2Z5CB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
147
structure length
106
Chain Sequence
ISYEFQTHKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYQVVTKLGDSADPKVPVVCVQIAELYRRVILPQFSLLISMSSKIWNDFGKLVFVLKCIKDMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
total genus 29
structure length 106
sequence length 147
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cB00
2Z5BB 2Z5CB 2Z5EA
chains in the Genus database with same CATH superfamily
4USMA 2C37A 4AM3A 2NN6F 4AQYI 4JI7E 4DPXA 1XNQI 2AJ4A 1XMOI 2V34A 3B78A 1HR0E 4OO1D 4JI3I 2WNRB 4DPUA 2Q2EB 1Y6ZA 4JI8E 4B3TE 1KKHA 5K36D 4DR1I 4DR4I 5DNXA 5IT9C 1N33E 3PYDA 1HNWE 5L3JA 1IBMI 1IBKI 1H73A 4DV1I 2BV3A 3PYGA 5LMNE 1HK7A 5ELWA 3PS1A 4DV0I 2PO1A 1DARA 4LF5E 4PU9A 3H4LA 4B3SI 3T1HE 2DEIA 1USUA 4OO1B 4JI0I 3V5RA 3JAMC 4OZEA 2NN6C 3QT8A 4PRVA 1XHKA 4JI2I 4HYMA 2BA1G 4UT4A 3P3EA 4DUYE 5A2QC 4DR5I 4LF4E 4X64E 5EKWA 4P52A 4DV4E 3ZKBA 2HKEA 1Y4UA 4YY3I 5JEAC 4LF7I 1XMQI 1WUUA 1KIJA 3B82A 4N3OA 4DV2E 3F0NA 2VESA 4LF6I 3PS2A 4DUZI 4IFDE 3K1JA 2NN6D 1N0VC 3WU4A 4IFDA 4KQVA 5IWAI 2ZM6E 2E1RA 4X66E 4U3DA 4FW3A 1N34I 1D6TA 1UDOA 1UEKA 3NZKA 4BA2A 2E5LI 4DR6E 2OI2A 2C38A 1RHYA 2HKJA 1Z5CA 2X7IA 4LF9I 1KVKA 2NN6B 2V2VA 4LF8I 3ZZ0A 2JEBB 2XEXA 2NPFA 3ZZTA 3J7AM 5C0XA 4OX9I 2VQFE 4DR3E 2F4VI 4XTJA 2PO0B 2R42A 2HHHE 5JEAB 4DPWA 5BR8E 3M6AA 3HJCA 3P06A 4MU3A 4MYTA 1MU5A 2WNRA 5FLXQ 2UUAE 2UXDE 1ZXMA 4GKKI 1XNRE 4B3RE 5GMEA 4X62I 1U2RA 1FNMA 5GMDA 1UDQA 4JI5E 4LFBE 2WW4A 4JI7I 3T1YE 4NXMI 4FW4A 2O1UA 4OKGA 5LL6R 1USVA 1A6FA 1Z0GA 4P7AA 2BR2B 3PRYA 4YHHE 1HR0I 1ZM4A 5DROA 4HY1A 3QT5A 4K0KE 4B3TI 4JI8I 4U3BA 3M7NG 1MX0A 3J81C 4WUBA 2HFSA 4OO1A 3J80C 1N33I 5K36E 4KHPI 3P3CA 5LMUE 1HNWI 1Z0CA 4B3MI 4FWDA 2O1TA 2UUCE 1N36I 5K36A 1OYSA 1B62A 4LF5I 1RR9A 5DNLA 4DU8A 5JEAF 1E3PA 3T1HI 2F1DA 4HACA 3PYFA 4MU4A 2JEAB 1PVGA 1UDNA 3M85G 2HK3A 2PNMA 1S16A 4DUYI 2AE8A 4ISAA 4FWHA 3GONA 4LF4I 4X64I 1Z5AA 4LFCE 4DV4I 4QNKA 2BA0G 2PO2B 2IOPA 3L7ZB 1Z0EA 4NXNE 2C37B 3OTOE 4DR2E 3K17A 4JI4E 4DV2I 2CVEA 3WU6A 4IZJD 1Y5YA 3UHMA 2CGEA 2UU9E 3M7ND 4LFAE 2EFGA 2VQEE 3CDJA 2A2DA 1Z5BA 3J7AG 5DRQA 2ZM6I 2NN6E 3U1YA 4X66I 1OYRA 1HNZI 2PNZB 2NN6A 3QT6A 1N32E 4LCHA 4DV7E 1I94E 1OJ4A 2J65A 1PIEA 1OYPA 4DR6I 2BM0A 1NZ0A 2JEBA 1S4EA 2C39B 2CZ9A 3M85D 2PO0A 1Z59A 4IZJB 5JEAA 3LTOA 1H72C 4URLA 1NHIA 4UTGA 2LJPA 5JEAD 4JI6I 1NHJA 4QNJA 4DU7A 4YY3E 4X65E 5DRRA 1YH8A 4MU0A 2BA0D 3GCMA 2BA1D 2VQFI 4I3HA 2JT2A 4DR3I 1VISA 4JYAI 4DV6E 2ZITA 3KRNA 4DUZE 2HHHI 1ELOA 1K47A 5C0XE 1IBLE 1ZM3A 4MQYA 3ZZUA 4ED4A 4DV3E 2X36A 2BR2A 1H74A 2UUAI 2O1VA 1R6MA 4R1FA 1R6LA 4B3RI 4LOMA 3ZM7A 2JE6B 4WUCA 4JI5I 4LFBI 3DD6A 4M1KA 3T1YI 3U1KA 4FWGA 3H1CA 2UUBE 2Z5BB 4YHHI 2UXBE 2V2QA 4FW6A 4K0KI 1FJGE 4FW9A 1Z0WA 2JEAA 3WU3A 4DR7E 5LMUI 1HNXE 3ZKDA 1H7UA 2UUCI 5FLXC 4HXZA 4OX9E 4JV5E 4IZKB 4FW5A 3HULA 4OO1E 1VI7A 1Z0BA 2UXCE 5K36C 2J7KA 4DPTA 3CDIA 5LMNI 1B63A 3P3GA 3LNUA 3WU5A 2WP8B 3L7ZA 2O1WA 1E3HA 4JI1E 2Z5CB 4MU1A 1FKAE 2PNLA 5IT9Q 4DV5E 3GMEA 4BA1B 4GKJE 3P76A 1KTVA 4FW7A 4NXME 2V2ZA 4PRXA 1ZXNA 4LFCI 1J5EE 4IFDF 4ZVIA 1N0UA 1EI1A 2PNZA 2V8PA 4AQYE 1Z0TA 4NXNI 1XNQE 3HKMA 3JAMQ 1XMOE 3OTOI 4DR2I 4KHPE 4JI4I 4B3ME 4JI3E 1N36E 1PKPA 2Z5EA 2UU9I 2HK2A 4LFAI 2C39A 4DR1E 2VQEI 4DR4E 1YHCA 3Q6MA 1FWKA 2VF3A 4IZJA 5A2QQ 2HFUA 2A2CA 1IBME 1N32I 1IBKE 4DV1E 4DV7I 4J3DA 4DXLA 1I94I 4DV0E 1UDSA 4USKA 1Y4SA 3V2UC 5K36B 4RPFA 4B3SE 5C0XF 4IFDC 1FWLA 4JI0E 2CG9A 2R3VA 2ZBKB 4MYUA 3Q1QA 1MG7A 4AIMA 4LPFA 4JI2E 4HACB 2PO1B 5JEAE 4Z7CA 2IOQA 4Z7YA 2O3ZA 4X65I 3LPSA 4DR5E 3D4JA 5FWKA 2IESA 4IS9A 2JE6A 1XXEA 2GO3A 4DV6I 1P42A 4LF7E 2IERA 3CWVA 1XMQE 1IBLI 4DV3I 1RREA 2Z5BA 4GQUA 4JG4A 5EL9A 4IFDD 1HNZE 5DRPA 1Z0VA 2GQ0A 4LF6E 3Q6NA 4EMDA 5C0XC 5IWAE 5BR8I 4OO1F 4MDTA 1N34E 3PS3A 4LCFA 2UXDI 5K36F 4IZKA 1XNRI 2E5LE 2UUBI 3QT7A 3K85A 3GLLA 2UXBI 4DPYA 3PYEA 4JI6E 1FJGI 4NBQA 4LF9E 4IFDB 2WP8A 3B4TA 1QZRA 1ZM9A 4DR7I 1H7SA 2BM1A 1HNXI 1EA6A 2Z5CA 4JV5I 4BA2B 4LF8E 4BA1A 5C0XD 4JYAE 2UXCI 2C38B 4OO1C 2F4VE 4WUDA 4JI1I 1NHHA 2GO4A 3J81Q 3J80Q 4DV5I 4GKJI 1BKNA 4LCGA 1ZM2A 1Y60A 2GS8A 2PO2A 3B8HA 4FN5A 2DEJA 1FI4A 4AIDA 4GKKE 5C0XB 1J5EI 4X62E
chains in the Genus database with same CATH topology
4USMA 4AQYI 4JI7E 4DPXA 1XNQI 2AJ4A 1XMOI 2V34A 3B78A 1HR0E 4JI3I 4DPUA 2Q2EB 1Y6ZA 4JI8E 4B3TE 1KKHA 4DR1I 4DR4I 5IT9C 1N33E 3PYDA 1HNWE 5L3JA 1IBMI 1IBKI 1H73A 4DV1I 2BV3A 3PYGA 5LMNE 1HK7A 4DV0I 1DARA 4LF5E 4PU9A 3H4LA 4B3SI 3T1HE 2DEIA 1USUA 4JI0I 3V5RA 3JAMC 3QT8A 4PRVA 1XHKA 4JI2I 4HYMA 4UT4A 4DUYE 5A2QC 4DR5I 4LF4E 4X64E 4P52A 4DV4E 3ZKBA 2HKEA 1Y4UA 4YY3I 4LF7I 1XMQI 1WUUA 1KIJA 3B82A 4N3OA 4DV2E 3F0NA 4LF6I 4DUZI 3K1JA 1N0VC 3WU4A 4KQVA 5IWAI 2ZM6E 2E1RA 4X66E 1N34I 1D6TA 1UEKA 2E5LI 4DR6E 2OI2A 2HKJA 1Z5CA 2X7IA 4LF9I 1KVKA 2V2VA 4LF8I 3ZZ0A 2XEXA 2NPFA 3ZZTA 3J7AM 4OX9I 2VQFE 4DR3E 2F4VI 4XTJA 2R42A 2HHHE 4DPWA 5BR8E 3M6AA 3HJCA 3P06A 4MYTA 1MU5A 5FLXQ 2UUAE 2UXDE 1ZXMA 4GKKI 1XNRE 4B3RE 5GMEA 4X62I 1U2RA 1FNMA 5GMDA 4JI5E 4LFBE 2WW4A 4JI7I 3T1YE 4NXMI 2O1UA 5LL6R 1USVA 1A6FA 1Z0GA 4P7AA 3PRYA 4YHHE 1HR0I 1ZM4A 4HY1A 3QT5A 4K0KE 4B3TI 4JI8I 1MX0A 3J81C 4WUBA 2HFSA 3J80C 1N33I 4KHPI 5LMUE 1HNWI 1Z0CA 4B3MI 4FWDA 2O1TA 2UUCE 1N36I 1B62A 4LF5I 1RR9A 4DU8A 3T1HI 4HACA 3PYFA 1PVGA 2HK3A 2PNMA 1S16A 4DUYI 4FWHA 3GONA 4LF4I 4X64I 1Z5AA 4LFCE 4DV4I 2IOPA 1Z0EA 4NXNE 3OTOE 4DR2E 3K17A 4JI4E 4DV2I 3WU6A 4IZJD 2UU9E 2CGEA 4LFAE 2EFGA 2VQEE 2A2DA 1Z5BA 3J7AG 2ZM6I 4X66I 1HNZI 1N32E 3QT6A 4DV7E 1I94E 1OJ4A 1PIEA 4DR6I 2BM0A 1NZ0A 1S4EA 2CZ9A 4IZJB 1Z59A 3LTOA 1H72C 4URLA 1NHIA 4UTGA 2LJPA 4JI6I 1NHJA 4DU7A 4YY3E 4X65E 2VQFI 4I3HA 4DR3I 1VISA 4JYAI 4DV6E 2ZITA 4DUZE 2HHHI 1ELOA 1K47A 1IBLE 1ZM3A 3ZZUA 4ED4A 4DV3E 2X36A 1H74A 2UUAI 2O1VA 4R1FA 4B3RI 3ZM7A 4WUCA 4JI5I 4LFBI 4M1KA 3T1YI 4FWGA 2UUBE 2Z5BB 4YHHI 2UXBE 2V2QA 4K0KI 1FJGE 4FW9A 1Z0WA 3WU3A 4DR7E 5LMUI 1HNXE 3ZKDA 1H7UA 2UUCI 5FLXC 4HXZA 4OX9E 4JV5E 4IZKB 3HULA 1Z0BA 2UXCE 2J7KA 4DPTA 5LMNI 1B63A 3LNUA 3WU5A 2O1WA 4JI1E 2Z5CB 1FKAE 2PNLA 5IT9Q 4DV5E 4GKJE 1KTVA 4NXME 2V2ZA 4PRXA 1ZXNA 4LFCI 1J5EE 4ZVIA 1N0UA 1EI1A 2V8PA 4AQYE 1Z0TA 4NXNI 1XNQE 3JAMQ 1XMOE 3OTOI 4DR2I 4KHPE 4JI4I 4B3ME 4JI3E 1N36E 1PKPA 2Z5EA 2UU9I 2HK2A 4LFAI 4DR1E 2VQEI 4DR4E 3Q6MA 1FWKA 2VF3A 4IZJA 5A2QQ 2HFUA 2A2CA 1IBME 1N32I 1IBKE 4DV1E 4DV7I 4DXLA 1I94I 4DV0E 4USKA 1Y4SA 3V2UC 4RPFA 4B3SE 1FWLA 4JI0E 2CG9A 2R3VA 2ZBKB 4MYUA 3Q1QA 1MG7A 4JI2E 4HACB 4Z7CA 2IOQA 4Z7YA 4X65I 3LPSA 4DR5E 3D4JA 5FWKA 4DV6I 4LF7E 1XMQE 3CWVA 1IBLI 4DV3I 1RREA 2Z5BA 4JG4A 1HNZE 1Z0VA 2GQ0A 4LF6E 3Q6NA 4EMDA 5IWAE 5BR8I 1N34E 2UXDI 4IZKA 1XNRI 2E5LE 2UUBI 3QT7A 3K85A 2UXBI 4DPYA 3PYEA 4JI6E 1FJGI 4LF9E 1QZRA 1ZM9A 4DR7I 1H7SA 2BM1A 1HNXI 1EA6A 2Z5CA 4JV5I 4LF8E 4JYAE 2UXCI 2F4VE 4WUDA 4JI1I 1NHHA 3J81Q 3J80Q 4DV5I 4GKJI 1BKNA 1ZM2A 2GS8A 3B8HA 4FN5A 2DEJA 1FI4A 4GKKE 1J5EI 4X62E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5B B;  2Z5C B;  2Z5E A; 
#chains in the Genus database with same CATH topology
 4USM A;  2C37 A;  4AM3 A;  2NN6 F;  4AQY I;  4JI7 E;  4DPX A;  1XNQ I;  2AJ4 A;  1XMO I;  2V34 A;  3B78 A;  1HR0 E;  4OO1 D;  4JI3 I;  2WNR B;  4DPU A;  2Q2E B;  1Y6Z A;  4JI8 E;  4B3T E;  1KKH A;  5K36 D;  4DR1 I;  4DR4 I;  5DNX A;  5IT9 C;  1N33 E;  3PYD A;  1HNW E;  5L3J A;  1IBM I;  1IBK I;  1H73 A;  4DV1 I;  2BV3 A;  3PYG A;  5LMN E;  1HK7 A;  5ELW A;  3PS1 A;  4DV0 I;  2PO1 A;  1DAR A;  4LF5 E;  4PU9 A;  3H4L A;  4B3S I;  3T1H E;  2DEI A;  1USU A;  4OO1 B;  4JI0 I;  3V5R A;  3JAM C;  4OZE A;  2NN6 C;  3QT8 A;  4PRV A;  1XHK A;  4JI2 I;  4HYM A;  2BA1 G;  4UT4 A;  3P3E A;  4DUY E;  5A2Q C;  4DR5 I;  4LF4 E;  4X64 E;  5EKW A;  4P52 A;  4DV4 E;  3ZKB A;  2HKE A;  1Y4U A;  4YY3 I;  5JEA C;  4LF7 I;  1XMQ I;  1WUU A;  1KIJ A;  3B82 A;  4N3O A;  4DV2 E;  3F0N A;  2VES A;  4LF6 I;  3PS2 A;  4DUZ I;  4IFD E;  3K1J A;  2NN6 D;  1N0V C;  3WU4 A;  4IFD A;  4KQV A;  5IWA I;  2ZM6 E;  2E1R A;  4X66 E;  4U3D A;  4FW3 A;  1N34 I;  1D6T A;  1UDO A;  1UEK A;  3NZK A;  4BA2 A;  2E5L I;  4DR6 E;  2OI2 A;  2C38 A;  1RHY A;  2HKJ A;  1Z5C A;  2X7I A;  4LF9 I;  1KVK A;  2NN6 B;  2V2V A;  4LF8 I;  3ZZ0 A;  2JEB B;  2XEX A;  2NPF A;  3ZZT A;  3J7A M;  5C0X A;  4OX9 I;  2VQF E;  4DR3 E;  2F4V I;  4XTJ A;  2PO0 B;  2R42 A;  2HHH E;  5JEA B;  4DPW A;  5BR8 E;  3M6A A;  3HJC A;  3P06 A;  4MU3 A;  4MYT A;  1MU5 A;  2WNR A;  5FLX Q;  2UUA E;  2UXD E;  1ZXM A;  4GKK I;  1XNR E;  4B3R E;  5GME A;  4X62 I;  1U2R A;  1FNM A;  5GMD A;  1UDQ A;  4JI5 E;  4LFB E;  2WW4 A;  4JI7 I;  3T1Y E;  4NXM I;  4FW4 A;  2O1U A;  4OKG A;  5LL6 R;  1USV A;  1A6F A;  1Z0G A;  4P7A A;  2BR2 B;  3PRY A;  4YHH E;  1HR0 I;  1ZM4 A;  5DRO A;  4HY1 A;  3QT5 A;  4K0K E;  4B3T I;  4JI8 I;  4U3B A;  3M7N G;  1MX0 A;  3J81 C;  4WUB A;  2HFS A;  4OO1 A;  3J80 C;  1N33 I;  5K36 E;  4KHP I;  3P3C A;  5LMU E;  1HNW I;  1Z0C A;  4B3M I;  4FWD A;  2O1T A;  2UUC E;  1N36 I;  5K36 A;  1OYS A;  1B62 A;  4LF5 I;  1RR9 A;  5DNL A;  4DU8 A;  5JEA F;  1E3P A;  3T1H I;  2F1D A;  4HAC A;  3PYF A;  4MU4 A;  2JEA B;  1PVG A;  1UDN A;  3M85 G;  2HK3 A;  2PNM A;  1S16 A;  4DUY I;  2AE8 A;  4ISA A;  4FWH A;  3GON A;  4LF4 I;  4X64 I;  1Z5A A;  4LFC E;  4DV4 I;  4QNK A;  2BA0 G;  2PO2 B;  2IOP A;  3L7Z B;  1Z0E A;  4NXN E;  2C37 B;  3OTO E;  4DR2 E;  3K17 A;  4JI4 E;  4DV2 I;  2CVE A;  3WU6 A;  4IZJ D;  1Y5Y A;  3UHM A;  2CGE A;  2UU9 E;  3M7N D;  4LFA E;  2EFG A;  2VQE E;  3CDJ A;  2A2D A;  1Z5B A;  3J7A G;  5DRQ A;  2ZM6 I;  2NN6 E;  3U1Y A;  4X66 I;  1OYR A;  1HNZ I;  2PNZ B;  2NN6 A;  3QT6 A;  1N32 E;  4LCH A;  4DV7 E;  1I94 E;  1OJ4 A;  2J65 A;  1PIE A;  1OYP A;  4DR6 I;  2BM0 A;  1NZ0 A;  2JEB A;  1S4E A;  2C39 B;  2CZ9 A;  3M85 D;  2PO0 A;  1Z59 A;  4IZJ B;  5JEA A;  3LTO A;  1H72 C;  4URL A;  1NHI A;  4UTG A;  2LJP A;  5JEA D;  4JI6 I;  1NHJ A;  4QNJ A;  4DU7 A;  4YY3 E;  4X65 E;  5DRR A;  1YH8 A;  4MU0 A;  2BA0 D;  3GCM A;  2BA1 D;  2VQF I;  4I3H A;  2JT2 A;  4DR3 I;  1VIS A;  4JYA I;  4DV6 E;  2ZIT A;  3KRN A;  4DUZ E;  2HHH I;  1ELO A;  1K47 A;  5C0X E;  1IBL E;  1ZM3 A;  4MQY A;  3ZZU A;  4ED4 A;  4DV3 E;  2X36 A;  2BR2 A;  1H74 A;  2UUA I;  2O1V A;  1R6M A;  4R1F A;  1R6L A;  4B3R I;  4LOM A;  3ZM7 A;  2JE6 B;  4WUC A;  4JI5 I;  4LFB I;  3DD6 A;  4M1K A;  3T1Y I;  3U1K A;  4FWG A;  3H1C A;  2UUB E;  2Z5B B;  4YHH I;  2UXB E;  2V2Q A;  4FW6 A;  4K0K I;  1FJG E;  4FW9 A;  1Z0W A;  2JEA A;  3WU3 A;  4DR7 E;  5LMU I;  1HNX E;  3ZKD A;  1H7U A;  2UUC I;  5FLX C;  4HXZ A;  4OX9 E;  4JV5 E;  4IZK B;  4FW5 A;  3HUL A;  4OO1 E;  1VI7 A;  1Z0B A;  2UXC E;  5K36 C;  2J7K A;  4DPT A;  3CDI A;  5LMN I;  1B63 A;  3P3G A;  3LNU A;  3WU5 A;  2WP8 B;  3L7Z A;  2O1W A;  1E3H A;  4JI1 E;  2Z5C B;  4MU1 A;  1FKA E;  2PNL A;  5IT9 Q;  4DV5 E;  3GME A;  4BA1 B;  4GKJ E;  3P76 A;  1KTV A;  4FW7 A;  4NXM E;  2V2Z A;  4PRX A;  1ZXN A;  4LFC I;  1J5E E;  4IFD F;  4ZVI A;  1N0U A;  1EI1 A;  2PNZ A;  2V8P A;  4AQY E;  1Z0T A;  4NXN I;  1XNQ E;  3HKM A;  3JAM Q;  1XMO E;  3OTO I;  4DR2 I;  4KHP E;  4JI4 I;  4B3M E;  4JI3 E;  1N36 E;  1PKP A;  2Z5E A;  2UU9 I;  2HK2 A;  4LFA I;  2C39 A;  4DR1 E;  2VQE I;  4DR4 E;  1YHC A;  3Q6M A;  1FWK A;  2VF3 A;  4IZJ A;  5A2Q Q;  2HFU A;  2A2C A;  1IBM E;  1N32 I;  1IBK E;  4DV1 E;  4DV7 I;  4J3D A;  4DXL A;  1I94 I;  4DV0 E;  1UDS A;  4USK A;  1Y4S A;  3V2U C;  5K36 B;  4RPF A;  4B3S E;  5C0X F;  4IFD C;  1FWL A;  4JI0 E;  2CG9 A;  2R3V A;  2ZBK B;  4MYU A;  3Q1Q A;  1MG7 A;  4AIM A;  4LPF A;  4JI2 E;  4HAC B;  2PO1 B;  5JEA E;  4Z7C A;  2IOQ A;  4Z7Y A;  2O3Z A;  4X65 I;  3LPS A;  4DR5 E;  3D4J A;  5FWK A;  2IES A;  4IS9 A;  2JE6 A;  1XXE A;  2GO3 A;  4DV6 I;  1P42 A;  4LF7 E;  2IER A;  3CWV A;  1XMQ E;  1IBL I;  4DV3 I;  1RRE A;  2Z5B A;  4GQU A;  4JG4 A;  5EL9 A;  4IFD D;  1HNZ E;  5DRP A;  1Z0V A;  2GQ0 A;  4LF6 E;  3Q6N A;  4EMD A;  5C0X C;  5IWA E;  5BR8 I;  4OO1 F;  4MDT A;  1N34 E;  3PS3 A;  4LCF A;  2UXD I;  5K36 F;  4IZK A;  1XNR I;  2E5L E;  2UUB I;  3QT7 A;  3K85 A;  3GLL A;  2UXB I;  4DPY A;  3PYE A;  4JI6 E;  1FJG I;  4NBQ A;  4LF9 E;  4IFD B;  2WP8 A;  3B4T A;  1QZR A;  1ZM9 A;  4DR7 I;  1H7S A;  2BM1 A;  1HNX I;  1EA6 A;  2Z5C A;  4JV5 I;  4BA2 B;  4LF8 E;  4BA1 A;  5C0X D;  4JYA E;  2UXC I;  2C38 B;  4OO1 C;  2F4V E;  4WUD A;  4JI1 I;  1NHH A;  2GO4 A;  3J81 Q;  3J80 Q;  4DV5 I;  4GKJ I;  1BKN A;  4LCG A;  1ZM2 A;  1Y60 A;  2GS8 A;  2PO2 A;  3B8H A;  4FN5 A;  2DEJ A;  1FI4 A;  4AID A;  4GKK E;  5C0X B;  1J5E I;  4X62 E; 
#chains in the Genus database with same CATH homology
 4USM A;  4AQY I;  4JI7 E;  4DPX A;  1XNQ I;  2AJ4 A;  1XMO I;  2V34 A;  3B78 A;  1HR0 E;  4JI3 I;  4DPU A;  2Q2E B;  1Y6Z A;  4JI8 E;  4B3T E;  1KKH A;  4DR1 I;  4DR4 I;  5IT9 C;  1N33 E;  3PYD A;  1HNW E;  5L3J A;  1IBM I;  1IBK I;  1H73 A;  4DV1 I;  2BV3 A;  3PYG A;  5LMN E;  1HK7 A;  4DV0 I;  1DAR A;  4LF5 E;  4PU9 A;  3H4L A;  4B3S I;  3T1H E;  2DEI A;  1USU A;  4JI0 I;  3V5R A;  3JAM C;  3QT8 A;  4PRV A;  1XHK A;  4JI2 I;  4HYM A;  4UT4 A;  4DUY E;  5A2Q C;  4DR5 I;  4LF4 E;  4X64 E;  4P52 A;  4DV4 E;  3ZKB A;  2HKE A;  1Y4U A;  4YY3 I;  4LF7 I;  1XMQ I;  1WUU A;  1KIJ A;  3B82 A;  4N3O A;  4DV2 E;  3F0N A;  4LF6 I;  4DUZ I;  3K1J A;  1N0V C;  3WU4 A;  4KQV A;  5IWA I;  2ZM6 E;  2E1R A;  4X66 E;  1N34 I;  1D6T A;  1UEK A;  2E5L I;  4DR6 E;  2OI2 A;  2HKJ A;  1Z5C A;  2X7I A;  4LF9 I;  1KVK A;  2V2V A;  4LF8 I;  3ZZ0 A;  2XEX A;  2NPF A;  3ZZT A;  3J7A M;  4OX9 I;  2VQF E;  4DR3 E;  2F4V I;  4XTJ A;  2R42 A;  2HHH E;  4DPW A;  5BR8 E;  3M6A A;  3HJC A;  3P06 A;  4MYT A;  1MU5 A;  5FLX Q;  2UUA E;  2UXD E;  1ZXM A;  4GKK I;  1XNR E;  4B3R E;  5GME A;  4X62 I;  1U2R A;  1FNM A;  5GMD A;  4JI5 E;  4LFB E;  2WW4 A;  4JI7 I;  3T1Y E;  4NXM I;  2O1U A;  5LL6 R;  1USV A;  1A6F A;  1Z0G A;  4P7A A;  3PRY A;  4YHH E;  1HR0 I;  1ZM4 A;  4HY1 A;  3QT5 A;  4K0K E;  4B3T I;  4JI8 I;  1MX0 A;  3J81 C;  4WUB A;  2HFS A;  3J80 C;  1N33 I;  4KHP I;  5LMU E;  1HNW I;  1Z0C A;  4B3M I;  4FWD A;  2O1T A;  2UUC E;  1N36 I;  1B62 A;  4LF5 I;  1RR9 A;  4DU8 A;  3T1H I;  4HAC A;  3PYF A;  1PVG A;  2HK3 A;  2PNM A;  1S16 A;  4DUY I;  4FWH A;  3GON A;  4LF4 I;  4X64 I;  1Z5A A;  4LFC E;  4DV4 I;  2IOP A;  1Z0E A;  4NXN E;  3OTO E;  4DR2 E;  3K17 A;  4JI4 E;  4DV2 I;  3WU6 A;  4IZJ D;  2UU9 E;  2CGE A;  4LFA E;  2EFG A;  2VQE E;  2A2D A;  1Z5B A;  3J7A G;  2ZM6 I;  4X66 I;  1HNZ I;  1N32 E;  3QT6 A;  4DV7 E;  1I94 E;  1OJ4 A;  1PIE A;  4DR6 I;  2BM0 A;  1NZ0 A;  1S4E A;  2CZ9 A;  4IZJ B;  1Z59 A;  3LTO A;  1H72 C;  4URL A;  1NHI A;  4UTG A;  2LJP A;  4JI6 I;  1NHJ A;  4DU7 A;  4YY3 E;  4X65 E;  2VQF I;  4I3H A;  4DR3 I;  1VIS A;  4JYA I;  4DV6 E;  2ZIT A;  4DUZ E;  2HHH I;  1ELO A;  1K47 A;  1IBL E;  1ZM3 A;  3ZZU A;  4ED4 A;  4DV3 E;  2X36 A;  1H74 A;  2UUA I;  2O1V A;  4R1F A;  4B3R I;  3ZM7 A;  4WUC A;  4JI5 I;  4LFB I;  4M1K A;  3T1Y I;  4FWG A;  2UUB E;  2Z5B B;  4YHH I;  2UXB E;  2V2Q A;  4K0K I;  1FJG E;  4FW9 A;  1Z0W A;  3WU3 A;  4DR7 E;  5LMU I;  1HNX E;  3ZKD A;  1H7U A;  2UUC I;  5FLX C;  4HXZ A;  4OX9 E;  4JV5 E;  4IZK B;  3HUL A;  1Z0B A;  2UXC E;  2J7K A;  4DPT A;  5LMN I;  1B63 A;  3LNU A;  3WU5 A;  2O1W A;  4JI1 E;  2Z5C B;  1FKA E;  2PNL A;  5IT9 Q;  4DV5 E;  4GKJ E;  1KTV A;  4NXM E;  2V2Z A;  4PRX A;  1ZXN A;  4LFC I;  1J5E E;  4ZVI A;  1N0U A;  1EI1 A;  2V8P A;  4AQY E;  1Z0T A;  4NXN I;  1XNQ E;  3JAM Q;  1XMO E;  3OTO I;  4DR2 I;  4KHP E;  4JI4 I;  4B3M E;  4JI3 E;  1N36 E;  1PKP A;  2Z5E A;  2UU9 I;  2HK2 A;  4LFA I;  4DR1 E;  2VQE I;  4DR4 E;  3Q6M A;  1FWK A;  2VF3 A;  4IZJ A;  5A2Q Q;  2HFU A;  2A2C A;  1IBM E;  1N32 I;  1IBK E;  4DV1 E;  4DV7 I;  4DXL A;  1I94 I;  4DV0 E;  4USK A;  1Y4S A;  3V2U C;  4RPF A;  4B3S E;  1FWL A;  4JI0 E;  2CG9 A;  2R3V A;  2ZBK B;  4MYU A;  3Q1Q A;  1MG7 A;  4JI2 E;  4HAC B;  4Z7C A;  2IOQ A;  4Z7Y A;  4X65 I;  3LPS A;  4DR5 E;  3D4J A;  5FWK A;  4DV6 I;  4LF7 E;  1XMQ E;  3CWV A;  1IBL I;  4DV3 I;  1RRE A;  2Z5B A;  4JG4 A;  1HNZ E;  1Z0V A;  2GQ0 A;  4LF6 E;  3Q6N A;  4EMD A;  5IWA E;  5BR8 I;  1N34 E;  2UXD I;  4IZK A;  1XNR I;  2E5L E;  2UUB I;  3QT7 A;  3K85 A;  2UXB I;  4DPY A;  3PYE A;  4JI6 E;  1FJG I;  4LF9 E;  1QZR A;  1ZM9 A;  4DR7 I;  1H7S A;  2BM1 A;  1HNX I;  1EA6 A;  2Z5C A;  4JV5 I;  4LF8 E;  4JYA E;  2UXC I;  2F4V E;  4WUD A;  4JI1 I;  1NHH A;  3J81 Q;  3J80 Q;  4DV5 I;  4GKJ I;  1BKN A;  1ZM2 A;  2GS8 A;  3B8H A;  4FN5 A;  2DEJ A;  1FI4 A;  4GKK E;  1J5E I;  4X62 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...