1A6FA

Rnase p protein from bacillus subtilis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords RIBONUCLEASE P PROTEIN
publication title Ribonuclease P protein structure: evolutionary origins in the translational apparatus.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 38
structure length 113
sequence length 113
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 1998-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1a6fA00
2UUBI 1H73A 2E1RA 4DU8A 1ZXNA 4DR1E 1RR9A 3ZZTA 5BR8E 4X66I 4HACA 3T1YE 3ZKDA 4LFCE 3WU6A 3H4LA 4HY1A 2DEJA 2WW4A 1NHHA 4JI0I 2UUAE 5FLXQ 1NHIA 2UXDI 3ZZ0A 4DR6E 1Z0EA 4JI0E 1ELOA 2F4VE 2OI2A 3PYFA 1WUUA 4DV6I 2HFSA 3ZKBA 1UEKA 2V8PA 4X64I 2R3VA 1N32I 1ZM9A 4NXME 4MYUA 3T1HE 1DARA 4LF5I 5GMDA 4DV2E 3ZZUA 1OJ4A 4JI6E 4JYAI 1HNWE 1Z0GA 4B3TI 1N34I 2ZM6I 4LFBE 2X7IA 5IWAI 4DV7I 2R42A 4JI2E 2ZITA 4DPYA 4GKKI 4DUZE 5IT9Q 4DPWA 4URLA 5IWAE 2HK3A 2HK2A 1Z5AA 4JV5I 4DV7E 2DEIA 4X65I 3HULA 3V2UC 4YY3I 3B8HA 1IBKE 2HHHI 3K17A 1H74A 1FJGE 4WUCA 1S4EA 1ZM2A 4B3MI 5A2QQ 4DV4E 1HR0E 3WU4A 4YY3E 3WU5A 1Z59A 1EI1A 2HHHE 1KTVA 4MYTA 3M6AA 4LF9E 4B3ME 2V2QA 4WUBA 4KHPE 4GKJE 1RREA 4LF4E 4AQYI 4JI8I 5LMNI 4LF6I 1ZXMA 1XNQE 4AQYE 4JI8E 1Z0TA 4R1FA 1ZM4A 1H7UA 3J80Q 1QZRA 3T1YI 1HNZI 4LFCI 4PRVA 4FWHA 4PRXA 1N36E 4XTJA 4USMA 4P52A 4PU9A 1J5EI 3B78A 1HNZE 2UUAI 4X62I 2NPFA 3PYGA 2LJPA 1J5EE 4DR6I 1PIEA 4B3SE 2F4VI 4X62E 4DR4I 3QT5A 4DR5I 1FKAE 1PVGA 1FWKA 4NXMI 4K0KE 2UU9E 4OX9E 3Q1QA 3T1HI 3J81C 2E5LE 3WU3A 3JAMQ 4DR4E 3PYDA 4DV2I 4JI6I 2BM1A 4DR5E 5LMUE 4ED4A 1HNWI 3F0NA 4FW9A 1FWLA 4LFBI 4YHHE 2V2VA 4JI2I 3J7AM 4DUZI 4DV0E 3D4JA 2HKJA 1S16A 4USKA 3J80C 4DR7I 4UTGA 1U2RA 4DU7A 3B82A 2VF3A 1IBKI 1XNRE 1XMQE 2EFGA 1H7SA 1PKPA 1FJGI 3LNUA 1MU5A 4DR7E 3OTOE 4DV4I 1HR0I 1N0UA 1A6FA 1EA6A 4JI5E 3LTOA 2BV3A 4LF9I 4KHPI 4GKJI 1IBLI 4LF4I 2VQEE 1I94I 5LL6R 5FLXC 4UT4A 3J7AG 1Z0CA 3QT8A 1XNQI 1N33I 1Z0VA 4LF8E 4B3RE 1IBLE 1I94E 4DV5I 3JAMC 4DUYE 2UXBE 3CWVA 1N33E 4JI7E 3ZM7A 2A2DA 4DV5E 4JI1E 4DV3I 1K47A 1N36I 1XMOE 4LFAE 4DV1E 2Q2EB 4DV3E 1B62A 2HKEA 2HFUA 4DR2E 4JI4E 1HNXE 4B3SI 4NXNE 1IBME 1FI4A 4JI3I 5IT9C 4I3HA 2UXCE 4M1KA 4K0KI 2UU9I 4OX9I 4FN5A 2E5LI 4JI3E 1MG7A 1D6TA 3K1JA 2ZBKB 3QT6A 5LMUI 2UUBE 2AJ4A 3LPSA 5A2QC 2A2CA 4Z7CA 2VQFI 4X66E 4YHHI 4DPXA 1XHKA 1NZ0A 3V5RA 1NHJA 2J7KA 1Z0BA 4DV0I 1KVKA 1Z5CA 4RPFA 2VQFE 4P7AA 4HYMA 4LF7I 2UXDE 1VISA 4ZVIA 5L3JA 3PYEA 4KQVA 1XMQI 1XNRI 4LF7E 4DV6E 3GONA 4Z7YA 3OTOI 4X64E 1N32E 4DPTA 2V34A 1KKHA 4JI5I 4LF5E 3QT7A 4JYAE 2VQEI 4WUDA 2GS8A 4DR3I 1Z5BA 2UUCI 4B3TE 4LF8I 2XEXA 1N34E 4B3RI 2ZM6E 2X36A 4DXLA 4HACB 1ZM3A 4DR3E 4DUYI 4JG4A 1MX0A 2UXBI 4GKKE 2UUCE 1KIJA 4JI7I 4JI1I 4JV5E 2V2ZA 1Z0WA 4X65E 5GMEA 4FWDA 1XMOI 3J81Q 4LFAI 4FWGA 4DV1I 4HXZA 1H72C 1FNMA 4DR2I 1N0VC 2CZ9A 4JI4I 1B63A 4NXNI 1HNXI 1IBMI 2UXCI 5LMNE 4LF6E 4DPUA 2BM0A 1BKNA 4EMDA 4DR1I 5BR8I
chains in the Genus database with same CATH superfamily
2UUBI 3P3GA 1H73A 2IESA 3M85D 2E1RA 1OYPA 4DU8A 1ZXNA 2BR2A 4DR1E 3Q6MA 1RR9A 3ZZTA 5BR8E 4X66I 4HACA 1R6LA 3T1YE 3ZKDA 4LFCE 2Z5EA 1E3PA 4IZKB 3WU6A 4OZEA 3H4LA 4HY1A 3H1CA 2DEJA 2WW4A 3U1YA 1NHHA 1USUA 4JI0I 2BA1D 2UUAE 2GO4A 5FLXQ 4BA2B 5C0XA 1NHIA 2UXDI 1OYRA 4FW6A 3ZZ0A 3P3CA 2PO1A 4DR6E 5DNLA 2WNRA 2CVEA 1Z0EA 4JI0E 1ELOA 2NN6A 4LCHA 2F4VE 2OI2A 3PYFA 1WUUA 4DV6I 2HFSA 3PS1A 3ZKBA 3P06A 1UEKA 2V8PA 4X64I 2C39A 2R3VA 5K36A 1N32I 1ZM9A 4NXME 4MYUA 3T1HE 1DARA 3U1KA 4LF5I 5GMDA 4DV2E 3ZZUA 1OJ4A 4JI6E 4JYAI 2IERA 2PO0A 1HNWE 2GO3A 1Z0GA 1OYSA 4GQUA 4B3TI 1N34I 1UDQA 2ZM6I 4LFBE 1HK7A 2X7IA 4BA1B 4OO1C 5IWAI 4DV7I 2R42A 2PNLA 4JI2E 2ZITA 4DPYA 4GKKI 4DUZE 5IT9Q 2BA0D 2O3ZA 4DPWA 4URLA 4IZKA 1UDOA 5IWAE 2HK3A 2HK2A 1Z5AA 2NN6C 4MU1A 4NBQA 4JV5I 4DV7E 2DEIA 3L7ZA 4X65I 2WP8A 3HULA 3V2UC 5ELWA 4YY3I 3B8HA 1IBKE 2HHHI 5K36C 3K17A 4BA2A 1H74A 1FJGE 4WUCA 1S4EA 1ZM2A 3P3EA 4B3MI 5A2QQ 4DV4E 1HR0E 3WU4A 2PNMA 4YY3E 3WU5A 1Z59A 4MDTA 1EI1A 2HHHE 1KTVA 4MYTA 3M6AA 4LF9E 4B3ME 2V2QA 4FW3A 3K85A 4WUBA 4KHPE 4GKJE 1RREA 4LF4E 4AQYI 4JI8I 5LMNI 1YH8A 4LF6I 2IOPA 3PRYA 1ZXMA 1XNQE 5JEAC 2O1UA 4AQYE 4JI8E 1Z0TA 4R1FA 1ZM4A 1H7UA 3J80Q 4OO1E 1QZRA 4QNKA 3GMEA 3T1YI 1HNZI 1P42A 2Z5BB 4LFCI 4PRVA 4FWHA 3GLLA 4PRXA 4MQYA 4XTJA 1N36E 4USMA 4P52A 4PU9A 1J5EI 2C38B 3M7ND 3B78A 1Y60A 1HNZE 2UUAI 2BA0G 1RHYA 4X62I 2NPFA 3PYGA 2LJPA 4IFDC 2IOQA 1J5EE 4FW5A 4DR6I 4FW4A 1PIEA 4B3SE 2F4VI 1YHCA 4X62E 4DR4I 1Y4SA 4N3OA 3QT5A 5DRRA 4DR5I 1FKAE 1PVGA 1FWKA 4NXMI 4K0KE 2JT2A 2UU9E 4OX9E 3Q1QA 3T1HI 3J81C 2E5LE 3WU3A 3JAMQ 4DR4E 3PYDA 4DV2I 4JI6I 2BM1A 4DR5E 3DD6A 2C37B 5LMUE 4OO1D 4ED4A 1HNWI 4LCGA 3F0NA 1Y6ZA 4FW9A 1FWLA 4LFBI 4YHHE 2V2VA 4IZJB 5DNXA 2CG9A 1USVA 4JI2I 3J7AM 4OO1F 4DUZI 1UDNA 4DV0E 2JEBA 2Z5BA 3D4JA 2HKJA 1S16A 4USKA 3J80C 4DR7I 4UTGA 5C0XC 1U2RA 2C38A 1Y4UA 3M85G 4DU7A 3B82A 2VF3A 1IBKI 1XNRE 1XMQE 2EFGA 1H7SA 1PKPA 1FJGI 3M7NG 3LNUA 1MU5A 4DR7E 3OTOE 4DV4I 1HR0I 5DRQA 2CGEA 3GCMA 1N0UA 4MU3A 5FWKA 1A6FA 5DRPA 1EA6A 4JI5E 3LTOA 2BV3A 4LF9I 2BA1G 4KHPI 4GKJI 1IBLI 4LF4I 2VQEE 1I94I 5LL6R 2Z5CB 5FLXC 3CDJA 4UT4A 3J7AG 1Z0CA 3QT8A 1XNQI 1N33I 1Z0VA 5DROA 2C37A 4LF8E 4B3RE 1IBLE 1I94E 2JE6B 5JEAF 4OO1B 3HKMA 4DV5I 3JAMC 4DUYE 1VI7A 4LCFA 2UXBE 1E3HA 4AIDA 3CWVA 1N33E 2VESA 4JI7E 4IZJA 3ZM7A 4IZJD 2A2DA 4DV5E 2NN6B 4JI1E 4DV3I 1K47A 1N36I 1XMOE 4LFAE 4J3DA 4BA1A 4DV1E 5K36B 5C0XE 2Q2EB 4DV3E 1B62A 2O1VA 2JEAB 2HKEA 2HFUA 4DR2E 2NN6E 4JI4E 1HNXE 1Y5YA 4B3SI 1IBME 1FI4A 4NXNE 4JI3I 5IT9C 5K36E 4I3HA 3KRNA 2UXCE 4M1KA 3PS2A 4K0KI 2UU9I 4OX9I 4FN5A 2E5LI 4JI3E 1MG7A 1D6TA 5JEAB 3K1JA 2AE8A 2ZBKB 2Z5CA 3QT6A 5LMUI 4AM3A 2UUBE 2AJ4A 3LPSA 5A2QC 2A2CA 3L7ZB 2PO2B 2O1WA 2WP8B 4Z7CA 2VQFI 2JE6A 4OO1A 4X66E 3NZKA 4YHHI 4DPXA 1XHKA 1NZ0A 3V5RA 5JEAE 1NHJA 5C0XD 2J7KA 1Z0BA 4DV0I 1KVKA 1Z5CA 4RPFA 2VQFE 4P7AA 4HYMA 2NN6D 3HJCA 4LF7I 2UXDE 1VISA 4ZVIA 5L3JA 4IFDB 4MU0A 3PYEA 5C0XF 4KQVA 1XMQI 1XNRI 5K36D 4LF7E 4DV6E 3GONA 2JEAA 2O1TA 4Z7YA 3OTOI 4QNJA 2NN6F 3PS3A 1XXEA 4X64E 1N32E 4DPTA 2V34A 1KKHA 4JI5I 4IFDE 5K36F 4LF5E 2PNZB 3QT7A 4JYAE 2VQEI 4WUDA 2GS8A 3UHMA 4DR3I 3P76A 4AIMA 5JEAA 5EKWA 1Z5BA 5JEAD 1R6MA 2UUCI 4B3TE 4LF8I 2XEXA 1N34E 2BR2B 4B3RI 4U3DA 4LPFA 2ZM6E 2X36A 3B4TA 4DXLA 4HACB 1ZM3A 4U3BA 4DR3E 4DUYI 4JG4A 2PO2A 1MX0A 2UXBI 4GKKE 2UUCE 1KIJA 4JI7I 4MU4A 1UDSA 4JI1I 4JV5E 2V2ZA 1Z0WA 4X65E 5GMEA 4FWDA 5C0XB 1XMOI 3J81Q 4LFAI 4FWGA 3Q6NA 2PO1B 4DV1I 2WNRB 4HXZA 1H72C 4LOMA 4IFDA 4IFDD 5EL9A 1FNMA 4DR2I 1N0VC 2CZ9A 2C39B 4JI4I 1B63A 4NXNI 1HNXI 1IBMI 4FW7A 4ISAA 2GQ0A 2F1DA 4IS9A 2UXCI 5LMNE 4LF6E 2J65A 4IFDF 4DPUA 3CDIA 2PO0B 4OKGA 2BM0A 1BKNA 4EMDA 2PNZA 4DR1I 5BR8I 2JEBB
chains in the Genus database with same CATH topology
2UUBI 1H73A 2E1RA 4DU8A 1ZXNA 4DR1E 3Q6MA 1RR9A 3ZZTA 5BR8E 4X66I 4HACA 3T1YE 3ZKDA 4LFCE 2Z5EA 4IZKB 3WU6A 3H4LA 4HY1A 2DEJA 2WW4A 1NHHA 1USUA 4JI0I 2UUAE 5FLXQ 1NHIA 2UXDI 3ZZ0A 4DR6E 1Z0EA 4JI0E 1ELOA 2F4VE 2OI2A 3PYFA 1WUUA 4DV6I 2HFSA 3ZKBA 3P06A 1UEKA 2V8PA 4X64I 2R3VA 1N32I 1ZM9A 4NXME 4MYUA 3T1HE 1DARA 4LF5I 5GMDA 4DV2E 3ZZUA 1OJ4A 4JI6E 4JYAI 1HNWE 1Z0GA 4B3TI 1N34I 2ZM6I 4LFBE 1HK7A 2X7IA 5IWAI 4DV7I 2R42A 2PNLA 4JI2E 2ZITA 4DPYA 4GKKI 4DUZE 5IT9Q 4DPWA 4URLA 4IZKA 5IWAE 2HK3A 2HK2A 1Z5AA 4JV5I 4DV7E 2DEIA 4X65I 3HULA 3V2UC 4YY3I 3B8HA 1IBKE 2HHHI 3K17A 1H74A 1FJGE 4WUCA 1S4EA 1ZM2A 4B3MI 5A2QQ 4DV4E 1HR0E 3WU4A 2PNMA 4YY3E 3WU5A 1Z59A 1EI1A 2HHHE 1KTVA 4MYTA 3M6AA 4LF9E 4B3ME 2V2QA 3K85A 4WUBA 4KHPE 4GKJE 1RREA 4LF4E 4AQYI 4JI8I 5LMNI 4LF6I 2IOPA 3PRYA 1ZXMA 1XNQE 2O1UA 4AQYE 4JI8E 1Z0TA 4R1FA 1ZM4A 1H7UA 3J80Q 1QZRA 3T1YI 1HNZI 4LFCI 2Z5BB 4PRVA 4FWHA 4PRXA 1N36E 4XTJA 4USMA 4P52A 4PU9A 1J5EI 3B78A 1HNZE 2UUAI 4X62I 2NPFA 3PYGA 2LJPA 2IOQA 1J5EE 4DR6I 1PIEA 4B3SE 2F4VI 4X62E 4DR4I 1Y4SA 4N3OA 3QT5A 4DR5I 1FKAE 1PVGA 1FWKA 4NXMI 4K0KE 2UU9E 4OX9E 3Q1QA 3T1HI 3J81C 2E5LE 3WU3A 3JAMQ 4DR4E 3PYDA 4DV2I 4JI6I 2BM1A 4DR5E 5LMUE 4ED4A 1HNWI 3F0NA 1Y6ZA 4FW9A 1FWLA 4LFBI 4YHHE 2V2VA 4IZJB 2CG9A 1USVA 4JI2I 3J7AM 4DUZI 4DV0E 2Z5BA 3D4JA 2HKJA 1S16A 4USKA 3J80C 4DR7I 4UTGA 1U2RA 1Y4UA 4DU7A 3B82A 2VF3A 1IBKI 1XNRE 1XMQE 2EFGA 1H7SA 1PKPA 1FJGI 3LNUA 1MU5A 4DR7E 3OTOE 4DV4I 1HR0I 2CGEA 1N0UA 5FWKA 1A6FA 1EA6A 4JI5E 3LTOA 2BV3A 4LF9I 4KHPI 4GKJI 1IBLI 4LF4I 2VQEE 1I94I 5LL6R 2Z5CB 5FLXC 4UT4A 3J7AG 1Z0CA 3QT8A 1XNQI 1N33I 1Z0VA 4LF8E 4B3RE 1IBLE 1I94E 4DV5I 3JAMC 4DUYE 2UXBE 3CWVA 1N33E 4JI7E 4IZJA 3ZM7A 4IZJD 2A2DA 4DV5E 4JI1E 4DV3I 1K47A 1N36I 1XMOE 4LFAE 4DV1E 2Q2EB 4DV3E 1B62A 2O1VA 2HKEA 2HFUA 4DR2E 4JI4E 1HNXE 4B3SI 4NXNE 1IBME 1FI4A 4JI3I 5IT9C 4I3HA 2UXCE 4M1KA 4K0KI 2UU9I 4OX9I 4FN5A 2E5LI 4JI3E 1MG7A 1D6TA 3K1JA 2ZBKB 2Z5CA 3QT6A 5LMUI 2UUBE 2AJ4A 3LPSA 5A2QC 2A2CA 2O1WA 4Z7CA 2VQFI 4X66E 4YHHI 4DPXA 1XHKA 1NZ0A 3V5RA 1NHJA 2J7KA 1Z0BA 4DV0I 1KVKA 1Z5CA 4RPFA 2VQFE 4P7AA 4HYMA 3HJCA 4LF7I 2UXDE 1VISA 4ZVIA 5L3JA 3PYEA 4KQVA 1XMQI 1XNRI 4LF7E 4DV6E 3GONA 2O1TA 4Z7YA 3OTOI 4X64E 1N32E 4DPTA 2V34A 1KKHA 4JI5I 4LF5E 3QT7A 4JYAE 2VQEI 4WUDA 2GS8A 4DR3I 1Z5BA 2UUCI 4B3TE 4LF8I 2XEXA 1N34E 4B3RI 2ZM6E 2X36A 4DXLA 4HACB 1ZM3A 4DR3E 4DUYI 4JG4A 1MX0A 2UXBI 4GKKE 2UUCE 1KIJA 4JI7I 4JI1I 4JV5E 2V2ZA 1Z0WA 4X65E 5GMEA 4FWDA 1XMOI 3J81Q 4LFAI 4FWGA 3Q6NA 4DV1I 4HXZA 1H72C 1FNMA 4DR2I 1N0VC 2CZ9A 4JI4I 1B63A 4NXNI 1HNXI 1IBMI 2GQ0A 2UXCI 5LMNE 4LF6E 4DPUA 2BM0A 1BKNA 4EMDA 4DR1I 5BR8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB I;  1H73 A;  2E1R A;  4DU8 A;  1ZXN A;  4DR1 E;  1RR9 A;  3ZZT A;  5BR8 E;  4X66 I;  4HAC A;  3T1Y E;  3ZKD A;  4LFC E;  3WU6 A;  3H4L A;  4HY1 A;  2DEJ A;  2WW4 A;  1NHH A;  4JI0 I;  2UUA E;  5FLX Q;  1NHI A;  2UXD I;  3ZZ0 A;  4DR6 E;  1Z0E A;  4JI0 E;  1ELO A;  2F4V E;  2OI2 A;  3PYF A;  1WUU A;  4DV6 I;  2HFS A;  3ZKB A;  1UEK A;  2V8P A;  4X64 I;  2R3V A;  1N32 I;  1ZM9 A;  4NXM E;  4MYU A;  3T1H E;  1DAR A;  4LF5 I;  5GMD A;  4DV2 E;  3ZZU A;  1OJ4 A;  4JI6 E;  4JYA I;  1HNW E;  1Z0G A;  4B3T I;  1N34 I;  2ZM6 I;  4LFB E;  2X7I A;  5IWA I;  4DV7 I;  2R42 A;  4JI2 E;  2ZIT A;  4DPY A;  4GKK I;  4DUZ E;  5IT9 Q;  4DPW A;  4URL A;  5IWA E;  2HK3 A;  2HK2 A;  1Z5A A;  4JV5 I;  4DV7 E;  2DEI A;  4X65 I;  3HUL A;  3V2U C;  4YY3 I;  3B8H A;  1IBK E;  2HHH I;  3K17 A;  1H74 A;  1FJG E;  4WUC A;  1S4E A;  1ZM2 A;  4B3M I;  5A2Q Q;  4DV4 E;  1HR0 E;  3WU4 A;  4YY3 E;  3WU5 A;  1Z59 A;  1EI1 A;  2HHH E;  1KTV A;  4MYT A;  3M6A A;  4LF9 E;  4B3M E;  2V2Q A;  4WUB A;  4KHP E;  4GKJ E;  1RRE A;  4LF4 E;  4AQY I;  4JI8 I;  5LMN I;  4LF6 I;  1ZXM A;  1XNQ E;  4AQY E;  4JI8 E;  1Z0T A;  4R1F A;  1ZM4 A;  1H7U A;  3J80 Q;  1QZR A;  3T1Y I;  1HNZ I;  4LFC I;  4PRV A;  4FWH A;  4PRX A;  1N36 E;  4XTJ A;  4USM A;  4P52 A;  4PU9 A;  1J5E I;  3B78 A;  1HNZ E;  2UUA I;  4X62 I;  2NPF A;  3PYG A;  2LJP A;  1J5E E;  4DR6 I;  1PIE A;  4B3S E;  2F4V I;  4X62 E;  4DR4 I;  3QT5 A;  4DR5 I;  1FKA E;  1PVG A;  1FWK A;  4NXM I;  4K0K E;  2UU9 E;  4OX9 E;  3Q1Q A;  3T1H I;  3J81 C;  2E5L E;  3WU3 A;  3JAM Q;  4DR4 E;  3PYD A;  4DV2 I;  4JI6 I;  2BM1 A;  4DR5 E;  5LMU E;  4ED4 A;  1HNW I;  3F0N A;  4FW9 A;  1FWL A;  4LFB I;  4YHH E;  2V2V A;  4JI2 I;  3J7A M;  4DUZ I;  4DV0 E;  3D4J A;  2HKJ A;  1S16 A;  4USK A;  3J80 C;  4DR7 I;  4UTG A;  1U2R A;  4DU7 A;  3B82 A;  2VF3 A;  1IBK I;  1XNR E;  1XMQ E;  2EFG A;  1H7S A;  1PKP A;  1FJG I;  3LNU A;  1MU5 A;  4DR7 E;  3OTO E;  4DV4 I;  1HR0 I;  1N0U A;  1A6F A;  1EA6 A;  4JI5 E;  3LTO A;  2BV3 A;  4LF9 I;  4KHP I;  4GKJ I;  1IBL I;  4LF4 I;  2VQE E;  1I94 I;  5LL6 R;  5FLX C;  4UT4 A;  3J7A G;  1Z0C A;  3QT8 A;  1XNQ I;  1N33 I;  1Z0V A;  4LF8 E;  4B3R E;  1IBL E;  1I94 E;  4DV5 I;  3JAM C;  4DUY E;  2UXB E;  3CWV A;  1N33 E;  4JI7 E;  3ZM7 A;  2A2D A;  4DV5 E;  4JI1 E;  4DV3 I;  1K47 A;  1N36 I;  1XMO E;  4LFA E;  4DV1 E;  2Q2E B;  4DV3 E;  1B62 A;  2HKE A;  2HFU A;  4DR2 E;  4JI4 E;  1HNX E;  4B3S I;  4NXN E;  1IBM E;  1FI4 A;  4JI3 I;  5IT9 C;  4I3H A;  2UXC E;  4M1K A;  4K0K I;  2UU9 I;  4OX9 I;  4FN5 A;  2E5L I;  4JI3 E;  1MG7 A;  1D6T A;  3K1J A;  2ZBK B;  3QT6 A;  5LMU I;  2UUB E;  2AJ4 A;  3LPS A;  5A2Q C;  2A2C A;  4Z7C A;  2VQF I;  4X66 E;  4YHH I;  4DPX A;  1XHK A;  1NZ0 A;  3V5R A;  1NHJ A;  2J7K A;  1Z0B A;  4DV0 I;  1KVK A;  1Z5C A;  4RPF A;  2VQF E;  4P7A A;  4HYM A;  4LF7 I;  2UXD E;  1VIS A;  4ZVI A;  5L3J A;  3PYE A;  4KQV A;  1XMQ I;  1XNR I;  4LF7 E;  4DV6 E;  3GON A;  4Z7Y A;  3OTO I;  4X64 E;  1N32 E;  4DPT A;  2V34 A;  1KKH A;  4JI5 I;  4LF5 E;  3QT7 A;  4JYA E;  2VQE I;  4WUD A;  2GS8 A;  4DR3 I;  1Z5B A;  2UUC I;  4B3T E;  4LF8 I;  2XEX A;  1N34 E;  4B3R I;  2ZM6 E;  2X36 A;  4DXL A;  4HAC B;  1ZM3 A;  4DR3 E;  4DUY I;  4JG4 A;  1MX0 A;  2UXB I;  4GKK E;  2UUC E;  1KIJ A;  4JI7 I;  4JI1 I;  4JV5 E;  2V2Z A;  1Z0W A;  4X65 E;  5GME A;  4FWD A;  1XMO I;  3J81 Q;  4LFA I;  4FWG A;  4DV1 I;  4HXZ A;  1H72 C;  1FNM A;  4DR2 I;  1N0V C;  2CZ9 A;  4JI4 I;  1B63 A;  4NXN I;  1HNX I;  1IBM I;  2UXC I;  5LMN E;  4LF6 E;  4DPU A;  2BM0 A;  1BKN A;  4EMD A;  4DR1 I;  5BR8 I; 
#chains in the Genus database with same CATH topology
 2UUB I;  3P3G A;  1H73 A;  2IES A;  3M85 D;  2E1R A;  1OYP A;  4DU8 A;  1ZXN A;  2BR2 A;  4DR1 E;  3Q6M A;  1RR9 A;  3ZZT A;  5BR8 E;  4X66 I;  4HAC A;  1R6L A;  3T1Y E;  3ZKD A;  4LFC E;  2Z5E A;  1E3P A;  4IZK B;  3WU6 A;  4OZE A;  3H4L A;  4HY1 A;  3H1C A;  2DEJ A;  2WW4 A;  3U1Y A;  1NHH A;  1USU A;  4JI0 I;  2BA1 D;  2UUA E;  2GO4 A;  5FLX Q;  4BA2 B;  5C0X A;  1NHI A;  2UXD I;  1OYR A;  4FW6 A;  3ZZ0 A;  3P3C A;  2PO1 A;  4DR6 E;  5DNL A;  2WNR A;  2CVE A;  1Z0E A;  4JI0 E;  1ELO A;  2NN6 A;  4LCH A;  2F4V E;  2OI2 A;  3PYF A;  1WUU A;  4DV6 I;  2HFS A;  3PS1 A;  3ZKB A;  3P06 A;  1UEK A;  2V8P A;  4X64 I;  2C39 A;  2R3V A;  5K36 A;  1N32 I;  1ZM9 A;  4NXM E;  4MYU A;  3T1H E;  1DAR A;  3U1K A;  4LF5 I;  5GMD A;  4DV2 E;  3ZZU A;  1OJ4 A;  4JI6 E;  4JYA I;  2IER A;  2PO0 A;  1HNW E;  2GO3 A;  1Z0G A;  1OYS A;  4GQU A;  4B3T I;  1N34 I;  1UDQ A;  2ZM6 I;  4LFB E;  1HK7 A;  2X7I A;  4BA1 B;  4OO1 C;  5IWA I;  4DV7 I;  2R42 A;  2PNL A;  4JI2 E;  2ZIT A;  4DPY A;  4GKK I;  4DUZ E;  5IT9 Q;  2BA0 D;  2O3Z A;  4DPW A;  4URL A;  4IZK A;  1UDO A;  5IWA E;  2HK3 A;  2HK2 A;  1Z5A A;  2NN6 C;  4MU1 A;  4NBQ A;  4JV5 I;  4DV7 E;  2DEI A;  3L7Z A;  4X65 I;  2WP8 A;  3HUL A;  3V2U C;  5ELW A;  4YY3 I;  3B8H A;  1IBK E;  2HHH I;  5K36 C;  3K17 A;  4BA2 A;  1H74 A;  1FJG E;  4WUC A;  1S4E A;  1ZM2 A;  3P3E A;  4B3M I;  5A2Q Q;  4DV4 E;  1HR0 E;  3WU4 A;  2PNM A;  4YY3 E;  3WU5 A;  1Z59 A;  4MDT A;  1EI1 A;  2HHH E;  1KTV A;  4MYT A;  3M6A A;  4LF9 E;  4B3M E;  2V2Q A;  4FW3 A;  3K85 A;  4WUB A;  4KHP E;  4GKJ E;  1RRE A;  4LF4 E;  4AQY I;  4JI8 I;  5LMN I;  1YH8 A;  4LF6 I;  2IOP A;  3PRY A;  1ZXM A;  1XNQ E;  5JEA C;  2O1U A;  4AQY E;  4JI8 E;  1Z0T A;  4R1F A;  1ZM4 A;  1H7U A;  3J80 Q;  4OO1 E;  1QZR A;  4QNK A;  3GME A;  3T1Y I;  1HNZ I;  1P42 A;  2Z5B B;  4LFC I;  4PRV A;  4FWH A;  3GLL A;  4PRX A;  4MQY A;  4XTJ A;  1N36 E;  4USM A;  4P52 A;  4PU9 A;  1J5E I;  2C38 B;  3M7N D;  3B78 A;  1Y60 A;  1HNZ E;  2UUA I;  2BA0 G;  1RHY A;  4X62 I;  2NPF A;  3PYG A;  2LJP A;  4IFD C;  2IOQ A;  1J5E E;  4FW5 A;  4DR6 I;  4FW4 A;  1PIE A;  4B3S E;  2F4V I;  1YHC A;  4X62 E;  4DR4 I;  1Y4S A;  4N3O A;  3QT5 A;  5DRR A;  4DR5 I;  1FKA E;  1PVG A;  1FWK A;  4NXM I;  4K0K E;  2JT2 A;  2UU9 E;  4OX9 E;  3Q1Q A;  3T1H I;  3J81 C;  2E5L E;  3WU3 A;  3JAM Q;  4DR4 E;  3PYD A;  4DV2 I;  4JI6 I;  2BM1 A;  4DR5 E;  3DD6 A;  2C37 B;  5LMU E;  4OO1 D;  4ED4 A;  1HNW I;  4LCG A;  3F0N A;  1Y6Z A;  4FW9 A;  1FWL A;  4LFB I;  4YHH E;  2V2V A;  4IZJ B;  5DNX A;  2CG9 A;  1USV A;  4JI2 I;  3J7A M;  4OO1 F;  4DUZ I;  1UDN A;  4DV0 E;  2JEB A;  2Z5B A;  3D4J A;  2HKJ A;  1S16 A;  4USK A;  3J80 C;  4DR7 I;  4UTG A;  5C0X C;  1U2R A;  2C38 A;  1Y4U A;  3M85 G;  4DU7 A;  3B82 A;  2VF3 A;  1IBK I;  1XNR E;  1XMQ E;  2EFG A;  1H7S A;  1PKP A;  1FJG I;  3M7N G;  3LNU A;  1MU5 A;  4DR7 E;  3OTO E;  4DV4 I;  1HR0 I;  5DRQ A;  2CGE A;  3GCM A;  1N0U A;  4MU3 A;  5FWK A;  1A6F A;  5DRP A;  1EA6 A;  4JI5 E;  3LTO A;  2BV3 A;  4LF9 I;  2BA1 G;  4KHP I;  4GKJ I;  1IBL I;  4LF4 I;  2VQE E;  1I94 I;  5LL6 R;  2Z5C B;  5FLX C;  3CDJ A;  4UT4 A;  3J7A G;  1Z0C A;  3QT8 A;  1XNQ I;  1N33 I;  1Z0V A;  5DRO A;  2C37 A;  4LF8 E;  4B3R E;  1IBL E;  1I94 E;  2JE6 B;  5JEA F;  4OO1 B;  3HKM A;  4DV5 I;  3JAM C;  4DUY E;  1VI7 A;  4LCF A;  2UXB E;  1E3H A;  4AID A;  3CWV A;  1N33 E;  2VES A;  4JI7 E;  4IZJ A;  3ZM7 A;  4IZJ D;  2A2D A;  4DV5 E;  2NN6 B;  4JI1 E;  4DV3 I;  1K47 A;  1N36 I;  1XMO E;  4LFA E;  4J3D A;  4BA1 A;  4DV1 E;  5K36 B;  5C0X E;  2Q2E B;  4DV3 E;  1B62 A;  2O1V A;  2JEA B;  2HKE A;  2HFU A;  4DR2 E;  2NN6 E;  4JI4 E;  1HNX E;  1Y5Y A;  4B3S I;  1IBM E;  1FI4 A;  4NXN E;  4JI3 I;  5IT9 C;  5K36 E;  4I3H A;  3KRN A;  2UXC E;  4M1K A;  3PS2 A;  4K0K I;  2UU9 I;  4OX9 I;  4FN5 A;  2E5L I;  4JI3 E;  1MG7 A;  1D6T A;  5JEA B;  3K1J A;  2AE8 A;  2ZBK B;  2Z5C A;  3QT6 A;  5LMU I;  4AM3 A;  2UUB E;  2AJ4 A;  3LPS A;  5A2Q C;  2A2C A;  3L7Z B;  2PO2 B;  2O1W A;  2WP8 B;  4Z7C A;  2VQF I;  2JE6 A;  4OO1 A;  4X66 E;  3NZK A;  4YHH I;  4DPX A;  1XHK A;  1NZ0 A;  3V5R A;  5JEA E;  1NHJ A;  5C0X D;  2J7K A;  1Z0B A;  4DV0 I;  1KVK A;  1Z5C A;  4RPF A;  2VQF E;  4P7A A;  4HYM A;  2NN6 D;  3HJC A;  4LF7 I;  2UXD E;  1VIS A;  4ZVI A;  5L3J A;  4IFD B;  4MU0 A;  3PYE A;  5C0X F;  4KQV A;  1XMQ I;  1XNR I;  5K36 D;  4LF7 E;  4DV6 E;  3GON A;  2JEA A;  2O1T A;  4Z7Y A;  3OTO I;  4QNJ A;  2NN6 F;  3PS3 A;  1XXE A;  4X64 E;  1N32 E;  4DPT A;  2V34 A;  1KKH A;  4JI5 I;  4IFD E;  5K36 F;  4LF5 E;  2PNZ B;  3QT7 A;  4JYA E;  2VQE I;  4WUD A;  2GS8 A;  3UHM A;  4DR3 I;  3P76 A;  4AIM A;  5JEA A;  5EKW A;  1Z5B A;  5JEA D;  1R6M A;  2UUC I;  4B3T E;  4LF8 I;  2XEX A;  1N34 E;  2BR2 B;  4B3R I;  4U3D A;  4LPF A;  2ZM6 E;  2X36 A;  3B4T A;  4DXL A;  4HAC B;  1ZM3 A;  4U3B A;  4DR3 E;  4DUY I;  4JG4 A;  2PO2 A;  1MX0 A;  2UXB I;  4GKK E;  2UUC E;  1KIJ A;  4JI7 I;  4MU4 A;  1UDS A;  4JI1 I;  4JV5 E;  2V2Z A;  1Z0W A;  4X65 E;  5GME A;  4FWD A;  5C0X B;  1XMO I;  3J81 Q;  4LFA I;  4FWG A;  3Q6N A;  2PO1 B;  4DV1 I;  2WNR B;  4HXZ A;  1H72 C;  4LOM A;  4IFD A;  4IFD D;  5EL9 A;  1FNM A;  4DR2 I;  1N0V C;  2CZ9 A;  2C39 B;  4JI4 I;  1B63 A;  4NXN I;  1HNX I;  1IBM I;  4FW7 A;  4ISA A;  2GQ0 A;  2F1D A;  4IS9 A;  2UXC I;  5LMN E;  4LF6 E;  2J65 A;  4IFD F;  4DPU A;  3CDI A;  2PO0 B;  4OKG A;  2BM0 A;  1BKN A;  4EMD A;  2PNZ A;  4DR1 I;  5BR8 I;  2JEB B; 
#chains in the Genus database with same CATH homology
 2UUB I;  1H73 A;  2E1R A;  4DU8 A;  1ZXN A;  4DR1 E;  3Q6M A;  1RR9 A;  3ZZT A;  5BR8 E;  4X66 I;  4HAC A;  3T1Y E;  3ZKD A;  4LFC E;  2Z5E A;  4IZK B;  3WU6 A;  3H4L A;  4HY1 A;  2DEJ A;  2WW4 A;  1NHH A;  1USU A;  4JI0 I;  2UUA E;  5FLX Q;  1NHI A;  2UXD I;  3ZZ0 A;  4DR6 E;  1Z0E A;  4JI0 E;  1ELO A;  2F4V E;  2OI2 A;  3PYF A;  1WUU A;  4DV6 I;  2HFS A;  3ZKB A;  3P06 A;  1UEK A;  2V8P A;  4X64 I;  2R3V A;  1N32 I;  1ZM9 A;  4NXM E;  4MYU A;  3T1H E;  1DAR A;  4LF5 I;  5GMD A;  4DV2 E;  3ZZU A;  1OJ4 A;  4JI6 E;  4JYA I;  1HNW E;  1Z0G A;  4B3T I;  1N34 I;  2ZM6 I;  4LFB E;  1HK7 A;  2X7I A;  5IWA I;  4DV7 I;  2R42 A;  2PNL A;  4JI2 E;  2ZIT A;  4DPY A;  4GKK I;  4DUZ E;  5IT9 Q;  4DPW A;  4URL A;  4IZK A;  5IWA E;  2HK3 A;  2HK2 A;  1Z5A A;  4JV5 I;  4DV7 E;  2DEI A;  4X65 I;  3HUL A;  3V2U C;  4YY3 I;  3B8H A;  1IBK E;  2HHH I;  3K17 A;  1H74 A;  1FJG E;  4WUC A;  1S4E A;  1ZM2 A;  4B3M I;  5A2Q Q;  4DV4 E;  1HR0 E;  3WU4 A;  2PNM A;  4YY3 E;  3WU5 A;  1Z59 A;  1EI1 A;  2HHH E;  1KTV A;  4MYT A;  3M6A A;  4LF9 E;  4B3M E;  2V2Q A;  3K85 A;  4WUB A;  4KHP E;  4GKJ E;  1RRE A;  4LF4 E;  4AQY I;  4JI8 I;  5LMN I;  4LF6 I;  2IOP A;  3PRY A;  1ZXM A;  1XNQ E;  2O1U A;  4AQY E;  4JI8 E;  1Z0T A;  4R1F A;  1ZM4 A;  1H7U A;  3J80 Q;  1QZR A;  3T1Y I;  1HNZ I;  4LFC I;  2Z5B B;  4PRV A;  4FWH A;  4PRX A;  1N36 E;  4XTJ A;  4USM A;  4P52 A;  4PU9 A;  1J5E I;  3B78 A;  1HNZ E;  2UUA I;  4X62 I;  2NPF A;  3PYG A;  2LJP A;  2IOQ A;  1J5E E;  4DR6 I;  1PIE A;  4B3S E;  2F4V I;  4X62 E;  4DR4 I;  1Y4S A;  4N3O A;  3QT5 A;  4DR5 I;  1FKA E;  1PVG A;  1FWK A;  4NXM I;  4K0K E;  2UU9 E;  4OX9 E;  3Q1Q A;  3T1H I;  3J81 C;  2E5L E;  3WU3 A;  3JAM Q;  4DR4 E;  3PYD A;  4DV2 I;  4JI6 I;  2BM1 A;  4DR5 E;  5LMU E;  4ED4 A;  1HNW I;  3F0N A;  1Y6Z A;  4FW9 A;  1FWL A;  4LFB I;  4YHH E;  2V2V A;  4IZJ B;  2CG9 A;  1USV A;  4JI2 I;  3J7A M;  4DUZ I;  4DV0 E;  2Z5B A;  3D4J A;  2HKJ A;  1S16 A;  4USK A;  3J80 C;  4DR7 I;  4UTG A;  1U2R A;  1Y4U A;  4DU7 A;  3B82 A;  2VF3 A;  1IBK I;  1XNR E;  1XMQ E;  2EFG A;  1H7S A;  1PKP A;  1FJG I;  3LNU A;  1MU5 A;  4DR7 E;  3OTO E;  4DV4 I;  1HR0 I;  2CGE A;  1N0U A;  5FWK A;  1A6F A;  1EA6 A;  4JI5 E;  3LTO A;  2BV3 A;  4LF9 I;  4KHP I;  4GKJ I;  1IBL I;  4LF4 I;  2VQE E;  1I94 I;  5LL6 R;  2Z5C B;  5FLX C;  4UT4 A;  3J7A G;  1Z0C A;  3QT8 A;  1XNQ I;  1N33 I;  1Z0V A;  4LF8 E;  4B3R E;  1IBL E;  1I94 E;  4DV5 I;  3JAM C;  4DUY E;  2UXB E;  3CWV A;  1N33 E;  4JI7 E;  4IZJ A;  3ZM7 A;  4IZJ D;  2A2D A;  4DV5 E;  4JI1 E;  4DV3 I;  1K47 A;  1N36 I;  1XMO E;  4LFA E;  4DV1 E;  2Q2E B;  4DV3 E;  1B62 A;  2O1V A;  2HKE A;  2HFU A;  4DR2 E;  4JI4 E;  1HNX E;  4B3S I;  4NXN E;  1IBM E;  1FI4 A;  4JI3 I;  5IT9 C;  4I3H A;  2UXC E;  4M1K A;  4K0K I;  2UU9 I;  4OX9 I;  4FN5 A;  2E5L I;  4JI3 E;  1MG7 A;  1D6T A;  3K1J A;  2ZBK B;  2Z5C A;  3QT6 A;  5LMU I;  2UUB E;  2AJ4 A;  3LPS A;  5A2Q C;  2A2C A;  2O1W A;  4Z7C A;  2VQF I;  4X66 E;  4YHH I;  4DPX A;  1XHK A;  1NZ0 A;  3V5R A;  1NHJ A;  2J7K A;  1Z0B A;  4DV0 I;  1KVK A;  1Z5C A;  4RPF A;  2VQF E;  4P7A A;  4HYM A;  3HJC A;  4LF7 I;  2UXD E;  1VIS A;  4ZVI A;  5L3J A;  3PYE A;  4KQV A;  1XMQ I;  1XNR I;  4LF7 E;  4DV6 E;  3GON A;  2O1T A;  4Z7Y A;  3OTO I;  4X64 E;  1N32 E;  4DPT A;  2V34 A;  1KKH A;  4JI5 I;  4LF5 E;  3QT7 A;  4JYA E;  2VQE I;  4WUD A;  2GS8 A;  4DR3 I;  1Z5B A;  2UUC I;  4B3T E;  4LF8 I;  2XEX A;  1N34 E;  4B3R I;  2ZM6 E;  2X36 A;  4DXL A;  4HAC B;  1ZM3 A;  4DR3 E;  4DUY I;  4JG4 A;  1MX0 A;  2UXB I;  4GKK E;  2UUC E;  1KIJ A;  4JI7 I;  4JI1 I;  4JV5 E;  2V2Z A;  1Z0W A;  4X65 E;  5GME A;  4FWD A;  1XMO I;  3J81 Q;  4LFA I;  4FWG A;  3Q6N A;  4DV1 I;  4HXZ A;  1H72 C;  1FNM A;  4DR2 I;  1N0V C;  2CZ9 A;  4JI4 I;  1B63 A;  4NXN I;  1HNX I;  1IBM I;  2GQ0 A;  2UXC I;  5LMN E;  4LF6 E;  4DPU A;  2BM0 A;  1BKN A;  4EMD A;  4DR1 I;  5BR8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...