1A6FA

Rnase p protein from bacillus subtilis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribonuclease P protein structure: evolutionary origins in the translational apparatus.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Endonuclease
molecule keywords RIBONUCLEASE P PROTEIN
total genus 38
structure length 113
sequence length 113
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 1998-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1a6fA00
5BR8I 4LFCI 4XTJA 4X65E 3CWVA 1HNWI 4LF9E 4YHHE 2LJPA 4JI2I 2UXCI 2UXBI 2E1RA 5L3JA 2UU9I 4DV4E 2R42A 1N36I 4GKJE 1Z0WA 5LMUI 4KQVA 4B3MI 4DU7A 4DPYA 4R1FA 4DR3I 4DR1I 4URLA 5LMNI 4JI8E 2UUBI 4K0KI 1XNRE 4DV1E 4DR7I 3F0NA 4YY3E 1HNZI 4DU8A 1Z0BA 1XNRI 4NXME 3T1YE 4M1KA 4JI4I 4GKKE 1FKAE 1XMOI 1B63A 4B3TI 1EI1A 4USMA 1VISA 1IBMI 2UXDE 1HR0I 3LPSA 3J7AM 3HULA 1ZM2A 5GMEA 1HNXE 5LMUE 1DARA 1UEKA 2UUCI 3J80Q 4DV6I 3OTOE 4DV3I 4YHHI 1N33I 2UXDI 1I94I 2A2DA 1IBME 5IT9Q 1HNWE 2R3VA 4X65I 1ELOA 5FLXQ 4DR4I 4B3SE 4X64E 4WUDA 2HK3A 2E5LI 3PYFA 1KKHA 4JI0E 4X66E 1N32E 4HACB 1HNZE 4LFAI 1ZM9A 4YY3I 2ZITA 2DEIA 4DXLA 2V8PA 4LF8E 1Z0CA 5IWAE 4LF5E 2AJ4A 2X36A 3B8HA 4FWGA 3J81C 3QT6A 4JI5E 4LF7I 1NHJA 1XHKA 4DR2E 4DR1E 4X66I 4K0KE 1FJGE 1BKNA 1NHIA 1Z0TA 2J7KA 1IBLE 2GS8A 4NXNI 1A6FA 2XEXA 4B3ME 5LL6R 1H7UA 4KHPE 4LF4E 4GKJI 1N36E 3ZM7A 1MU5A 1RREA 1D6TA 2HHHI 1MG7A 4X62E 4JI6I 1ZM4A 3J81Q 2UU9E 4DR5E 1XMQI 3WU5A 1B62A 2DEJA 4DPXA 4DPUA 1FJGI 3JAMC 4JI7E 3QT5A 4AQYI 1J5EE 1Z59A 4JV5I 4FWHA 4Z7YA 3T1YI 1ZXMA 4NXMI 4UTGA 4DV5E 2F4VI 1ZM3A 3ZZTA 2VQEI 2OI2A 5IT9C 2ZM6I 3Q1QA 3K1JA 2A2CA 4DV5I 2BM0A 2F4VE 3ZZUA 2CZ9A 4LFBE 4JI8I 1MX0A 5LMNE 4PRVA 3B82A 1EA6A 2ZBKB 1K47A 4LF6I 4DV6E 2UUCE 4DR5I 4HY1A 4OX9I 1FWKA 3D4JA 4LF4I 3K17A 1Z5BA 4USKA 4I3HA 2HHHE 1N0UA 4OX9E 1N0VC 1NZ0A 2X7IA 1H72C 4NXNE 1HNXI 2UXBE 4JI2E 4MYTA 1IBLI 1Z0GA 4FWDA 2EFGA 1S16A 2BV3A 1HR0E 2HFSA 4PU9A 5BR8E 4DV0E 4DR6E 1ZXNA 3V2UC 4GKKI 5IWAI 4LF8I 4EMDA 1PKPA 4DR2I 2Q2EB 2VQFI 2V2ZA 2ZM6E 1Z5AA 2VQEE 1S4EA 1Z0VA 3ZKBA 3ZZ0A 4DR4E 4DV0I 4DR6I 1J5EI 1N32I 4DV3E 3J80C 1N33E 4B3RI 2E5LE 3WU6A 3T1HE 4DUYI 4DPTA 5A2QC 1PIEA 5FLXC 3H4LA 4JI6E 4P52A 4X62I 3ZKDA 3QT7A 1I94E 4DV4I 4WUCA 4JI1I 2UXCE 3V5RA 3LNUA 4KHPI 3B78A 3QT8A 1OJ4A 2V34A 4DUYE 1XMOE 3T1HI 1U2RA 5GMDA 4JI4E 4DV7E 3PYGA 4B3RE 2HFUA 4WUBA 4LF7E 3GONA 4RPFA 2VQFE 3LTOA 1FWLA 1IBKE 4B3TE 4HACA 4JI3E 4DV2E 2HKEA 1Z5CA 4LF5I 2UUBE 4JI3I 4LFAE 3PYEA 4JV5E 4DR7E 3PYDA 3WU3A 4ED4A 1PVGA 4JI0I 4DR3E 4PRXA 4JYAE 2VF3A 1WUUA 4X64I 2HK2A 4MYUA 1XMQE 4HXZA 4HYMA 4JG4A 3J7AG 3OTOI 1XNQI 4JI1E 3WU4A 1FI4A 1KTVA 1NHHA 1XNQE 2HKJA 4LF6E 1KIJA 1H7SA 1H73A 5A2QQ 4Z7CA 4LFCE 2BM1A 2UUAE 1N34E 4JYAI 4ZVIA 4DUZE 4UT4A 4LF9I 2NPFA 4P7AA 4JI5I 2V2VA 4LFBI 3M6AA 2V2QA 4DV2I 1IBKI 4DV1I 3JAMQ 1KVKA 4AQYE 2WW4A 1FNMA 4JI7I 4FW9A 1QZRA 1RR9A 1Z0EA 4DUZI 4DPWA 1H74A 4FN5A 4DV7I 1N34I 2UUAI 4B3SI
chains in the Genus database with same CATH superfamily
5BR8I 4LFCI 4XTJA 3L7ZA 1HK7A 4X65E 4NBQA 3CWVA 1HNWI 4LF9E 4YHHE 2PNZA 2LJPA 4ISAA 4JI2I 4BA1B 2UXBI 2UXCI 2E1RA 2JEAB 4LCGA 2PNMA 5L3JA 2UU9I 5C0XC 1YH8A 4DV4E 2R42A 1N36I 5K36A 4GKJE 1Z0WA 5LMUI 2O3ZA 4KQVA 4B3MI 3K85A 4DU7A 4DPYA 5DNLA 4R1FA 2Z5CA 4MDTA 4DR3I 4LPFA 1Y4UA 4DR1I 2JE6B 2GO4A 3GCMA 2NN6B 4IS9A 3P3GA 4URLA 5JEAC 5LMNI 4JI8E 2UUBI 4K0KI 5JEAD 4FW3A 1XNRE 4DV1E 4DR7I 3F0NA 4YY3E 1HNZI 4DU8A 1Z0BA 1XNRI 4NXME 3T1YE 2CG9A 4M1KA 4JI4I 5JEAF 4GKKE 1FKAE 1XMOI 1R6MA 1B63A 1P42A 2BA0G 4B3TI 1EI1A 4USMA 1VISA 1IBMI 2UXDE 4AIDA 1HR0I 3LPSA 1Y60A 3J7AM 3HULA 5JEAE 2O1VA 1ZM2A 5GMEA 1HNXE 2O1UA 2NN6A 5LMUE 4LCHA 5C0XE 1DARA 1UEKA 2UUCI 3J80Q 4DV6I 3OTOE 4LCFA 4IFDC 4DV3I 4YHHI 1N33I 2UXDI 1I94I 2A2DA 1IBME 5IT9Q 1HNWE 2R3VA 4X65I 1ELOA 5K36B 5FLXQ 1E3PA 4DR4I 5DRQA 4B3SE 4X64E 4WUDA 2JEAA 5EL9A 2HK3A 4BA1A 4MQYA 2E5LI 3PYFA 2PNZB 1KKHA 4JI0E 4X66E 1Y4SA 1N32E 5K36F 4HACB 1UDNA 4BA2A 1HNZE 3L7ZB 4LFAI 1ZM9A 4YY3I 2BR2B 2ZITA 1OYRA 2DEIA 2J65A 2V8PA 4DXLA 4LF8E 5DRPA 1Z0CA 3GLLA 3KRNA 5IWAE 4LF5E 2AJ4A 4IZJA 2X36A 3PS3A 2AE8A 3B8HA 4LOMA 4FWGA 5C0XF 3P3EA 3Q6MA 3J81C 1UDSA 3QT6A 4JI5E 4LF7I 1NHJA 2C39A 4GQUA 1XHKA 4DR2E 4DR1E 3PRYA 4X66I 4K0KE 2PO2A 1FJGE 1BKNA 1NHIA 1Z0TA 2J7KA 1Y5YA 3B4TA 3CDIA 3DD6A 2GS8A 1IBLE 4NXNI 1A6FA 1OYSA 2XEXA 4B3ME 4OKGA 5LL6R 1H7UA 5ELWA 4KHPE 4LF4E 4GKJI 1N36E 2O1WA 2NN6D 3ZM7A 1MU5A 5K36E 1RREA 2PO1A 1R6LA 2BA1G 2IESA 1D6TA 2HHHI 1MG7A 4X62E 4JI6I 1ZM4A 3J81Q 3H1CA 4IFDE 2UU9E 4DR5E 2F1DA 1XMQI 3WU5A 2C38A 1B62A 2DEJA 4DPXA 4OO1C 4DPUA 2JT2A 1FJGI 3JAMC 4JI7E 2WP8B 3QT5A 2NN6F 4AQYI 1J5EE 1Z59A 4OO1D 3U1YA 2PO0A 4JV5I 1UDQA 4MU4A 3PS2A 4FWHA 4Z7YA 3M85D 2C37A 3T1YI 1ZXMA 4NXMI 4UTGA 2Z5BB 4DV5E 2F4VI 1ZM3A 2IOQA 3ZZTA 2VQEI 2OI2A 4OO1F 5IT9C 2ZM6I 1XXEA 3Q1QA 4J3DA 3K1JA 4IZKA 2A2CA 2BM0A 4DV5I 2F4VE 3ZZUA 2CZ9A 4LFBE 4JI8I 4FW7A 1MX0A 5LMNE 4PRVA 3B82A 2JEBB 1EA6A 2BA0D 2ZBKB 1K47A 4LF6I 3NZKA 4DV6E 2UUCE 5C0XA 4OO1A 4DR5I 3M7ND 4HY1A 4OX9I 3HKMA 4N3OA 1FWKA 3D4JA 4U3DA 4LF4I 3K17A 1Z5BA 4USKA 4I3HA 2HHHE 1N0UA 4OX9E 1N0VC 1NZ0A 2X7IA 1H72C 4MU3A 4NXNE 4IFDB 1HNXI 2UXBE 4JI2E 4MYTA 4OZEA 1Z0GA 1IBLI 4FWDA 2EFGA 1S16A 2BV3A 3CDJA 1HR0E 2HFSA 5K36D 3M7NG 4PU9A 5BR8E 4FW5A 2GO3A 4DV0E 4DR6E 2IERA 1ZXNA 2WNRA 3V2UC 1Y6ZA 5JEAA 4GKKI 5IWAI 4LF8I 4EMDA 1PKPA 4DR2I 2PO0B 2Q2EB 2VQFI 2V2ZA 2ZM6E 1Z5AA 2VQEE 1S4EA 3U1KA 1Z0VA 3ZKBA 3ZZ0A 1RHYA 4FW4A 3P76A 5DRRA 2C38B 2IOPA 4DR4E 4DV0I 4DR6I 1J5EI 4IZJD 2VESA 1N32I 4DV3E 3J80C 1N33E 4B3RI 2E5LE 2CGEA 5JEAB 2WNRB 3WU6A 3T1HE 4DUYI 3GMEA 4DPTA 5A2QC 1PIEA 3Q6NA 5FLXC 3H4LA 4JI6E 4FW6A 4P52A 4X62I 3ZKDA 2NN6C 3QT7A 1I94E 1E3HA 4DV4I 4WUCA 4JI1I 2UXCE 4IFDA 3V5RA 3LNUA 2BA1D 4KHPI 3B78A 3QT8A 1OJ4A 2V34A 4OO1B 5C0XB 4DUYE 1XMOE 3T1HI 1U2RA 5DROA 4IZJB 5GMDA 4JI4E 4DV7E 3PYGA 2O1TA 4B3RE 4AM3A 2HFUA 4WUBA 2BR2A 5FWKA 4LF7E 2NN6E 3GONA 4RPFA 2VQFE 3LTOA 1FWLA 5DNXA 1IBKE 4B3TE 4AIMA 4HACA 4BA2B 2JEBA 4JI3E 4DV2E 2HKEA 1Z5CA 4LF5I 1OYPA 2UUBE 4MU1A 4JI3I 4IZKB 4IFDF 5EKWA 4LFAE 2Z5EA 3PYEA 4JV5E 4DR7E 1YHCA 3PYDA 3WU3A 4ED4A 1PVGA 4JI0I 2Z5BA 3HJCA 4DR3E 2C37B 4PRXA 4JYAE 2VF3A 1WUUA 2PNLA 4IFDD 4X64I 2HK2A 4MYUA 5C0XD 4QNKA 1XMQE 4HXZA 2CVEA 1USUA 4HYMA 2WP8A 4JG4A 3J7AG 4OO1E 3OTOI 4U3BA 1XNQI 4JI1E 3WU4A 1FI4A 1KTVA 1NHHA 4QNJA 1USVA 1XNQE 3P06A 2HKJA 4LF6E 4MU0A 1KIJA 1VI7A 1H7SA 1H73A 5A2QQ 4Z7CA 4LFCE 2BM1A 2UUAE 2PO1B 1N34E 1UDOA 4JYAI 4ZVIA 4DUZE 4UT4A 5K36C 4LF9I 2GQ0A 3P3CA 2NPFA 4P7AA 4JI5I 2V2VA 4LFBI 3M6AA 3PS1A 2V2QA 2PO2B 4DV2I 2C39B 1IBKI 4DV1I 3JAMQ 1KVKA 4AQYE 2JE6A 2WW4A 1FNMA 4JI7I 4FW9A 1QZRA 1RR9A 1Z0EA 4DUZI 4DPWA 1H74A 4FN5A 4DV7I 1N34I 2Z5CB 2UUAI 3UHMA 3M85G 4B3SI
chains in the Genus database with same CATH topology
5BR8I 4LFCI 4XTJA 1HK7A 4X65E 3CWVA 1HNWI 4LF9E 4YHHE 2LJPA 4JI2I 2UXCI 2UXBI 2E1RA 2PNMA 5L3JA 2UU9I 4DV4E 2R42A 1N36I 4GKJE 1Z0WA 5LMUI 4KQVA 4B3MI 3K85A 4DU7A 4DPYA 4R1FA 2Z5CA 4DR3I 1Y4UA 4DR1I 4URLA 5LMNI 4JI8E 2UUBI 4K0KI 1XNRE 4DV1E 4DR7I 3F0NA 4YY3E 1HNZI 4DU8A 1Z0BA 1XNRI 4NXME 3T1YE 2CG9A 4M1KA 4JI4I 4GKKE 1FKAE 1XMOI 1B63A 4B3TI 1EI1A 4USMA 1VISA 1IBMI 2UXDE 1HR0I 3LPSA 3J7AM 3HULA 2O1VA 1ZM2A 5GMEA 1HNXE 2O1UA 5LMUE 1DARA 1UEKA 2UUCI 3J80Q 4DV6I 3OTOE 4DV3I 4YHHI 1N33I 2UXDI 1I94I 2A2DA 1IBME 5IT9Q 1HNWE 2R3VA 4X65I 1ELOA 5FLXQ 4DR4I 4B3SE 4X64E 4WUDA 2HK3A 2E5LI 3PYFA 1KKHA 4JI0E 4X66E 1Y4SA 1N32E 4HACB 1HNZE 4LFAI 1ZM9A 4YY3I 2ZITA 2DEIA 4DXLA 2V8PA 4LF8E 1Z0CA 5IWAE 4LF5E 2AJ4A 4IZJA 2X36A 3B8HA 4FWGA 3Q6MA 3J81C 3QT6A 4JI5E 4LF7I 1NHJA 1XHKA 4DR2E 4DR1E 3PRYA 4X66I 4K0KE 1FJGE 1BKNA 1NHIA 1Z0TA 2J7KA 1IBLE 2GS8A 4NXNI 1A6FA 2XEXA 4B3ME 5LL6R 1H7UA 4KHPE 4LF4E 4GKJI 1N36E 2O1WA 3ZM7A 1MU5A 1RREA 1D6TA 2HHHI 1MG7A 4X62E 4JI6I 1ZM4A 3J81Q 2UU9E 4DR5E 1XMQI 3WU5A 1B62A 2DEJA 4DPXA 4DPUA 1FJGI 3JAMC 4JI7E 3QT5A 4AQYI 1J5EE 1Z59A 4JV5I 4FWHA 4Z7YA 3T1YI 1ZXMA 4NXMI 4UTGA 2Z5BB 4DV5E 2F4VI 1ZM3A 2IOQA 3ZZTA 2VQEI 2OI2A 5IT9C 2ZM6I 3Q1QA 3K1JA 4IZKA 2A2CA 4DV5I 2BM0A 2F4VE 3ZZUA 2CZ9A 4LFBE 4JI8I 1MX0A 5LMNE 4PRVA 3B82A 1EA6A 2ZBKB 1K47A 4LF6I 4DV6E 2UUCE 4DR5I 4HY1A 4OX9I 4N3OA 1FWKA 3D4JA 4LF4I 3K17A 1Z5BA 4USKA 4I3HA 2HHHE 1N0UA 4OX9E 1N0VC 1NZ0A 2X7IA 1H72C 4NXNE 1HNXI 2UXBE 4JI2E 4MYTA 1IBLI 1Z0GA 4FWDA 2EFGA 1S16A 2BV3A 1HR0E 2HFSA 4PU9A 5BR8E 4DV0E 4DR6E 1ZXNA 3V2UC 1Y6ZA 4GKKI 5IWAI 4LF8I 4EMDA 1PKPA 4DR2I 2Q2EB 2VQFI 2V2ZA 2ZM6E 1Z5AA 2VQEE 1S4EA 1Z0VA 3ZKBA 3ZZ0A 2IOPA 4DR4E 4DV0I 4DR6I 1J5EI 4IZJD 1N32I 4DV3E 3J80C 1N33E 4B3RI 2E5LE 2CGEA 3WU6A 3T1HE 4DUYI 4DPTA 5A2QC 1PIEA 3Q6NA 5FLXC 3H4LA 4JI6E 4P52A 4X62I 3ZKDA 3QT7A 1I94E 4DV4I 4WUCA 4JI1I 2UXCE 3V5RA 3LNUA 4KHPI 3B78A 3QT8A 1OJ4A 2V34A 4DUYE 1XMOE 3T1HI 1U2RA 4IZJB 5GMDA 4JI4E 4DV7E 3PYGA 2O1TA 4B3RE 2HFUA 4WUBA 5FWKA 4LF7E 3GONA 4RPFA 2VQFE 3LTOA 1FWLA 1IBKE 4B3TE 4HACA 4JI3E 4DV2E 2HKEA 1Z5CA 4LF5I 2UUBE 4JI3I 4IZKB 4LFAE 2Z5EA 3PYEA 4JV5E 4DR7E 3PYDA 3WU3A 4ED4A 1PVGA 4JI0I 2Z5BA 3HJCA 4DR3E 4PRXA 4JYAE 2VF3A 1WUUA 2PNLA 4X64I 2HK2A 4MYUA 1XMQE 4HXZA 1USUA 4HYMA 4JG4A 3J7AG 3OTOI 1XNQI 4JI1E 3WU4A 1FI4A 1KTVA 1NHHA 1USVA 1XNQE 3P06A 2HKJA 4LF6E 1KIJA 1H7SA 1H73A 5A2QQ 4Z7CA 4LFCE 2BM1A 2UUAE 1N34E 4JYAI 4ZVIA 4DUZE 4UT4A 4LF9I 2GQ0A 2NPFA 4P7AA 4JI5I 2V2VA 4LFBI 3M6AA 2V2QA 4DV2I 1IBKI 4DV1I 3JAMQ 1KVKA 4AQYE 2WW4A 1FNMA 4JI7I 4FW9A 1QZRA 1RR9A 1Z0EA 4DUZI 4DPWA 1H74A 4FN5A 4DV7I 1N34I 2Z5CB 2UUAI 4B3SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 I;  4LFC I;  4XTJ A;  4X65 E;  3CWV A;  1HNW I;  4LF9 E;  4YHH E;  2LJP A;  4JI2 I;  2UXC I;  2UXB I;  2E1R A;  5L3J A;  2UU9 I;  4DV4 E;  2R42 A;  1N36 I;  4GKJ E;  1Z0W A;  5LMU I;  4KQV A;  4B3M I;  4DU7 A;  4DPY A;  4R1F A;  4DR3 I;  4DR1 I;  4URL A;  5LMN I;  4JI8 E;  2UUB I;  4K0K I;  1XNR E;  4DV1 E;  4DR7 I;  3F0N A;  4YY3 E;  1HNZ I;  4DU8 A;  1Z0B A;  1XNR I;  4NXM E;  3T1Y E;  4M1K A;  4JI4 I;  4GKK E;  1FKA E;  1XMO I;  1B63 A;  4B3T I;  1EI1 A;  4USM A;  1VIS A;  1IBM I;  2UXD E;  1HR0 I;  3LPS A;  3J7A M;  3HUL A;  1ZM2 A;  5GME A;  1HNX E;  5LMU E;  1DAR A;  1UEK A;  2UUC I;  3J80 Q;  4DV6 I;  3OTO E;  4DV3 I;  4YHH I;  1N33 I;  2UXD I;  1I94 I;  2A2D A;  1IBM E;  5IT9 Q;  1HNW E;  2R3V A;  4X65 I;  1ELO A;  5FLX Q;  4DR4 I;  4B3S E;  4X64 E;  4WUD A;  2HK3 A;  2E5L I;  3PYF A;  1KKH A;  4JI0 E;  4X66 E;  1N32 E;  4HAC B;  1HNZ E;  4LFA I;  1ZM9 A;  4YY3 I;  2ZIT A;  2DEI A;  4DXL A;  2V8P A;  4LF8 E;  1Z0C A;  5IWA E;  4LF5 E;  2AJ4 A;  2X36 A;  3B8H A;  4FWG A;  3J81 C;  3QT6 A;  4JI5 E;  4LF7 I;  1NHJ A;  1XHK A;  4DR2 E;  4DR1 E;  4X66 I;  4K0K E;  1FJG E;  1BKN A;  1NHI A;  1Z0T A;  2J7K A;  1IBL E;  2GS8 A;  4NXN I;  1A6F A;  2XEX A;  4B3M E;  5LL6 R;  1H7U A;  4KHP E;  4LF4 E;  4GKJ I;  1N36 E;  3ZM7 A;  1MU5 A;  1RRE A;  1D6T A;  2HHH I;  1MG7 A;  4X62 E;  4JI6 I;  1ZM4 A;  3J81 Q;  2UU9 E;  4DR5 E;  1XMQ I;  3WU5 A;  1B62 A;  2DEJ A;  4DPX A;  4DPU A;  1FJG I;  3JAM C;  4JI7 E;  3QT5 A;  4AQY I;  1J5E E;  1Z59 A;  4JV5 I;  4FWH A;  4Z7Y A;  3T1Y I;  1ZXM A;  4NXM I;  4UTG A;  4DV5 E;  2F4V I;  1ZM3 A;  3ZZT A;  2VQE I;  2OI2 A;  5IT9 C;  2ZM6 I;  3Q1Q A;  3K1J A;  2A2C A;  4DV5 I;  2BM0 A;  2F4V E;  3ZZU A;  2CZ9 A;  4LFB E;  4JI8 I;  1MX0 A;  5LMN E;  4PRV A;  3B82 A;  1EA6 A;  2ZBK B;  1K47 A;  4LF6 I;  4DV6 E;  2UUC E;  4DR5 I;  4HY1 A;  4OX9 I;  1FWK A;  3D4J A;  4LF4 I;  3K17 A;  1Z5B A;  4USK A;  4I3H A;  2HHH E;  1N0U A;  4OX9 E;  1N0V C;  1NZ0 A;  2X7I A;  1H72 C;  4NXN E;  1HNX I;  2UXB E;  4JI2 E;  4MYT A;  1IBL I;  1Z0G A;  4FWD A;  2EFG A;  1S16 A;  2BV3 A;  1HR0 E;  2HFS A;  4PU9 A;  5BR8 E;  4DV0 E;  4DR6 E;  1ZXN A;  3V2U C;  4GKK I;  5IWA I;  4LF8 I;  4EMD A;  1PKP A;  4DR2 I;  2Q2E B;  2VQF I;  2V2Z A;  2ZM6 E;  1Z5A A;  2VQE E;  1S4E A;  1Z0V A;  3ZKB A;  3ZZ0 A;  4DR4 E;  4DV0 I;  4DR6 I;  1J5E I;  1N32 I;  4DV3 E;  3J80 C;  1N33 E;  4B3R I;  2E5L E;  3WU6 A;  3T1H E;  4DUY I;  4DPT A;  5A2Q C;  1PIE A;  5FLX C;  3H4L A;  4JI6 E;  4P52 A;  4X62 I;  3ZKD A;  3QT7 A;  1I94 E;  4DV4 I;  4WUC A;  4JI1 I;  2UXC E;  3V5R A;  3LNU A;  4KHP I;  3B78 A;  3QT8 A;  1OJ4 A;  2V34 A;  4DUY E;  1XMO E;  3T1H I;  1U2R A;  5GMD A;  4JI4 E;  4DV7 E;  3PYG A;  4B3R E;  2HFU A;  4WUB A;  4LF7 E;  3GON A;  4RPF A;  2VQF E;  3LTO A;  1FWL A;  1IBK E;  4B3T E;  4HAC A;  4JI3 E;  4DV2 E;  2HKE A;  1Z5C A;  4LF5 I;  2UUB E;  4JI3 I;  4LFA E;  3PYE A;  4JV5 E;  4DR7 E;  3PYD A;  3WU3 A;  4ED4 A;  1PVG A;  4JI0 I;  4DR3 E;  4PRX A;  4JYA E;  2VF3 A;  1WUU A;  4X64 I;  2HK2 A;  4MYU A;  1XMQ E;  4HXZ A;  4HYM A;  4JG4 A;  3J7A G;  3OTO I;  1XNQ I;  4JI1 E;  3WU4 A;  1FI4 A;  1KTV A;  1NHH A;  1XNQ E;  2HKJ A;  4LF6 E;  1KIJ A;  1H7S A;  1H73 A;  5A2Q Q;  4Z7C A;  4LFC E;  2BM1 A;  2UUA E;  1N34 E;  4JYA I;  4ZVI A;  4DUZ E;  4UT4 A;  4LF9 I;  2NPF A;  4P7A A;  4JI5 I;  2V2V A;  4LFB I;  3M6A A;  2V2Q A;  4DV2 I;  1IBK I;  4DV1 I;  3JAM Q;  1KVK A;  4AQY E;  2WW4 A;  1FNM A;  4JI7 I;  4FW9 A;  1QZR A;  1RR9 A;  1Z0E A;  4DUZ I;  4DPW A;  1H74 A;  4FN5 A;  4DV7 I;  1N34 I;  2UUA I;  4B3S I; 
#chains in the Genus database with same CATH topology
 5BR8 I;  4LFC I;  4XTJ A;  3L7Z A;  1HK7 A;  4X65 E;  4NBQ A;  3CWV A;  1HNW I;  4LF9 E;  4YHH E;  2PNZ A;  2LJP A;  4ISA A;  4JI2 I;  4BA1 B;  2UXB I;  2UXC I;  2E1R A;  2JEA B;  4LCG A;  2PNM A;  5L3J A;  2UU9 I;  5C0X C;  1YH8 A;  4DV4 E;  2R42 A;  1N36 I;  5K36 A;  4GKJ E;  1Z0W A;  5LMU I;  2O3Z A;  4KQV A;  4B3M I;  3K85 A;  4DU7 A;  4DPY A;  5DNL A;  4R1F A;  2Z5C A;  4MDT A;  4DR3 I;  4LPF A;  1Y4U A;  4DR1 I;  2JE6 B;  2GO4 A;  3GCM A;  2NN6 B;  4IS9 A;  3P3G A;  4URL A;  5JEA C;  5LMN I;  4JI8 E;  2UUB I;  4K0K I;  5JEA D;  4FW3 A;  1XNR E;  4DV1 E;  4DR7 I;  3F0N A;  4YY3 E;  1HNZ I;  4DU8 A;  1Z0B A;  1XNR I;  4NXM E;  3T1Y E;  2CG9 A;  4M1K A;  4JI4 I;  5JEA F;  4GKK E;  1FKA E;  1XMO I;  1R6M A;  1B63 A;  1P42 A;  2BA0 G;  4B3T I;  1EI1 A;  4USM A;  1VIS A;  1IBM I;  2UXD E;  4AID A;  1HR0 I;  3LPS A;  1Y60 A;  3J7A M;  3HUL A;  5JEA E;  2O1V A;  1ZM2 A;  5GME A;  1HNX E;  2O1U A;  2NN6 A;  5LMU E;  4LCH A;  5C0X E;  1DAR A;  1UEK A;  2UUC I;  3J80 Q;  4DV6 I;  3OTO E;  4LCF A;  4IFD C;  4DV3 I;  4YHH I;  1N33 I;  2UXD I;  1I94 I;  2A2D A;  1IBM E;  5IT9 Q;  1HNW E;  2R3V A;  4X65 I;  1ELO A;  5K36 B;  5FLX Q;  1E3P A;  4DR4 I;  5DRQ A;  4B3S E;  4X64 E;  4WUD A;  2JEA A;  5EL9 A;  2HK3 A;  4BA1 A;  4MQY A;  2E5L I;  3PYF A;  2PNZ B;  1KKH A;  4JI0 E;  4X66 E;  1Y4S A;  1N32 E;  5K36 F;  4HAC B;  1UDN A;  4BA2 A;  1HNZ E;  3L7Z B;  4LFA I;  1ZM9 A;  4YY3 I;  2BR2 B;  2ZIT A;  1OYR A;  2DEI A;  2J65 A;  2V8P A;  4DXL A;  4LF8 E;  5DRP A;  1Z0C A;  3GLL A;  3KRN A;  5IWA E;  4LF5 E;  2AJ4 A;  4IZJ A;  2X36 A;  3PS3 A;  2AE8 A;  3B8H A;  4LOM A;  4FWG A;  5C0X F;  3P3E A;  3Q6M A;  3J81 C;  1UDS A;  3QT6 A;  4JI5 E;  4LF7 I;  1NHJ A;  2C39 A;  4GQU A;  1XHK A;  4DR2 E;  4DR1 E;  3PRY A;  4X66 I;  4K0K E;  2PO2 A;  1FJG E;  1BKN A;  1NHI A;  1Z0T A;  2J7K A;  1Y5Y A;  3B4T A;  3CDI A;  3DD6 A;  2GS8 A;  1IBL E;  4NXN I;  1A6F A;  1OYS A;  2XEX A;  4B3M E;  4OKG A;  5LL6 R;  1H7U A;  5ELW A;  4KHP E;  4LF4 E;  4GKJ I;  1N36 E;  2O1W A;  2NN6 D;  3ZM7 A;  1MU5 A;  5K36 E;  1RRE A;  2PO1 A;  1R6L A;  2BA1 G;  2IES A;  1D6T A;  2HHH I;  1MG7 A;  4X62 E;  4JI6 I;  1ZM4 A;  3J81 Q;  3H1C A;  4IFD E;  2UU9 E;  4DR5 E;  2F1D A;  1XMQ I;  3WU5 A;  2C38 A;  1B62 A;  2DEJ A;  4DPX A;  4OO1 C;  4DPU A;  2JT2 A;  1FJG I;  3JAM C;  4JI7 E;  2WP8 B;  3QT5 A;  2NN6 F;  4AQY I;  1J5E E;  1Z59 A;  4OO1 D;  3U1Y A;  2PO0 A;  4JV5 I;  1UDQ A;  4MU4 A;  3PS2 A;  4FWH A;  4Z7Y A;  3M85 D;  2C37 A;  3T1Y I;  1ZXM A;  4NXM I;  4UTG A;  2Z5B B;  4DV5 E;  2F4V I;  1ZM3 A;  2IOQ A;  3ZZT A;  2VQE I;  2OI2 A;  4OO1 F;  5IT9 C;  2ZM6 I;  1XXE A;  3Q1Q A;  4J3D A;  3K1J A;  4IZK A;  2A2C A;  2BM0 A;  4DV5 I;  2F4V E;  3ZZU A;  2CZ9 A;  4LFB E;  4JI8 I;  4FW7 A;  1MX0 A;  5LMN E;  4PRV A;  3B82 A;  2JEB B;  1EA6 A;  2BA0 D;  2ZBK B;  1K47 A;  4LF6 I;  3NZK A;  4DV6 E;  2UUC E;  5C0X A;  4OO1 A;  4DR5 I;  3M7N D;  4HY1 A;  4OX9 I;  3HKM A;  4N3O A;  1FWK A;  3D4J A;  4U3D A;  4LF4 I;  3K17 A;  1Z5B A;  4USK A;  4I3H A;  2HHH E;  1N0U A;  4OX9 E;  1N0V C;  1NZ0 A;  2X7I A;  1H72 C;  4MU3 A;  4NXN E;  4IFD B;  1HNX I;  2UXB E;  4JI2 E;  4MYT A;  4OZE A;  1Z0G A;  1IBL I;  4FWD A;  2EFG A;  1S16 A;  2BV3 A;  3CDJ A;  1HR0 E;  2HFS A;  5K36 D;  3M7N G;  4PU9 A;  5BR8 E;  4FW5 A;  2GO3 A;  4DV0 E;  4DR6 E;  2IER A;  1ZXN A;  2WNR A;  3V2U C;  1Y6Z A;  5JEA A;  4GKK I;  5IWA I;  4LF8 I;  4EMD A;  1PKP A;  4DR2 I;  2PO0 B;  2Q2E B;  2VQF I;  2V2Z A;  2ZM6 E;  1Z5A A;  2VQE E;  1S4E A;  3U1K A;  1Z0V A;  3ZKB A;  3ZZ0 A;  1RHY A;  4FW4 A;  3P76 A;  5DRR A;  2C38 B;  2IOP A;  4DR4 E;  4DV0 I;  4DR6 I;  1J5E I;  4IZJ D;  2VES A;  1N32 I;  4DV3 E;  3J80 C;  1N33 E;  4B3R I;  2E5L E;  2CGE A;  5JEA B;  2WNR B;  3WU6 A;  3T1H E;  4DUY I;  3GME A;  4DPT A;  5A2Q C;  1PIE A;  3Q6N A;  5FLX C;  3H4L A;  4JI6 E;  4FW6 A;  4P52 A;  4X62 I;  3ZKD A;  2NN6 C;  3QT7 A;  1I94 E;  1E3H A;  4DV4 I;  4WUC A;  4JI1 I;  2UXC E;  4IFD A;  3V5R A;  3LNU A;  2BA1 D;  4KHP I;  3B78 A;  3QT8 A;  1OJ4 A;  2V34 A;  4OO1 B;  5C0X B;  4DUY E;  1XMO E;  3T1H I;  1U2R A;  5DRO A;  4IZJ B;  5GMD A;  4JI4 E;  4DV7 E;  3PYG A;  2O1T A;  4B3R E;  4AM3 A;  2HFU A;  4WUB A;  2BR2 A;  5FWK A;  4LF7 E;  2NN6 E;  3GON A;  4RPF A;  2VQF E;  3LTO A;  1FWL A;  5DNX A;  1IBK E;  4B3T E;  4AIM A;  4HAC A;  4BA2 B;  2JEB A;  4JI3 E;  4DV2 E;  2HKE A;  1Z5C A;  4LF5 I;  1OYP A;  2UUB E;  4MU1 A;  4JI3 I;  4IZK B;  4IFD F;  5EKW A;  4LFA E;  2Z5E A;  3PYE A;  4JV5 E;  4DR7 E;  1YHC A;  3PYD A;  3WU3 A;  4ED4 A;  1PVG A;  4JI0 I;  2Z5B A;  3HJC A;  4DR3 E;  2C37 B;  4PRX A;  4JYA E;  2VF3 A;  1WUU A;  2PNL A;  4IFD D;  4X64 I;  2HK2 A;  4MYU A;  5C0X D;  4QNK A;  1XMQ E;  4HXZ A;  2CVE A;  1USU A;  4HYM A;  2WP8 A;  4JG4 A;  3J7A G;  4OO1 E;  3OTO I;  4U3B A;  1XNQ I;  4JI1 E;  3WU4 A;  1FI4 A;  1KTV A;  1NHH A;  4QNJ A;  1USV A;  1XNQ E;  3P06 A;  2HKJ A;  4LF6 E;  4MU0 A;  1KIJ A;  1VI7 A;  1H7S A;  1H73 A;  5A2Q Q;  4Z7C A;  4LFC E;  2BM1 A;  2UUA E;  2PO1 B;  1N34 E;  1UDO A;  4JYA I;  4ZVI A;  4DUZ E;  4UT4 A;  5K36 C;  4LF9 I;  2GQ0 A;  3P3C A;  2NPF A;  4P7A A;  4JI5 I;  2V2V A;  4LFB I;  3M6A A;  3PS1 A;  2V2Q A;  2PO2 B;  4DV2 I;  2C39 B;  1IBK I;  4DV1 I;  3JAM Q;  1KVK A;  4AQY E;  2JE6 A;  2WW4 A;  1FNM A;  4JI7 I;  4FW9 A;  1QZR A;  1RR9 A;  1Z0E A;  4DUZ I;  4DPW A;  1H74 A;  4FN5 A;  4DV7 I;  1N34 I;  2Z5C B;  2UUA I;  3UHM A;  3M85 G;  4B3S I; 
#chains in the Genus database with same CATH homology
 5BR8 I;  4LFC I;  4XTJ A;  1HK7 A;  4X65 E;  3CWV A;  1HNW I;  4LF9 E;  4YHH E;  2LJP A;  4JI2 I;  2UXC I;  2UXB I;  2E1R A;  2PNM A;  5L3J A;  2UU9 I;  4DV4 E;  2R42 A;  1N36 I;  4GKJ E;  1Z0W A;  5LMU I;  4KQV A;  4B3M I;  3K85 A;  4DU7 A;  4DPY A;  4R1F A;  2Z5C A;  4DR3 I;  1Y4U A;  4DR1 I;  4URL A;  5LMN I;  4JI8 E;  2UUB I;  4K0K I;  1XNR E;  4DV1 E;  4DR7 I;  3F0N A;  4YY3 E;  1HNZ I;  4DU8 A;  1Z0B A;  1XNR I;  4NXM E;  3T1Y E;  2CG9 A;  4M1K A;  4JI4 I;  4GKK E;  1FKA E;  1XMO I;  1B63 A;  4B3T I;  1EI1 A;  4USM A;  1VIS A;  1IBM I;  2UXD E;  1HR0 I;  3LPS A;  3J7A M;  3HUL A;  2O1V A;  1ZM2 A;  5GME A;  1HNX E;  2O1U A;  5LMU E;  1DAR A;  1UEK A;  2UUC I;  3J80 Q;  4DV6 I;  3OTO E;  4DV3 I;  4YHH I;  1N33 I;  2UXD I;  1I94 I;  2A2D A;  1IBM E;  5IT9 Q;  1HNW E;  2R3V A;  4X65 I;  1ELO A;  5FLX Q;  4DR4 I;  4B3S E;  4X64 E;  4WUD A;  2HK3 A;  2E5L I;  3PYF A;  1KKH A;  4JI0 E;  4X66 E;  1Y4S A;  1N32 E;  4HAC B;  1HNZ E;  4LFA I;  1ZM9 A;  4YY3 I;  2ZIT A;  2DEI A;  4DXL A;  2V8P A;  4LF8 E;  1Z0C A;  5IWA E;  4LF5 E;  2AJ4 A;  4IZJ A;  2X36 A;  3B8H A;  4FWG A;  3Q6M A;  3J81 C;  3QT6 A;  4JI5 E;  4LF7 I;  1NHJ A;  1XHK A;  4DR2 E;  4DR1 E;  3PRY A;  4X66 I;  4K0K E;  1FJG E;  1BKN A;  1NHI A;  1Z0T A;  2J7K A;  1IBL E;  2GS8 A;  4NXN I;  1A6F A;  2XEX A;  4B3M E;  5LL6 R;  1H7U A;  4KHP E;  4LF4 E;  4GKJ I;  1N36 E;  2O1W A;  3ZM7 A;  1MU5 A;  1RRE A;  1D6T A;  2HHH I;  1MG7 A;  4X62 E;  4JI6 I;  1ZM4 A;  3J81 Q;  2UU9 E;  4DR5 E;  1XMQ I;  3WU5 A;  1B62 A;  2DEJ A;  4DPX A;  4DPU A;  1FJG I;  3JAM C;  4JI7 E;  3QT5 A;  4AQY I;  1J5E E;  1Z59 A;  4JV5 I;  4FWH A;  4Z7Y A;  3T1Y I;  1ZXM A;  4NXM I;  4UTG A;  2Z5B B;  4DV5 E;  2F4V I;  1ZM3 A;  2IOQ A;  3ZZT A;  2VQE I;  2OI2 A;  5IT9 C;  2ZM6 I;  3Q1Q A;  3K1J A;  4IZK A;  2A2C A;  4DV5 I;  2BM0 A;  2F4V E;  3ZZU A;  2CZ9 A;  4LFB E;  4JI8 I;  1MX0 A;  5LMN E;  4PRV A;  3B82 A;  1EA6 A;  2ZBK B;  1K47 A;  4LF6 I;  4DV6 E;  2UUC E;  4DR5 I;  4HY1 A;  4OX9 I;  4N3O A;  1FWK A;  3D4J A;  4LF4 I;  3K17 A;  1Z5B A;  4USK A;  4I3H A;  2HHH E;  1N0U A;  4OX9 E;  1N0V C;  1NZ0 A;  2X7I A;  1H72 C;  4NXN E;  1HNX I;  2UXB E;  4JI2 E;  4MYT A;  1IBL I;  1Z0G A;  4FWD A;  2EFG A;  1S16 A;  2BV3 A;  1HR0 E;  2HFS A;  4PU9 A;  5BR8 E;  4DV0 E;  4DR6 E;  1ZXN A;  3V2U C;  1Y6Z A;  4GKK I;  5IWA I;  4LF8 I;  4EMD A;  1PKP A;  4DR2 I;  2Q2E B;  2VQF I;  2V2Z A;  2ZM6 E;  1Z5A A;  2VQE E;  1S4E A;  1Z0V A;  3ZKB A;  3ZZ0 A;  2IOP A;  4DR4 E;  4DV0 I;  4DR6 I;  1J5E I;  4IZJ D;  1N32 I;  4DV3 E;  3J80 C;  1N33 E;  4B3R I;  2E5L E;  2CGE A;  3WU6 A;  3T1H E;  4DUY I;  4DPT A;  5A2Q C;  1PIE A;  3Q6N A;  5FLX C;  3H4L A;  4JI6 E;  4P52 A;  4X62 I;  3ZKD A;  3QT7 A;  1I94 E;  4DV4 I;  4WUC A;  4JI1 I;  2UXC E;  3V5R A;  3LNU A;  4KHP I;  3B78 A;  3QT8 A;  1OJ4 A;  2V34 A;  4DUY E;  1XMO E;  3T1H I;  1U2R A;  4IZJ B;  5GMD A;  4JI4 E;  4DV7 E;  3PYG A;  2O1T A;  4B3R E;  2HFU A;  4WUB A;  5FWK A;  4LF7 E;  3GON A;  4RPF A;  2VQF E;  3LTO A;  1FWL A;  1IBK E;  4B3T E;  4HAC A;  4JI3 E;  4DV2 E;  2HKE A;  1Z5C A;  4LF5 I;  2UUB E;  4JI3 I;  4IZK B;  4LFA E;  2Z5E A;  3PYE A;  4JV5 E;  4DR7 E;  3PYD A;  3WU3 A;  4ED4 A;  1PVG A;  4JI0 I;  2Z5B A;  3HJC A;  4DR3 E;  4PRX A;  4JYA E;  2VF3 A;  1WUU A;  2PNL A;  4X64 I;  2HK2 A;  4MYU A;  1XMQ E;  4HXZ A;  1USU A;  4HYM A;  4JG4 A;  3J7A G;  3OTO I;  1XNQ I;  4JI1 E;  3WU4 A;  1FI4 A;  1KTV A;  1NHH A;  1USV A;  1XNQ E;  3P06 A;  2HKJ A;  4LF6 E;  1KIJ A;  1H7S A;  1H73 A;  5A2Q Q;  4Z7C A;  4LFC E;  2BM1 A;  2UUA E;  1N34 E;  4JYA I;  4ZVI A;  4DUZ E;  4UT4 A;  4LF9 I;  2GQ0 A;  2NPF A;  4P7A A;  4JI5 I;  2V2V A;  4LFB I;  3M6A A;  2V2Q A;  4DV2 I;  1IBK I;  4DV1 I;  3JAM Q;  1KVK A;  4AQY E;  2WW4 A;  1FNM A;  4JI7 I;  4FW9 A;  1QZR A;  1RR9 A;  1Z0E A;  4DUZ I;  4DPW A;  1H74 A;  4FN5 A;  4DV7 I;  1N34 I;  2Z5C B;  2UUA I;  4B3S I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...