1IHGA

Bovine cyclophilin 40, monoclinic form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
364
structure length
364
Chain Sequence
SHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two structures of cyclophilin 40: folding and fidelity in the TPR domains.
pubmed doi rcsb
source organism Bos taurus
molecule tags Isomerase
molecule keywords Cyclophilin 40
total genus 130
structure length 364
sequence length 364
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
A PF13176 TPR_7 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ihgA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 1ihgA01
3OEPA 1NA0A 4U0SA 4GPKA 4TOTA 2VSNA 1ISTA 3ICIA 2DBAA 4JCPA 4UQXA 4U04A 2E2EA 1W8LA 1MIKA 4I9CA 2VGXB 3CVPA 4N3BA 2VGXA 5JHEA 4CYHA 1WAO1 2XCCA 4N1MA 2XPIA 4GCNA 3CYSA 3WXXA 3GYZA 4GYYA 3S7JA 3R57A 1MF8C 5CCLA 5KJKA 5DUDA 2PZIA 2LSUA 4GYWA 4W9RA 2ZP2A 4AY5A 1FCHA 1J2AA 3T1UA 2BITX 3LY7A 1M9EA 4LEUA 1AWSA 4A1SA 4YVQC 5KV5A 2YHCA 4HOTA 2FEZA 3CVNA 1QNGA 4HY7A 1CWCA 5KJNA 3GW4A 4J0UA 4I17A 4YUNA 4GZ6A 4GCOA 4WNFA 2BUGA 3GZ1A 3Q15A 5AYWD 5KUVA 1XNFA 4ABNA 3TG4A 3OXLA 2Y4UA 1CWLA 1NMKA 4HOSA 4YUKA 2HR2A 3ODIA 3OXGA 3HYMB 4NRHB 4GA2A 4N2QA 5G05J 1NZNA 5KV1A 4EYVA 2PQRA 2RMAA 4GZ3A 2WQHA 5CCSX 4JA7A 4JHRA 5KUQA 5BW8C 5KV2A 5KULA 3MEKA 1IYGA 4BTAA 4UI9K 5KUOA 2WLWA 2ONDA 2RMCA 1QOIA 4UQZA 1XO7A 3VA7A 2V5FA 2VGYA 4KBQA 1CWMA 3TAXA 5KV7A 1A58A 2MVZA 4CGVA 1XYHA 3ULQA 3PDNA 2KCVA 2RMBA 3R56A 3U4TA 3ZGQA 5FTPA 3RO3A 3RDAX 4DGBA 5KJMA 3K2CA 4DGAA 3MMLA 4HORA 2AVPA 3K0PA 4HOUA 4YUHA 4I2WA 3ZHEA 3QWWA 2GW2A 4KXKB 3CKBA 1VBTA 4N1SA 5LCWC 1HH8A 3ESKA 5KUUA 5ARGA 3VTYA 1CWIA 3UPVA 1M9CA 4YUIA 3ZN3A 4RG6A 4J5BA 4R3EA 2N0TA 3ASDA 4APOA 2HQJA 3URZA 5FT9A 5KUWA 4ZSCA 5G04J 2NC9A 2GW1A 2Y4TA 4J59A 2OJUA 3LYAA 3QOUA 5CCQA 2CYHA 5FJYA 3R49A 2B71A 4KYOB 5BT1A 2MS4A 3KS2A 4WUYA 2XCBA 2C3BA 3R59A 3ASFA 2WFJA 4GA1A 3ASHA 4XI9A 3MV3B 1TJCA 3ASGA 2HYZA 5EX0A 5M72A 1RMHA 3PMPA 4RG9A 3CV0A 4YUMA 4UI9J 3Q49B 2MHKA 5KURA 3JB9d 4HOQA 4XIFA 4U0ZA 2IGVA 4R3FA 2OSEA 4N1OA 3CYHA 5G05C 2X83B 2HO1A 3QWPA 4Y6CA 4AM9A 2RS4A 2UY1B 2LSVA 1DYWA 1CWFA 2PHCB 2X2CK 4BT9A 2X2DB 4AIFA 1ELRA 1KLXA 1AWRA 1ZMFA 4Y6WA 4G1TA 3AS4A 1C5FA 3LY9A 2J9QA 3QYUA 3SZ7A 2KCKA 5G04C 2CK1A 5A0EA 4GYOA 4S1EA 2VYIA 1IHGA 4H7XA 3CEQA 4LQWA 4J58A 2CMTA 1H0PA 2K7NA 1FGLA 3LCAA 5DIZA 1CWAA 4GZ5A 1ZKFA 2MC9A 1VAIA 4JA9A 1NA3A 2XEVA 4N1NA 2C0LA 2FBNA 1CWJA 1E96B 1A33A 4G24A 4J8EA 1AK4A 4UI9C 3S7DA 2WPVA 3RU0A 1CWHA 4I1AA 1AWUA 1BCKA 1KT1A 3LY8A 4ZSDA 1W3BA 2OK3A 1X7FA 1P5QA 1M9DA 2FI7A 3KD7A 4YUGA 3AS8A 2P0OA 3RCKX 3R54A 3PE3A 2I6HA 3SF4A 3ZPJA 1E3BA 3FWVA 3RD9X 2X2AA 3RCGA 4E1QA 2PL2A 5EX3A 2IGWA 2MZUA 2BIUX 4YULA 2YQ8A 2KC7A 5C1DA 4CGWA 5HI7A 3EDTB 1IIPA 3QDNA 3PE4A 4WNGA 1YA0A 5CCNA 3MKRA 2X25B 1XQ7A 5A6CA 5KV3A 4N39A 3Q4AB 4J8DA 5DBKA 2Q7FA 3ICHA 3ZFWA 3RDCA 3LPZA 4N3CA 3JYSA 2FO7A 4O6FA 4ME2A 4N1PA 1QNHA 2NULA 3AS5A 2JLBA 3CK9A 3BT8A 3QWVA 5KV0A 3NF1A 3CVQA 4XNCA 4S1JA 5ARFA 4N1QA 3FP3A 4AY6A 3RCIX 4YUJA 4B94A 3O7TA 4EQFA 4XI0A 2IFUA 5KUSA 4GA0A 4YUPA 5CBUA 5JJ7A 1LOPA 3CVLA 3N71A 4U07A 1QZ2A 4NQ0A 3K0OA 2R99A 4J5DX 2QFCA 1XWNA 1ZBPA 1YNDA 4WNEA 5CBVA 2X7KA 3S6MA 2XGMA 4N3AA 4U0UA 1VBSA 3K0MA 5CYHA 4IN3B 1M9FA 3O48A 3R4GA 1ZKCA 1OUVA 3K0NA 2OOEA 1AWTA 1B89A 3K0RA 3ODLA 5FZSA 2POYA 1ZU2A 3Q5MA 4N2SA 3RCFA 4DGEA 1WM5A 5CBTA 1QQEA 3UCHA 3S7BA 3MA5A 4I9EA 5D0QD 2XGYB 4O8HA 5CBWA 3UQ3A 4IPZA 1W74A 4BWRA 2XGSA 3MV2B 3IEGA 4G25A 5CCRA 3CKCA 4J5CX 1Z81A 2FF4A 4YVOA 1CYNA 2CFEA 3ZHEB 1OCAA 2WFIA 3RIBA 4F3VA 1HZ4A 5CHEE 3BO7A 2R5SA 2L6JA 4I2ZA 2CPLA 4JL0A 3OREA 4G26A 3EOVA 4WNDA 3GZ2A 3OXFA 3MMLB 1A17A 1VDNA 3RDDA 5HQ8A 2UY1A 5KJLA 5KV6A 1M63C 1CWOA 3TGOA 4FRVA 3QKYA 4N5CA 2QERA 4JJMA 2UWJG 2VQ2A 4BT8A 2FU0A 3RJVA 2XGOA 1Y8MA 1ELWA 3FFLA 5F66A 1M9XA 1KT0A 3CK7A 1AWVA 3CK8A 3RCLA 3BEEA 5A7DB 2KCLA 4DGDA 3RFYA 4O8IA 5LUDA 2POEA 3VTXA 1CWKA 1W8VA 4YUOA 3RKVA 2ESLA 1HXIA 1PC2A 1MZWA 3LKUA 3K0QA 5LCWJ 2HAQA 2C2LA 4G2VA 3RDBA 3UUXA 5CCMA 5KV4A 4N1RA 4UQYA 2VSYA 2ALFA 1W8MA 3S7FA 2A2NA 1V9TA 3BKPA 2IF4A 2HE9A 4BTBA 3K9IA 4FRUA 3R9AB 5JJTA 4DGCA 4YNDA 4J5EX 4H7YA 1M9YA 2PQNA 2C0MA 5KUNA 1E8KA 4CDRA 5KUZA 2P58C 1CLHA 4I9YA 3OPFA 2Z6WA 3TG5A 5BNWA 4J5AX 1AWQA 5EKQD 2HQ6A 2KATA 3E4BA 4G23A 5JJ6A 2PLUA 3RO2A 3U3WA 3KAEA 5D0OD 2LNIA 5FZRA 1CWBA 3Q47B 4J8FA 5FZQA
chains in the Genus database with same CATH superfamily
3OEPA 3ICIA 3UKUG 2DBAA 3FH8A 2H6IA 4YDYA 2LXMA 4I9CA 3NZSA 4N3BA 1O5MA 2VGXA 3ZU7B 1WAO1 2XCCA 4N1MA 3DSTA 3CYSA 3GYZA 3S7JA 3SY2A 4OVUA 1MF8C 1EPUA 4EBAG 2WXGA 3PS6A 4TV3A 3E37A 3HXBA 5JMND 2WXKA 4W9RA 1JWFA 3UT4A 3G2TA 4UUCA 1M9EA 4JC8A 3HXCA 3SNXA 4PS3A 5AARA 2YHCA 4OYSA 5CRVA 2XRYA 1Y6IA 2WXJA 4I17A 2RKKA 4J0UA 4J6IA 2BUGA 4L1BA 3MKQA 3T5VA 2RD0A 5KUVA 1IHBA 2R05A 4MS6A 2CG3A 3TG4A 3EHRA 1CWLA 1NMKA 3U66A 4YUKA 3OXGA 4NRHB 5G05J 3UMVA 3HXEA 4EYVA 2PQRA 1U2VG 3I5PA 2DZNA 5CCSX 4JA7A 1X81A 5KNHD 1OCRE 3CQGB 5E76A 5KULA 4UI9K 5KUOA 3GZSA 5CMWA 2WLWA 1QOIA 1XO7A 3VA7A 2VGYA 1H2VC 3KEAA 1N0RA 3TAXA 2A4ZA 3PDNA 3ZGQA 3TWWA 4DGAA 3MMLA 4HORA 4U96D 4O1OA 4KXKB 2WXOA 4FHJA 4ILHB 2IEJA 1HH8A 3ESKA 5EIDA 3G2SA 3UPVA 2KM4A 4J5BA 4R3EA 2N0TA 3ENEA 4TUUA 1AWCB 2XPYA 3D3MA 1FT2A 2L0IA 3LYAA 3QOUA 2R59A 3UM0A 4EPZA 2B71A 4KYOB 1N95A 4WUYA 2XCBA 4B93B 3R59A 1YCSB 4M3OA 3ISMC 1OCOE 4LUNU 3ASGA 2HYZA 3QARA 2FULA 5EX0A 4Q96A 3Q7AA 2WXHA 1JCRA 2MHKA 1DVPA 4B8CB 3FTSA 2IOSA 2IGVA 2PM7A 3CSFA 3CYHA 2ZGGA 1D9SA 2R03A 3PZ1A 3QWPA 4RVBA 4AM9A 4AXHA 2X2CK 4PDXA 1LD8A 4BT9A 4WWOA 4AIFA 4ANVA 5EDSA 1UJKA 1ZMFA 2DYSE 3NZUA 4GZCA 5CEAA 3MCXA 5G04C 3I3NA 1TNUA 4GYOA 3PZDA 5A0EA 2BTDA 5FQ4A 4H7XA 4GMLA 4J7WA 1TNBA 1ZKFA 5J90A 3ML9A 2FBNA 1V54E 1XGWA 3RK6A 1AK4A 2WPVA 1S63A 3S7DA 1NL4A 4I1AA 3V79K 1AWUA 2XQ0A 3LY8A 3CHMA 4HVBA 1M9DA 1X7FA 3KD7A 1KPSB 3ZYLA 3AS8A 4J8SA 3R54A 4G8LA 5AAOA 2I6HA 2KBXA 3FWVA 3RCGA 4GMRA 2KZTA 4E1QA 2PL2A 4K5AB 5EX3A 4X8QA 2MZUA 4YULA 4XEIG 5C1DA 1EF1C 1S0PA 4CGWA 4HLLA 4ZHBA 5HI7A 2J8SD 3UT8A 4PUCA 2AXZA 4DX2A 1XQ7A 1ELKA 1JPLA 5KV3A 3Q4AB 2X6IA 1MX4A 3RDCA 4OAUC 1EYHA 2WXMA 3HDXA 4ME2A 3CGHA 3D9LA 3QK0A 3CK9A 5ENNA 3HVEA 3CVQA 3I4RB 4JHJA 4BY6A 4AY6A 3RCIX 4YUJA 1H6OA 4C0EA 5KUSA 4UWGA 1LOPA 4NACA 3N71A 4U07A 4CZ2D 3E30A 2R99A 1XWNA 1YMPA 3LXUX 5CBVA 2XGMA 3L08A 1OUVA 2V0PA 4JEHA 5C2YA 1B89A 3T8KA 3K0RA 2P9LG 5FZSA 3V2OA 3Q5MA 4N2SA 3OAWA 5BXOA 2H6GA 3MA5A 2LO6A 4I9EA 2XGYB 2CG2A 4BWRA 1O1SA 2XGSA 3MV2B 1Z81A 4QFVA 1N52A 1HF8A 1WDYA 4C0MA 4YVOA 2OV8A 3ZHEB 3J5QB 2X6HA 4F3VA 1HZ4A 2R5SA 4K0RA 5ENQD 3ZRHA 4GAAA 2L6JA 2CPLA 3L6AA 2LXLA 4WNDA 3GZ2A 2Y3AA 5HQ8A 4JD2G 5KV6A 3QJZA 3TGOA 4CT0A 3P2BA 3Q9UC 2XGOA 4DJAA 1N94A 4Z68A 1IKND 3CK7A 3O4ZA 4PS7A 3BEEA 5A7DB 4LERA 3RFYA 4LNUD 4A3TA 2WXIA 5G55A 2P9IG 3TWRA 1TNZA 3RKVA 2ESLA 4KVOA 2V5QC 3EHQA 5EN5D 4AOFA 2I1KA 3K0QA 1LF8A 1OCZE 2NYJA 2HAQA 2C2LA 4G2VA 3UUXA 4BETA 2XRZA 2F37A 1V9TA 2IF4A 4KVMA 4CRWA 3BQOA 2LAIA 1JWGA 3UM3A 2IONA 4J5EX 3CVWA 4CDRA 2IOLA 4A1GA 3SBTB 5EIBE 5LOZA 2F0YA 3ZVVA 3AG1E 4DX6D 4DLOA 1OWPA 2AWIA 1HFAA 4L2YA 3AG2E 2HQ6A 2KATA 3E4BA 4G23A 5FWQA 5D0OD 3Q47B 4GPKA 2VSNA 3D9JA 5BUZA 2XEHA 3L82A 4GTRA 2JEKA 4QQIA 3AU5A 4UQXA 4U04A 3CHQA 2R02A 4F1SA 1W8LA 3CVPA 1SA5A 1H2UA 1V55E 4C48B 2BEDA 3C72A 3L9TA 4GYYA 3AAAC 2AJAA 3C3QA 3U9WA 2VSXE 5DUDA 5HKPA 4A63B 3KEZA 3ULEG 5T8IA 4ILGA 1FCHA 3B7TA 2P9UG 1J2AA 4XZ4A 4DUIA 4F53A 4KMOA 4C9BB 2BKGA 4LEUA 2EQXA 2BKKB 4YVQC 4L23A 5KV5A 2WXPA 1OWMA 4HY7A 2X6KA 5KJNA 3EU9A 4I1MA 5HRYA 3GW4A 4GZ6A 3APDA 4JW1A 3TL5A 3GZ1A 1Z3YA 3Q15A 2DVWA 3FUMA 3EJNA 3R9MA 2Y4UA 4HOSA 3ODIA 1SQMA 3HYMB 4DX7D 1JCSA 1N4RA 1RZ4A 4GZ3A 3DRAA 3QC1A 2XENA 1LTXA 1DC2A 2ZISA 1BU9A 2ETAA 4BTAA 4FULA 4UWFA 1LD7A 2RMCA 3ABME 2QY7A 3TWQA 2P9SG 4DI3A 3LVRE 3TXNA 2GRMA 5KV7A 4CGVA 3ULQA 1K3ZD 2ZXWE 4TUMA 2KCVA 2RMBA 3MJWA 4AJWA 1JCQA 3B95A 4BSXA 3NOCD 3FUNA 2AVPA 2AXUA 3ZHEA 2GW2A 4N1SA 2L0TB 3VTYA 4DRXE 3ZN3A 4RG6A 4YUIA 3ZW3A 4CDMA 3CIAA 1FPPA 4APOA 2HQJA 5FT9A 4U8VD 3SGHA 1MX6A 5G04J 2GW1A 2NC9A 2E0IA 1ZB1A 2J49A 5FJYA 3SBSA 5BT1A 2IO2C 2MS4A 3KS2A 2C3BA 3ABLE 2WFJA 4GA1A 2XZDG 3MV3B 1IXVA 3EIJA 4EZKA 3FTXA 4TXPA 5E75A 5KURA 3JB9d 4HOQA 4XIFA 2WVIA 4U0ZA 1H6PA 5EILA 2HO1A 2UY1B 1DYWA 3E32A 3PZ2A 3JQ0A 2VTBB 3V2XA 2XEEA 5AQAA 1MX2A 3PUKA 1KLXA 1AWRA 3G2UA 5KCMA 4EZJA 3FH7A 2J9QA 4HLEA 3NOGD 1E8ZA 3QYUA 4HS2A 4S1EA 2DIWA 1IHGA 3FY4A 4J58A 2K7NA 3ZXPA 1H0PA 3Q9NC 1FGLA 4FLHA 2F8XK 3UIOC 1VAIA 4KZCA 1S64A 4IYPA 1A33A 3SI5A 4TXRA 2CFZA 5H7PA 2OK3A 1P5QA 3TJPA 3W9GA 3ZYKA 2P0OA 4UWLA 2A5UA 4RQIA 4F7AA 3PE3A 1O1RA 1E3BA 3DSUA 3FUDA 2IGWA 2BIUX 5CEDB 3DWLG 5LX8A 2EIME 1YA0A 2GGFA 3FU6A 1K1AA 4BX9A 4OAVB 4N39A 5DBKA 2Q7FA 3ZYMA 1O1TA 4N1PA 2GRRB 1QNHA 1TEZA 3Q73A 2Y0BG 1H2TC 1FVHA 1N0QA 1SVXA 5BPPA 4APFA 3J5PA 1HS6A 4YUPA 2J08A 5JJ7A 3V30A 3FTVA 3NQPA 5IY5E 3LJ3A 4NQ0A 1E8WA 3K0OA 4J5DX 3PVLA 2CHXA 1ZBPA 1YNDA 4WNEA 2X7KA 2EILE 3D9NA 3S6MA 4N3AA 3CHPA 3K0MA 2L6BA 3O48A 2AW6A 2OOEA 5CMYA 2WMNA 5CERB 1PY1A 4FA6A 3F6QA 5CBTA 3L22A 5D0QD 4A3VA 1BI7B 2FF4A 3TXMA 3ZNGA 1HG2A 1OCAA 2WFIA 3RIBA 3LVQE 5CHEE 3BO7A 2I9CA 3UM1A 5D66A 1UOHA 5KBAA 3JCKC 5AQ9A 4G8KA 4G26A 3NB2A 3EOVA 3OXFA 1VDNA 1QYMA 5KJLA 2OCCE 1M63C 2GRNB 4N5CA 1UG3A 2UWJG 2VQ2A 4BT8A 1U3DA 3DPDA 4ATGA 4DX1A 1M9XA 3MKQB 4BFRA 1TN7A 5CBNA 1PAQA 3KSQA 3RCLA 4DGDA 3IHVA 4JB8P 2POEA 4DPRA 4GZDA 4JEUA 3CVVA 5J08A 1INZA 4K5BA 4JXTA 1OY3D 4GTQA 1Q2ZA 3CQCB 3LJNA 5EYPF 3FEYA 4YDEA 5CCMA 4UQYA 4JVSA 1KZOA 1UJJA 2A5EA 4AEZC 3E34A 3DSSA 3ZKJA 3K9IA 4FRUA 2IJGX 3R9AB 4DGCA 2ETCA 2B0OE 5KUZA 2P58C 3PEUB 3G2WA 3P1UA 5BNWA 4XKCA 4MLPA 5EKQD 4BX8A 5BXUA 3RO2A 5CBOA 3FEXA 3KAEA 4U7EB 1CWBA 1MZCA 4L9PA 3IKOB 4J8FA 4U0SA 4TOTA 3V31A 3FUKA 4JCPA 2BF0X 2E2EA 3ESLA 1MIKA 2VGXB 5JHEA 1TN8A 4CYHA 3UXGA 2PM6A 2M63A 2XHEA 3C5RA 3WXXA 2P2CP 4DI4A 3R57A 2PZIA 3FDHA 2LSUA 4GYWA 4AY5A 3MX3A 3T1UA 2BITX 4UWKA 2MRIA 4A1SA 3JUIA 4HOTA 1OXJA 2FEZA 1QNGA 3FU5A 3DXKG 3VLDA 1CWCA 4YUNA 4LG6A 4D10C 2EINE 2HE0A 1NI1A 1RW2A 3ASOE 2J07A 2J4BA 2WXQA 2IQCA 3PNTB 2HR2A 3APCA 4XX5A 4N2QA 1A5EA 3G2VA 4URKA 1N4SA 1NZNA 4HB5A 4FHKA 4ILIA 3RAUA 5KV1A 3EU5A 2ZGDA 4MRUA 3S2AA 3ZXSA 5KUQA 3MGBA 5BW8C 4WWPA 3B13A 3EUVA 4UQZA 2V5FA 4I1OB 1XYHA 3EHMA 4AV7A 4MBGA 3R56A 3ML8A 2B6CA 4LSZE 4P29A 4V3IA 5FTPA 5T3RA 5KJMA 3CVYA 3K2CA 3K0PA 3T9KA 4HOUA 4YUHA 4I2WA 1ZX8A 3QWWA 3FTZA 1S70B 3CKBA 5LCWC 3HHMA 3JXIA 5KWDA 1CWIA 1M9CA 3B7SA 2JABA 1TNOA 3ASDA 2WB2A 1WY6A 3URZA 5KUWA 4ZSCA 3HXFA 2Y4TA 4ANUA 2OJUA 5CCQA 2CYHA 3R49A 5ANRA 2V4LA 2VGEA 4XI9A 2WMOA 5M72A 4FC8A 3ZYQA 3PMPA 4RG9A 1Z5SC 3E33A 4HNAD 3PUJA 4GTTA 3L54A 1FVFA 2XS1A 1NP7A 2WQ6A 1E7VA 3DPYA 4R3FA 4BESA 4NIKA 4TRQA 5G05C 4XKBA 1CWFA 4E85A 1ELRA 2XPZA 2DCPA 1N4PA 4BERA 4Y6WA 4HRMB 4NURA 5FIOA 1OWNA 2KCKA 3FH5A 4YDOA 3OTNA 2NNZA 3CEQA 3D9HA 1U3CA 3RRNB 3LCAA 5DIZA 1CWAA 4GZ5A 4TXQA 4N1NA 2XEVA 1EDUA 2C0LA 3IHYA 3JQ1A 2RG8A 1N9AA 1MYOA 4UI9C 1HG5A 1CWHA 3ULYA 3DSXA 1BCKA 1KT1A 1W3BA 3IBEA 2I2OA 3TWSA 1N4QA 4YUGA 1G3NB 3BU8A 3I4GA 2WXLA 3SF4A 3BG1B 3HG0D 2X2AA 3SO8A 3EHNA 3PRZA 3B7UX 1JUQA 4KT6B 5ENSD 2KC7A 3R7QA 2P9PG 4F1PA 2QYUA 4JPSA 3PE4A 3TWXA 5B1AE 3FUFA 3NAWA 5A6CA 1MQSA 4ACLA 3SD5A 2X6JA 3IXEA 1BI8B 4N3CA 3CHRA 2RFAA 3JYSA 2FO7A 5LP0A 5ENTD 3HVEB 4B89A 1TYQG 3BG0B 4R7LA 2CHZA 3IV0A 3QWVA 2VSOE 4HFGA 2GRLA 5KV0A 3NF1A 3ZUVB 4XNCA 3D9KA 3X27A 5ARFA 4N1QA 3FP3A 4B94A 3O7TA 4EQFA 4XI0A 2ZIRA 3FTYA 4YDWA 2QFCA 1E8XA 4JZYA 2WXFA 1M9FA 4FLBA 1SW6A 3R4GA 1ZKCA 5AIJA 3K0NA 3FTWA 1MJ0A 1AWTA 2DWZA 3ODLA 1ZU2A 3RCFA 1QNFA 3B7BA 3CLJA 4DGEA 1WM5A 3S7BA 3UQ3A 4IPZA 1W74A 4FADA 4EBAA 1HX8A 1WG0A 1Z3XA 4HI8A 4PS8A 4G25A 4CCAA 3Q78A 3RRUA 4J5CX 4ACKA 4WAFA 3MYVA 3PREA 3UI2A 5G2NA 3UKRG 1UN9A 2Y69E 3FTUA 1GW6A 4FU3A 2QZAA 4GMJA 2UY1A 2KZTB 4HXIA 1CWOA 4FRVA 1IQRA 3QKYA 2QERA 3TWVA 4Q69A 2FU0A 3RJVA 3TWUA 2H6HA 1Y8MA 1ELWA 3FFLA 4UWHA 1KT0A 1AWVA 4PH4B 2KCLA 2DYRE 4J8YA 1W8VA 1Z6TA 1VDYA 5D2MC 3SFYA 1DNPA 1HXIA 2J4DA 1PC2A 1E90A 4CYMD 1MZWA 2EIJE 5ENPD 3FUHA 2EIKE 5KV4A 4FJYA 2VSYA 5AN8A 3SQVA 3U64A 2ALFA 3RSEG 2A2NA 3ZIMA 4IRUA 5CECB 4O60A 2LAHA 2HE9A 1N11A 4U8HA 2ILRA 2YHEA 4YNDA 3KOPA 2PQNA 4XE0A 2OVFA 1E8KA 2LUHA 1NFIE 1CLHA 3ABKE 2ZU6B 3AG3E 4J5AX 4DX5D 4I6EA 1IQUA 2PLUA 4K03A 1H6KA 5BV0A 5AQ7A 2J09A 2CFUA 5EYLA 2NSZA 1NA0A 3FUIA 3R7RA 5HS0A 1ISTA 2X38A 4KZ0A 4GTMA 4ATZD 3CSTA 3LDZA 2MYOA 2XPIA 4GCNA 2OVBA 2FO1E 2OEVA 5BV1A 2XS8A 5CCLA 5KJKA 3D9PA 1K8KG 3PZ3A 1BLXB 2AXVA 3KSLA 4EZLA 4A55A 2ZP2A 3LY7A 3PZ4A 4LNBA 1AWSA 1TR4A 2QYJA 1E7UA 4BSZB 3CVNA 4RLYA 2WXNA 3ONKA 5JHAA 1L5JA 4HRLA 4N5QA 4GCOA 4WNFA 5AYWD 3X2QE 1AP7A 1XNFA 4M7CA 4ABNA 3QB2A 3OXLA 5KNGA 3SFXA 3APFA 4GA2A 2DZOA 4HBDA 3UM2A 4HRNA 2RMAA 3T8MA 2WQHA 2MOWA 2P9NG 1N54A 2NXPA 4JHRA 3SFZA 2CHWA 3JXJA 5KV2A 3UTMA 3MEKA 1IYGA 3DSVA 2ONDA 3PEVB 4ANWA 4KBQA 1CWMA 2ETBA 1A58A 2MVZA 3VLFA 5LFAA 3U4TA 3LS8A 3RO3A 3RDAX 4DGBA 4AP2A 1VBTA 5KUUA 5ARGA 2H6FA 2OEWA 2PNNA 4I6GA 1BPOA 4WWNA 3FU3A 4J59A 1HE8A 3FU0A 4I6JA 2RFMA 3NBNB 3ASFA 3B7RL 4B0ZA 3ASHA 1TJCA 4GTSA 1RMHA 5ENRD 2GRPB 3CV0A 2VJ8A 4YUMA 4U95D 4UI9J 3UINC 4ZFHA 3Q49B 5AJDA 3CHOA 4L2LA 2OSEA 3L16A 4N1OA 5ENOD 2IU1A 2X83B 4Y6CA 2RS4A 2LSVA 5T4YA 2PHCB 2R17C 2X2DB 4O1PA 1OT8A 3UIPC 4B8AA 2R2LA 1HO8A 1YYHA 3CVUA 2KA0A 1TNYA 4G1TA 2YNQA 3AS4A 3D9MA 3LY9A 1C5FA 3D9OA 3W9FA 3FUJA 3UT7A 3SZ7A 2CK1A 5CRUA 2V8SE 2VYIA 3HIZA 3VLEA 4LQWA 4GPMA 3DXMG 4DLQA 2Y1LE 2CMTA 2MC9A 4JA9A 4CT4A 1NA3A 4DK5A 3C3OA 1E96B 1CWJA 5FQ7A 2HM8A 4G24A 4J8EA 3WG7E 5B3SE 4FJZA 3RU0A 1HU3A 2KXPC 3ONLA 5AENA 4ZSDA 2FI7A 3HXDA 4EECA 3RCKX 4E6HA 4I43A 3ZPJA 3TWTA 3RD9X 3MZLB 1SZ9A 3FUEA 4F6RD 2IY0C 2YQ8A 4LNGA 2QC9A 3EDTB 5JHBA 2X3MA 1IIPA 3QDNA 1BD8A 4LRZA 4WNGA 1E8YA 5CCNA 4K5CA 3SHFA 3MKRA 2X25B 2I1JA 4J8DA 2XZTG 4HQDA 3LEWA 2YINA 4EHMA 3ICHA 3ZFWA 3LPZA 4GTVA 4ANXA 2WM9A 3FULA 4O6FA 3ASNE 2NULA 3AS5A 2JLBA 3BT8A 1TJFA 4S1JA 5CBUA 3AU4A 2IFUA 4GA0A 3T5XA 3CVLA 1QZ2A 1KZPA 1X5BA 4CDNA 3RRMB 1MHQA 3FHEA 4U0UA 1VBSA 5JA4D 5CYHA 4IN3B 5ANLA 4FP7A 1SZAA 1OWOA 4BEPA 4MKTA 1D8DA 2POYA 3Q79A 2GROB 2VTBA 2X6FA 3AG4E 5A23A 1QQEA 3PNLB 3UCHA 1K1BA 4O8HA 3C98A 5CBWA 2WQ7A 3HRAA 3IEGA 3Q7FA 5CCRA 3CKCA 1DCQA 1OCCE 1CYNA 2CFEA 3QNKA 3PH0C 1UN8A 3BUAA 4AVXA 1FT1A 4I2ZA 4GTOA 5FQ8A 4IULA 4JL0A 3OREA 3JUEA 3Q75A 5AJLA 5B1BE 4CEMA 3MMLB 1A17A 3RDDA 1H19A 1H0AA 2L9BA 4OVVA 2GRQB 4JJMA 4GTPA 3CHSA 3L17A 2P9KG 3DBSA 3C3RA 5F66A 4RSYA 3L13A 3CK8A 1OWLA 3DEOA 4O8IA 5LUDA 3VTXA 1UW4B 1CWKA 3AJIA 3CR3A 4YUOA 1TN6A 3LKUA 5LCWJ 4U8YD 3RDBA 2V4HC 4U63A 4N1RA 1DCEA 3UX4A 3EIQC 3QAQA 3DSWA 1W8MA 5AQBA 5ITZF 2F8YA 3S7FA 4LCTA 4Q94A 3BKPA 4GB9A 2IO3C 4GU5A 3CVXA 4BTBA 4G11A 5JJTA 1D8EA 4H7YA 1M9YA 2C0MA 1QBQA 5KUNA 3DEPA 4I9YA 3OPFA 3ZEFA 5FQ6A 2Z6WA 4JHKA 3D9IA 3TG5A 1AWQA 4L7TA 5FINA 5JJ6A 1SA4A 2WXRA 3U3WA 5FZRA 2LNIA 4HI9A 5FZQA
chains in the Genus database with same CATH topology
2CFUA 3OEPA 1NA0A 4U0SA 3FUIA 3R7RA 4GPKA 4TOTA 2VSNA 3D9JA 5BUZA 1ISTA 3ICIA 3FUKA 2JEKA 2X38A 2DBAA 3FH8A 4KZ0A 4JCPA 3AU5A 4UQXA 2BF0X 2E2EA 3CHQA 4U04A 4F1SA 3ESLA 1W8LA 1MIKA 4I9CA 2VGXB 3CVPA 3NZSA 1H2UA 4N3BA 3CSTA 2VGXA 5JHEA 4CYHA 3LDZA 2PM6A 1WAO1 2M63A 2XCCA 2XHEA 4N1MA 2XPIA 4GCNA 3CYSA 3WXXA 3GYZA 4GYYA 4DI4A 2OVBA 3S7JA 3R57A 4OVUA 3U9WA 1MF8C 1EPUA 5BV1A 2VSXE 5CCLA 4EBAG 2WXGA 3PS6A 4TV3A 5KJKA 3D9PA 5DUDA 2AXVA 2PZIA 3FDHA 2LSUA 2WXKA 3KEZA 4GYWA 4W9RA 1JWFA 4ILGA 5T8IA 4AY5A 1FCHA 3B7TA 3MX3A 4A55A 1J2AA 4XZ4A 4UWKA 3UT4A 3G2TA 2BITX 3LY7A 4F53A 1M9EA 4KMOA 2MRIA 4LEUA 4C9BB 4JC8A 1AWSA 3SNXA 4A1SA 2EQXA 4YVQC 4L23A 4PS3A 1E7UA 5KV5A 2YHCA 2WXPA 3JUIA 4HOTA 2FEZA 3CVNA 1OWMA 1QNGA 4HY7A 3FU5A 2WXNA 2X6KA 4OYSA 3VLDA 3ONKA 4N1NA 1CWCA 5JHAA 5KJNA 2XRYA 1L5JA 1Y6IA 4I1MA 3GW4A 2WXJA 4I17A 4J0UA 4YUNA 4J6IA 4D10C 4GZ6A 3APDA 4GCOA 4JW1A 4WNFA 2BUGA 3TL5A 3GZ1A 4L1BA 3MKQA 1Z3YA 3Q15A 5AYWD 2RD0A 3T5VA 5KUVA 2J07A 3FUMA 1XNFA 2J4BA 4ABNA 4CT4A 4MS6A 3EJNA 3QB2A 2WXQA 2CG3A 3TG4A 3OXLA 2Y4UA 1CWLA 1NMKA 3APFA 2IQCA 3PNTB 2HR2A 3U66A 3APCA 4HOSA 1SQMA 3OXGA 3HYMB 3ODIA 4YUKA 4XX5A 4NRHB 4GA2A 4N2QA 5G05J 3G2VA 3UMVA 4URKA 1NZNA 4ILIA 4FHKA 5KV1A 4EYVA 2PQRA 2RMAA 4GZ3A 4MRUA 3S2AA 3QC1A 3T8MA 3ZXSA 3I5PA 2WQHA 5CCSX 2MOWA 4JA7A 1N54A 2NXPA 4JHRA 3SFZA 5KUQA 3MGBA 5BW8C 2CHWA 3CQGB 4WWPA 3B13A 5E76A 5KV2A 5KULA 3MEKA 1IYGA 4BTAA 4UI9K 4FULA 4UWFA 5KUOA 3GZSA 5CMWA 2WLWA 2ONDA 2RMCA 1QOIA 2QY7A 4UQZA 1XO7A 3PEVB 2V5FA 4R3EA 3VA7A 4ANWA 2VGYA 4DI3A 3LVRE 4KBQA 3TXNA 1CWMA 1H2VC 2GRMA 4I1OB 3TAXA 1A58A 5KV7A 2MVZA 3VLFA 4CGVA 1XYHA 2A4ZA 3ULQA 3PDNA 5LFAA 3EHMA 4AV7A 2KCVA 2RMBA 3MJWA 3R56A 4AJWA 3U4TA 3ZGQA 5CBUA 3LS8A 3ML8A 4P29A 4V3IA 5FTPA 3RO3A 3RDAX 5T3RA 4DGBA 5KJMA 3CVYA 3K2CA 4BSXA 3FUNA 4DGAA 3MMLA 4HORA 2AVPA 2AXUA 3K0PA 4HOUA 4YUHA 4I2WA 3ZHEA 3QWWA 2GW2A 4KXKB 3FTZA 2WXOA 4FHJA 3CKBA 4ILHB 4AP2A 1VBTA 5LCWC 4N1SA 1HH8A 3ESKA 3HHMA 3G2SA 5KUUA 5ARGA 2L0TB 3VTYA 1CWIA 3UPVA 1M9CA 2KM4A 3B7SA 4RG6A 3ZN3A 4J5BA 2N0TA 3ASDA 3ENEA 4TUUA 3CIAA 3ZW3A 4APOA 4CDMA 4I6GA 1WY6A 4EZLA 2WB2A 1BPOA 2HQJA 3URZA 5FT9A 5KUWA 4ZSCA 4WWNA 2XPYA 3D3MA 3SGHA 5G04J 2L0IA 2Y4TA 2GW1A 2E0IA 2NC9A 3FU3A 4ANUA 1HE8A 3LYAA 3FU0A 2R59A 3QOUA 4I6JA 2OJUA 2CYHA 5CCQA 2J49A 5FJYA 4EPZA 3SBSA 2B71A 3R49A 4KYOB 5ANRA 5BT1A 2MS4A 3KS2A 2V4LA 4WUYA 2XCBA 2C3BA 3R59A 3ASFA 3B7RL 4B0ZA 4GA1A 3ASHA 2WFJA 4XI9A 4M3OA 3MV3B 4LUNU 1TJCA 3ASGA 2WMOA 2HYZA 3QARA 2FULA 3EIJA 5EX0A 4EZKA 4FC8A 5M72A 4Q96A 1RMHA 3ZYQA 3PMPA 4RG9A 3CV0A 2VJ8A 4YUMA 4UI9J 2WXHA 3FTXA 3Q49B 3CHOA 5AJDA 4L2LA 5E75A 2MHKA 3PUJA 3L54A 5KURA 1FVFA 2WQ6A 1NP7A 4HOQA 3JB9d 4XIFA 1E7VA 1DVPA 2WVIA 3FTSA 4U0ZA 4B8CB 2IOSA 2IGVA 4TRQA 2PM7A 2OSEA 4R3FA 3L16A 3CSFA 4N1OA 3CYHA 5G05C 2IU1A 2X83B 2HO1A 3QWPA 4RVBA 4Y6CA 4AM9A 4AXHA 4XKBA 2RS4A 2UY1B 2LSVA 1DYWA 5T4YA 1CWFA 2PHCB 3JQ0A 2X2CK 4PDXA 2VTBB 4BT9A 2R17C 5KUSA 4E85A 4WWOA 3PUKA 4AIFA 4ANVA 5EDSA 2X2DB 1ELRA 1KLXA 2XPZA 2DCPA 1UJKA 3G2UA 1AWRA 1ZMFA 4Y6WA 4B8AA 1HO8A 5KCMA 3CVUA 3NZUA 4EZJA 3FH7A 4GZCA 4G1TA 2YNQA 3AS4A 3D9MA 3LY9A 1C5FA 2J9QA 3D9OA 4HLEA 4NURA 3MCXA 3FUJA 3UT7A 1E8ZA 3QYUA 3SZ7A 1OWNA 2KCKA 5G04C 3FH5A 2CK1A 3I3NA 4GYOA 4HS2A 3PZDA 4S1EA 5A0EA 2DIWA 2V8SE 2VYIA 3HIZA 3OTNA 1IHGA 2BTDA 5FQ4A 4H7XA 3CEQA 3FY4A 3VLEA 4LQWA 4J58A 1U3CA 3RRNB 4GMLA 4DLQA 2CMTA 1H0PA 2K7NA 2J09A 3LCAA 5DIZA 1CWAA 4FLHA 1FGLA 4GZ5A 1ZKFA 2MC9A 1VAIA 5J90A 4JA9A 1NA3A 2XEVA 3ML9A 1EDUA 4KZCA 4IYPA 2C0LA 2FBNA 3IHYA 1E96B 4DK5A 3JQ1A 1CWJA 2RG8A 1XGWA 1A33A 5FQ7A 2HM8A 4G24A 4J8EA 3RK6A 1AK4A 3SI5A 2WPVA 4FJZA 4UI9C 1HG5A 1HU3A 3RU0A 3S7DA 2CFZA 1CWHA 4I1AA 1AWUA 1BCKA 1KT1A 2XQ0A 3LY8A 3ONLA 5AENA 4ZSDA 3CHMA 1W3BA 3IBEA 2OK3A 2I2OA 1P5QA 4HVBA 3TJPA 2FI7A 3KD7A 1M9DA 1X7FA 3ZYKA 3ZYLA 4YUGA 3AS8A 4EECA 2P0OA 4E6HA 4J8SA 3RCKX 4I43A 4UWLA 2A5UA 3I4GA 3R54A 4F7AA 3PE3A 2WXLA 2I6HA 3SF4A 3BG1B 3ZPJA 1E3BA 3FWVA 3RD9X 2X2AA 3RCGA 3MZLB 1SZ9A 3FUDA 2KZTA 3EHNA 4E1QA 3FUEA 2PL2A 3PRZA 3B7UX 5EX3A 1JUQA 2ZP2A 4KT6B 2IGWA 2MZUA 2BIUX 4YULA 2YQ8A 2KC7A 5C1DA 1EF1C 1S0PA 3R7QA 4CGWA 5HI7A 3EDTB 5ENNA 3UT8A 2X3MA 4JPSA 3QDNA 3PE4A 5JHBA 4PUCA 1IIPA 2AXZA 4LRZA 4WNGA 5LX8A 1E8YA 1YA0A 2GGFA 5CCNA 3SHFA 3FUFA 3FU6A 3MKRA 2X25B 1XQ7A 5A6CA 1MQSA 4BX9A 2I1JA 1ELKA 4ACLA 1JPLA 5KV3A 4N39A 3Q4AB 4J8DA 5DBKA 2X6JA 3SD5A 2Q7FA 3ZYMA 2X6IA 3LEWA 2YINA 3ICHA 3ZFWA 3RDCA 1EYHA 3LPZA 4N3CA 2WXMA 3CHRA 3HDXA 4ANXA 3JYSA 2FO7A 2WM9A 3FULA 4ME2A 4O6FA 5LP0A 4N1PA 1QNHA 3CGHA 1TEZA 3D9LA 3HVEB 3QK0A 3AS5A 4B89A 2JLBA 3BG0B 3CK9A 3HVEA 2CHZA 3IV0A 3QWVA 4R7LA 2VSOE 1H2TC 1FVHA 4HFGA 2GRLA 5KV0A 3NF1A 3CVQA 5BPPA 3I4RB 4XNCA 4JHJA 4BY6A 1TJFA 3D9KA 4APFA 4S1JA 5ARFA 4N1QA 3FP3A 4AY6A 3RCIX 4YUJA 4B94A 3O7TA 4EQFA 1HS6A 2IFUA 3AU4A 2J08A 4GA0A 4UWGA 4XI0A 3T5XA 4C0EA 4IPZA 4YUPA 5JJ7A 3FTVA 3FTYA 4NACA 1LOPA 3CVLA 3N71A 3NQPA 1QZ2A 4U07A 3LJ3A 4NQ0A 1E8WA 1X5BA 3K0OA 2R99A 4J5DX 2QFCA 4CDNA 1XWNA 3LXUX 1E8XA 2CHXA 3PVLA 1ZBPA 4JZYA 3RRMB 4WNEA 1YNDA 5CBVA 2X7KA 2WXFA 3D9NA 3S6MA 2XGMA 4N3AA 1MHQA 3CHPA 3FHEA 4U0UA 1VBSA 3K0MA 5CYHA 4IN3B 5ANLA 1M9FA 3O48A 4FLBA 3R4GA 3L08A 1ZKCA 5AIJA 1OUVA 2V0PA 3FTWA 4JEHA 2AW6A 3K0NA 4FP7A 1SZAA 1OWOA 2OOEA 5C2YA 1AWTA 4MKTA 1B89A 5CMYA 3K0RA 3ODLA 2WMNA 1PY1A 5FZSA 2POYA 1ZU2A 3Q5MA 4FA6A 4N2SA 2VTBA 3RCFA 3OAWA 1QNFA 2X6FA 3CLJA 5A23A 4DGEA 1WM5A 5CBTA 1QQEA 3PNLB 3S7BA 3L22A 3UCHA 3MA5A 2LO6A 4I9EA 5D0QD 3C98A 2XGYB 4O8HA 5CBWA 3UQ3A 4A3VA 2CG2A 4FADA 4BWRA 4EBAA 2WQ7A 1W74A 1HX8A 1Z3XA 2XGSA 3MV2B 3IEGA 4PS8A 4G25A 5CCRA 4CCAA 3RRUA 3CKCA 4J5CX 1Z81A 4QFVA 1N52A 1HF8A 4ACKA 2FF4A 4C0MA 4YVOA 2OV8A 1CYNA 2CFEA 4WAFA 3TXMA 1HG2A 3ZHEB 3MYVA 3PREA 3QNKA 1OCAA 2WFIA 3RIBA 2NULA 2X6HA 3PH0C 4F3VA 3LVQE 1HZ4A 5CHEE 1UN8A 5G2NA 3BO7A 2I9CA 1UN9A 2R5SA 4K0RA 3BT8A 3ZRHA 4AVXA 4GAAA 2L6JA 4I2ZA 3JCKC 5FQ8A 2CPLA 3L6AA 4IULA 4JL0A 3OREA 4J59A 4G26A 5AJLA 4WNDA 3FTUA 3GZ2A 3OXFA 1GW6A 4FU3A 4CEMA 3EOVA 3MMLB 1A17A 1VDNA 2Y3AA 4GMJA 3RDDA 5HQ8A 2UY1A 2KZTB 5KJLA 3QJZA 5KV6A 1H19A 1H0AA 4HXIA 2L9BA 1M63C 4OVVA 1CWOA 3TGOA 4FRVA 1IQRA 3QKYA 4N5CA 2QERA 1UG3A 4CT0A 4JJMA 2UWJG 2VQ2A 3P2BA 3CHSA 3L17A 4BT8A 1U3DA 4Q69A 2FU0A 3DBSA 3RJVA 3DPDA 4ATGA 2XGOA 4DJAA 1Y8MA 1ELWA 3FFLA 5F66A 4UWHA 4RSYA 1KT0A 3MKQB 3CK7A 4BFRA 3L13A 3CK8A 1PAQA 4PH4B 3O4ZA 4PS7A 1AWVA 3RCLA 1OWLA 3BEEA 5A7DB 2KCLA 4LERA 3RFYA 3IHVA 4O8IA 4DGDA 5LUDA 2POEA 3VTXA 4DPRA 4YUIA 4A3TA 4GZDA 1UW4B 4JEUA 3CVVA 1CWKA 5J08A 2WXIA 5G55A 3CR3A 1Z6TA 1INZA 1W8VA 1VDYA 4JXTA 4YUOA 1DNPA 3RKVA 2ESLA 2HE9A 1HXIA 4KVOA 2J4DA 1PC2A 3CQCB 1E90A 1MZWA 4AOFA 3LKUA 2I1KA 3K0QA 1LF8A 5LCWJ 3FUHA 2HAQA 2C2LA 3FEYA 4G2VA 3RDBA 3UUXA 5CCMA 5KV4A 4U63A 4FJYA 2XRZA 4N1RA 4UQYA 2VSYA 3UX4A 3EIQC 3U64A 2ALFA 3QAQA 3T1UA 4JVSA 1UJJA 1W8MA 4AEZC 3S7FA 4LCTA 4Q94A 3ZIMA 1V9TA 2A2NA 3BKPA 4GB9A 4IRUA 2IF4A 2LAHA 4GU5A 4BTBA 4KVMA 4U8HA 3K9IA 4G11A 4CRWA 2IJGX 2ILRA 3CVXA 4FRUA 2LAIA 3R9AB 5JJTA 2YHEA 4YNDA 4DGCA 1JWGA 2IONA 4J5EX 4H7YA 1M9YA 2PQNA 2C0MA 4XE0A 1M9XA 2OVFA 3CVWA 5KUNA 1E8KA 4CDRA 5KUZA 2IOLA 2P58C 1CLHA 3PEUB 3G2WA 4I9YA 4A1GA 3OPFA 3P1UA 5FQ6A 3SBTB 4JHKA 5LOZA 3ZEFA 2Z6WA 3D9IA 3TG5A 3ZVVA 5BNWA 2ZU6B 4XKCA 4DLOA 1OWPA 2AWIA 4MLPA 1AWQA 4J5AX 1HFAA 5EKQD 4BX8A 4L7TA 4L2YA 4I6EA 2HQ6A 2KATA 1IQUA 3E4BA 4G23A 5FWQA 5JJ6A 4K03A 2PLUA 1H6KA 3RO2A 5BV0A 2WXRA 3FEXA 3KAEA 5D0OD 2LNIA 5FZRA 3U3WA 1CWBA 3Q47B 3IKOB 4J8FA 5FZQA 2NSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEP A;  1NA0 A;  4U0S A;  4GPK A;  4TOT A;  2VSN A;  1IST A;  3ICI A;  2DBA A;  4JCP A;  4UQX A;  4U04 A;  2E2E A;  1W8L A;  1MIK A;  4I9C A;  2VGX B;  3CVP A;  4N3B A;  2VGX A;  5JHE A;  4CYH A;  1WAO 1;  2XCC A;  4N1M A;  2XPI A;  4GCN A;  3CYS A;  3WXX A;  3GYZ A;  4GYY A;  3S7J A;  3R57 A;  1MF8 C;  5CCL A;  5KJK A;  5DUD A;  2PZI A;  2LSU A;  4GYW A;  4W9R A;  2ZP2 A;  4AY5 A;  1FCH A;  1J2A A;  3T1U A;  2BIT X;  3LY7 A;  1M9E A;  4LEU A;  1AWS A;  4A1S A;  4YVQ C;  5KV5 A;  2YHC A;  4HOT A;  2FEZ A;  3CVN A;  1QNG A;  4HY7 A;  1CWC A;  5KJN A;  3GW4 A;  4J0U A;  4I17 A;  4YUN A;  4GZ6 A;  4GCO A;  4WNF A;  2BUG A;  3GZ1 A;  3Q15 A;  5AYW D;  5KUV A;  1XNF A;  4ABN A;  3TG4 A;  3OXL A;  2Y4U A;  1CWL A;  1NMK A;  4HOS A;  4YUK A;  2HR2 A;  3ODI A;  3OXG A;  3HYM B;  4NRH B;  4GA2 A;  4N2Q A;  5G05 J;  1NZN A;  5KV1 A;  4EYV A;  2PQR A;  2RMA A;  4GZ3 A;  2WQH A;  5CCS X;  4JA7 A;  4JHR A;  5KUQ A;  5BW8 C;  5KV2 A;  5KUL A;  3MEK A;  1IYG A;  4BTA A;  4UI9 K;  5KUO A;  2WLW A;  2OND A;  2RMC A;  1QOI A;  4UQZ A;  1XO7 A;  3VA7 A;  2V5F A;  2VGY A;  4KBQ A;  1CWM A;  3TAX A;  5KV7 A;  1A58 A;  2MVZ A;  4CGV A;  1XYH A;  3ULQ A;  3PDN A;  2KCV A;  2RMB A;  3R56 A;  3U4T A;  3ZGQ A;  5FTP A;  3RO3 A;  3RDA X;  4DGB A;  5KJM A;  3K2C A;  4DGA A;  3MML A;  4HOR A;  2AVP A;  3K0P A;  4HOU A;  4YUH A;  4I2W A;  3ZHE A;  3QWW A;  2GW2 A;  4KXK B;  3CKB A;  1VBT A;  4N1S A;  5LCW C;  1HH8 A;  3ESK A;  5KUU A;  5ARG A;  3VTY A;  1CWI A;  3UPV A;  1M9C A;  4YUI A;  3ZN3 A;  4RG6 A;  4J5B A;  4R3E A;  2N0T A;  3ASD A;  4APO A;  2HQJ A;  3URZ A;  5FT9 A;  5KUW A;  4ZSC A;  5G04 J;  2NC9 A;  2GW1 A;  2Y4T A;  4J59 A;  2OJU A;  3LYA A;  3QOU A;  5CCQ A;  2CYH A;  5FJY A;  3R49 A;  2B71 A;  4KYO B;  5BT1 A;  2MS4 A;  3KS2 A;  4WUY A;  2XCB A;  2C3B A;  3R59 A;  3ASF A;  2WFJ A;  4GA1 A;  3ASH A;  4XI9 A;  3MV3 B;  1TJC A;  3ASG A;  2HYZ A;  5EX0 A;  5M72 A;  1RMH A;  3PMP A;  4RG9 A;  3CV0 A;  4YUM A;  4UI9 J;  3Q49 B;  2MHK A;  5KUR A;  3JB9 d;  4HOQ A;  4XIF A;  4U0Z A;  2IGV A;  4R3F A;  2OSE A;  4N1O A;  3CYH A;  5G05 C;  2X83 B;  2HO1 A;  3QWP A;  4Y6C A;  4AM9 A;  2RS4 A;  2UY1 B;  2LSV A;  1DYW A;  1CWF A;  2PHC B;  2X2C K;  4BT9 A;  2X2D B;  4AIF A;  1ELR A;  1KLX A;  1AWR A;  1ZMF A;  4Y6W A;  4G1T A;  3AS4 A;  1C5F A;  3LY9 A;  2J9Q A;  3QYU A;  3SZ7 A;  2KCK A;  5G04 C;  2CK1 A;  5A0E A;  4GYO A;  4S1E A;  2VYI A;  1IHG A;  4H7X A;  3CEQ A;  4LQW A;  4J58 A;  2CMT A;  1H0P A;  2K7N A;  1FGL A;  3LCA A;  5DIZ A;  1CWA A;  4GZ5 A;  1ZKF A;  2MC9 A;  1VAI A;  4JA9 A;  1NA3 A;  2XEV A;  4N1N A;  2C0L A;  2FBN A;  1CWJ A;  1E96 B;  1A33 A;  4G24 A;  4J8E A;  1AK4 A;  4UI9 C;  3S7D A;  2WPV A;  3RU0 A;  1CWH A;  4I1A A;  1AWU A;  1BCK A;  1KT1 A;  3LY8 A;  4ZSD A;  1W3B A;  2OK3 A;  1X7F A;  1P5Q A;  1M9D A;  2FI7 A;  3KD7 A;  4YUG A;  3AS8 A;  2P0O A;  3RCK X;  3R54 A;  3PE3 A;  2I6H A;  3SF4 A;  3ZPJ A;  1E3B A;  3FWV A;  3RD9 X;  2X2A A;  3RCG A;  4E1Q A;  2PL2 A;  5EX3 A;  2IGW A;  2MZU A;  2BIU X;  4YUL A;  2YQ8 A;  2KC7 A;  5C1D A;  4CGW A;  5HI7 A;  3EDT B;  1IIP A;  3QDN A;  3PE4 A;  4WNG A;  1YA0 A;  5CCN A;  3MKR A;  2X25 B;  1XQ7 A;  5A6C A;  5KV3 A;  4N39 A;  3Q4A B;  4J8D A;  5DBK A;  2Q7F A;  3ICH A;  3ZFW A;  3RDC A;  3LPZ A;  4N3C A;  3JYS A;  2FO7 A;  4O6F A;  4ME2 A;  4N1P A;  1QNH A;  2NUL A;  3AS5 A;  2JLB A;  3CK9 A;  3BT8 A;  3QWV A;  5KV0 A;  3NF1 A;  3CVQ A;  4XNC A;  4S1J A;  5ARF A;  4N1Q A;  3FP3 A;  4AY6 A;  3RCI X;  4YUJ A;  4B94 A;  3O7T A;  4EQF A;  4XI0 A;  2IFU A;  5KUS A;  4GA0 A;  4YUP A;  5CBU A;  5JJ7 A;  1LOP A;  3CVL A;  3N71 A;  4U07 A;  1QZ2 A;  4NQ0 A;  3K0O A;  2R99 A;  4J5D X;  2QFC A;  1XWN A;  1ZBP A;  1YND A;  4WNE A;  5CBV A;  2X7K A;  3S6M A;  2XGM A;  4N3A A;  4U0U A;  1VBS A;  3K0M A;  5CYH A;  4IN3 B;  1M9F A;  3O48 A;  3R4G A;  1ZKC A;  1OUV A;  3K0N A;  2OOE A;  1AWT A;  1B89 A;  3K0R A;  3ODL A;  5FZS A;  2POY A;  1ZU2 A;  3Q5M A;  4N2S A;  3RCF A;  4DGE A;  1WM5 A;  5CBT A;  1QQE A;  3UCH A;  3S7B A;  3MA5 A;  4I9E A;  5D0Q D;  2XGY B;  4O8H A;  5CBW A;  3UQ3 A;  4IPZ A;  1W74 A;  4BWR A;  2XGS A;  3MV2 B;  3IEG A;  4G25 A;  5CCR A;  3CKC A;  4J5C X;  1Z81 A;  2FF4 A;  4YVO A;  1CYN A;  2CFE A;  3ZHE B;  1OCA A;  2WFI A;  3RIB A;  4F3V A;  1HZ4 A;  5CHE E;  3BO7 A;  2R5S A;  2L6J A;  4I2Z A;  2CPL A;  4JL0 A;  3ORE A;  4G26 A;  3EOV A;  4WND A;  3GZ2 A;  3OXF A;  3MML B;  1A17 A;  1VDN A;  3RDD A;  5HQ8 A;  2UY1 A;  5KJL A;  5KV6 A;  1M63 C;  1CWO A;  3TGO A;  4FRV A;  3QKY A;  4N5C A;  2QER A;  4JJM A;  2UWJ G;  2VQ2 A;  4BT8 A;  2FU0 A;  3RJV A;  2XGO A;  1Y8M A;  1ELW A;  3FFL A;  5F66 A;  1M9X A;  1KT0 A;  3CK7 A;  1AWV A;  3CK8 A;  3RCL A;  3BEE A;  5A7D B;  2KCL A;  4DGD A;  3RFY A;  4O8I A;  5LUD A;  2POE A;  3VTX A;  1CWK A;  1W8V A;  4YUO A;  3RKV A;  2ESL A;  1HXI A;  1PC2 A;  1MZW A;  3LKU A;  3K0Q A;  5LCW J;  2HAQ A;  2C2L A;  4G2V A;  3RDB A;  3UUX A;  5CCM A;  5KV4 A;  4N1R A;  4UQY A;  2VSY A;  2ALF A;  1W8M A;  3S7F A;  2A2N A;  1V9T A;  3BKP A;  2IF4 A;  2HE9 A;  4BTB A;  3K9I A;  4FRU A;  3R9A B;  5JJT A;  4DGC A;  4YND A;  4J5E X;  4H7Y A;  1M9Y A;  2PQN A;  2C0M A;  5KUN A;  1E8K A;  4CDR A;  5KUZ A;  2P58 C;  1CLH A;  4I9Y A;  3OPF A;  2Z6W A;  3TG5 A;  5BNW A;  4J5A X;  1AWQ A;  5EKQ D;  2HQ6 A;  2KAT A;  3E4B A;  4G23 A;  5JJ6 A;  2PLU A;  3RO2 A;  3U3W A;  3KAE A;  5D0O D;  2LNI A;  5FZR A;  1CWB A;  3Q47 B;  4J8F A;  5FZQ A; 
#chains in the Genus database with same CATH topology
 3OEP A;  3ICI A;  3UKU G;  2DBA A;  3FH8 A;  2H6I A;  4YDY A;  2LXM A;  4I9C A;  3NZS A;  4N3B A;  1O5M A;  2VGX A;  3ZU7 B;  1WAO 1;  2XCC A;  4N1M A;  3DST A;  3CYS A;  3GYZ A;  3S7J A;  3SY2 A;  4OVU A;  1MF8 C;  1EPU A;  4EBA G;  2WXG A;  3PS6 A;  4TV3 A;  3E37 A;  3HXB A;  5JMN D;  2WXK A;  4W9R A;  1JWF A;  3UT4 A;  3G2T A;  4UUC A;  1M9E A;  4JC8 A;  3HXC A;  3SNX A;  4PS3 A;  5AAR A;  2YHC A;  4OYS A;  5CRV A;  2XRY A;  1Y6I A;  2WXJ A;  4I17 A;  2RKK A;  4J0U A;  4J6I A;  2BUG A;  4L1B A;  3MKQ A;  3T5V A;  2RD0 A;  5KUV A;  1IHB A;  2R05 A;  4MS6 A;  2CG3 A;  3TG4 A;  3EHR A;  1CWL A;  1NMK A;  3U66 A;  4YUK A;  3OXG A;  4NRH B;  5G05 J;  3UMV A;  3HXE A;  4EYV A;  2PQR A;  1U2V G;  3I5P A;  2DZN A;  5CCS X;  4JA7 A;  1X81 A;  5KNH D;  1OCR E;  3CQG B;  5E76 A;  5KUL A;  4UI9 K;  5KUO A;  3GZS A;  5CMW A;  2WLW A;  1QOI A;  1XO7 A;  3VA7 A;  2VGY A;  1H2V C;  3KEA A;  1N0R A;  3TAX A;  2A4Z A;  3PDN A;  3ZGQ A;  3TWW A;  4DGA A;  3MML A;  4HOR A;  4U96 D;  4O1O A;  4KXK B;  2WXO A;  4FHJ A;  4ILH B;  2IEJ A;  1HH8 A;  3ESK A;  5EID A;  3G2S A;  3UPV A;  2KM4 A;  4J5B A;  4R3E A;  2N0T A;  3ENE A;  4TUU A;  1AWC B;  2XPY A;  3D3M A;  1FT2 A;  2L0I A;  3LYA A;  3QOU A;  2R59 A;  3UM0 A;  4EPZ A;  2B71 A;  4KYO B;  1N95 A;  4WUY A;  2XCB A;  4B93 B;  3R59 A;  1YCS B;  4M3O A;  3ISM C;  1OCO E;  4LUN U;  3ASG A;  2HYZ A;  3QAR A;  2FUL A;  5EX0 A;  4Q96 A;  3Q7A A;  2WXH A;  1JCR A;  2MHK A;  1DVP A;  4B8C B;  3FTS A;  2IOS A;  2IGV A;  2PM7 A;  3CSF A;  3CYH A;  2ZGG A;  1D9S A;  2R03 A;  3PZ1 A;  3QWP A;  4RVB A;  4AM9 A;  4AXH A;  2X2C K;  4PDX A;  1LD8 A;  4BT9 A;  4WWO A;  4AIF A;  4ANV A;  5EDS A;  1UJK A;  1ZMF A;  2DYS E;  3NZU A;  4GZC A;  5CEA A;  3MCX A;  5G04 C;  3I3N A;  1TNU A;  4GYO A;  3PZD A;  5A0E A;  2BTD A;  5FQ4 A;  4H7X A;  4GML A;  4J7W A;  1TNB A;  1ZKF A;  5J90 A;  3ML9 A;  2FBN A;  1V54 E;  1XGW A;  3RK6 A;  1AK4 A;  2WPV A;  1S63 A;  3S7D A;  1NL4 A;  4I1A A;  3V79 K;  1AWU A;  2XQ0 A;  3LY8 A;  3CHM A;  4HVB A;  1M9D A;  1X7F A;  3KD7 A;  1KPS B;  3ZYL A;  3AS8 A;  4J8S A;  3R54 A;  4G8L A;  5AAO A;  2I6H A;  2KBX A;  3FWV A;  3RCG A;  4GMR A;  2KZT A;  4E1Q A;  2PL2 A;  4K5A B;  5EX3 A;  4X8Q A;  2MZU A;  4YUL A;  4XEI G;  5C1D A;  1EF1 C;  1S0P A;  4CGW A;  4HLL A;  4ZHB A;  5HI7 A;  2J8S D;  3UT8 A;  4PUC A;  2AXZ A;  4DX2 A;  1XQ7 A;  1ELK A;  1JPL A;  5KV3 A;  3Q4A B;  2X6I A;  1MX4 A;  3RDC A;  4OAU C;  1EYH A;  2WXM A;  3HDX A;  4ME2 A;  3CGH A;  3D9L A;  3QK0 A;  3CK9 A;  5ENN A;  3HVE A;  3CVQ A;  3I4R B;  4JHJ A;  4BY6 A;  4AY6 A;  3RCI X;  4YUJ A;  1H6O A;  4C0E A;  5KUS A;  4UWG A;  1LOP A;  4NAC A;  3N71 A;  4U07 A;  4CZ2 D;  3E30 A;  2R99 A;  1XWN A;  1YMP A;  3LXU X;  5CBV A;  2XGM A;  3L08 A;  1OUV A;  2V0P A;  4JEH A;  5C2Y A;  1B89 A;  3T8K A;  3K0R A;  2P9L G;  5FZS A;  3V2O A;  3Q5M A;  4N2S A;  3OAW A;  5BXO A;  2H6G A;  3MA5 A;  2LO6 A;  4I9E A;  2XGY B;  2CG2 A;  4BWR A;  1O1S A;  2XGS A;  3MV2 B;  1Z81 A;  4QFV A;  1N52 A;  1HF8 A;  1WDY A;  4C0M A;  4YVO A;  2OV8 A;  3ZHE B;  3J5Q B;  2X6H A;  4F3V A;  1HZ4 A;  2R5S A;  4K0R A;  5ENQ D;  3ZRH A;  4GAA A;  2L6J A;  2CPL A;  3L6A A;  2LXL A;  4WND A;  3GZ2 A;  2Y3A A;  5HQ8 A;  4JD2 G;  5KV6 A;  3QJZ A;  3TGO A;  4CT0 A;  3P2B A;  3Q9U C;  2XGO A;  4DJA A;  1N94 A;  4Z68 A;  1IKN D;  3CK7 A;  3O4Z A;  4PS7 A;  3BEE A;  5A7D B;  4LER A;  3RFY A;  4LNU D;  4A3T A;  2WXI A;  5G55 A;  2P9I G;  3TWR A;  1TNZ A;  3RKV A;  2ESL A;  4KVO A;  2V5Q C;  3EHQ A;  5EN5 D;  4AOF A;  2I1K A;  3K0Q A;  1LF8 A;  1OCZ E;  2NYJ A;  2HAQ A;  2C2L A;  4G2V A;  3UUX A;  4BET A;  2XRZ A;  2F37 A;  1V9T A;  2IF4 A;  4KVM A;  4CRW A;  3BQO A;  2LAI A;  1JWG A;  3UM3 A;  2ION A;  4J5E X;  3CVW A;  4CDR A;  2IOL A;  4A1G A;  3SBT B;  5EIB E;  5LOZ A;  2F0Y A;  3ZVV A;  3AG1 E;  4DX6 D;  4DLO A;  1OWP A;  2AWI A;  1HFA A;  4L2Y A;  3AG2 E;  2HQ6 A;  2KAT A;  3E4B A;  4G23 A;  5FWQ A;  5D0O D;  3Q47 B;  4GPK A;  2VSN A;  3D9J A;  5BUZ A;  2XEH A;  3L82 A;  4GTR A;  2JEK A;  4QQI A;  3AU5 A;  4UQX A;  4U04 A;  3CHQ A;  2R02 A;  4F1S A;  1W8L A;  3CVP A;  1SA5 A;  1H2U A;  1V55 E;  4C48 B;  2BED A;  3C72 A;  3L9T A;  4GYY A;  3AAA C;  2AJA A;  3C3Q A;  3U9W A;  2VSX E;  5DUD A;  5HKP A;  4A63 B;  3KEZ A;  3ULE G;  5T8I A;  4ILG A;  1FCH A;  3B7T A;  2P9U G;  1J2A A;  4XZ4 A;  4DUI A;  4F53 A;  4KMO A;  4C9B B;  2BKG A;  4LEU A;  2EQX A;  2BKK B;  4YVQ C;  4L23 A;  5KV5 A;  2WXP A;  1OWM A;  4HY7 A;  2X6K A;  5KJN A;  3EU9 A;  4I1M A;  5HRY A;  3GW4 A;  4GZ6 A;  3APD A;  4JW1 A;  3TL5 A;  3GZ1 A;  1Z3Y A;  3Q15 A;  2DVW A;  3FUM A;  3EJN A;  3R9M A;  2Y4U A;  4HOS A;  3ODI A;  1SQM A;  3HYM B;  4DX7 D;  1JCS A;  1N4R A;  1RZ4 A;  4GZ3 A;  3DRA A;  3QC1 A;  2XEN A;  1LTX A;  1DC2 A;  2ZIS A;  1BU9 A;  2ETA A;  4BTA A;  4FUL A;  4UWF A;  1LD7 A;  2RMC A;  3ABM E;  2QY7 A;  3TWQ A;  2P9S G;  4DI3 A;  3LVR E;  3TXN A;  2GRM A;  5KV7 A;  4CGV A;  3ULQ A;  1K3Z D;  2ZXW E;  4TUM A;  2KCV A;  2RMB A;  3MJW A;  4AJW A;  1JCQ A;  3B95 A;  4BSX A;  3NOC D;  3FUN A;  2AVP A;  2AXU A;  3ZHE A;  2GW2 A;  4N1S A;  2L0T B;  3VTY A;  4DRX E;  3ZN3 A;  4RG6 A;  4YUI A;  3ZW3 A;  4CDM A;  3CIA A;  1FPP A;  4APO A;  2HQJ A;  5FT9 A;  4U8V D;  3SGH A;  1MX6 A;  5G04 J;  2GW1 A;  2NC9 A;  2E0I A;  1ZB1 A;  2J49 A;  5FJY A;  3SBS A;  5BT1 A;  2IO2 C;  2MS4 A;  3KS2 A;  2C3B A;  3ABL E;  2WFJ A;  4GA1 A;  2XZD G;  3MV3 B;  1IXV A;  3EIJ A;  4EZK A;  3FTX A;  4TXP A;  5E75 A;  5KUR A;  3JB9 d;  4HOQ A;  4XIF A;  2WVI A;  4U0Z A;  1H6P A;  5EIL A;  2HO1 A;  2UY1 B;  1DYW A;  3E32 A;  3PZ2 A;  3JQ0 A;  2VTB B;  3V2X A;  2XEE A;  5AQA A;  1MX2 A;  3PUK A;  1KLX A;  1AWR A;  3G2U A;  5KCM A;  4EZJ A;  3FH7 A;  2J9Q A;  4HLE A;  3NOG D;  1E8Z A;  3QYU A;  4HS2 A;  4S1E A;  2DIW A;  1IHG A;  3FY4 A;  4J58 A;  2K7N A;  3ZXP A;  1H0P A;  3Q9N C;  1FGL A;  4FLH A;  2F8X K;  3UIO C;  1VAI A;  4KZC A;  1S64 A;  4IYP A;  1A33 A;  3SI5 A;  4TXR A;  2CFZ A;  5H7P A;  2OK3 A;  1P5Q A;  3TJP A;  3W9G A;  3ZYK A;  2P0O A;  4UWL A;  2A5U A;  4RQI A;  4F7A A;  3PE3 A;  1O1R A;  1E3B A;  3DSU A;  3FUD A;  2IGW A;  2BIU X;  5CED B;  3DWL G;  5LX8 A;  2EIM E;  1YA0 A;  2GGF A;  3FU6 A;  1K1A A;  4BX9 A;  4OAV B;  4N39 A;  5DBK A;  2Q7F A;  3ZYM A;  1O1T A;  4N1P A;  2GRR B;  1QNH A;  1TEZ A;  3Q73 A;  2Y0B G;  1H2T C;  1FVH A;  1N0Q A;  1SVX A;  5BPP A;  4APF A;  3J5P A;  1HS6 A;  4YUP A;  2J08 A;  5JJ7 A;  3V30 A;  3FTV A;  3NQP A;  5IY5 E;  3LJ3 A;  4NQ0 A;  1E8W A;  3K0O A;  4J5D X;  3PVL A;  2CHX A;  1ZBP A;  1YND A;  4WNE A;  2X7K A;  2EIL E;  3D9N A;  3S6M A;  4N3A A;  3CHP A;  3K0M A;  2L6B A;  3O48 A;  2AW6 A;  2OOE A;  5CMY A;  2WMN A;  5CER B;  1PY1 A;  4FA6 A;  3F6Q A;  5CBT A;  3L22 A;  5D0Q D;  4A3V A;  1BI7 B;  2FF4 A;  3TXM A;  3ZNG A;  1HG2 A;  1OCA A;  2WFI A;  3RIB A;  3LVQ E;  5CHE E;  3BO7 A;  2I9C A;  3UM1 A;  5D66 A;  1UOH A;  5KBA A;  3JCK C;  5AQ9 A;  4G8K A;  4G26 A;  3NB2 A;  3EOV A;  3OXF A;  1VDN A;  1QYM A;  5KJL A;  2OCC E;  1M63 C;  2GRN B;  4N5C A;  1UG3 A;  2UWJ G;  2VQ2 A;  4BT8 A;  1U3D A;  3DPD A;  4ATG A;  4DX1 A;  1M9X A;  3MKQ B;  4BFR A;  1TN7 A;  5CBN A;  1PAQ A;  3KSQ A;  3RCL A;  4DGD A;  3IHV A;  4JB8 P;  2POE A;  4DPR A;  4GZD A;  4JEU A;  3CVV A;  5J08 A;  1INZ A;  4K5B A;  4JXT A;  1OY3 D;  4GTQ A;  1Q2Z A;  3CQC B;  3LJN A;  5EYP F;  3FEY A;  4YDE A;  5CCM A;  4UQY A;  4JVS A;  1KZO A;  1UJJ A;  2A5E A;  4AEZ C;  3E34 A;  3DSS A;  3ZKJ A;  3K9I A;  4FRU A;  2IJG X;  3R9A B;  4DGC A;  2ETC A;  2B0O E;  5KUZ A;  2P58 C;  3PEU B;  3G2W A;  3P1U A;  5BNW A;  4XKC A;  4MLP A;  5EKQ D;  4BX8 A;  5BXU A;  3RO2 A;  5CBO A;  3FEX A;  3KAE A;  4U7E B;  1CWB A;  1MZC A;  4L9P A;  3IKO B;  4J8F A;  4U0S A;  4TOT A;  3V31 A;  3FUK A;  4JCP A;  2BF0 X;  2E2E A;  3ESL A;  1MIK A;  2VGX B;  5JHE A;  1TN8 A;  4CYH A;  3UXG A;  2PM6 A;  2M63 A;  2XHE A;  3C5R A;  3WXX A;  2P2C P;  4DI4 A;  3R57 A;  2PZI A;  3FDH A;  2LSU A;  4GYW A;  4AY5 A;  3MX3 A;  3T1U A;  2BIT X;  4UWK A;  2MRI A;  4A1S A;  3JUI A;  4HOT A;  1OXJ A;  2FEZ A;  1QNG A;  3FU5 A;  3DXK G;  3VLD A;  1CWC A;  4YUN A;  4LG6 A;  4D10 C;  2EIN E;  2HE0 A;  1NI1 A;  1RW2 A;  3ASO E;  2J07 A;  2J4B A;  2WXQ A;  2IQC A;  3PNT B;  2HR2 A;  3APC A;  4XX5 A;  4N2Q A;  1A5E A;  3G2V A;  4URK A;  1N4S A;  1NZN A;  4HB5 A;  4FHK A;  4ILI A;  3RAU A;  5KV1 A;  3EU5 A;  2ZGD A;  4MRU A;  3S2A A;  3ZXS A;  5KUQ A;  3MGB A;  5BW8 C;  4WWP A;  3B13 A;  3EUV A;  4UQZ A;  2V5F A;  4I1O B;  1XYH A;  3EHM A;  4AV7 A;  4MBG A;  3R56 A;  3ML8 A;  2B6C A;  4LSZ E;  4P29 A;  4V3I A;  5FTP A;  5T3R A;  5KJM A;  3CVY A;  3K2C A;  3K0P A;  3T9K A;  4HOU A;  4YUH A;  4I2W A;  1ZX8 A;  3QWW A;  3FTZ A;  1S70 B;  3CKB A;  5LCW C;  3HHM A;  3JXI A;  5KWD A;  1CWI A;  1M9C A;  3B7S A;  2JAB A;  1TNO A;  3ASD A;  2WB2 A;  1WY6 A;  3URZ A;  5KUW A;  4ZSC A;  3HXF A;  2Y4T A;  4ANU A;  2OJU A;  5CCQ A;  2CYH A;  3R49 A;  5ANR A;  2V4L A;  2VGE A;  4XI9 A;  2WMO A;  5M72 A;  4FC8 A;  3ZYQ A;  3PMP A;  4RG9 A;  1Z5S C;  3E33 A;  4HNA D;  3PUJ A;  4GTT A;  3L54 A;  1FVF A;  2XS1 A;  1NP7 A;  2WQ6 A;  1E7V A;  3DPY A;  4R3F A;  4BES A;  4NIK A;  4TRQ A;  5G05 C;  4XKB A;  1CWF A;  4E85 A;  1ELR A;  2XPZ A;  2DCP A;  1N4P A;  4BER A;  4Y6W A;  4HRM B;  4NUR A;  5FIO A;  1OWN A;  2KCK A;  3FH5 A;  4YDO A;  3OTN A;  2NNZ A;  3CEQ A;  3D9H A;  1U3C A;  3RRN B;  3LCA A;  5DIZ A;  1CWA A;  4GZ5 A;  4TXQ A;  4N1N A;  2XEV A;  1EDU A;  2C0L A;  3IHY A;  3JQ1 A;  2RG8 A;  1N9A A;  1MYO A;  4UI9 C;  1HG5 A;  1CWH A;  3ULY A;  3DSX A;  1BCK A;  1KT1 A;  1W3B A;  3IBE A;  2I2O A;  3TWS A;  1N4Q A;  4YUG A;  1G3N B;  3BU8 A;  3I4G A;  2WXL A;  3SF4 A;  3BG1 B;  3HG0 D;  2X2A A;  3SO8 A;  3EHN A;  3PRZ A;  3B7U X;  1JUQ A;  4KT6 B;  5ENS D;  2KC7 A;  3R7Q A;  2P9P G;  4F1P A;  2QYU A;  4JPS A;  3PE4 A;  3TWX A;  5B1A E;  3FUF A;  3NAW A;  5A6C A;  1MQS A;  4ACL A;  3SD5 A;  2X6J A;  3IXE A;  1BI8 B;  4N3C A;  3CHR A;  2RFA A;  3JYS A;  2FO7 A;  5LP0 A;  5ENT D;  3HVE B;  4B89 A;  1TYQ G;  3BG0 B;  4R7L A;  2CHZ A;  3IV0 A;  3QWV A;  2VSO E;  4HFG A;  2GRL A;  5KV0 A;  3NF1 A;  3ZUV B;  4XNC A;  3D9K A;  3X27 A;  5ARF A;  4N1Q A;  3FP3 A;  4B94 A;  3O7T A;  4EQF A;  4XI0 A;  2ZIR A;  3FTY A;  4YDW A;  2QFC A;  1E8X A;  4JZY A;  2WXF A;  1M9F A;  4FLB A;  1SW6 A;  3R4G A;  1ZKC A;  5AIJ A;  3K0N A;  3FTW A;  1MJ0 A;  1AWT A;  2DWZ A;  3ODL A;  1ZU2 A;  3RCF A;  1QNF A;  3B7B A;  3CLJ A;  4DGE A;  1WM5 A;  3S7B A;  3UQ3 A;  4IPZ A;  1W74 A;  4FAD A;  4EBA A;  1HX8 A;  1WG0 A;  1Z3X A;  4HI8 A;  4PS8 A;  4G25 A;  4CCA A;  3Q78 A;  3RRU A;  4J5C X;  4ACK A;  4WAF A;  3MYV A;  3PRE A;  3UI2 A;  5G2N A;  3UKR G;  1UN9 A;  2Y69 E;  3FTU A;  1GW6 A;  4FU3 A;  2QZA A;  4GMJ A;  2UY1 A;  2KZT B;  4HXI A;  1CWO A;  4FRV A;  1IQR A;  3QKY A;  2QER A;  3TWV A;  4Q69 A;  2FU0 A;  3RJV A;  3TWU A;  2H6H A;  1Y8M A;  1ELW A;  3FFL A;  4UWH A;  1KT0 A;  1AWV A;  4PH4 B;  2KCL A;  2DYR E;  4J8Y A;  1W8V A;  1Z6T A;  1VDY A;  5D2M C;  3SFY A;  1DNP A;  1HXI A;  2J4D A;  1PC2 A;  1E90 A;  4CYM D;  1MZW A;  2EIJ E;  5ENP D;  3FUH A;  2EIK E;  5KV4 A;  4FJY A;  2VSY A;  5AN8 A;  3SQV A;  3U64 A;  2ALF A;  3RSE G;  2A2N A;  3ZIM A;  4IRU A;  5CEC B;  4O60 A;  2LAH A;  2HE9 A;  1N11 A;  4U8H A;  2ILR A;  2YHE A;  4YND A;  3KOP A;  2PQN A;  4XE0 A;  2OVF A;  1E8K A;  2LUH A;  1NFI E;  1CLH A;  3ABK E;  2ZU6 B;  3AG3 E;  4J5A X;  4DX5 D;  4I6E A;  1IQU A;  2PLU A;  4K03 A;  1H6K A;  5BV0 A;  5AQ7 A;  2J09 A;  2CFU A;  5EYL A;  2NSZ A;  1NA0 A;  3FUI A;  3R7R A;  5HS0 A;  1IST A;  2X38 A;  4KZ0 A;  4GTM A;  4ATZ D;  3CST A;  3LDZ A;  2MYO A;  2XPI A;  4GCN A;  2OVB A;  2FO1 E;  2OEV A;  5BV1 A;  2XS8 A;  5CCL A;  5KJK A;  3D9P A;  1K8K G;  3PZ3 A;  1BLX B;  2AXV A;  3KSL A;  4EZL A;  4A55 A;  2ZP2 A;  3LY7 A;  3PZ4 A;  4LNB A;  1AWS A;  1TR4 A;  2QYJ A;  1E7U A;  4BSZ B;  3CVN A;  4RLY A;  2WXN A;  3ONK A;  5JHA A;  1L5J A;  4HRL A;  4N5Q A;  4GCO A;  4WNF A;  5AYW D;  3X2Q E;  1AP7 A;  1XNF A;  4M7C A;  4ABN A;  3QB2 A;  3OXL A;  5KNG A;  3SFX A;  3APF A;  4GA2 A;  2DZO A;  4HBD A;  3UM2 A;  4HRN A;  2RMA A;  3T8M A;  2WQH A;  2MOW A;  2P9N G;  1N54 A;  2NXP A;  4JHR A;  3SFZ A;  2CHW A;  3JXJ A;  5KV2 A;  3UTM A;  3MEK A;  1IYG A;  3DSV A;  2OND A;  3PEV B;  4ANW A;  4KBQ A;  1CWM A;  2ETB A;  1A58 A;  2MVZ A;  3VLF A;  5LFA A;  3U4T A;  3LS8 A;  3RO3 A;  3RDA X;  4DGB A;  4AP2 A;  1VBT A;  5KUU A;  5ARG A;  2H6F A;  2OEW A;  2PNN A;  4I6G A;  1BPO A;  4WWN A;  3FU3 A;  4J59 A;  1HE8 A;  3FU0 A;  4I6J A;  2RFM A;  3NBN B;  3ASF A;  3B7R L;  4B0Z A;  3ASH A;  1TJC A;  4GTS A;  1RMH A;  5ENR D;  2GRP B;  3CV0 A;  2VJ8 A;  4YUM A;  4U95 D;  4UI9 J;  3UIN C;  4ZFH A;  3Q49 B;  5AJD A;  3CHO A;  4L2L A;  2OSE A;  3L16 A;  4N1O A;  5ENO D;  2IU1 A;  2X83 B;  4Y6C A;  2RS4 A;  2LSV A;  5T4Y A;  2PHC B;  2R17 C;  2X2D B;  4O1P A;  1OT8 A;  3UIP C;  4B8A A;  2R2L A;  1HO8 A;  1YYH A;  3CVU A;  2KA0 A;  1TNY A;  4G1T A;  2YNQ A;  3AS4 A;  3D9M A;  3LY9 A;  1C5F A;  3D9O A;  3W9F A;  3FUJ A;  3UT7 A;  3SZ7 A;  2CK1 A;  5CRU A;  2V8S E;  2VYI A;  3HIZ A;  3VLE A;  4LQW A;  4GPM A;  3DXM G;  4DLQ A;  2Y1L E;  2CMT A;  2MC9 A;  4JA9 A;  4CT4 A;  1NA3 A;  4DK5 A;  3C3O A;  1E96 B;  1CWJ A;  5FQ7 A;  2HM8 A;  4G24 A;  4J8E A;  3WG7 E;  5B3S E;  4FJZ A;  3RU0 A;  1HU3 A;  2KXP C;  3ONL A;  5AEN A;  4ZSD A;  2FI7 A;  3HXD A;  4EEC A;  3RCK X;  4E6H A;  4I43 A;  3ZPJ A;  3TWT A;  3RD9 X;  3MZL B;  1SZ9 A;  3FUE A;  4F6R D;  2IY0 C;  2YQ8 A;  4LNG A;  2QC9 A;  3EDT B;  5JHB A;  2X3M A;  1IIP A;  3QDN A;  1BD8 A;  4LRZ A;  4WNG A;  1E8Y A;  5CCN A;  4K5C A;  3SHF A;  3MKR A;  2X25 B;  2I1J A;  4J8D A;  2XZT G;  4HQD A;  3LEW A;  2YIN A;  4EHM A;  3ICH A;  3ZFW A;  3LPZ A;  4GTV A;  4ANX A;  2WM9 A;  3FUL A;  4O6F A;  3ASN E;  2NUL A;  3AS5 A;  2JLB A;  3BT8 A;  1TJF A;  4S1J A;  5CBU A;  3AU4 A;  2IFU A;  4GA0 A;  3T5X A;  3CVL A;  1QZ2 A;  1KZP A;  1X5B A;  4CDN A;  3RRM B;  1MHQ A;  3FHE A;  4U0U A;  1VBS A;  5JA4 D;  5CYH A;  4IN3 B;  5ANL A;  4FP7 A;  1SZA A;  1OWO A;  4BEP A;  4MKT A;  1D8D A;  2POY A;  3Q79 A;  2GRO B;  2VTB A;  2X6F A;  3AG4 E;  5A23 A;  1QQE A;  3PNL B;  3UCH A;  1K1B A;  4O8H A;  3C98 A;  5CBW A;  2WQ7 A;  3HRA A;  3IEG A;  3Q7F A;  5CCR A;  3CKC A;  1DCQ A;  1OCC E;  1CYN A;  2CFE A;  3QNK A;  3PH0 C;  1UN8 A;  3BUA A;  4AVX A;  1FT1 A;  4I2Z A;  4GTO A;  5FQ8 A;  4IUL A;  4JL0 A;  3ORE A;  3JUE A;  3Q75 A;  5AJL A;  5B1B E;  4CEM A;  3MML B;  1A17 A;  3RDD A;  1H19 A;  1H0A A;  2L9B A;  4OVV A;  2GRQ B;  4JJM A;  4GTP A;  3CHS A;  3L17 A;  2P9K G;  3DBS A;  3C3R A;  5F66 A;  4RSY A;  3L13 A;  3CK8 A;  1OWL A;  3DEO A;  4O8I A;  5LUD A;  3VTX A;  1UW4 B;  1CWK A;  3AJI A;  3CR3 A;  4YUO A;  1TN6 A;  3LKU A;  5LCW J;  4U8Y D;  3RDB A;  2V4H C;  4U63 A;  4N1R A;  1DCE A;  3UX4 A;  3EIQ C;  3QAQ A;  3DSW A;  1W8M A;  5AQB A;  5ITZ F;  2F8Y A;  3S7F A;  4LCT A;  4Q94 A;  3BKP A;  4GB9 A;  2IO3 C;  4GU5 A;  3CVX A;  4BTB A;  4G11 A;  5JJT A;  1D8E A;  4H7Y A;  1M9Y A;  2C0M A;  1QBQ A;  5KUN A;  3DEP A;  4I9Y A;  3OPF A;  3ZEF A;  5FQ6 A;  2Z6W A;  4JHK A;  3D9I A;  3TG5 A;  1AWQ A;  4L7T A;  5FIN A;  5JJ6 A;  1SA4 A;  2WXR A;  3U3W A;  5FZR A;  2LNI A;  4HI9 A;  5FZQ A; 
#chains in the Genus database with same CATH homology
 2CFU A;  3OEP A;  1NA0 A;  4U0S A;  3FUI A;  3R7R A;  4GPK A;  4TOT A;  2VSN A;  3D9J A;  5BUZ A;  1IST A;  3ICI A;  3FUK A;  2JEK A;  2X38 A;  2DBA A;  3FH8 A;  4KZ0 A;  4JCP A;  3AU5 A;  4UQX A;  2BF0 X;  2E2E A;  3CHQ A;  4U04 A;  4F1S A;  3ESL A;  1W8L A;  1MIK A;  4I9C A;  2VGX B;  3CVP A;  3NZS A;  1H2U A;  4N3B A;  3CST A;  2VGX A;  5JHE A;  4CYH A;  3LDZ A;  2PM6 A;  1WAO 1;  2M63 A;  2XCC A;  2XHE A;  4N1M A;  2XPI A;  4GCN A;  3CYS A;  3WXX A;  3GYZ A;  4GYY A;  4DI4 A;  2OVB A;  3S7J A;  3R57 A;  4OVU A;  3U9W A;  1MF8 C;  1EPU A;  5BV1 A;  2VSX E;  5CCL A;  4EBA G;  2WXG A;  3PS6 A;  4TV3 A;  5KJK A;  3D9P A;  5DUD A;  2AXV A;  2PZI A;  3FDH A;  2LSU A;  2WXK A;  3KEZ A;  4GYW A;  4W9R A;  1JWF A;  4ILG A;  5T8I A;  4AY5 A;  1FCH A;  3B7T A;  3MX3 A;  4A55 A;  1J2A A;  4XZ4 A;  4UWK A;  3UT4 A;  3G2T A;  2BIT X;  3LY7 A;  4F53 A;  1M9E A;  4KMO A;  2MRI A;  4LEU A;  4C9B B;  4JC8 A;  1AWS A;  3SNX A;  4A1S A;  2EQX A;  4YVQ C;  4L23 A;  4PS3 A;  1E7U A;  5KV5 A;  2YHC A;  2WXP A;  3JUI A;  4HOT A;  2FEZ A;  3CVN A;  1OWM A;  1QNG A;  4HY7 A;  3FU5 A;  2WXN A;  2X6K A;  4OYS A;  3VLD A;  3ONK A;  4N1N A;  1CWC A;  5JHA A;  5KJN A;  2XRY A;  1L5J A;  1Y6I A;  4I1M A;  3GW4 A;  2WXJ A;  4I17 A;  4J0U A;  4YUN A;  4J6I A;  4D10 C;  4GZ6 A;  3APD A;  4GCO A;  4JW1 A;  4WNF A;  2BUG A;  3TL5 A;  3GZ1 A;  4L1B A;  3MKQ A;  1Z3Y A;  3Q15 A;  5AYW D;  2RD0 A;  3T5V A;  5KUV A;  2J07 A;  3FUM A;  1XNF A;  2J4B A;  4ABN A;  4CT4 A;  4MS6 A;  3EJN A;  3QB2 A;  2WXQ A;  2CG3 A;  3TG4 A;  3OXL A;  2Y4U A;  1CWL A;  1NMK A;  3APF A;  2IQC A;  3PNT B;  2HR2 A;  3U66 A;  3APC A;  4HOS A;  1SQM A;  3OXG A;  3HYM B;  3ODI A;  4YUK A;  4XX5 A;  4NRH B;  4GA2 A;  4N2Q A;  5G05 J;  3G2V A;  3UMV A;  4URK A;  1NZN A;  4ILI A;  4FHK A;  5KV1 A;  4EYV A;  2PQR A;  2RMA A;  4GZ3 A;  4MRU A;  3S2A A;  3QC1 A;  3T8M A;  3ZXS A;  3I5P A;  2WQH A;  5CCS X;  2MOW A;  4JA7 A;  1N54 A;  2NXP A;  4JHR A;  3SFZ A;  5KUQ A;  3MGB A;  5BW8 C;  2CHW A;  3CQG B;  4WWP A;  3B13 A;  5E76 A;  5KV2 A;  5KUL A;  3MEK A;  1IYG A;  4BTA A;  4UI9 K;  4FUL A;  4UWF A;  5KUO A;  3GZS A;  5CMW A;  2WLW A;  2OND A;  2RMC A;  1QOI A;  2QY7 A;  4UQZ A;  1XO7 A;  3PEV B;  2V5F A;  4R3E A;  3VA7 A;  4ANW A;  2VGY A;  4DI3 A;  3LVR E;  4KBQ A;  3TXN A;  1CWM A;  1H2V C;  2GRM A;  4I1O B;  3TAX A;  1A58 A;  5KV7 A;  2MVZ A;  3VLF A;  4CGV A;  1XYH A;  2A4Z A;  3ULQ A;  3PDN A;  5LFA A;  3EHM A;  4AV7 A;  2KCV A;  2RMB A;  3MJW A;  3R56 A;  4AJW A;  3U4T A;  3ZGQ A;  5CBU A;  3LS8 A;  3ML8 A;  4P29 A;  4V3I A;  5FTP A;  3RO3 A;  3RDA X;  5T3R A;  4DGB A;  5KJM A;  3CVY A;  3K2C A;  4BSX A;  3FUN A;  4DGA A;  3MML A;  4HOR A;  2AVP A;  2AXU A;  3K0P A;  4HOU A;  4YUH A;  4I2W A;  3ZHE A;  3QWW A;  2GW2 A;  4KXK B;  3FTZ A;  2WXO A;  4FHJ A;  3CKB A;  4ILH B;  4AP2 A;  1VBT A;  5LCW C;  4N1S A;  1HH8 A;  3ESK A;  3HHM A;  3G2S A;  5KUU A;  5ARG A;  2L0T B;  3VTY A;  1CWI A;  3UPV A;  1M9C A;  2KM4 A;  3B7S A;  4RG6 A;  3ZN3 A;  4J5B A;  2N0T A;  3ASD A;  3ENE A;  4TUU A;  3CIA A;  3ZW3 A;  4APO A;  4CDM A;  4I6G A;  1WY6 A;  4EZL A;  2WB2 A;  1BPO A;  2HQJ A;  3URZ A;  5FT9 A;  5KUW A;  4ZSC A;  4WWN A;  2XPY A;  3D3M A;  3SGH A;  5G04 J;  2L0I A;  2Y4T A;  2GW1 A;  2E0I A;  2NC9 A;  3FU3 A;  4ANU A;  1HE8 A;  3LYA A;  3FU0 A;  2R59 A;  3QOU A;  4I6J A;  2OJU A;  2CYH A;  5CCQ A;  2J49 A;  5FJY A;  4EPZ A;  3SBS A;  2B71 A;  3R49 A;  4KYO B;  5ANR A;  5BT1 A;  2MS4 A;  3KS2 A;  2V4L A;  4WUY A;  2XCB A;  2C3B A;  3R59 A;  3ASF A;  3B7R L;  4B0Z A;  4GA1 A;  3ASH A;  2WFJ A;  4XI9 A;  4M3O A;  3MV3 B;  4LUN U;  1TJC A;  3ASG A;  2WMO A;  2HYZ A;  3QAR A;  2FUL A;  3EIJ A;  5EX0 A;  4EZK A;  4FC8 A;  5M72 A;  4Q96 A;  1RMH A;  3ZYQ A;  3PMP A;  4RG9 A;  3CV0 A;  2VJ8 A;  4YUM A;  4UI9 J;  2WXH A;  3FTX A;  3Q49 B;  3CHO A;  5AJD A;  4L2L A;  5E75 A;  2MHK A;  3PUJ A;  3L54 A;  5KUR A;  1FVF A;  2WQ6 A;  1NP7 A;  4HOQ A;  3JB9 d;  4XIF A;  1E7V A;  1DVP A;  2WVI A;  3FTS A;  4U0Z A;  4B8C B;  2IOS A;  2IGV A;  4TRQ A;  2PM7 A;  2OSE A;  4R3F A;  3L16 A;  3CSF A;  4N1O A;  3CYH A;  5G05 C;  2IU1 A;  2X83 B;  2HO1 A;  3QWP A;  4RVB A;  4Y6C A;  4AM9 A;  4AXH A;  4XKB A;  2RS4 A;  2UY1 B;  2LSV A;  1DYW A;  5T4Y A;  1CWF A;  2PHC B;  3JQ0 A;  2X2C K;  4PDX A;  2VTB B;  4BT9 A;  2R17 C;  5KUS A;  4E85 A;  4WWO A;  3PUK A;  4AIF A;  4ANV A;  5EDS A;  2X2D B;  1ELR A;  1KLX A;  2XPZ A;  2DCP A;  1UJK A;  3G2U A;  1AWR A;  1ZMF A;  4Y6W A;  4B8A A;  1HO8 A;  5KCM A;  3CVU A;  3NZU A;  4EZJ A;  3FH7 A;  4GZC A;  4G1T A;  2YNQ A;  3AS4 A;  3D9M A;  3LY9 A;  1C5F A;  2J9Q A;  3D9O A;  4HLE A;  4NUR A;  3MCX A;  3FUJ A;  3UT7 A;  1E8Z A;  3QYU A;  3SZ7 A;  1OWN A;  2KCK A;  5G04 C;  3FH5 A;  2CK1 A;  3I3N A;  4GYO A;  4HS2 A;  3PZD A;  4S1E A;  5A0E A;  2DIW A;  2V8S E;  2VYI A;  3HIZ A;  3OTN A;  1IHG A;  2BTD A;  5FQ4 A;  4H7X A;  3CEQ A;  3FY4 A;  3VLE A;  4LQW A;  4J58 A;  1U3C A;  3RRN B;  4GML A;  4DLQ A;  2CMT A;  1H0P A;  2K7N A;  2J09 A;  3LCA A;  5DIZ A;  1CWA A;  4FLH A;  1FGL A;  4GZ5 A;  1ZKF A;  2MC9 A;  1VAI A;  5J90 A;  4JA9 A;  1NA3 A;  2XEV A;  3ML9 A;  1EDU A;  4KZC A;  4IYP A;  2C0L A;  2FBN A;  3IHY A;  1E96 B;  4DK5 A;  3JQ1 A;  1CWJ A;  2RG8 A;  1XGW A;  1A33 A;  5FQ7 A;  2HM8 A;  4G24 A;  4J8E A;  3RK6 A;  1AK4 A;  3SI5 A;  2WPV A;  4FJZ A;  4UI9 C;  1HG5 A;  1HU3 A;  3RU0 A;  3S7D A;  2CFZ A;  1CWH A;  4I1A A;  1AWU A;  1BCK A;  1KT1 A;  2XQ0 A;  3LY8 A;  3ONL A;  5AEN A;  4ZSD A;  3CHM A;  1W3B A;  3IBE A;  2OK3 A;  2I2O A;  1P5Q A;  4HVB A;  3TJP A;  2FI7 A;  3KD7 A;  1M9D A;  1X7F A;  3ZYK A;  3ZYL A;  4YUG A;  3AS8 A;  4EEC A;  2P0O A;  4E6H A;  4J8S A;  3RCK X;  4I43 A;  4UWL A;  2A5U A;  3I4G A;  3R54 A;  4F7A A;  3PE3 A;  2WXL A;  2I6H A;  3SF4 A;  3BG1 B;  3ZPJ A;  1E3B A;  3FWV A;  3RD9 X;  2X2A A;  3RCG A;  3MZL B;  1SZ9 A;  3FUD A;  2KZT A;  3EHN A;  4E1Q A;  3FUE A;  2PL2 A;  3PRZ A;  3B7U X;  5EX3 A;  1JUQ A;  2ZP2 A;  4KT6 B;  2IGW A;  2MZU A;  2BIU X;  4YUL A;  2YQ8 A;  2KC7 A;  5C1D A;  1EF1 C;  1S0P A;  3R7Q A;  4CGW A;  5HI7 A;  3EDT B;  5ENN A;  3UT8 A;  2X3M A;  4JPS A;  3QDN A;  3PE4 A;  5JHB A;  4PUC A;  1IIP A;  2AXZ A;  4LRZ A;  4WNG A;  5LX8 A;  1E8Y A;  1YA0 A;  2GGF A;  5CCN A;  3SHF A;  3FUF A;  3FU6 A;  3MKR A;  2X25 B;  1XQ7 A;  5A6C A;  1MQS A;  4BX9 A;  2I1J A;  1ELK A;  4ACL A;  1JPL A;  5KV3 A;  4N39 A;  3Q4A B;  4J8D A;  5DBK A;  2X6J A;  3SD5 A;  2Q7F A;  3ZYM A;  2X6I A;  3LEW A;  2YIN A;  3ICH A;  3ZFW A;  3RDC A;  1EYH A;  3LPZ A;  4N3C A;  2WXM A;  3CHR A;  3HDX A;  4ANX A;  3JYS A;  2FO7 A;  2WM9 A;  3FUL A;  4ME2 A;  4O6F A;  5LP0 A;  4N1P A;  1QNH A;  3CGH A;  1TEZ A;  3D9L A;  3HVE B;  3QK0 A;  3AS5 A;  4B89 A;  2JLB A;  3BG0 B;  3CK9 A;  3HVE A;  2CHZ A;  3IV0 A;  3QWV A;  4R7L A;  2VSO E;  1H2T C;  1FVH A;  4HFG A;  2GRL A;  5KV0 A;  3NF1 A;  3CVQ A;  5BPP A;  3I4R B;  4XNC A;  4JHJ A;  4BY6 A;  1TJF A;  3D9K A;  4APF A;  4S1J A;  5ARF A;  4N1Q A;  3FP3 A;  4AY6 A;  3RCI X;  4YUJ A;  4B94 A;  3O7T A;  4EQF A;  1HS6 A;  2IFU A;  3AU4 A;  2J08 A;  4GA0 A;  4UWG A;  4XI0 A;  3T5X A;  4C0E A;  4IPZ A;  4YUP A;  5JJ7 A;  3FTV A;  3FTY A;  4NAC A;  1LOP A;  3CVL A;  3N71 A;  3NQP A;  1QZ2 A;  4U07 A;  3LJ3 A;  4NQ0 A;  1E8W A;  1X5B A;  3K0O A;  2R99 A;  4J5D X;  2QFC A;  4CDN A;  1XWN A;  3LXU X;  1E8X A;  2CHX A;  3PVL A;  1ZBP A;  4JZY A;  3RRM B;  4WNE A;  1YND A;  5CBV A;  2X7K A;  2WXF A;  3D9N A;  3S6M A;  2XGM A;  4N3A A;  1MHQ A;  3CHP A;  3FHE A;  4U0U A;  1VBS A;  3K0M A;  5CYH A;  4IN3 B;  5ANL A;  1M9F A;  3O48 A;  4FLB A;  3R4G A;  3L08 A;  1ZKC A;  5AIJ A;  1OUV A;  2V0P A;  3FTW A;  4JEH A;  2AW6 A;  3K0N A;  4FP7 A;  1SZA A;  1OWO A;  2OOE A;  5C2Y A;  1AWT A;  4MKT A;  1B89 A;  5CMY A;  3K0R A;  3ODL A;  2WMN A;  1PY1 A;  5FZS A;  2POY A;  1ZU2 A;  3Q5M A;  4FA6 A;  4N2S A;  2VTB A;  3RCF A;  3OAW A;  1QNF A;  2X6F A;  3CLJ A;  5A23 A;  4DGE A;  1WM5 A;  5CBT A;  1QQE A;  3PNL B;  3S7B A;  3L22 A;  3UCH A;  3MA5 A;  2LO6 A;  4I9E A;  5D0Q D;  3C98 A;  2XGY B;  4O8H A;  5CBW A;  3UQ3 A;  4A3V A;  2CG2 A;  4FAD A;  4BWR A;  4EBA A;  2WQ7 A;  1W74 A;  1HX8 A;  1Z3X A;  2XGS A;  3MV2 B;  3IEG A;  4PS8 A;  4G25 A;  5CCR A;  4CCA A;  3RRU A;  3CKC A;  4J5C X;  1Z81 A;  4QFV A;  1N52 A;  1HF8 A;  4ACK A;  2FF4 A;  4C0M A;  4YVO A;  2OV8 A;  1CYN A;  2CFE A;  4WAF A;  3TXM A;  1HG2 A;  3ZHE B;  3MYV A;  3PRE A;  3QNK A;  1OCA A;  2WFI A;  3RIB A;  2NUL A;  2X6H A;  3PH0 C;  4F3V A;  3LVQ E;  1HZ4 A;  5CHE E;  1UN8 A;  5G2N A;  3BO7 A;  2I9C A;  1UN9 A;  2R5S A;  4K0R A;  3BT8 A;  3ZRH A;  4AVX A;  4GAA A;  2L6J A;  4I2Z A;  3JCK C;  5FQ8 A;  2CPL A;  3L6A A;  4IUL A;  4JL0 A;  3ORE A;  4J59 A;  4G26 A;  5AJL A;  4WND A;  3FTU A;  3GZ2 A;  3OXF A;  1GW6 A;  4FU3 A;  4CEM A;  3EOV A;  3MML B;  1A17 A;  1VDN A;  2Y3A A;  4GMJ A;  3RDD A;  5HQ8 A;  2UY1 A;  2KZT B;  5KJL A;  3QJZ A;  5KV6 A;  1H19 A;  1H0A A;  4HXI A;  2L9B A;  1M63 C;  4OVV A;  1CWO A;  3TGO A;  4FRV A;  1IQR A;  3QKY A;  4N5C A;  2QER A;  1UG3 A;  4CT0 A;  4JJM A;  2UWJ G;  2VQ2 A;  3P2B A;  3CHS A;  3L17 A;  4BT8 A;  1U3D A;  4Q69 A;  2FU0 A;  3DBS A;  3RJV A;  3DPD A;  4ATG A;  2XGO A;  4DJA A;  1Y8M A;  1ELW A;  3FFL A;  5F66 A;  4UWH A;  4RSY A;  1KT0 A;  3MKQ B;  3CK7 A;  4BFR A;  3L13 A;  3CK8 A;  1PAQ A;  4PH4 B;  3O4Z A;  4PS7 A;  1AWV A;  3RCL A;  1OWL A;  3BEE A;  5A7D B;  2KCL A;  4LER A;  3RFY A;  3IHV A;  4O8I A;  4DGD A;  5LUD A;  2POE A;  3VTX A;  4DPR A;  4YUI A;  4A3T A;  4GZD A;  1UW4 B;  4JEU A;  3CVV A;  1CWK A;  5J08 A;  2WXI A;  5G55 A;  3CR3 A;  1Z6T A;  1INZ A;  1W8V A;  1VDY A;  4JXT A;  4YUO A;  1DNP A;  3RKV A;  2ESL A;  2HE9 A;  1HXI A;  4KVO A;  2J4D A;  1PC2 A;  3CQC B;  1E90 A;  1MZW A;  4AOF A;  3LKU A;  2I1K A;  3K0Q A;  1LF8 A;  5LCW J;  3FUH A;  2HAQ A;  2C2L A;  3FEY A;  4G2V A;  3RDB A;  3UUX A;  5CCM A;  5KV4 A;  4U63 A;  4FJY A;  2XRZ A;  4N1R A;  4UQY A;  2VSY A;  3UX4 A;  3EIQ C;  3U64 A;  2ALF A;  3QAQ A;  3T1U A;  4JVS A;  1UJJ A;  1W8M A;  4AEZ C;  3S7F A;  4LCT A;  4Q94 A;  3ZIM A;  1V9T A;  2A2N A;  3BKP A;  4GB9 A;  4IRU A;  2IF4 A;  2LAH A;  4GU5 A;  4BTB A;  4KVM A;  4U8H A;  3K9I A;  4G11 A;  4CRW A;  2IJG X;  2ILR A;  3CVX A;  4FRU A;  2LAI A;  3R9A B;  5JJT A;  2YHE A;  4YND A;  4DGC A;  1JWG A;  2ION A;  4J5E X;  4H7Y A;  1M9Y A;  2PQN A;  2C0M A;  4XE0 A;  1M9X A;  2OVF A;  3CVW A;  5KUN A;  1E8K A;  4CDR A;  5KUZ A;  2IOL A;  2P58 C;  1CLH A;  3PEU B;  3G2W A;  4I9Y A;  4A1G A;  3OPF A;  3P1U A;  5FQ6 A;  3SBT B;  4JHK A;  5LOZ A;  3ZEF A;  2Z6W A;  3D9I A;  3TG5 A;  3ZVV A;  5BNW A;  2ZU6 B;  4XKC A;  4DLO A;  1OWP A;  2AWI A;  4MLP A;  1AWQ A;  4J5A X;  1HFA A;  5EKQ D;  4BX8 A;  4L7T A;  4L2Y A;  4I6E A;  2HQ6 A;  2KAT A;  1IQU A;  3E4B A;  4G23 A;  5FWQ A;  5JJ6 A;  4K03 A;  2PLU A;  1H6K A;  3RO2 A;  5BV0 A;  2WXR A;  3FEX A;  3KAE A;  5D0O D;  2LNI A;  5FZR A;  3U3W A;  1CWB A;  3Q47 B;  3IKO B;  4J8F A;  5FZQ A;  2NSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...