0 A;  3I4G A;  1X7F A;  4ANW A;  4WWO A;  1E7V A;  1M9E A;  3K0M A;  3G2T A;  3ONL A;  2X6I A;  4U8H A;  3CVX A;  2WFI A;  3GZ2 A;  4AIF A;  3G2S A;  3MML A;  1JWG A;  3WXX A;  3ZYL A;  2X3M A;  4B89 A;  4CDN A;  3CVW A;  3FTZ A;  3ICI A;  5LCW J;  3QB2 A;  3LVQ E;  3LEW A;  1C5F A;  1A33 A;  3Q4A B;  5C1D A;  5CCM A;  3RDC A;  2GGF A;  5FTP A;  2WVI A;  3RRM B;  2XCB A;  3B7T A;  4AXH A;  2LAH A;  3KEZ A;  4KXK B;  5KJN A;  4UI9 C;  3ZGQ A;  1TJF A;  3LY7 A;  4I6J A;  1N54 A;  5T3R A;  2KAT A;  2YIN A;  3FUI A;  4JA9 A;  5ARG A;  4HFG A;  3CK7 A;  4CYH A;  2R5S A;  4EBA G;  3D9P A;  3K9I A;  1YND A;  2ION A;  3LY9 A;  3CST A;  1QQE A;  1AWV A;  1Z81 A;  3RD9 X;  4FJZ A;  4RG9 A;  3LCA A;  3PVL A;  3Q5M A;  4G2V A;  4J6I A;  1IST A;  2POY A;  3I5P A;  1H19 A;  4EZK A;  3RRN B;  3FU6 A;  4EPZ A;  2YQ8 A;  5KV1 A;  5G05 J;  1V9T A;  5LX8 A;  3B13 A;  2GW1 A;  3QNK A;  3CVQ A;  4PH4 B;  4APO A;  3CYH A;  1WAO 1;  1X5B A;  4B94 A;  3G2V A;  4NRH B;  2AVP A;  3UUX A;  2IQC A;  5CBT A;  1TEZ A;  5AYW D;  4AM9 A;  3D9K A;  3EHM A;  2E0I A;  3SF4 A;  2I2O A;  4J59 A;  3CHQ A;  3L08 A;  4KT6 B;  3T8M A;  4GU5 A;  4MKT A;  5ENN A;  2X2A A;  1MF8 C;  4ANU A;  3D9O A;  4JEH A;  1EF1 C;  3QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...