1A6FA

Rnase p protein from bacillus subtilis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE P PROTEIN
publication title Ribonuclease P protein structure: evolutionary origins in the translational apparatus.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Endonuclease
total genus 38
structure length 113
sequence length 113
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 1998-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00825 Ribonuclease_P Ribonuclease P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1a6fA00
1FKAE 1IBLI 4JI4E 3HULA 2UXBI 4P52A 4USKA 4B3MI 4JV5E 4DV4E 1IBKE 4RPFA 1Z0CA 4JI0E 4LFAI 2UUAI 4DR7E 1FI4A 4ZVIA 1XMOI 4JI7E 4X64E 3WU4A 2Q2EB 2J7KA 5L3JA 1HNZE 4LF7I 4USMA 4LF9E 2BM1A 1XNQE 1I94E 4R1FA 1D6TA 4JI5I 4FW9A 3H4LA 2UXDI 1ZM3A 4KHPE 1H7UA 3ZKDA 1KIJA 4JI8I 1Z0BA 1ZM4A 3WU5A 2UXCE 2DEJA 3OTOE 4Z7YA 1ZXNA 4LFCI 4DPUA 4AQYE 4DUZI 1NHHA 1PVGA 3J80C 4LF6E 3M6AA 4JI1E 1VISA 4DV2I 4DV1I 1HNWI 1N33I 2V34A 1HNXI 1EA6A 4DV6I 4DR1E 4X62E 4WUCA 3QT8A 5GMEA 1HR0E 2ZM6E 1MX0A 4YY3E 1MG7A 5LMUI 4JI4I 4B3RE 1A6FA 1B62A 4DR5E 4JV5I 4DPWA 3PYGA 5FLXC 4DV4I 1IBKI 1NZ0A 4HY1A 2UU9E 1KKHA 4DR4I 3GONA 1N32I 4DR7I 4JI7I 4X64I 4NXME 1XNRE 3CWVA 1HNZI 1B63A 4WUBA 1XNQI 2R3VA 3PYDA 1N36E 1I94I 4DV0E 3PYEA 4KHPI 3PYFA 4MYUA 2AJ4A 4PRVA 4DR3E 2UXCI 3OTOI 4DV5E 4NXNE 4Z7CA 4WUDA 3JAMQ 2V2QA 3K1JA 4DR2E 4AQYI 1FJGE 1RREA 1ZM9A 1XMQE 1ZM2A 4LF6I 4JI1I 1H73A 4P7AA 2UUBE 1KTVA 1Z5BA 1H72C 1QZRA 4DPXA 4JI2I 4DR1I 4X62I 3J7AG 2VQFE 2E1RA 4LFBE 4DU7A 1HR0I 4I3HA 4LF8E 1S16A 4K0KE 2HHHE 4YY3I 3J81C 3T1YE 2XEXA 1DARA 1MU5A 2F4VE 1ELOA 1NHIA 4X66I 3F0NA 4B3RI 2DEIA 1XHKA 4DR5I 4DV7I 2E5LE 2V8PA 5IT9C 3ZZUA 1PKPA 1U2RA 1FWLA 1Z0EA 4LF4E 4NXMI 1XNRI 1Z0WA 4HXZA 4UTGA 2V2VA 2V2ZA 3B8HA 1N36I 4DR6I 3J81Q 2ZITA 3LNUA 1RR9A 1H7SA 4DV0I 2UXBE 5GMDA 4FWHA 3QT6A 4DR3I 2UUCI 3B82A 4LFAE 4DV5I 4NXNI 2VQEE 4DUYE 4YHHE 3QT7A 2WW4A 4DR2I 3J7AM 4FWDA 2BM0A 3J80Q 4LF7E 1XMQI 4JI0I 4FN5A 1Z59A 4GKKE 2UXDE 4EMDA 2HFSA 4DU8A 4JI8E 2VQFI 4LFBI 4LF9I 1BKNA 4LF8I 4K0KI 2LJPA 5BR8E 4LF5E 3T1YI 2HFUA 2F4VI 2HK3A 4ED4A 4JYAE 5IWAE 5FLXQ 3Q1QA 4DV1E 4FWGA 2E5LI 4HYMA 2VF3A 4JI3E 4JI6E 3V2UC 3ZZTA 5LL6R 5LMNE 2EFGA 5A2QC 4PU9A 4B3TE 4X65E 4DXLA 1S4EA 2CZ9A 4GKJE 3WU3A 1J5EE 4B3SE 4MYTA 1H74A 3ZM7A 2ZM6I 1OJ4A 1Z5CA 4HACB 2VQEI 1WUUA 4DUYI 4YHHI 4DR4E 1N32E 2X7IA 1FWKA 1EI1A 5A2QQ 4DV3E 1IBME 4URLA 2OI2A 4OX9E 1PIEA 2NPFA 3WU6A 3ZKBA 2R42A 3D4JA 2UU9I 4GKKI 2HKEA 2GS8A 3T1HE 1N34E 4DPTA 1IBLE 1FNMA 5BR8I 4LF5I 1Z5AA 3K17A 4B3ME 3B78A 4XTJA 4JYAI 3ZZ0A 4DPYA 5IT9Q 5IWAI 2HK2A 2A2CA 4JI3I 4JI6I 2UUAE 2HKJA 4JI2E 5LMNI 1XMOE 1FJGI 1K47A 2BV3A 4B3TI 4X65I 3LPSA 2UUBI 4JI5E 4PRXA 4GKJI 1J5EI 1Z0TA 4B3SI 4X66E 1Z0VA 4DV7E 2HHHI 1N0UA 4LFCE 3V5RA 4DUZE 2ZBKB 2A2DA 3JAMC 4UT4A 2X36A 1Z0GA 4DV3I 1NHJA 4DV2E 1IBMI 4KQVA 1HNWE 1N33E 4M1KA 4OX9I 1HNXE 4DV6E 4HACA 4DR6E 3LTOA 1KVKA 4JG4A 4LF4I 3T1HI 1UEKA 1N34I 2UUCE 1N0VC 5LMUE 3QT5A 1ZXMA
chains in the Genus database with same CATH superfamily
1FKAE 1IBLI 4JI4E 5DNXA 3PS1A 3HULA 2UXBI 1E3PA 2WNRB 4P52A 2IERA 2JE6A 2Z5BB 4USKA 4B3MI 4JV5E 4DV4E 1IBKE 3P3GA 4RPFA 1Z0CA 4JI0E 4LFAI 3M7NG 2Z5EA 3U1YA 4FW7A 2UUAI 4DR7E 1FI4A 4ZVIA 4IFDA 1XMOI 4JI7E 3L7ZA 4GQUA 4X64E 3WU4A 2Q2EB 2J7KA 5L3JA 1HNZE 4LF7I 4USMA 4LF9E 2BM1A 3PS3A 1XNQE 1I94E 4R1FA 5K36D 2PO1B 1D6TA 4JI5I 2O1WA 4FW9A 1OYPA 3H4LA 2UXDI 1ZM3A 4KHPE 1R6MA 2IOQA 1H7UA 3ZKDA 1KIJA 5JEAB 4JI8I 1OYSA 1R6LA 4IFDC 1Z0BA 1ZM4A 3WU5A 2UXCE 2DEJA 3OTOE 4Z7YA 1ZXNA 4LFCI 4DPUA 5K36A 2GO3A 4AQYE 4DUZI 1YHCA 2NN6E 1NHHA 5DROA 4OO1E 1PVGA 2O1UA 3GMEA 3J80C 4LF6E 3M6AA 4JI1E 1VISA 2C39A 4IFDF 4DV2I 4DV1I 4MDTA 1HNWI 1N33I 2PNZB 2V34A 1HNXI 4N3OA 1EA6A 4DV6I 2PO2B 4DR1E 2VESA 4X62E 4WUCA 3B4TA 5C0XD 3QT8A 5K36C 5GMEA 1HR0E 5DRPA 2ZM6E 4FW3A 1MX0A 2C38A 4YY3E 1MG7A 4AIMA 4MU3A 3M7ND 5LMUI 4JI4I 4B3RE 4IFDD 4U3DA 1A6FA 1B62A 2Z5CA 5C0XA 2C37B 2WP8A 4DR5E 4JV5I 4DPWA 3PYGA 5FLXC 4DV4I 1IBKI 1NZ0A 4QNJA 4HY1A 2UU9E 1KKHA 4DR4I 3GONA 1N32I 4DR7I 2WNRA 4JI7I 4X64I 4NXME 1XNRE 2Z5BA 3CWVA 1HNZI 4OO1B 1B63A 4WUBA 1XNQI 2R3VA 3PYDA 1N36E 1I94I 4DV0E 2PO0A 4IZKA 3PYEA 4KHPI 3PYFA 4MYUA 2AJ4A 1YH8A 4PRVA 4DR3E 2UXCI 5DRRA 3OTOI 4DV5E 4IZJB 4NXNE 4Z7CA 4WUDA 1USUA 3GCMA 3JAMQ 2V2QA 3K1JA 4DR2E 4MU4A 4AQYI 1FJGE 1RREA 1ZM9A 4QNKA 4LOMA 1XMQE 1ZM2A 4LF6I 4JI1I 1H73A 4P7AA 2UUBE 1KTVA 1Z5BA 1H72C 3GLLA 1QZRA 4DPXA 4JI2I 4DR1I 4X62I 4AM3A 3J7AG 2VQFE 2E1RA 4LFBE 4DU7A 1UDOA 1HR0I 3Q6MA 4I3HA 3NZKA 4LF8E 1S16A 4K0KE 2HHHE 4YY3I 3M85G 2PNZA 3J81C 3Q6NA 3T1YE 2BA0G 3CDIA 2XEXA 1DARA 1MU5A 2F4VE 1ELOA 1NHIA 4X66I 3F0NA 4B3RI 2DEIA 1XHKA 2IOPA 2JEBB 4DR5I 4DV7I 5JEAF 2E5LE 2V8PA 5IT9C 4AIDA 1USVA 4LCHA 4OZEA 2PNLA 5K36E 3ZZUA 4IS9A 1PKPA 1U2RA 1FWLA 5EL9A 1Z0EA 4LF4E 4NXMI 1XXEA 1XNRI 1Z0WA 2JE6B 4HXZA 4UTGA 2V2VA 2V2ZA 3B8HA 1N36I 4DR6I 3J81Q 2ZITA 3LNUA 1RR9A 1H7SA 4DV0I 2UXBE 4MU1A 5GMDA 4FWHA 4FW5A 1Y60A 2BA1G 3QT6A 4DR3I 2UUCI 3B82A 4LFAE 4DV5I 3HKMA 4NXNI 2VQEE 4DUYE 4YHHE 3H1CA 3QT7A 2WW4A 2PNMA 5C0XE 4DR2I 3J7AM 4FWDA 2BM0A 3J80Q 2BR2B 4LF7E 1XMQI 4LPFA 5EKWA 4JI0I 4FN5A 1Z59A 3M85D 5ELWA 1VI7A 4GKKE 2BA0D 2UXDE 4FW4A 5K36B 4EMDA 4BA1B 2HFSA 2NN6B 4JI8E 1Y6ZA 4DU8A 2VQFI 4LFBI 4LF9I 3U1KA 2O3ZA 2J65A 1BKNA 3P76A 4LF8I 4K0KI 5JEAD 2JT2A 4OO1F 2LJPA 5BR8E 4LF5E 3T1YI 2HFUA 2F4VI 5FWKA 2HK3A 4ED4A 2CVEA 4JYAE 3CDJA 5IWAE 5FLXQ 3Q1QA 2PO1A 3KRNA 4DV1E 4FWGA 3UHMA 2E5LI 2C38B 4HYMA 2VF3A 4JI3E 4JI6E 3V2UC 3ZZTA 5LL6R 5LMNE 2EFGA 2F1DA 5JEAA 5A2QC 4PU9A 2JEBA 4B3TE 2Z5CB 4X65E 5C0XB 3P06A 4DXLA 1S4EA 2BA1D 2CZ9A 2CGEA 4GKJE 3WU3A 4IFDE 1J5EE 2IESA 5DNLA 4J3DA 1UDNA 4B3SE 1E3HA 4MYTA 1H74A 1Y4SA 5JEAC 3ZM7A 2ZM6I 1OJ4A 4BA2B 1Z5CA 2PO2A 3PRYA 4HACB 2VQEI 1WUUA 4DUYI 4YHHI 4DR4E 2PO0B 1N32E 2X7IA 4IZKB 1FWKA 1EI1A 5A2QQ 4DV3E 4MU0A 2JEAB 1IBME 4URLA 2OI2A 4OX9E 1PIEA 2NPFA 3WU6A 1HK7A 3ZKBA 2R42A 3D4JA 3DD6A 2UU9I 2NN6D 1UDQA 4GKKI 4LCGA 2HKEA 4OO1D 2C37A 2BR2A 2GS8A 3T1HE 2O1TA 4LCFA 1N34E 4U3BA 4NBQA 1RHYA 2GQ0A 4DPTA 1IBLE 1FNMA 3HJCA 1P42A 5BR8I 4LF5I 4IFDB 3L7ZB 4OKGA 1Y5YA 4BA1A 1Z5AA 2NN6A 4MQYA 3K17A 4OO1A 4B3ME 3B78A 4IZJD 4XTJA 4JYAI 3ZZ0A 4DPYA 5IT9Q 5IWAI 2HK2A 2A2CA 4JI3I 4JI6I 2UUAE 2HKJA 4JI2E 5LMNI 1XMOE 1FJGI 1K47A 2BV3A 2NN6C 4B3TI 4X65I 4OO1C 3LPSA 2UUBI 4IZJA 4JI5E 4PRXA 4GKJI 1J5EI 1Z0TA 4B3SI 3PS2A 4X66E 5K36F 3K85A 1Z0VA 2C39B 2O1VA 4DV7E 2HHHI 2NN6F 1N0UA 3P3EA 4LFCE 3V5RA 4ISAA 2GO4A 4DUZE 2ZBKB 2A2DA 2AE8A 3JAMC 4UT4A 2X36A 2CG9A 5DRQA 1OYRA 1Z0GA 4DV3I 1NHJA 4DV2E 1IBMI 4KQVA 1HNWE 1N33E 4M1KA 5C0XC 4BA2A 4OX9I 1HNXE 1Y4UA 4DV6E 4HACA 4FW6A 5JEAE 4DR6E 3LTOA 1UDSA 1KVKA 4JG4A 4LF4I 2WP8B 2JEAA 3P3CA 3T1HI 1UEKA 1N34I 2UUCE 1N0VC 5LMUE 5C0XF 3QT5A 1ZXMA
chains in the Genus database with same CATH topology
1FKAE 1IBLI 4JI4E 3HULA 2UXBI 4P52A 2Z5BB 4USKA 4B3MI 4JV5E 4DV4E 1IBKE 4RPFA 1Z0CA 4JI0E 4LFAI 2Z5EA 2UUAI 4DR7E 1FI4A 4ZVIA 1XMOI 4JI7E 4X64E 3WU4A 2Q2EB 2J7KA 5L3JA 1HNZE 4LF7I 4USMA 4LF9E 2BM1A 1XNQE 1I94E 4R1FA 1D6TA 4JI5I 2O1WA 4FW9A 3H4LA 2UXDI 1ZM3A 4KHPE 2IOQA 1H7UA 3ZKDA 1KIJA 4JI8I 1Z0BA 1ZM4A 3WU5A 2UXCE 2DEJA 3OTOE 4Z7YA 1ZXNA 4LFCI 4DPUA 4AQYE 4DUZI 1NHHA 1PVGA 2O1UA 3J80C 4LF6E 3M6AA 4JI1E 1VISA 4DV2I 4DV1I 1HNWI 1N33I 2V34A 1HNXI 4N3OA 1EA6A 4DV6I 4DR1E 4X62E 4WUCA 3QT8A 5GMEA 1HR0E 2ZM6E 1MX0A 4YY3E 1MG7A 5LMUI 4JI4I 4B3RE 1A6FA 1B62A 2Z5CA 4DR5E 4JV5I 4DPWA 3PYGA 5FLXC 4DV4I 1IBKI 1NZ0A 4HY1A 2UU9E 1KKHA 4DR4I 3GONA 1N32I 4DR7I 4JI7I 4X64I 4NXME 1XNRE 2Z5BA 3CWVA 1HNZI 1B63A 4WUBA 1XNQI 2R3VA 3PYDA 1N36E 1I94I 4DV0E 4IZKA 3PYEA 4KHPI 3PYFA 4MYUA 2AJ4A 4PRVA 4DR3E 2UXCI 3OTOI 4DV5E 4IZJB 4NXNE 4Z7CA 4WUDA 1USUA 3JAMQ 2V2QA 3K1JA 4DR2E 4AQYI 1FJGE 1RREA 1ZM9A 1XMQE 1ZM2A 4LF6I 4JI1I 1H73A 4P7AA 2UUBE 1KTVA 1Z5BA 1H72C 1QZRA 4DPXA 4JI2I 4DR1I 4X62I 3J7AG 2VQFE 2E1RA 4LFBE 4DU7A 1HR0I 3Q6MA 4I3HA 4LF8E 1S16A 4K0KE 2HHHE 4YY3I 3J81C 3Q6NA 3T1YE 2XEXA 1DARA 1MU5A 2F4VE 1ELOA 1NHIA 4X66I 3F0NA 4B3RI 2DEIA 1XHKA 2IOPA 4DR5I 4DV7I 2E5LE 2V8PA 5IT9C 1USVA 2PNLA 3ZZUA 1PKPA 1U2RA 1FWLA 1Z0EA 4LF4E 4NXMI 1XNRI 1Z0WA 4HXZA 4UTGA 2V2VA 2V2ZA 3B8HA 1N36I 4DR6I 3J81Q 2ZITA 3LNUA 1RR9A 1H7SA 4DV0I 2UXBE 5GMDA 4FWHA 3QT6A 4DR3I 2UUCI 3B82A 4LFAE 4DV5I 4NXNI 2VQEE 4DUYE 4YHHE 3QT7A 2WW4A 2PNMA 4DR2I 3J7AM 4FWDA 2BM0A 3J80Q 4LF7E 1XMQI 4JI0I 4FN5A 1Z59A 4GKKE 2UXDE 4EMDA 2HFSA 4DU8A 4JI8E 1Y6ZA 2VQFI 4LFBI 4LF9I 1BKNA 4LF8I 4K0KI 2LJPA 5BR8E 4LF5E 3T1YI 2HFUA 2F4VI 5FWKA 2HK3A 4ED4A 4JYAE 5IWAE 5FLXQ 3Q1QA 4DV1E 4FWGA 2E5LI 4HYMA 2VF3A 4JI3E 4JI6E 3V2UC 3ZZTA 5LL6R 5LMNE 2EFGA 5A2QC 4PU9A 4B3TE 2Z5CB 4X65E 3P06A 4DXLA 1S4EA 2CZ9A 2CGEA 4GKJE 3WU3A 1J5EE 4B3SE 4MYTA 1H74A 1Y4SA 3ZM7A 2ZM6I 1OJ4A 1Z5CA 3PRYA 4HACB 2VQEI 1WUUA 4DUYI 4YHHI 4DR4E 1N32E 2X7IA 4IZKB 1FWKA 1EI1A 5A2QQ 4DV3E 1IBME 4URLA 2OI2A 4OX9E 1PIEA 2NPFA 3WU6A 1HK7A 3ZKBA 2R42A 3D4JA 2UU9I 4GKKI 2HKEA 2GS8A 3T1HE 2O1TA 1N34E 2GQ0A 4DPTA 1IBLE 1FNMA 3HJCA 5BR8I 4LF5I 1Z5AA 3K17A 4B3ME 3B78A 4IZJD 4XTJA 4JYAI 3ZZ0A 4DPYA 5IT9Q 5IWAI 2HK2A 2A2CA 4JI3I 4JI6I 2UUAE 2HKJA 4JI2E 5LMNI 1XMOE 1FJGI 1K47A 2BV3A 4B3TI 4X65I 3LPSA 2UUBI 4IZJA 4JI5E 4PRXA 4GKJI 1J5EI 1Z0TA 4B3SI 4X66E 3K85A 1Z0VA 2O1VA 4DV7E 2HHHI 1N0UA 4LFCE 3V5RA 4DUZE 2ZBKB 2A2DA 3JAMC 4UT4A 2X36A 2CG9A 1Z0GA 4DV3I 1NHJA 4DV2E 1IBMI 4KQVA 1HNWE 1N33E 4M1KA 4OX9I 1HNXE 1Y4UA 4DV6E 4HACA 4DR6E 3LTOA 1KVKA 4JG4A 4LF4I 3T1HI 1UEKA 1N34I 2UUCE 1N0VC 5LMUE 3QT5A 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKA E;  1IBL I;  4JI4 E;  3HUL A;  2UXB I;  4P52 A;  4USK A;  4B3M I;  4JV5 E;  4DV4 E;  1IBK E;  4RPF A;  1Z0C A;  4JI0 E;  4LFA I;  2UUA I;  4DR7 E;  1FI4 A;  4ZVI A;  1XMO I;  4JI7 E;  4X64 E;  3WU4 A;  2Q2E B;  2J7K A;  5L3J A;  1HNZ E;  4LF7 I;  4USM A;  4LF9 E;  2BM1 A;  1XNQ E;  1I94 E;  4R1F A;  1D6T A;  4JI5 I;  4FW9 A;  3H4L A;  2UXD I;  1ZM3 A;  4KHP E;  1H7U A;  3ZKD A;  1KIJ A;  4JI8 I;  1Z0B A;  1ZM4 A;  3WU5 A;  2UXC E;  2DEJ A;  3OTO E;  4Z7Y A;  1ZXN A;  4LFC I;  4DPU A;  4AQY E;  4DUZ I;  1NHH A;  1PVG A;  3J80 C;  4LF6 E;  3M6A A;  4JI1 E;  1VIS A;  4DV2 I;  4DV1 I;  1HNW I;  1N33 I;  2V34 A;  1HNX I;  1EA6 A;  4DV6 I;  4DR1 E;  4X62 E;  4WUC A;  3QT8 A;  5GME A;  1HR0 E;  2ZM6 E;  1MX0 A;  4YY3 E;  1MG7 A;  5LMU I;  4JI4 I;  4B3R E;  1A6F A;  1B62 A;  4DR5 E;  4JV5 I;  4DPW A;  3PYG A;  5FLX C;  4DV4 I;  1IBK I;  1NZ0 A;  4HY1 A;  2UU9 E;  1KKH A;  4DR4 I;  3GON A;  1N32 I;  4DR7 I;  4JI7 I;  4X64 I;  4NXM E;  1XNR E;  3CWV A;  1HNZ I;  1B63 A;  4WUB A;  1XNQ I;  2R3V A;  3PYD A;  1N36 E;  1I94 I;  4DV0 E;  3PYE A;  4KHP I;  3PYF A;  4MYU A;  2AJ4 A;  4PRV A;  4DR3 E;  2UXC I;  3OTO I;  4DV5 E;  4NXN E;  4Z7C A;  4WUD A;  3JAM Q;  2V2Q A;  3K1J A;  4DR2 E;  4AQY I;  1FJG E;  1RRE A;  1ZM9 A;  1XMQ E;  1ZM2 A;  4LF6 I;  4JI1 I;  1H73 A;  4P7A A;  2UUB E;  1KTV A;  1Z5B A;  1H72 C;  1QZR A;  4DPX A;  4JI2 I;  4DR1 I;  4X62 I;  3J7A G;  2VQF E;  2E1R A;  4LFB E;  4DU7 A;  1HR0 I;  4I3H A;  4LF8 E;  1S16 A;  4K0K E;  2HHH E;  4YY3 I;  3J81 C;  3T1Y E;  2XEX A;  1DAR A;  1MU5 A;  2F4V E;  1ELO A;  1NHI A;  4X66 I;  3F0N A;  4B3R I;  2DEI A;  1XHK A;  4DR5 I;  4DV7 I;  2E5L E;  2V8P A;  5IT9 C;  3ZZU A;  1PKP A;  1U2R A;  1FWL A;  1Z0E A;  4LF4 E;  4NXM I;  1XNR I;  1Z0W A;  4HXZ A;  4UTG A;  2V2V A;  2V2Z A;  3B8H A;  1N36 I;  4DR6 I;  3J81 Q;  2ZIT A;  3LNU A;  1RR9 A;  1H7S A;  4DV0 I;  2UXB E;  5GMD A;  4FWH A;  3QT6 A;  4DR3 I;  2UUC I;  3B82 A;  4LFA E;  4DV5 I;  4NXN I;  2VQE E;  4DUY E;  4YHH E;  3QT7 A;  2WW4 A;  4DR2 I;  3J7A M;  4FWD A;  2BM0 A;  3J80 Q;  4LF7 E;  1XMQ I;  4JI0 I;  4FN5 A;  1Z59 A;  4GKK E;  2UXD E;  4EMD A;  2HFS A;  4DU8 A;  4JI8 E;  2VQF I;  4LFB I;  4LF9 I;  1BKN A;  4LF8 I;  4K0K I;  2LJP A;  5BR8 E;  4LF5 E;  3T1Y I;  2HFU A;  2F4V I;  2HK3 A;  4ED4 A;  4JYA E;  5IWA E;  5FLX Q;  3Q1Q A;  4DV1 E;  4FWG A;  2E5L I;  4HYM A;  2VF3 A;  4JI3 E;  4JI6 E;  3V2U C;  3ZZT A;  5LL6 R;  5LMN E;  2EFG A;  5A2Q C;  4PU9 A;  4B3T E;  4X65 E;  4DXL A;  1S4E A;  2CZ9 A;  4GKJ E;  3WU3 A;  1J5E E;  4B3S E;  4MYT A;  1H74 A;  3ZM7 A;  2ZM6 I;  1OJ4 A;  1Z5C A;  4HAC B;  2VQE I;  1WUU A;  4DUY I;  4YHH I;  4DR4 E;  1N32 E;  2X7I A;  1FWK A;  1EI1 A;  5A2Q Q;  4DV3 E;  1IBM E;  4URL A;  2OI2 A;  4OX9 E;  1PIE A;  2NPF A;  3WU6 A;  3ZKB A;  2R42 A;  3D4J A;  2UU9 I;  4GKK I;  2HKE A;  2GS8 A;  3T1H E;  1N34 E;  4DPT A;  1IBL E;  1FNM A;  5BR8 I;  4LF5 I;  1Z5A A;  3K17 A;  4B3M E;  3B78 A;  4XTJ A;  4JYA I;  3ZZ0 A;  4DPY A;  5IT9 Q;  5IWA I;  2HK2 A;  2A2C A;  4JI3 I;  4JI6 I;  2UUA E;  2HKJ A;  4JI2 E;  5LMN I;  1XMO E;  1FJG I;  1K47 A;  2BV3 A;  4B3T I;  4X65 I;  3LPS A;  2UUB I;  4JI5 E;  4PRX A;  4GKJ I;  1J5E I;  1Z0T A;  4B3S I;  4X66 E;  1Z0V A;  4DV7 E;  2HHH I;  1N0U A;  4LFC E;  3V5R A;  4DUZ E;  2ZBK B;  2A2D A;  3JAM C;  4UT4 A;  2X36 A;  1Z0G A;  4DV3 I;  1NHJ A;  4DV2 E;  1IBM I;  4KQV A;  1HNW E;  1N33 E;  4M1K A;  4OX9 I;  1HNX E;  4DV6 E;  4HAC A;  4DR6 E;  3LTO A;  1KVK A;  4JG4 A;  4LF4 I;  3T1H I;  1UEK A;  1N34 I;  2UUC E;  1N0V C;  5LMU E;  3QT5 A;  1ZXM A; 
#chains in the Genus database with same CATH topology
 1FKA E;  1IBL I;  4JI4 E;  5DNX A;  3PS1 A;  3HUL A;  2UXB I;  1E3P A;  2WNR B;  4P52 A;  2IER A;  2JE6 A;  2Z5B B;  4USK A;  4B3M I;  4JV5 E;  4DV4 E;  1IBK E;  3P3G A;  4RPF A;  1Z0C A;  4JI0 E;  4LFA I;  3M7N G;  2Z5E A;  3U1Y A;  4FW7 A;  2UUA I;  4DR7 E;  1FI4 A;  4ZVI A;  4IFD A;  1XMO I;  4JI7 E;  3L7Z A;  4GQU A;  4X64 E;  3WU4 A;  2Q2E B;  2J7K A;  5L3J A;  1HNZ E;  4LF7 I;  4USM A;  4LF9 E;  2BM1 A;  3PS3 A;  1XNQ E;  1I94 E;  4R1F A;  5K36 D;  2PO1 B;  1D6T A;  4JI5 I;  2O1W A;  4FW9 A;  1OYP A;  3H4L A;  2UXD I;  1ZM3 A;  4KHP E;  1R6M A;  2IOQ A;  1H7U A;  3ZKD A;  1KIJ A;  5JEA B;  4JI8 I;  1OYS A;  1R6L A;  4IFD C;  1Z0B A;  1ZM4 A;  3WU5 A;  2UXC E;  2DEJ A;  3OTO E;  4Z7Y A;  1ZXN A;  4LFC I;  4DPU A;  5K36 A;  2GO3 A;  4AQY E;  4DUZ I;  1YHC A;  2NN6 E;  1NHH A;  5DRO A;  4OO1 E;  1PVG A;  2O1U A;  3GME A;  3J80 C;  4LF6 E;  3M6A A;  4JI1 E;  1VIS A;  2C39 A;  4IFD F;  4DV2 I;  4DV1 I;  4MDT A;  1HNW I;  1N33 I;  2PNZ B;  2V34 A;  1HNX I;  4N3O A;  1EA6 A;  4DV6 I;  2PO2 B;  4DR1 E;  2VES A;  4X62 E;  4WUC A;  3B4T A;  5C0X D;  3QT8 A;  5K36 C;  5GME A;  1HR0 E;  5DRP A;  2ZM6 E;  4FW3 A;  1MX0 A;  2C38 A;  4YY3 E;  1MG7 A;  4AIM A;  4MU3 A;  3M7N D;  5LMU I;  4JI4 I;  4B3R E;  4IFD D;  4U3D A;  1A6F A;  1B62 A;  2Z5C A;  5C0X A;  2C37 B;  2WP8 A;  4DR5 E;  4JV5 I;  4DPW A;  3PYG A;  5FLX C;  4DV4 I;  1IBK I;  1NZ0 A;  4QNJ A;  4HY1 A;  2UU9 E;  1KKH A;  4DR4 I;  3GON A;  1N32 I;  4DR7 I;  2WNR A;  4JI7 I;  4X64 I;  4NXM E;  1XNR E;  2Z5B A;  3CWV A;  1HNZ I;  4OO1 B;  1B63 A;  4WUB A;  1XNQ I;  2R3V A;  3PYD A;  1N36 E;  1I94 I;  4DV0 E;  2PO0 A;  4IZK A;  3PYE A;  4KHP I;  3PYF A;  4MYU A;  2AJ4 A;  1YH8 A;  4PRV A;  4DR3 E;  2UXC I;  5DRR A;  3OTO I;  4DV5 E;  4IZJ B;  4NXN E;  4Z7C A;  4WUD A;  1USU A;  3GCM A;  3JAM Q;  2V2Q A;  3K1J A;  4DR2 E;  4MU4 A;  4AQY I;  1FJG E;  1RRE A;  1ZM9 A;  4QNK A;  4LOM A;  1XMQ E;  1ZM2 A;  4LF6 I;  4JI1 I;  1H73 A;  4P7A A;  2UUB E;  1KTV A;  1Z5B A;  1H72 C;  3GLL A;  1QZR A;  4DPX A;  4JI2 I;  4DR1 I;  4X62 I;  4AM3 A;  3J7A G;  2VQF E;  2E1R A;  4LFB E;  4DU7 A;  1UDO A;  1HR0 I;  3Q6M A;  4I3H A;  3NZK A;  4LF8 E;  1S16 A;  4K0K E;  2HHH E;  4YY3 I;  3M85 G;  2PNZ A;  3J81 C;  3Q6N A;  3T1Y E;  2BA0 G;  3CDI A;  2XEX A;  1DAR A;  1MU5 A;  2F4V E;  1ELO A;  1NHI A;  4X66 I;  3F0N A;  4B3R I;  2DEI A;  1XHK A;  2IOP A;  2JEB B;  4DR5 I;  4DV7 I;  5JEA F;  2E5L E;  2V8P A;  5IT9 C;  4AID A;  1USV A;  4LCH A;  4OZE A;  2PNL A;  5K36 E;  3ZZU A;  4IS9 A;  1PKP A;  1U2R A;  1FWL A;  5EL9 A;  1Z0E A;  4LF4 E;  4NXM I;  1XXE A;  1XNR I;  1Z0W A;  2JE6 B;  4HXZ A;  4UTG A;  2V2V A;  2V2Z A;  3B8H A;  1N36 I;  4DR6 I;  3J81 Q;  2ZIT A;  3LNU A;  1RR9 A;  1H7S A;  4DV0 I;  2UXB E;  4MU1 A;  5GMD A;  4FWH A;  4FW5 A;  1Y60 A;  2BA1 G;  3QT6 A;  4DR3 I;  2UUC I;  3B82 A;  4LFA E;  4DV5 I;  3HKM A;  4NXN I;  2VQE E;  4DUY E;  4YHH E;  3H1C A;  3QT7 A;  2WW4 A;  2PNM A;  5C0X E;  4DR2 I;  3J7A M;  4FWD A;  2BM0 A;  3J80 Q;  2BR2 B;  4LF7 E;  1XMQ I;  4LPF A;  5EKW A;  4JI0 I;  4FN5 A;  1Z59 A;  3M85 D;  5ELW A;  1VI7 A;  4GKK E;  2BA0 D;  2UXD E;  4FW4 A;  5K36 B;  4EMD A;  4BA1 B;  2HFS A;  2NN6 B;  4JI8 E;  1Y6Z A;  4DU8 A;  2VQF I;  4LFB I;  4LF9 I;  3U1K A;  2O3Z A;  2J65 A;  1BKN A;  3P76 A;  4LF8 I;  4K0K I;  5JEA D;  2JT2 A;  4OO1 F;  2LJP A;  5BR8 E;  4LF5 E;  3T1Y I;  2HFU A;  2F4V I;  5FWK A;  2HK3 A;  4ED4 A;  2CVE A;  4JYA E;  3CDJ A;  5IWA E;  5FLX Q;  3Q1Q A;  2PO1 A;  3KRN A;  4DV1 E;  4FWG A;  3UHM A;  2E5L I;  2C38 B;  4HYM A;  2VF3 A;  4JI3 E;  4JI6 E;  3V2U C;  3ZZT A;  5LL6 R;  5LMN E;  2EFG A;  2F1D A;  5JEA A;  5A2Q C;  4PU9 A;  2JEB A;  4B3T E;  2Z5C B;  4X65 E;  5C0X B;  3P06 A;  4DXL A;  1S4E A;  2BA1 D;  2CZ9 A;  2CGE A;  4GKJ E;  3WU3 A;  4IFD E;  1J5E E;  2IES A;  5DNL A;  4J3D A;  1UDN A;  4B3S E;  1E3H A;  4MYT A;  1H74 A;  1Y4S A;  5JEA C;  3ZM7 A;  2ZM6 I;  1OJ4 A;  4BA2 B;  1Z5C A;  2PO2 A;  3PRY A;  4HAC B;  2VQE I;  1WUU A;  4DUY I;  4YHH I;  4DR4 E;  2PO0 B;  1N32 E;  2X7I A;  4IZK B;  1FWK A;  1EI1 A;  5A2Q Q;  4DV3 E;  4MU0 A;  2JEA B;  1IBM E;  4URL A;  2OI2 A;  4OX9 E;  1PIE A;  2NPF A;  3WU6 A;  1HK7 A;  3ZKB A;  2R42 A;  3D4J A;  3DD6 A;  2UU9 I;  2NN6 D;  1UDQ A;  4GKK I;  4LCG A;  2HKE A;  4OO1 D;  2C37 A;  2BR2 A;  2GS8 A;  3T1H E;  2O1T A;  4LCF A;  1N34 E;  4U3B A;  4NBQ A;  1RHY A;  2GQ0 A;  4DPT A;  1IBL E;  1FNM A;  3HJC A;  1P42 A;  5BR8 I;  4LF5 I;  4IFD B;  3L7Z B;  4OKG A;  1Y5Y A;  4BA1 A;  1Z5A A;  2NN6 A;  4MQY A;  3K17 A;  4OO1 A;  4B3M E;  3B78 A;  4IZJ D;  4XTJ A;  4JYA I;  3ZZ0 A;  4DPY A;  5IT9 Q;  5IWA I;  2HK2 A;  2A2C A;  4JI3 I;  4JI6 I;  2UUA E;  2HKJ A;  4JI2 E;  5LMN I;  1XMO E;  1FJG I;  1K47 A;  2BV3 A;  2NN6 C;  4B3T I;  4X65 I;  4OO1 C;  3LPS A;  2UUB I;  4IZJ A;  4JI5 E;  4PRX A;  4GKJ I;  1J5E I;  1Z0T A;  4B3S I;  3PS2 A;  4X66 E;  5K36 F;  3K85 A;  1Z0V A;  2C39 B;  2O1V A;  4DV7 E;  2HHH I;  2NN6 F;  1N0U A;  3P3E A;  4LFC E;  3V5R A;  4ISA A;  2GO4 A;  4DUZ E;  2ZBK B;  2A2D A;  2AE8 A;  3JAM C;  4UT4 A;  2X36 A;  2CG9 A;  5DRQ A;  1OYR A;  1Z0G A;  4DV3 I;  1NHJ A;  4DV2 E;  1IBM I;  4KQV A;  1HNW E;  1N33 E;  4M1K A;  5C0X C;  4BA2 A;  4OX9 I;  1HNX E;  1Y4U A;  4DV6 E;  4HAC A;  4FW6 A;  5JEA E;  4DR6 E;  3LTO A;  1UDS A;  1KVK A;  4JG4 A;  4LF4 I;  2WP8 B;  2JEA A;  3P3C A;  3T1H I;  1UEK A;  1N34 I;  2UUC E;  1N0V C;  5LMU E;  5C0X F;  3QT5 A;  1ZXM A; 
#chains in the Genus database with same CATH homology
 1FKA E;  1IBL I;  4JI4 E;  3HUL A;  2UXB I;  4P52 A;  2Z5B B;  4USK A;  4B3M I;  4JV5 E;  4DV4 E;  1IBK E;  4RPF A;  1Z0C A;  4JI0 E;  4LFA I;  2Z5E A;  2UUA I;  4DR7 E;  1FI4 A;  4ZVI A;  1XMO I;  4JI7 E;  4X64 E;  3WU4 A;  2Q2E B;  2J7K A;  5L3J A;  1HNZ E;  4LF7 I;  4USM A;  4LF9 E;  2BM1 A;  1XNQ E;  1I94 E;  4R1F A;  1D6T A;  4JI5 I;  2O1W A;  4FW9 A;  3H4L A;  2UXD I;  1ZM3 A;  4KHP E;  2IOQ A;  1H7U A;  3ZKD A;  1KIJ A;  4JI8 I;  1Z0B A;  1ZM4 A;  3WU5 A;  2UXC E;  2DEJ A;  3OTO E;  4Z7Y A;  1ZXN A;  4LFC I;  4DPU A;  4AQY E;  4DUZ I;  1NHH A;  1PVG A;  2O1U A;  3J80 C;  4LF6 E;  3M6A A;  4JI1 E;  1VIS A;  4DV2 I;  4DV1 I;  1HNW I;  1N33 I;  2V34 A;  1HNX I;  4N3O A;  1EA6 A;  4DV6 I;  4DR1 E;  4X62 E;  4WUC A;  3QT8 A;  5GME A;  1HR0 E;  2ZM6 E;  1MX0 A;  4YY3 E;  1MG7 A;  5LMU I;  4JI4 I;  4B3R E;  1A6F A;  1B62 A;  2Z5C A;  4DR5 E;  4JV5 I;  4DPW A;  3PYG A;  5FLX C;  4DV4 I;  1IBK I;  1NZ0 A;  4HY1 A;  2UU9 E;  1KKH A;  4DR4 I;  3GON A;  1N32 I;  4DR7 I;  4JI7 I;  4X64 I;  4NXM E;  1XNR E;  2Z5B A;  3CWV A;  1HNZ I;  1B63 A;  4WUB A;  1XNQ I;  2R3V A;  3PYD A;  1N36 E;  1I94 I;  4DV0 E;  4IZK A;  3PYE A;  4KHP I;  3PYF A;  4MYU A;  2AJ4 A;  4PRV A;  4DR3 E;  2UXC I;  3OTO I;  4DV5 E;  4IZJ B;  4NXN E;  4Z7C A;  4WUD A;  1USU A;  3JAM Q;  2V2Q A;  3K1J A;  4DR2 E;  4AQY I;  1FJG E;  1RRE A;  1ZM9 A;  1XMQ E;  1ZM2 A;  4LF6 I;  4JI1 I;  1H73 A;  4P7A A;  2UUB E;  1KTV A;  1Z5B A;  1H72 C;  1QZR A;  4DPX A;  4JI2 I;  4DR1 I;  4X62 I;  3J7A G;  2VQF E;  2E1R A;  4LFB E;  4DU7 A;  1HR0 I;  3Q6M A;  4I3H A;  4LF8 E;  1S16 A;  4K0K E;  2HHH E;  4YY3 I;  3J81 C;  3Q6N A;  3T1Y E;  2XEX A;  1DAR A;  1MU5 A;  2F4V E;  1ELO A;  1NHI A;  4X66 I;  3F0N A;  4B3R I;  2DEI A;  1XHK A;  2IOP A;  4DR5 I;  4DV7 I;  2E5L E;  2V8P A;  5IT9 C;  1USV A;  2PNL A;  3ZZU A;  1PKP A;  1U2R A;  1FWL A;  1Z0E A;  4LF4 E;  4NXM I;  1XNR I;  1Z0W A;  4HXZ A;  4UTG A;  2V2V A;  2V2Z A;  3B8H A;  1N36 I;  4DR6 I;  3J81 Q;  2ZIT A;  3LNU A;  1RR9 A;  1H7S A;  4DV0 I;  2UXB E;  5GMD A;  4FWH A;  3QT6 A;  4DR3 I;  2UUC I;  3B82 A;  4LFA E;  4DV5 I;  4NXN I;  2VQE E;  4DUY E;  4YHH E;  3QT7 A;  2WW4 A;  2PNM A;  4DR2 I;  3J7A M;  4FWD A;  2BM0 A;  3J80 Q;  4LF7 E;  1XMQ I;  4JI0 I;  4FN5 A;  1Z59 A;  4GKK E;  2UXD E;  4EMD A;  2HFS A;  4DU8 A;  4JI8 E;  1Y6Z A;  2VQF I;  4LFB I;  4LF9 I;  1BKN A;  4LF8 I;  4K0K I;  2LJP A;  5BR8 E;  4LF5 E;  3T1Y I;  2HFU A;  2F4V I;  5FWK A;  2HK3 A;  4ED4 A;  4JYA E;  5IWA E;  5FLX Q;  3Q1Q A;  4DV1 E;  4FWG A;  2E5L I;  4HYM A;  2VF3 A;  4JI3 E;  4JI6 E;  3V2U C;  3ZZT A;  5LL6 R;  5LMN E;  2EFG A;  5A2Q C;  4PU9 A;  4B3T E;  2Z5C B;  4X65 E;  3P06 A;  4DXL A;  1S4E A;  2CZ9 A;  2CGE A;  4GKJ E;  3WU3 A;  1J5E E;  4B3S E;  4MYT A;  1H74 A;  1Y4S A;  3ZM7 A;  2ZM6 I;  1OJ4 A;  1Z5C A;  3PRY A;  4HAC B;  2VQE I;  1WUU A;  4DUY I;  4YHH I;  4DR4 E;  1N32 E;  2X7I A;  4IZK B;  1FWK A;  1EI1 A;  5A2Q Q;  4DV3 E;  1IBM E;  4URL A;  2OI2 A;  4OX9 E;  1PIE A;  2NPF A;  3WU6 A;  1HK7 A;  3ZKB A;  2R42 A;  3D4J A;  2UU9 I;  4GKK I;  2HKE A;  2GS8 A;  3T1H E;  2O1T A;  1N34 E;  2GQ0 A;  4DPT A;  1IBL E;  1FNM A;  3HJC A;  5BR8 I;  4LF5 I;  1Z5A A;  3K17 A;  4B3M E;  3B78 A;  4IZJ D;  4XTJ A;  4JYA I;  3ZZ0 A;  4DPY A;  5IT9 Q;  5IWA I;  2HK2 A;  2A2C A;  4JI3 I;  4JI6 I;  2UUA E;  2HKJ A;  4JI2 E;  5LMN I;  1XMO E;  1FJG I;  1K47 A;  2BV3 A;  4B3T I;  4X65 I;  3LPS A;  2UUB I;  4IZJ A;  4JI5 E;  4PRX A;  4GKJ I;  1J5E I;  1Z0T A;  4B3S I;  4X66 E;  3K85 A;  1Z0V A;  2O1V A;  4DV7 E;  2HHH I;  1N0U A;  4LFC E;  3V5R A;  4DUZ E;  2ZBK B;  2A2D A;  3JAM C;  4UT4 A;  2X36 A;  2CG9 A;  1Z0G A;  4DV3 I;  1NHJ A;  4DV2 E;  1IBM I;  4KQV A;  1HNW E;  1N33 E;  4M1K A;  4OX9 I;  1HNX E;  1Y4U A;  4DV6 E;  4HAC A;  4DR6 E;  3LTO A;  1KVK A;  4JG4 A;  4LF4 I;  3T1H I;  1UEK A;  1N34 I;  2UUC E;  1N0V C;  5LMU E;  3QT5 A;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...