2Z5CB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
147
structure length
106
Chain Sequence
b'ISYEFQTHKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYQVVTKLGDSADPKVPVVCVQIAELYRRVILPQFSLLISMSSKIWNDFGKLVFVLKCIKDMYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
molecule tags Chaperone/hydrolase
source organism Saccharomyces cerevisiae
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
total genus 29
structure length 106
sequence length 147
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cB00
2Z5CB 2Z5EA 2Z5BB
chains in the Genus database with same CATH superfamily
2WP8A 5K36D 4JYAE 5JEAB 2PNLA 4DV6I 4DV3E 4OO1E 2C38B 2R42A 2X7IA 4DV0E 1FJGI 4IFDA 3M7ND 3ZZUA 2BR2A 4XTJA 1HNWI 1ELOA 2BA0D 4K0KI 4K0KE 3CDJA 3M7NG 1Y4UA 2HFSA 1KKHA 1MG7A 3T1HE 1XNRI 1XNRE 2ZM6I 4IFDD 4FW5A 4QNJA 4JI0E 3K85A 1IBLE 5LMNE 2A2CA 4NXNE 2BM0A 4DV0I 4X65E 1FJGE 5A2QC 3J80C 1N0UA 2UUAE 1MU5A 1H72C 2JEAA 3ZKDA 3J7AM 4KHPI 2DEJA 2UXDE 1IBMI 5DROA 1E3PA 2BV3A 4FWGA 2ZM6E 4B3ME 1J5EE 4BA2B 1UEKA 1IBKE 4FWHA 1DARA 1Y60A 2JE6A 4P7AA 2LJPA 2BA1D 4LCFA 2HFUA 4BA1B 4DUYI 2UU9E 1Z0CA 2BM1A 1MX0A 1RHYA 5FWKA 5DNXA 1Y4SA 1Z0WA 4LFBE 3M85D 1NHIA 1RREA 2HK2A 4FW9A 3QT5A 1OYRA 1Z5CA 4LF9E 1OYSA 5K36E 4HXZA 2J7KA 4JI5E 2PO1A 3GCMA 3HULA 4AM3A 1B62A 2AE8A 4OO1C 3B4TA 4EMDA 4DV3I 4WUBA 4X64E 4OKGA 4FW6A 4DV4I 1N32E 4DR5I 2OI2A 4DR5E 3CDIA 1RR9A 2F1DA 3JAMQ 5FLXQ 1S4EA 2UU9I 2PO1B 4JI3I 4JG4A 5IT9C 1Z0TA 2CGEA 2Z5CB 5C0XA 2VQEE 1Y5YA 1XMQE 2F4VI 5C0XE 1PIEA 5IWAI 1ZXNA 4ZVIA 3K17A 4DV7E 1N36I 1FWKA 4IZJD 1Z5AA 4DPWA 4LCGA 1Z0EA 2HKEA 1EI1A 1OJ4A 4X62I 2UXBE 3KRNA 4X66E 3DD6A 2IOPA 4LF4I 2JEBB 4LF4E 1H7SA 4HYMA 4DV5I 5JEAC 2C38A 1ZM3A 4FW7A 2NPFA 2UUCI 3T1HI 4DUYE 2IOQA 3GONA 3L7ZA 3PYGA 2VQEI 4U3BA 3P76A 4MU4A 4MU3A 4KQVA 3P3CA 1XNQI 2VQFI 4FN5A 2PO0B 3M6AA 4DR6E 4IFDE 2PO2B 4P52A 3LPSA 3PYDA 4OO1D 3QT6A 2UXDI 4LFAI 3PS3A 3WU6A 1N34I 4MQYA 4DV2I 4FWDA 2HHHI 1N0VC 4IFDC 2GO3A 3P3GA 4DV6E 1IBLI 2O1TA 2C37A 4NXME 4DR1I 3Q6MA 4AIDA 1NHJA 4MU0A 3QT8A 4N3OA 4LFCI 5K36B 1PKPA 4OX9I 1A6FA 1B63A 4JI8E 2O1UA 3J81C 4AQYI 3JAMC 4JI4E 3PS2A 1HNWE 2BA0G 1UDNA 2Z5EA 1ZM9A 4LF5E 2JEBA 3OTOE 4NBQA 2UXCI 1N36E 1E3HA 1NHHA 5LMUE 2NN6F 4BA1A 4DPYA 2J65A 1Z0VA 4IZKB 1H74A 4KHPE 1KTVA 4JI4I 1XXEA 4DR4I 4JI0I 4JV5I 4LOMA 1FI4A 4BA2A 5BR8I 5IT9Q 4X65I 3B82A 2UUCE 2PO2A 4JI8I 5C0XB 4R1FA 1FNMA 3Q1QA 2V8PA 3P06A 4JI1E 4LF6E 3WU3A 1UDQA 3PYEA 3LTOA 4OO1F 4GKKE 5JEAD 4DR6I 4ISAA 3D4JA 4USKA 2WNRA 3J81Q 4YY3I 4LFBI 2E5LE 1R6LA 2NN6B 3U1KA 1Z0GA 4IFDF 3WU4A 3ZZ0A 2NN6A 2JE6B 4LFCE 2X36A 4OX9E 4JI2E 2WNRB 2HHHE 1ZXMA 4FW4A 2WW4A 5JEAE 4NXMI 4J3DA 1HR0E 3F0NA 1N33E 4LF7I 4PRXA 4LF7E 4DR2E 4DR3E 1HNZI 2E1RA 2V2ZA 4LF9I 5K36A 4UTGA 2V2QA 3NZKA 1KVKA 3H4LA 5EL9A 2NN6D 2O1VA 1H73A 1Y6ZA 2BA1G 3PRYA 4B3TE 3PS1A 2NN6E 4JI1I 4LF6I 3V2UC 4PU9A 1N33I 4GKKI 1Z59A 4QNKA 3HJCA 4DUZI 2EFGA 1R6MA 4X62E 2UXBI 1H7UA 5L3JA 2XEXA 5BR8E 2E5LI 4LF8I 3UHMA 4DU8A 4OO1B 4DR2I 4DR3I 1HNZE 1NZ0A 3Q6NA 3J7AG 3ZM7A 3HKMA 2UUBE 4MYUA 2CZ9A 4LFAE 4YY3E 4GKJE 2GQ0A 1P42A 1EA6A 4RPFA 2VQFE 1QZRA 1VI7A 4DU7A 2O1WA 2C37B 3P3EA 2JEAB 3OTOI 2UXCE 2DEIA 2ZITA 4M1KA 2O3ZA 4WUCA 5DRPA 5GMDA 4MDTA 1J5EI 1XMOE 4JI2I 2R3VA 2NN6C 4HACB 4HACA 4WUDA 1UDOA 2PO0A 4X64I 5GMEA 3H1CA 2UUAI 4LF5I 3PYFA 3GLLA 4YHHE 4YHHI 3B8HA 4I3HA 5ELWA 1PVGA 3GMEA 5EKWA 4LCHA 1WUUA 3L7ZB 4JYAI 3V5RA 1USVA 2Q2EB 4ED4A 5C0XC 2F4VE 5IWAE 4NXNI 2A2DA 4DV1I 4DR1E 2BR2B 4IS9A 4LPFA 4DPXA 2AJ4A 3K1JA 1USUA 4DUZE 1XMOI 4B3MI 4B3TI 2GS8A 4DXLA 4B3SI 4OO1A 1D6TA 2WP8B 4JV5E 4U3DA 1IBKI 3U1YA 3LNUA 2ZBKB 5C0XD 4DV1E 1U2RA 1HK7A 2PNZA 4OZEA 1ZM2A 1BKNA 4MU1A 5LMUI 2IESA 3ZZTA 3WU5A 2Z5CA 2Z5BA 4GKJI 2C39B 4DPUA 4DR7I 4AQYE 1I94E 5K36C 1Z5BA 4IZJA 5DRRA 3ZKBA 5LL6R 2GO4A 4JI7E 5DNLA 4HY1A 2IERA 1Z0BA 4DV2E 1N34E 4Z7CA 2C39A 2CVEA 1I94I 2PNMA 1ZM4A 5A2QQ 3J80Q 1YH8A 4GQUA 4DV7I 5DRQA 3T1YE 1N32I 2VESA 3M85G 1UDSA 2Z5BB 1HNXI 4JI6E 4B3SE 1HR0I 2JT2A 2PNZB 1XMQI 4LF8E 1YHCA 2HK3A 1S16A 1KIJA 1VISA 4MYTA 4DPTA 1XHKA 4Z7YA 1FKAE 4JI3E 4IFDB 4URLA 2UUBI 4PRVA 1HNXE 3QT7A 4DR4E 5JEAA 2HKJA 4X66I 4USMA 1FWLA 4UT4A 1XNQE 1K47A 3T1YI 4JI7I 4AIMA 1IBME 5C0XF 4B3RE 4B3RI 2V2VA 4JI5I 5JEAF 2VF3A 4IZJB 4DR7E 4FW3A 5LMNI 3B78A 4DV5E 5K36F 1OYPA 2CG9A 5FLXC 4DV4E 4IZKA 2V34A 3CWVA 4JI6I
chains in the Genus database with same CATH topology
4JYAE 4DV6I 2PNLA 4DV3E 2R42A 2X7IA 4DV0E 1FJGI 3ZZUA 4XTJA 1HNWI 1ELOA 4K0KI 4K0KE 1Y4UA 2HFSA 1KKHA 1MG7A 3T1HE 1XNRI 1XNRE 2ZM6I 4JI0E 3K85A 1IBLE 5LMNE 2A2CA 4NXNE 2BM0A 4DV0I 4X65E 1FJGE 5A2QC 3J80C 1N0UA 2UUAE 1MU5A 1H72C 3ZKDA 3J7AM 4KHPI 2DEJA 2UXDE 1IBMI 2BV3A 4FWGA 2ZM6E 4B3ME 1J5EE 1UEKA 1IBKE 4FWHA 1DARA 4P7AA 2LJPA 2HFUA 4DUYI 2UU9E 1Z0CA 2BM1A 1MX0A 5FWKA 1Y4SA 1Z0WA 4LFBE 1NHIA 1RREA 2HK2A 4FW9A 3QT5A 1Z5CA 4LF9E 4HXZA 2J7KA 4JI5E 3HULA 1B62A 4EMDA 4DV3I 4WUBA 4X64E 4DV4I 1N32E 4DR5I 2OI2A 4DR5E 2UU9I 1RR9A 3JAMQ 5FLXQ 1S4EA 4JI3I 4JG4A 5IT9C 1Z0TA 2CGEA 2Z5CB 2VQEE 1XMQE 2F4VI 1PIEA 5IWAI 1ZXNA 4ZVIA 4DV7E 3K17A 1N36I 1FWKA 4IZJD 1Z5AA 4DPWA 1Z0EA 2HKEA 1EI1A 1OJ4A 4X62I 2UXBE 4X66E 2IOPA 4LF4I 4LF4E 1H7SA 4HYMA 4DV5I 2UUCI 1ZM3A 2NPFA 3T1HI 4DUYE 2IOQA 3GONA 3PYGA 2VQEI 4KQVA 1XNQI 2VQFI 4FN5A 3M6AA 4DR6E 4P52A 3LPSA 3PYDA 3QT6A 2UXDI 4LFAI 3WU6A 1N34I 4DV2I 4FWDA 2HHHI 1N0VC 4DV6E 1IBLI 2O1TA 4NXME 4DR1I 3Q6MA 1NHJA 3QT8A 4N3OA 4LFCI 1PKPA 4OX9I 1A6FA 1B63A 4JI8E 2O1UA 3J81C 4AQYI 3JAMC 4JI4E 1HNWE 2Z5EA 1ZM9A 4LF5E 3OTOE 2UXCI 1N36E 1NHHA 5LMUE 4DPYA 4IZKB 1Z0VA 4KHPE 1H74A 1KTVA 4JI4I 4DR4I 4JI0I 4JV5I 1FI4A 5BR8I 5IT9Q 4X65I 3B82A 2UUCE 4JI8I 4R1FA 1FNMA 3Q1QA 2V8PA 3P06A 4JI1E 4LF6E 3WU3A 3PYEA 3LTOA 4GKKE 4DR6I 3D4JA 4USKA 3J81Q 4YY3I 4LFBI 2E5LE 1Z0GA 3WU4A 3ZZ0A 4LFCE 2X36A 4OX9E 4JI2E 2HHHE 1ZXMA 2WW4A 4NXMI 1HR0E 3F0NA 1N33E 4LF7I 4PRXA 4LF7E 4DR2E 4DR3E 1HNZI 2E1RA 2V2ZA 4LF9I 4UTGA 2V2QA 1KVKA 3H4LA 2O1VA 1H73A 1Y6ZA 3PRYA 4B3TE 4JI1I 4LF6I 3V2UC 4PU9A 1N33I 4GKKI 1Z59A 3HJCA 4DUZI 2EFGA 4X62E 2UXBI 1H7UA 5L3JA 2XEXA 5BR8E 2E5LI 4LF8I 4DU8A 4DR2I 4DR3I 1HNZE 1NZ0A 3Q6NA 3J7AG 3ZM7A 2UUBE 4MYUA 2CZ9A 4LFAE 4YY3E 4GKJE 2GQ0A 1EA6A 4RPFA 2VQFE 1QZRA 4DU7A 2O1WA 3OTOI 2UXCE 2DEIA 2ZITA 4M1KA 4WUCA 5GMDA 1J5EI 1XMOE 4JI2I 2R3VA 4HACB 4HACA 4WUDA 4X64I 5GMEA 2UUAI 4LF5I 3PYFA 4YHHE 4YHHI 3B8HA 4I3HA 1PVGA 1WUUA 4JYAI 3V5RA 1USVA 2Q2EB 4ED4A 2F4VE 5IWAE 4NXNI 4DV1I 2A2DA 4DR1E 4DPXA 2AJ4A 3K1JA 1USUA 4DUZE 1XMOI 4B3MI 4B3TI 2GS8A 4DXLA 4B3SI 1D6TA 4JV5E 1IBKI 3LNUA 2ZBKB 4DV1E 1U2RA 1HK7A 1ZM2A 1BKNA 5LMUI 3ZZTA 3WU5A 2Z5CA 2Z5BA 4GKJI 4DPUA 4DR7I 4AQYE 1I94E 1Z5BA 4IZJA 3ZKBA 5LL6R 4JI7E 4HY1A 1Z0BA 4DV2E 1N34E 4Z7CA 1I94I 2PNMA 1ZM4A 5A2QQ 3J80Q 4DV7I 3T1YE 1N32I 2Z5BB 1HNXI 4JI6E 4B3SE 1HR0I 1XMQI 4LF8E 2HK3A 1S16A 1KIJA 1VISA 4MYTA 4DPTA 1XHKA 4Z7YA 1FKAE 4JI3E 4URLA 2UUBI 4PRVA 1HNXE 3QT7A 4DR4E 2HKJA 4X66I 4USMA 1FWLA 4UT4A 1XNQE 1K47A 3T1YI 4JI7I 1IBME 4B3RE 4B3RI 2V2VA 4JI5I 2VF3A 4IZJB 4DR7E 5LMNI 3B78A 4DV5E 2CG9A 5FLXC 4DV4E 4IZKA 2V34A 3CWVA 4JI6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C B;  2Z5E A;  2Z5B B; 
#chains in the Genus database with same CATH topology
 2WP8 A;  5K36 D;  4JYA E;  5JEA B;  2PNL A;  4DV6 I;  4DV3 E;  4OO1 E;  2C38 B;  2R42 A;  2X7I A;  4DV0 E;  1FJG I;  4IFD A;  3M7N D;  3ZZU A;  2BR2 A;  4XTJ A;  1HNW I;  1ELO A;  2BA0 D;  4K0K I;  4K0K E;  3CDJ A;  3M7N G;  1Y4U A;  2HFS A;  1KKH A;  1MG7 A;  3T1H E;  1XNR I;  1XNR E;  2ZM6 I;  4IFD D;  4FW5 A;  4QNJ A;  4JI0 E;  3K85 A;  1IBL E;  5LMN E;  2A2C A;  4NXN E;  2BM0 A;  4DV0 I;  4X65 E;  1FJG E;  5A2Q C;  3J80 C;  1N0U A;  2UUA E;  1MU5 A;  1H72 C;  2JEA A;  3ZKD A;  3J7A M;  4KHP I;  2DEJ A;  2UXD E;  1IBM I;  5DRO A;  1E3P A;  2BV3 A;  4FWG A;  2ZM6 E;  4B3M E;  1J5E E;  4BA2 B;  1UEK A;  1IBK E;  4FWH A;  1DAR A;  1Y60 A;  2JE6 A;  4P7A A;  2LJP A;  2BA1 D;  4LCF A;  2HFU A;  4BA1 B;  4DUY I;  2UU9 E;  1Z0C A;  2BM1 A;  1MX0 A;  1RHY A;  5FWK A;  5DNX A;  1Y4S A;  1Z0W A;  4LFB E;  3M85 D;  1NHI A;  1RRE A;  2HK2 A;  4FW9 A;  3QT5 A;  1OYR A;  1Z5C A;  4LF9 E;  1OYS A;  5K36 E;  4HXZ A;  2J7K A;  4JI5 E;  2PO1 A;  3GCM A;  3HUL A;  4AM3 A;  1B62 A;  2AE8 A;  4OO1 C;  3B4T A;  4EMD A;  4DV3 I;  4WUB A;  4X64 E;  4OKG A;  4FW6 A;  4DV4 I;  1N32 E;  4DR5 I;  2OI2 A;  4DR5 E;  3CDI A;  1RR9 A;  2F1D A;  3JAM Q;  5FLX Q;  1S4E A;  2UU9 I;  2PO1 B;  4JI3 I;  4JG4 A;  5IT9 C;  1Z0T A;  2CGE A;  2Z5C B;  5C0X A;  2VQE E;  1Y5Y A;  1XMQ E;  2F4V I;  5C0X E;  1PIE A;  5IWA I;  1ZXN A;  4ZVI A;  3K17 A;  4DV7 E;  1N36 I;  1FWK A;  4IZJ D;  1Z5A A;  4DPW A;  4LCG A;  1Z0E A;  2HKE A;  1EI1 A;  1OJ4 A;  4X62 I;  2UXB E;  3KRN A;  4X66 E;  3DD6 A;  2IOP A;  4LF4 I;  2JEB B;  4LF4 E;  1H7S A;  4HYM A;  4DV5 I;  5JEA C;  2C38 A;  1ZM3 A;  4FW7 A;  2NPF A;  2UUC I;  3T1H I;  4DUY E;  2IOQ A;  3GON A;  3L7Z A;  3PYG A;  2VQE I;  4U3B A;  3P76 A;  4MU4 A;  4MU3 A;  4KQV A;  3P3C A;  1XNQ I;  2VQF I;  4FN5 A;  2PO0 B;  3M6A A;  4DR6 E;  4IFD E;  2PO2 B;  4P52 A;  3LPS A;  3PYD A;  4OO1 D;  3QT6 A;  2UXD I;  4LFA I;  3PS3 A;  3WU6 A;  1N34 I;  4MQY A;  4DV2 I;  4FWD A;  2HHH I;  1N0V C;  4IFD C;  2GO3 A;  3P3G A;  4DV6 E;  1IBL I;  2O1T A;  2C37 A;  4NXM E;  4DR1 I;  3Q6M A;  4AID A;  1NHJ A;  4MU0 A;  3QT8 A;  4N3O A;  4LFC I;  5K36 B;  1PKP A;  4OX9 I;  1A6F A;  1B63 A;  4JI8 E;  2O1U A;  3J81 C;  4AQY I;  3JAM C;  4JI4 E;  3PS2 A;  1HNW E;  2BA0 G;  1UDN A;  2Z5E A;  1ZM9 A;  4LF5 E;  2JEB A;  3OTO E;  4NBQ A;  2UXC I;  1N36 E;  1E3H A;  1NHH A;  5LMU E;  2NN6 F;  4BA1 A;  4DPY A;  2J65 A;  1Z0V A;  4IZK B;  1H74 A;  4KHP E;  1KTV A;  4JI4 I;  1XXE A;  4DR4 I;  4JI0 I;  4JV5 I;  4LOM A;  1FI4 A;  4BA2 A;  5BR8 I;  5IT9 Q;  4X65 I;  3B82 A;  2UUC E;  2PO2 A;  4JI8 I;  5C0X B;  4R1F A;  1FNM A;  3Q1Q A;  2V8P A;  3P06 A;  4JI1 E;  4LF6 E;  3WU3 A;  1UDQ A;  3PYE A;  3LTO A;  4OO1 F;  4GKK E;  5JEA D;  4DR6 I;  4ISA A;  3D4J A;  4USK A;  2WNR A;  3J81 Q;  4YY3 I;  4LFB I;  2E5L E;  1R6L A;  2NN6 B;  3U1K A;  1Z0G A;  4IFD F;  3WU4 A;  3ZZ0 A;  2NN6 A;  2JE6 B;  4LFC E;  2X36 A;  4OX9 E;  4JI2 E;  2WNR B;  2HHH E;  1ZXM A;  4FW4 A;  2WW4 A;  5JEA E;  4NXM I;  4J3D A;  1HR0 E;  3F0N A;  1N33 E;  4LF7 I;  4PRX A;  4LF7 E;  4DR2 E;  4DR3 E;  1HNZ I;  2E1R A;  2V2Z A;  4LF9 I;  5K36 A;  4UTG A;  2V2Q A;  3NZK A;  1KVK A;  3H4L A;  5EL9 A;  2NN6 D;  2O1V A;  1H73 A;  1Y6Z A;  2BA1 G;  3PRY A;  4B3T E;  3PS1 A;  2NN6 E;  4JI1 I;  4LF6 I;  3V2U C;  4PU9 A;  1N33 I;  4GKK I;  1Z59 A;  4QNK A;  3HJC A;  4DUZ I;  2EFG A;  1R6M A;  4X62 E;  2UXB I;  1H7U A;  5L3J A;  2XEX A;  5BR8 E;  2E5L I;  4LF8 I;  3UHM A;  4DU8 A;  4OO1 B;  4DR2 I;  4DR3 I;  1HNZ E;  1NZ0 A;  3Q6N A;  3J7A G;  3ZM7 A;  3HKM A;  2UUB E;  4MYU A;  2CZ9 A;  4LFA E;  4YY3 E;  4GKJ E;  2GQ0 A;  1P42 A;  1EA6 A;  4RPF A;  2VQF E;  1QZR A;  1VI7 A;  4DU7 A;  2O1W A;  2C37 B;  3P3E A;  2JEA B;  3OTO I;  2UXC E;  2DEI A;  2ZIT A;  4M1K A;  2O3Z A;  4WUC A;  5DRP A;  5GMD A;  4MDT A;  1J5E I;  1XMO E;  4JI2 I;  2R3V A;  2NN6 C;  4HAC B;  4HAC A;  4WUD A;  1UDO A;  2PO0 A;  4X64 I;  5GME A;  3H1C A;  2UUA I;  4LF5 I;  3PYF A;  3GLL A;  4YHH E;  4YHH I;  3B8H A;  4I3H A;  5ELW A;  1PVG A;  3GME A;  5EKW A;  4LCH A;  1WUU A;  3L7Z B;  4JYA I;  3V5R A;  1USV A;  2Q2E B;  4ED4 A;  5C0X C;  2F4V E;  5IWA E;  4NXN I;  2A2D A;  4DV1 I;  4DR1 E;  2BR2 B;  4IS9 A;  4LPF A;  4DPX A;  2AJ4 A;  3K1J A;  1USU A;  4DUZ E;  1XMO I;  4B3M I;  4B3T I;  2GS8 A;  4DXL A;  4B3S I;  4OO1 A;  1D6T A;  2WP8 B;  4JV5 E;  4U3D A;  1IBK I;  3U1Y A;  3LNU A;  2ZBK B;  5C0X D;  4DV1 E;  1U2R A;  1HK7 A;  2PNZ A;  4OZE A;  1ZM2 A;  1BKN A;  4MU1 A;  5LMU I;  2IES A;  3ZZT A;  3WU5 A;  2Z5C A;  2Z5B A;  4GKJ I;  2C39 B;  4DPU A;  4DR7 I;  4AQY E;  1I94 E;  5K36 C;  1Z5B A;  4IZJ A;  5DRR A;  3ZKB A;  5LL6 R;  2GO4 A;  4JI7 E;  5DNL A;  4HY1 A;  2IER A;  1Z0B A;  4DV2 E;  1N34 E;  4Z7C A;  2C39 A;  2CVE A;  1I94 I;  2PNM A;  1ZM4 A;  5A2Q Q;  3J80 Q;  1YH8 A;  4GQU A;  4DV7 I;  5DRQ A;  3T1Y E;  1N32 I;  2VES A;  3M85 G;  1UDS A;  2Z5B B;  1HNX I;  4JI6 E;  4B3S E;  1HR0 I;  2JT2 A;  2PNZ B;  1XMQ I;  4LF8 E;  1YHC A;  2HK3 A;  1S16 A;  1KIJ A;  1VIS A;  4MYT A;  4DPT A;  1XHK A;  4Z7Y A;  1FKA E;  4JI3 E;  4IFD B;  4URL A;  2UUB I;  4PRV A;  1HNX E;  3QT7 A;  4DR4 E;  5JEA A;  2HKJ A;  4X66 I;  4USM A;  1FWL A;  4UT4 A;  1XNQ E;  1K47 A;  3T1Y I;  4JI7 I;  4AIM A;  1IBM E;  5C0X F;  4B3R E;  4B3R I;  2V2V A;  4JI5 I;  5JEA F;  2VF3 A;  4IZJ B;  4DR7 E;  4FW3 A;  5LMN I;  3B78 A;  4DV5 E;  5K36 F;  1OYP A;  2CG9 A;  5FLX C;  4DV4 E;  4IZK A;  2V34 A;  3CWV A;  4JI6 I; 
#chains in the Genus database with same CATH homology
 4JYA E;  4DV6 I;  2PNL A;  4DV3 E;  2R42 A;  2X7I A;  4DV0 E;  1FJG I;  3ZZU A;  4XTJ A;  1HNW I;  1ELO A;  4K0K I;  4K0K E;  1Y4U A;  2HFS A;  1KKH A;  1MG7 A;  3T1H E;  1XNR I;  1XNR E;  2ZM6 I;  4JI0 E;  3K85 A;  1IBL E;  5LMN E;  2A2C A;  4NXN E;  2BM0 A;  4DV0 I;  4X65 E;  1FJG E;  5A2Q C;  3J80 C;  1N0U A;  2UUA E;  1MU5 A;  1H72 C;  3ZKD A;  3J7A M;  4KHP I;  2DEJ A;  2UXD E;  1IBM I;  2BV3 A;  4FWG A;  2ZM6 E;  4B3M E;  1J5E E;  1UEK A;  1IBK E;  4FWH A;  1DAR A;  4P7A A;  2LJP A;  2HFU A;  4DUY I;  2UU9 E;  1Z0C A;  2BM1 A;  1MX0 A;  5FWK A;  1Y4S A;  1Z0W A;  4LFB E;  1NHI A;  1RRE A;  2HK2 A;  4FW9 A;  3QT5 A;  1Z5C A;  4LF9 E;  4HXZ A;  2J7K A;  4JI5 E;  3HUL A;  1B62 A;  4EMD A;  4DV3 I;  4WUB A;  4X64 E;  4DV4 I;  1N32 E;  4DR5 I;  2OI2 A;  4DR5 E;  2UU9 I;  1RR9 A;  3JAM Q;  5FLX Q;  1S4E A;  4JI3 I;  4JG4 A;  5IT9 C;  1Z0T A;  2CGE A;  2Z5C B;  2VQE E;  1XMQ E;  2F4V I;  1PIE A;  5IWA I;  1ZXN A;  4ZVI A;  4DV7 E;  3K17 A;  1N36 I;  1FWK A;  4IZJ D;  1Z5A A;  4DPW A;  1Z0E A;  2HKE A;  1EI1 A;  1OJ4 A;  4X62 I;  2UXB E;  4X66 E;  2IOP A;  4LF4 I;  4LF4 E;  1H7S A;  4HYM A;  4DV5 I;  2UUC I;  1ZM3 A;  2NPF A;  3T1H I;  4DUY E;  2IOQ A;  3GON A;  3PYG A;  2VQE I;  4KQV A;  1XNQ I;  2VQF I;  4FN5 A;  3M6A A;  4DR6 E;  4P52 A;  3LPS A;  3PYD A;  3QT6 A;  2UXD I;  4LFA I;  3WU6 A;  1N34 I;  4DV2 I;  4FWD A;  2HHH I;  1N0V C;  4DV6 E;  1IBL I;  2O1T A;  4NXM E;  4DR1 I;  3Q6M A;  1NHJ A;  3QT8 A;  4N3O A;  4LFC I;  1PKP A;  4OX9 I;  1A6F A;  1B63 A;  4JI8 E;  2O1U A;  3J81 C;  4AQY I;  3JAM C;  4JI4 E;  1HNW E;  2Z5E A;  1ZM9 A;  4LF5 E;  3OTO E;  2UXC I;  1N36 E;  1NHH A;  5LMU E;  4DPY A;  4IZK B;  1Z0V A;  4KHP E;  1H74 A;  1KTV A;  4JI4 I;  4DR4 I;  4JI0 I;  4JV5 I;  1FI4 A;  5BR8 I;  5IT9 Q;  4X65 I;  3B82 A;  2UUC E;  4JI8 I;  4R1F A;  1FNM A;  3Q1Q A;  2V8P A;  3P06 A;  4JI1 E;  4LF6 E;  3WU3 A;  3PYE A;  3LTO A;  4GKK E;  4DR6 I;  3D4J A;  4USK A;  3J81 Q;  4YY3 I;  4LFB I;  2E5L E;  1Z0G A;  3WU4 A;  3ZZ0 A;  4LFC E;  2X36 A;  4OX9 E;  4JI2 E;  2HHH E;  1ZXM A;  2WW4 A;  4NXM I;  1HR0 E;  3F0N A;  1N33 E;  4LF7 I;  4PRX A;  4LF7 E;  4DR2 E;  4DR3 E;  1HNZ I;  2E1R A;  2V2Z A;  4LF9 I;  4UTG A;  2V2Q A;  1KVK A;  3H4L A;  2O1V A;  1H73 A;  1Y6Z A;  3PRY A;  4B3T E;  4JI1 I;  4LF6 I;  3V2U C;  4PU9 A;  1N33 I;  4GKK I;  1Z59 A;  3HJC A;  4DUZ I;  2EFG A;  4X62 E;  2UXB I;  1H7U A;  5L3J A;  2XEX A;  5BR8 E;  2E5L I;  4LF8 I;  4DU8 A;  4DR2 I;  4DR3 I;  1HNZ E;  1NZ0 A;  3Q6N A;  3J7A G;  3ZM7 A;  2UUB E;  4MYU A;  2CZ9 A;  4LFA E;  4YY3 E;  4GKJ E;  2GQ0 A;  1EA6 A;  4RPF A;  2VQF E;  1QZR A;  4DU7 A;  2O1W A;  3OTO I;  2UXC E;  2DEI A;  2ZIT A;  4M1K A;  4WUC A;  5GMD A;  1J5E I;  1XMO E;  4JI2 I;  2R3V A;  4HAC B;  4HAC A;  4WUD A;  4X64 I;  5GME A;  2UUA I;  4LF5 I;  3PYF A;  4YHH E;  4YHH I;  3B8H A;  4I3H A;  1PVG A;  1WUU A;  4JYA I;  3V5R A;  1USV A;  2Q2E B;  4ED4 A;  2F4V E;  5IWA E;  4NXN I;  4DV1 I;  2A2D A;  4DR1 E;  4DPX A;  2AJ4 A;  3K1J A;  1USU A;  4DUZ E;  1XMO I;  4B3M I;  4B3T I;  2GS8 A;  4DXL A;  4B3S I;  1D6T A;  4JV5 E;  1IBK I;  3LNU A;  2ZBK B;  4DV1 E;  1U2R A;  1HK7 A;  1ZM2 A;  1BKN A;  5LMU I;  3ZZT A;  3WU5 A;  2Z5C A;  2Z5B A;  4GKJ I;  4DPU A;  4DR7 I;  4AQY E;  1I94 E;  1Z5B A;  4IZJ A;  3ZKB A;  5LL6 R;  4JI7 E;  4HY1 A;  1Z0B A;  4DV2 E;  1N34 E;  4Z7C A;  1I94 I;  2PNM A;  1ZM4 A;  5A2Q Q;  3J80 Q;  4DV7 I;  3T1Y E;  1N32 I;  2Z5B B;  1HNX I;  4JI6 E;  4B3S E;  1HR0 I;  1XMQ I;  4LF8 E;  2HK3 A;  1S16 A;  1KIJ A;  1VIS A;  4MYT A;  4DPT A;  1XHK A;  4Z7Y A;  1FKA E;  4JI3 E;  4URL A;  2UUB I;  4PRV A;  1HNX E;  3QT7 A;  4DR4 E;  2HKJ A;  4X66 I;  4USM A;  1FWL A;  4UT4 A;  1XNQ E;  1K47 A;  3T1Y I;  4JI7 I;  1IBM E;  4B3R E;  4B3R I;  2V2V A;  4JI5 I;  2VF3 A;  4IZJ B;  4DR7 E;  5LMN I;  3B78 A;  4DV5 E;  2CG9 A;  5FLX C;  4DV4 E;  4IZK A;  2V34 A;  3CWV A;  4JI6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...