2Z5CB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
147
structure length
106
Chain Sequence
ISYEFQTHKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYQVVTKLGDSADPKVPVVCVQIAELYRRVILPQFSLLISMSSKIWNDFGKLVFVLKCIKDMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
molecule keywords Protein YPL144W
total genus 29
structure length 106
sequence length 147
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cB00
2Z5EA 2Z5BB 2Z5CB
chains in the Genus database with same CATH superfamily
1ZM3A 4JI3E 4DR4E 1RHYA 3JAMQ 3B82A 1UDQA 1IBKE 4YY3E 3OTOI 4HACB 4AIDA 5K36A 4BA2A 1FJGI 2UUAI 4X62E 4B3SE 3U1YA 1Z5CA 3ZZUA 4AQYI 3M7NG 1IBLE 2C39B 3J80Q 2DEJA 3HKMA 4KHPI 3P3GA 3GLLA 3CDIA 2C37A 2ZBKB 1NHHA 1N33E 2GO3A 4B3TI 5EKWA 3ZKBA 4FW6A 3WU3A 4GKKI 2IOPA 4DV6I 1FKAE 4LCHA 1H73A 4MYTA 4LF7E 5IT9C 3V2UC 4LFCE 4BA2B 3T1HE 1Z59A 1N34E 3HJCA 4LF9E 2BA1D 4P52A 1H7UA 4DPXA 3K17A 4DR3E 2HKJA 1KTVA 4LF8I 2BR2B 4DR7E 1IBME 3Q1QA 4MU3A 1Z0CA 1UDSA 2UUCE 4IZKA 1WUUA 2HKEA 4B3SI 4OO1C 4JI7E 4OO1B 3LTOA 3J81C 2PO1B 4U3DA 1IBMI 2VQFI 4FW4A 2VQEI 1Y4SA 2IERA 4USKA 2UUCI 2HHHI 2O1UA 1MG7A 1XMQE 3F0NA 4JI6E 4XTJA 2IESA 5IWAE 4P7AA 4OO1A 2WNRB 4IFDF 2JE6B 1VISA 3PS3A 2XEXA 5DNLA 1U2RA 1VI7A 3JAMC 1UDNA 1FWLA 4BA1A 1MX0A 3K85A 2UXCI 1R6LA 2X36A 1XNRE 1BKNA 4DV6E 1Y5YA 2E5LE 1OYSA 2Z5BB 4USMA 4YHHE 1XMOE 2UXBE 4LF7I 3GMEA 4NXNE 3B78A 3UHMA 3GCMA 4LF9I 5IT9Q 2UUBE 2HK2A 4DV4I 4DV5E 2A2CA 1J5EE 4YHHI 3LNUA 3P3EA 2X7IA 5K36B 3WU4A 4DV0I 1UEKA 5EL9A 4JI7I 4DR4I 3WU6A 3PYGA 3J81Q 4DR1E 4MYUA 1J5EI 4QNJA 2UXDI 1I94E 4DV3E 4JI4E 2O1VA 4OKGA 5IWAI 1IBLI 1Z0GA 1ZM2A 4GQUA 1XNQI 4MU4A 2JEBA 4B3ME 3CDJA 3WU5A 4B3RI 5JEAC 2BA1G 2CG9A 3K1JA 2PNLA 3GONA 2AJ4A 1USVA 2UXCE 1OYPA 1Z5BA 2NPFA 4WUDA 4OX9E 4MQYA 4URLA 4JI5E 3PYEA 2V34A 3P3CA 1PKPA 4FW3A 4LF4E 4GKKE 4DU7A 4PRXA 4OO1E 2Z5CA 3PRYA 4JG4A 4R1FA 2UXBI 3T1HI 4DUYE 2O1WA 2ZITA 4NBQA 2BR2A 1RR9A 1P42A 1N34I 1S16A 4QNKA 2R42A 2GQ0A 4FW5A 1RREA 3M7ND 1PIEA 4LFAE 3P06A 2VF3A 1ZM9A 5JEAF 2V2ZA 4K0KE 4GKJE 2PO2A 1R6MA 2O1TA 1FJGE 2UUAE 1QZRA 3PYDA 2WP8A 4X66E 4PU9A 1ELOA 1IBKI 1Y60A 4I3HA 4DV2I 4DR2E 1Y4UA 2R3VA 4DPYA 2EFGA 3PYFA 4LF4I 4JI1I 2IOQA 4JI6I 4FW9A 1HNXI 2GS8A 5C0XB 1N32I 4B3TE 3J7AG 4PRVA 1FI4A 1OJ4A 4WUCA 4JI0I 1FNMA 2HFSA 1PVGA 4DUYI 4OZEA 2Z5BA 4IS9A 4WUBA 1N32E 4U3BA 1NZ0A 4LFCI 1H74A 1XMOI 4IZJB 1B62A 2BA0G 4RPFA 4NXNI 2J65A 4GKJI 4K0KI 2F1DA 2WP8B 2CGEA 4DPTA 4X65E 2J7KA 4LF5E 4IFDC 4DPUA 5DROA 4DR3I 4IZJA 4X66I 1XHKA 5JEAE 1HNZE 1HR0E 2HFUA 4ZVIA 1DARA 4Z7YA 2F4VE 2NN6A 5L3JA 1KIJA 4HXZA 5DRQA 1HNWE 3ZZ0A 4OO1F 4IFDA 3D4JA 3ZZTA 4JI1E 4FW7A 3PS1A 3P76A 2PO0B 2F4VI 5JEAB 5JEAD 3Q6NA 4X62I 2O3ZA 2PNZB 1N0VC 5A2QQ 3LPSA 4M1KA 4DV1I 4IFDE 1HNXE 1N36E 2C39A 1HK7A 2JT2A 2V2VA 3M6AA 5DNXA 2HHHE 1KKHA 4NXME 1XNRI 2JEAA 3T1YI 4X65I 1N0UA 3PS2A 1USUA 3J7AM 2NN6C 4IFDD 2NN6B 1HNZI 4JI8E 4FWGA 2BV3A 1MU5A 3ZM7A 2ZM6E 5A2QC 3T1YE 3HULA 5C0XA 4DR5I 4JI2E 4KQVA 4BA1B 4DUZI 3ZKDA 1ZXNA 4DPWA 2NN6D 4JI8I 4DR6I 3B4TA 2ZM6I 4N3OA 1NHJA 1Z0VA 4LOMA 2PO2B 1YH8A 4J3DA 1Z0EA 5C0XF 2JEAB 4DV0E 4DR6E 4FWDA 4HYMA 1Z5AA 2LJPA 1Z0BA 2NN6E 5LMNE 2CVEA 1I94I 4JI4I 5LMUI 4OX9I 1XXEA 5DRRA 4OO1D 2PO1A 1N36I 2E5LI 4IZJD 4EMDA 2VQEE 3L7ZB 5K36C 3H4LA 1EI1A 3CWVA 2C38B 5JEAA 4DUZE 1OYRA 4X64E 3V5RA 4JYAE 2PNZA 2CZ9A 4LFBE 1EA6A 1ZXMA 2Q2EB 2E1RA 4DR5E 4JI2I 2V8PA 5ELWA 5K36D 1H72C 3NZKA 4FN5A 3U1KA 4LF8E 2BM0A 4UT4A 2AE8A 2JEBB 4LFBI 4DR7I 1Y6ZA 4DV4E 4DV5I 2DEIA 1E3HA 5GMDA 2Z5CB 5LMNI 2V2QA 4LCFA 4MDTA 3DD6A 4LFAI 5GMEA 3KRNA 4Z7CA 3B8HA 4UTGA 1NHIA 3H1CA 1B63A 4DR2I 5K36E 3Q6MA 1K47A 2VQFE 4DR1I 4JI5I 5BR8E 4LPFA 2UXDE 3QT8A 2VESA 1S4EA 2C37B 1N33I 4LF6E 4B3MI 2HK3A 4JI0E 1YHCA 1H7SA 3M85G 5FWKA 5C0XE 2UUBI 4DV7I 4JV5E 4ED4A 3J80C 2WNRA 4HY1A 4FWHA 2NN6F 4LF5I 2JE6A 4JV5I 3M85D 2PO0A 2A2DA 2BM1A 5C0XD 4DV3I 1FWKA 4HACA 4AIMA 2UU9E 1XNQE 1Z0WA 4AM3A 1HNWI 1D6TA 2WW4A 3QT7A 5LL6R 1HR0I 2PNMA 5DRPA 5FLXC 5FLXQ 4KHPE 4ISAA 4B3RE 5BR8I 4IZKB 5LMUE 1XMQI 4DU8A 4LCGA 4AQYE 3QT6A 4IFDB 4DV2E 4LF6I 2OI2A 3QT5A 1A6FA 3L7ZA 1KVKA 4NXMI 2C38A 4DV1E 4DXLA 1E3PA 4MU0A 4MU1A 4DV7E 4JI3I 1ZM4A 2BA0D 4JYAI 5K36F 1Z0TA 4X64I 4YY3I 3OTOE 2UU9I 2GO4A 5C0XC 1UDOA 2Z5EA
chains in the Genus database with same CATH topology
1ZM3A 4JI3E 4DR4E 3JAMQ 3B82A 1IBKE 4YY3E 3OTOI 4HACB 1FJGI 2UUAI 4X62E 4B3SE 1Z5CA 3ZZUA 4AQYI 1IBLE 3J80Q 2DEJA 4KHPI 2ZBKB 1NHHA 1N33E 4B3TI 3ZKBA 3WU3A 4GKKI 2IOPA 4DV6I 1FKAE 1H73A 4MYTA 4LF7E 5IT9C 3V2UC 4LFCE 3T1HE 1Z59A 1N34E 3HJCA 4LF9E 4P52A 1H7UA 4DPXA 3K17A 4DR3E 2HKJA 1KTVA 4LF8I 4DR7E 1IBME 3Q1QA 1Z0CA 2UUCE 4IZKA 1WUUA 2HKEA 4B3SI 4JI7E 3LTOA 3J81C 1IBMI 2VQFI 2VQEI 1Y4SA 4USKA 2UUCI 2HHHI 2O1UA 1MG7A 1XMQE 3F0NA 4JI6E 4XTJA 5IWAE 4P7AA 1VISA 2XEXA 1U2RA 3JAMC 1FWLA 1MX0A 3K85A 2UXCI 2X36A 1XNRE 1BKNA 4DV6E 2E5LE 2Z5BB 4USMA 4YHHE 1XMOE 2UXBE 4LF7I 4NXNE 3B78A 4LF9I 5IT9Q 2UUBE 4DV5E 4DV4I 2HK2A 2A2CA 1J5EE 4YHHI 3LNUA 2X7IA 3WU4A 4DV0I 1UEKA 4JI7I 4DR4I 3WU6A 3PYGA 3J81Q 4DR1E 4MYUA 1J5EI 2UXDI 1I94E 4DV3E 4JI4E 2O1VA 5IWAI 1IBLI 1Z0GA 1ZM2A 1XNQI 4B3ME 3WU5A 4B3RI 2CG9A 3K1JA 2PNLA 3GONA 2AJ4A 1USVA 2UXCE 1Z5BA 2NPFA 4WUDA 4OX9E 4URLA 4JI5E 3PYEA 2V34A 1PKPA 4LF4E 4GKKE 4DU7A 4PRXA 2Z5CA 3PRYA 4JG4A 4R1FA 2UXBI 3T1HI 4DUYE 2O1WA 2ZITA 1RR9A 1N34I 1S16A 2R42A 2GQ0A 1RREA 1PIEA 4LFAE 3P06A 2VF3A 1ZM9A 2V2ZA 4K0KE 4GKJE 2O1TA 1FJGE 2UUAE 1QZRA 3PYDA 4X66E 4PU9A 1ELOA 1IBKI 4I3HA 4DV2I 4DR2E 1Y4UA 2R3VA 4DPYA 2EFGA 3PYFA 4LF4I 4JI1I 2IOQA 4JI6I 4FW9A 1HNXI 2GS8A 1N32I 4B3TE 3J7AG 4PRVA 1FI4A 1OJ4A 4WUCA 4JI0I 1FNMA 2HFSA 1PVGA 4DUYI 2Z5BA 4WUBA 1N32E 1NZ0A 4LFCI 1H74A 1XMOI 4IZJB 1B62A 4NXNI 4RPFA 4GKJI 4K0KI 2CGEA 4DPTA 4X65E 2J7KA 4LF5E 4DPUA 4DR3I 4IZJA 4X66I 1XHKA 1HNZE 1HR0E 2HFUA 4ZVIA 1DARA 4Z7YA 2F4VE 5L3JA 1KIJA 4HXZA 1HNWE 3ZZ0A 3D4JA 3ZZTA 4JI1E 2F4VI 3Q6NA 4X62I 1N0VC 5A2QQ 3LPSA 4M1KA 4DV1I 1HNXE 1N36E 1HK7A 2V2VA 3M6AA 2HHHE 1KKHA 4NXME 1XNRI 3T1YI 4X65I 1N0UA 1USUA 3J7AM 1HNZI 4JI8E 4FWGA 2BV3A 1MU5A 3ZM7A 2ZM6E 5A2QC 3T1YE 3HULA 4DR5I 4JI2E 4KQVA 4DUZI 3ZKDA 1ZXNA 4DPWA 4JI8I 4DR6I 2ZM6I 4N3OA 1NHJA 1Z0VA 1Z0EA 4DV0E 4DR6E 4FWDA 4HYMA 1Z5AA 2LJPA 1Z0BA 5LMNE 1I94I 4JI4I 5LMUI 4OX9I 1N36I 2E5LI 4IZJD 4EMDA 2VQEE 3H4LA 1EI1A 3CWVA 4DUZE 4X64E 3V5RA 4JYAE 2CZ9A 4LFBE 1EA6A 1ZXMA 2Q2EB 2E1RA 4DR5E 4JI2I 2V8PA 1H72C 4FN5A 4LF8E 2BM0A 4UT4A 4LFBI 4DR7I 1Y6ZA 4DV4E 4DV5I 2DEIA 5GMDA 2Z5CB 5LMNI 2V2QA 4LFAI 5GMEA 4Z7CA 3B8HA 4UTGA 1NHIA 1B63A 4DR2I 3Q6MA 1K47A 2VQFE 4DR1I 4JI5I 5BR8E 2UXDE 3QT8A 1S4EA 1N33I 4LF6E 4B3MI 2HK3A 4JI0E 1H7SA 5FWKA 2UUBI 4DV7I 4JV5E 4ED4A 3J80C 4HY1A 4FWHA 4LF5I 4JV5I 2A2DA 2BM1A 4DV3I 1FWKA 4HACA 2UU9E 1XNQE 1Z0WA 1HNWI 1D6TA 2WW4A 3QT7A 5LL6R 1HR0I 2PNMA 5FLXC 5FLXQ 4KHPE 4B3RE 5BR8I 4IZKB 5LMUE 1XMQI 4DU8A 4AQYE 3QT6A 4DV2E 4LF6I 2OI2A 3QT5A 1A6FA 1KVKA 4NXMI 4DV1E 4DXLA 4DV7E 4JI3I 1ZM4A 4JYAI 1Z0TA 4X64I 4YY3I 3OTOE 2UU9I 2Z5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5E A;  2Z5B B;  2Z5C B; 
#chains in the Genus database with same CATH topology
 1ZM3 A;  4JI3 E;  4DR4 E;  1RHY A;  3JAM Q;  3B82 A;  1UDQ A;  1IBK E;  4YY3 E;  3OTO I;  4HAC B;  4AID A;  5K36 A;  4BA2 A;  1FJG I;  2UUA I;  4X62 E;  4B3S E;  3U1Y A;  1Z5C A;  3ZZU A;  4AQY I;  3M7N G;  1IBL E;  2C39 B;  3J80 Q;  2DEJ A;  3HKM A;  4KHP I;  3P3G A;  3GLL A;  3CDI A;  2C37 A;  2ZBK B;  1NHH A;  1N33 E;  2GO3 A;  4B3T I;  5EKW A;  3ZKB A;  4FW6 A;  3WU3 A;  4GKK I;  2IOP A;  4DV6 I;  1FKA E;  4LCH A;  1H73 A;  4MYT A;  4LF7 E;  5IT9 C;  3V2U C;  4LFC E;  4BA2 B;  3T1H E;  1Z59 A;  1N34 E;  3HJC A;  4LF9 E;  2BA1 D;  4P52 A;  1H7U A;  4DPX A;  3K17 A;  4DR3 E;  2HKJ A;  1KTV A;  4LF8 I;  2BR2 B;  4DR7 E;  1IBM E;  3Q1Q A;  4MU3 A;  1Z0C A;  1UDS A;  2UUC E;  4IZK A;  1WUU A;  2HKE A;  4B3S I;  4OO1 C;  4JI7 E;  4OO1 B;  3LTO A;  3J81 C;  2PO1 B;  4U3D A;  1IBM I;  2VQF I;  4FW4 A;  2VQE I;  1Y4S A;  2IER A;  4USK A;  2UUC I;  2HHH I;  2O1U A;  1MG7 A;  1XMQ E;  3F0N A;  4JI6 E;  4XTJ A;  2IES A;  5IWA E;  4P7A A;  4OO1 A;  2WNR B;  4IFD F;  2JE6 B;  1VIS A;  3PS3 A;  2XEX A;  5DNL A;  1U2R A;  1VI7 A;  3JAM C;  1UDN A;  1FWL A;  4BA1 A;  1MX0 A;  3K85 A;  2UXC I;  1R6L A;  2X36 A;  1XNR E;  1BKN A;  4DV6 E;  1Y5Y A;  2E5L E;  1OYS A;  2Z5B B;  4USM A;  4YHH E;  1XMO E;  2UXB E;  4LF7 I;  3GME A;  4NXN E;  3B78 A;  3UHM A;  3GCM A;  4LF9 I;  5IT9 Q;  2UUB E;  2HK2 A;  4DV4 I;  4DV5 E;  2A2C A;  1J5E E;  4YHH I;  3LNU A;  3P3E A;  2X7I A;  5K36 B;  3WU4 A;  4DV0 I;  1UEK A;  5EL9 A;  4JI7 I;  4DR4 I;  3WU6 A;  3PYG A;  3J81 Q;  4DR1 E;  4MYU A;  1J5E I;  4QNJ A;  2UXD I;  1I94 E;  4DV3 E;  4JI4 E;  2O1V A;  4OKG A;  5IWA I;  1IBL I;  1Z0G A;  1ZM2 A;  4GQU A;  1XNQ I;  4MU4 A;  2JEB A;  4B3M E;  3CDJ A;  3WU5 A;  4B3R I;  5JEA C;  2BA1 G;  2CG9 A;  3K1J A;  2PNL A;  3GON A;  2AJ4 A;  1USV A;  2UXC E;  1OYP A;  1Z5B A;  2NPF A;  4WUD A;  4OX9 E;  4MQY A;  4URL A;  4JI5 E;  3PYE A;  2V34 A;  3P3C A;  1PKP A;  4FW3 A;  4LF4 E;  4GKK E;  4DU7 A;  4PRX A;  4OO1 E;  2Z5C A;  3PRY A;  4JG4 A;  4R1F A;  2UXB I;  3T1H I;  4DUY E;  2O1W A;  2ZIT A;  4NBQ A;  2BR2 A;  1RR9 A;  1P42 A;  1N34 I;  1S16 A;  4QNK A;  2R42 A;  2GQ0 A;  4FW5 A;  1RRE A;  3M7N D;  1PIE A;  4LFA E;  3P06 A;  2VF3 A;  1ZM9 A;  5JEA F;  2V2Z A;  4K0K E;  4GKJ E;  2PO2 A;  1R6M A;  2O1T A;  1FJG E;  2UUA E;  1QZR A;  3PYD A;  2WP8 A;  4X66 E;  4PU9 A;  1ELO A;  1IBK I;  1Y60 A;  4I3H A;  4DV2 I;  4DR2 E;  1Y4U A;  2R3V A;  4DPY A;  2EFG A;  3PYF A;  4LF4 I;  4JI1 I;  2IOQ A;  4JI6 I;  4FW9 A;  1HNX I;  2GS8 A;  5C0X B;  1N32 I;  4B3T E;  3J7A G;  4PRV A;  1FI4 A;  1OJ4 A;  4WUC A;  4JI0 I;  1FNM A;  2HFS A;  1PVG A;  4DUY I;  4OZE A;  2Z5B A;  4IS9 A;  4WUB A;  1N32 E;  4U3B A;  1NZ0 A;  4LFC I;  1H74 A;  1XMO I;  4IZJ B;  1B62 A;  2BA0 G;  4RPF A;  4NXN I;  2J65 A;  4GKJ I;  4K0K I;  2F1D A;  2WP8 B;  2CGE A;  4DPT A;  4X65 E;  2J7K A;  4LF5 E;  4IFD C;  4DPU A;  5DRO A;  4DR3 I;  4IZJ A;  4X66 I;  1XHK A;  5JEA E;  1HNZ E;  1HR0 E;  2HFU A;  4ZVI A;  1DAR A;  4Z7Y A;  2F4V E;  2NN6 A;  5L3J A;  1KIJ A;  4HXZ A;  5DRQ A;  1HNW E;  3ZZ0 A;  4OO1 F;  4IFD A;  3D4J A;  3ZZT A;  4JI1 E;  4FW7 A;  3PS1 A;  3P76 A;  2PO0 B;  2F4V I;  5JEA B;  5JEA D;  3Q6N A;  4X62 I;  2O3Z A;  2PNZ B;  1N0V C;  5A2Q Q;  3LPS A;  4M1K A;  4DV1 I;  4IFD E;  1HNX E;  1N36 E;  2C39 A;  1HK7 A;  2JT2 A;  2V2V A;  3M6A A;  5DNX A;  2HHH E;  1KKH A;  4NXM E;  1XNR I;  2JEA A;  3T1Y I;  4X65 I;  1N0U A;  3PS2 A;  1USU A;  3J7A M;  2NN6 C;  4IFD D;  2NN6 B;  1HNZ I;  4JI8 E;  4FWG A;  2BV3 A;  1MU5 A;  3ZM7 A;  2ZM6 E;  5A2Q C;  3T1Y E;  3HUL A;  5C0X A;  4DR5 I;  4JI2 E;  4KQV A;  4BA1 B;  4DUZ I;  3ZKD A;  1ZXN A;  4DPW A;  2NN6 D;  4JI8 I;  4DR6 I;  3B4T A;  2ZM6 I;  4N3O A;  1NHJ A;  1Z0V A;  4LOM A;  2PO2 B;  1YH8 A;  4J3D A;  1Z0E A;  5C0X F;  2JEA B;  4DV0 E;  4DR6 E;  4FWD A;  4HYM A;  1Z5A A;  2LJP A;  1Z0B A;  2NN6 E;  5LMN E;  2CVE A;  1I94 I;  4JI4 I;  5LMU I;  4OX9 I;  1XXE A;  5DRR A;  4OO1 D;  2PO1 A;  1N36 I;  2E5L I;  4IZJ D;  4EMD A;  2VQE E;  3L7Z B;  5K36 C;  3H4L A;  1EI1 A;  3CWV A;  2C38 B;  5JEA A;  4DUZ E;  1OYR A;  4X64 E;  3V5R A;  4JYA E;  2PNZ A;  2CZ9 A;  4LFB E;  1EA6 A;  1ZXM A;  2Q2E B;  2E1R A;  4DR5 E;  4JI2 I;  2V8P A;  5ELW A;  5K36 D;  1H72 C;  3NZK A;  4FN5 A;  3U1K A;  4LF8 E;  2BM0 A;  4UT4 A;  2AE8 A;  2JEB B;  4LFB I;  4DR7 I;  1Y6Z A;  4DV4 E;  4DV5 I;  2DEI A;  1E3H A;  5GMD A;  2Z5C B;  5LMN I;  2V2Q A;  4LCF A;  4MDT A;  3DD6 A;  4LFA I;  5GME A;  3KRN A;  4Z7C A;  3B8H A;  4UTG A;  1NHI A;  3H1C A;  1B63 A;  4DR2 I;  5K36 E;  3Q6M A;  1K47 A;  2VQF E;  4DR1 I;  4JI5 I;  5BR8 E;  4LPF A;  2UXD E;  3QT8 A;  2VES A;  1S4E A;  2C37 B;  1N33 I;  4LF6 E;  4B3M I;  2HK3 A;  4JI0 E;  1YHC A;  1H7S A;  3M85 G;  5FWK A;  5C0X E;  2UUB I;  4DV7 I;  4JV5 E;  4ED4 A;  3J80 C;  2WNR A;  4HY1 A;  4FWH A;  2NN6 F;  4LF5 I;  2JE6 A;  4JV5 I;  3M85 D;  2PO0 A;  2A2D A;  2BM1 A;  5C0X D;  4DV3 I;  1FWK A;  4HAC A;  4AIM A;  2UU9 E;  1XNQ E;  1Z0W A;  4AM3 A;  1HNW I;  1D6T A;  2WW4 A;  3QT7 A;  5LL6 R;  1HR0 I;  2PNM A;  5DRP A;  5FLX C;  5FLX Q;  4KHP E;  4ISA A;  4B3R E;  5BR8 I;  4IZK B;  5LMU E;  1XMQ I;  4DU8 A;  4LCG A;  4AQY E;  3QT6 A;  4IFD B;  4DV2 E;  4LF6 I;  2OI2 A;  3QT5 A;  1A6F A;  3L7Z A;  1KVK A;  4NXM I;  2C38 A;  4DV1 E;  4DXL A;  1E3P A;  4MU0 A;  4MU1 A;  4DV7 E;  4JI3 I;  1ZM4 A;  2BA0 D;  4JYA I;  5K36 F;  1Z0T A;  4X64 I;  4YY3 I;  3OTO E;  2UU9 I;  2GO4 A;  5C0X C;  1UDO A;  2Z5E A; 
#chains in the Genus database with same CATH homology
 1ZM3 A;  4JI3 E;  4DR4 E;  3JAM Q;  3B82 A;  1IBK E;  4YY3 E;  3OTO I;  4HAC B;  1FJG I;  2UUA I;  4X62 E;  4B3S E;  1Z5C A;  3ZZU A;  4AQY I;  1IBL E;  3J80 Q;  2DEJ A;  4KHP I;  2ZBK B;  1NHH A;  1N33 E;  4B3T I;  3ZKB A;  3WU3 A;  4GKK I;  2IOP A;  4DV6 I;  1FKA E;  1H73 A;  4MYT A;  4LF7 E;  5IT9 C;  3V2U C;  4LFC E;  3T1H E;  1Z59 A;  1N34 E;  3HJC A;  4LF9 E;  4P52 A;  1H7U A;  4DPX A;  3K17 A;  4DR3 E;  2HKJ A;  1KTV A;  4LF8 I;  4DR7 E;  1IBM E;  3Q1Q A;  1Z0C A;  2UUC E;  4IZK A;  1WUU A;  2HKE A;  4B3S I;  4JI7 E;  3LTO A;  3J81 C;  1IBM I;  2VQF I;  2VQE I;  1Y4S A;  4USK A;  2UUC I;  2HHH I;  2O1U A;  1MG7 A;  1XMQ E;  3F0N A;  4JI6 E;  4XTJ A;  5IWA E;  4P7A A;  1VIS A;  2XEX A;  1U2R A;  3JAM C;  1FWL A;  1MX0 A;  3K85 A;  2UXC I;  2X36 A;  1XNR E;  1BKN A;  4DV6 E;  2E5L E;  2Z5B B;  4USM A;  4YHH E;  1XMO E;  2UXB E;  4LF7 I;  4NXN E;  3B78 A;  4LF9 I;  5IT9 Q;  2UUB E;  4DV5 E;  4DV4 I;  2HK2 A;  2A2C A;  1J5E E;  4YHH I;  3LNU A;  2X7I A;  3WU4 A;  4DV0 I;  1UEK A;  4JI7 I;  4DR4 I;  3WU6 A;  3PYG A;  3J81 Q;  4DR1 E;  4MYU A;  1J5E I;  2UXD I;  1I94 E;  4DV3 E;  4JI4 E;  2O1V A;  5IWA I;  1IBL I;  1Z0G A;  1ZM2 A;  1XNQ I;  4B3M E;  3WU5 A;  4B3R I;  2CG9 A;  3K1J A;  2PNL A;  3GON A;  2AJ4 A;  1USV A;  2UXC E;  1Z5B A;  2NPF A;  4WUD A;  4OX9 E;  4URL A;  4JI5 E;  3PYE A;  2V34 A;  1PKP A;  4LF4 E;  4GKK E;  4DU7 A;  4PRX A;  2Z5C A;  3PRY A;  4JG4 A;  4R1F A;  2UXB I;  3T1H I;  4DUY E;  2O1W A;  2ZIT A;  1RR9 A;  1N34 I;  1S16 A;  2R42 A;  2GQ0 A;  1RRE A;  1PIE A;  4LFA E;  3P06 A;  2VF3 A;  1ZM9 A;  2V2Z A;  4K0K E;  4GKJ E;  2O1T A;  1FJG E;  2UUA E;  1QZR A;  3PYD A;  4X66 E;  4PU9 A;  1ELO A;  1IBK I;  4I3H A;  4DV2 I;  4DR2 E;  1Y4U A;  2R3V A;  4DPY A;  2EFG A;  3PYF A;  4LF4 I;  4JI1 I;  2IOQ A;  4JI6 I;  4FW9 A;  1HNX I;  2GS8 A;  1N32 I;  4B3T E;  3J7A G;  4PRV A;  1FI4 A;  1OJ4 A;  4WUC A;  4JI0 I;  1FNM A;  2HFS A;  1PVG A;  4DUY I;  2Z5B A;  4WUB A;  1N32 E;  1NZ0 A;  4LFC I;  1H74 A;  1XMO I;  4IZJ B;  1B62 A;  4NXN I;  4RPF A;  4GKJ I;  4K0K I;  2CGE A;  4DPT A;  4X65 E;  2J7K A;  4LF5 E;  4DPU A;  4DR3 I;  4IZJ A;  4X66 I;  1XHK A;  1HNZ E;  1HR0 E;  2HFU A;  4ZVI A;  1DAR A;  4Z7Y A;  2F4V E;  5L3J A;  1KIJ A;  4HXZ A;  1HNW E;  3ZZ0 A;  3D4J A;  3ZZT A;  4JI1 E;  2F4V I;  3Q6N A;  4X62 I;  1N0V C;  5A2Q Q;  3LPS A;  4M1K A;  4DV1 I;  1HNX E;  1N36 E;  1HK7 A;  2V2V A;  3M6A A;  2HHH E;  1KKH A;  4NXM E;  1XNR I;  3T1Y I;  4X65 I;  1N0U A;  1USU A;  3J7A M;  1HNZ I;  4JI8 E;  4FWG A;  2BV3 A;  1MU5 A;  3ZM7 A;  2ZM6 E;  5A2Q C;  3T1Y E;  3HUL A;  4DR5 I;  4JI2 E;  4KQV A;  4DUZ I;  3ZKD A;  1ZXN A;  4DPW A;  4JI8 I;  4DR6 I;  2ZM6 I;  4N3O A;  1NHJ A;  1Z0V A;  1Z0E A;  4DV0 E;  4DR6 E;  4FWD A;  4HYM A;  1Z5A A;  2LJP A;  1Z0B A;  5LMN E;  1I94 I;  4JI4 I;  5LMU I;  4OX9 I;  1N36 I;  2E5L I;  4IZJ D;  4EMD A;  2VQE E;  3H4L A;  1EI1 A;  3CWV A;  4DUZ E;  4X64 E;  3V5R A;  4JYA E;  2CZ9 A;  4LFB E;  1EA6 A;  1ZXM A;  2Q2E B;  2E1R A;  4DR5 E;  4JI2 I;  2V8P A;  1H72 C;  4FN5 A;  4LF8 E;  2BM0 A;  4UT4 A;  4LFB I;  4DR7 I;  1Y6Z A;  4DV4 E;  4DV5 I;  2DEI A;  5GMD A;  2Z5C B;  5LMN I;  2V2Q A;  4LFA I;  5GME A;  4Z7C A;  3B8H A;  4UTG A;  1NHI A;  1B63 A;  4DR2 I;  3Q6M A;  1K47 A;  2VQF E;  4DR1 I;  4JI5 I;  5BR8 E;  2UXD E;  3QT8 A;  1S4E A;  1N33 I;  4LF6 E;  4B3M I;  2HK3 A;  4JI0 E;  1H7S A;  5FWK A;  2UUB I;  4DV7 I;  4JV5 E;  4ED4 A;  3J80 C;  4HY1 A;  4FWH A;  4LF5 I;  4JV5 I;  2A2D A;  2BM1 A;  4DV3 I;  1FWK A;  4HAC A;  2UU9 E;  1XNQ E;  1Z0W A;  1HNW I;  1D6T A;  2WW4 A;  3QT7 A;  5LL6 R;  1HR0 I;  2PNM A;  5FLX C;  5FLX Q;  4KHP E;  4B3R E;  5BR8 I;  4IZK B;  5LMU E;  1XMQ I;  4DU8 A;  4AQY E;  3QT6 A;  4DV2 E;  4LF6 I;  2OI2 A;  3QT5 A;  1A6F A;  1KVK A;  4NXM I;  4DV1 E;  4DXL A;  4DV7 E;  4JI3 I;  1ZM4 A;  4JYA I;  1Z0T A;  4X64 I;  4YY3 I;  3OTO E;  2UU9 I;  2Z5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...