2Z5CB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
147
structure length
106
Chain Sequence
ISYEFQTHKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYQVVTKLGDSADPKVPVVCVQIAELYRRVILPQFSLLISMSSKIWNDFGKLVFVLKCIKDMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/hydrolase
molecule keywords Protein YPL144W
total genus 29
structure length 106
sequence length 147
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cB00
2Z5CB 2Z5EA 2Z5BB
chains in the Genus database with same CATH superfamily
4LF6I 2E5LE 4QNKA 3P06A 5LMUE 4LF8I 3U1KA 3ZZTA 4DV4I 4IZJA 1FJGE 1Z0TA 4J3DA 2PNLA 1XHKA 4OO1C 1Y4UA 1Y6ZA 4Z7YA 4MQYA 4JYAE 4JI8E 2PNZA 1PIEA 4U3DA 4OO1A 4XTJA 4DV7E 4LF7E 4DR5E 2CG9A 2BM1A 4JYAI 4DPTA 3L7ZB 4B3SI 4JG4A 3OTOI 5A2QQ 1HNXE 2C39B 3H4LA 4DV3E 1N34I 2BA1D 2IOQA 1R6LA 1VI7A 3QT7A 4JI7E 4IFDE 4LCGA 4PRVA 4GKKE 1N32I 2ZITA 4USMA 1U2RA 4JV5E 3F0NA 3QT8A 2UXCE 4LF9E 2UXBI 3PS3A 3J80C 3B78A 1D6TA 3L7ZA 4X62E 2Z5CA 4NXNE 4X65I 4HY1A 1MU5A 4FW9A 1J5EE 1H72C 3GMEA 5JEAE 4LF7I 2F4VI 1UDSA 4DV6I 3CWVA 5LMUI 3CDJA 1FI4A 1RHYA 4JI0E 5ELWA 3QT6A 2CZ9A 5IT9Q 2UUBE 3PS2A 2UUCE 4LFBI 1UDNA 5DNXA 3K85A 2O1VA 4YY3E 1HNZI 3DD6A 2WP8A 4RPFA 2CVEA 2Z5CB 3GLLA 1KKHA 2ZM6E 1S16A 3T1HE 5LL6R 3P76A 4MU3A 2PO1B 4DR7E 5A2QC 5BR8I 1ZM3A 3NZKA 4R1FA 4KHPE 5K36D 4DU7A 4ISAA 2HHHE 4JI2I 4OO1D 2BR2A 5C0XF 2HK2A 2J7KA 4LPFA 2BV3A 4B3TI 3QT5A 4JI4E 1IBME 4B3MI 1XMQE 5C0XE 1MG7A 4YY3I 2BA0G 3JAMC 3K1JA 2BA1G 4DR3I 4DR4I 4K0KI 4AIMA 3OTOE 3CDIA 1I94I 2PO0A 4DR2I 4HACA 1KIJA 5DRPA 1H73A 4GQUA 4NXMI 4DV1E 1Z5BA 3LPSA 5C0XB 1OYPA 4IFDB 1PVGA 4FW7A 1RREA 5K36A 4DR1E 4LCFA 4JI3I 4ZVIA 1PKPA 2WNRA 1XMQI 4IZKA 1ZM2A 3M6AA 4X66I 3LNUA 5DROA 4LF4E 2GO3A 4B3TE 2E5LI 4DPWA 2C38B 1Z5CA 2PO2A 4MDTA 5GMEA 4GKKI 4YHHE 1KTVA 4AM3A 1J5EI 2JEBA 3V2UC 2C37A 2VESA 5BR8E 2PNMA 1OYRA 4DUZI 1FWLA 3HJCA 2HHHI 4BA2A 2IERA 1USVA 5JEAF 4B3SE 2V2ZA 4FW6A 5DRQA 4JI6E 4DR7I 1ZM9A 5K36B 5IWAI 1Z0EA 4MYUA 1I94E 5EL9A 5C0XA 2VQFI 2ZM6I 3P3EA 2NPFA 3JAMQ 3Q6NA 1N36E 1N33I 4JI3E 1Z5AA 1P42A 1FKAE 1E3PA 2O1UA 4P7AA 1N36I 2V34A 4MU0A 1N33E 2UUCI 4URLA 1XXEA 4DV0E 4BA2B 2GO4A 1NHHA 4FW3A 2LJPA 3P3CA 3PYGA 2UU9I 3M7NG 3PRYA 1HR0E 2R42A 5C0XD 1HR0I 4UT4A 4K0KE 1Z0CA 4X65E 4LFAE 2VF3A 3WU6A 4USKA 5K36F 4AIDA 1BKNA 4U3BA 3ZZ0A 3B82A 1KVKA 1A6FA 3KRNA 3GONA 1UEKA 4WUBA 5K36E 4X66E 5IT9C 4OZEA 4HYMA 1N34E 3J81C 1Y4SA 2JEAA 2Q2EB 4OO1B 3H1CA 4DV7I 3HULA 1H7SA 2EFGA 4JI6I 1E3HA 1FNMA 3T1HI 4IFDA 2O1WA 2J65A 4HACB 4DR4E 5LMNE 2NN6A 2V2VA 2V8PA 2JE6A 4IFDC 3UHMA 1UDOA 4PU9A 3WU4A 1ZXMA 4DR6I 4GKJE 4YHHI 1FWKA 2HKJA 5L3JA 1N0VC 4BA1A 4LF6E 3J7AG 5JEAD 2C37B 2JEAB 5FLXC 3D4JA 4JI2E 3WU5A 2BA0D 2C38A 2PO2B 1XMOE 4IFDD 4I3HA 4JI5I 1XMOI 2WW4A 2JEBB 4LFCI 1H7UA 2IOPA 5JEAC 1XNQI 4DUYE 1XNRE 2R3VA 2DEIA 4Z7CA 4DV0I 1QZRA 4LF4I 4EMDA 4N3OA 5JEAA 4DR6E 4GKJI 3J80Q 2O3ZA 1IBMI 2XEXA 4HXZA 2ZBKB 4DV1I 3PS1A 3Q6MA 1MX0A 1RR9A 1EI1A 1XNRI 4MU4A 1N0UA 2WP8B 4KQVA 4OKGA 4DV2E 1ZM4A 2UUAE 3ZZUA 4JI1E 4MU1A 1OJ4A 3T1YE 1YHCA 1B63A 2JT2A 4NXNI 2HKEA 2JE6B 4FW5A 4X62I 2VQEI 4JV5I 1K47A 1Z0WA 4DPUA 2UXCI 1B62A 1DARA 1IBLI 3B4TA 2NN6C 4B3RI 1UDQA 2NN6E 4OO1F 1YH8A 1Z0VA 2VQFE 5DNLA 4DV3I 3M7ND 3WU3A 3LTOA 4DV6E 1ELOA 1OYSA 3Q1QA 2O1TA 4ED4A 4X64I 4NXME 4X64E 2PNZB 3HKMA 2AE8A 2V2QA 1FJGI 1Y5YA 4DV4E 4DR3E 2UU9E 2E1RA 4LFBE 2UUBI 4UTGA 4LF5E 4FWGA 4LF8E 2NN6B 4IZJB 2X36A 4B3ME 2DEJA 4JI4I 1IBLE 4P52A 3M85G 2CGEA 4M1KA 2UXDE 4AQYI 1NZ0A 4IZJD 3U1YA 4DPXA 2NN6D 4LFAI 4DUZE 4DPYA 4LF9I 3J7AM 2UXBE 2OI2A 3K17A 1WUUA 1VISA 2BR2B 4DR2E 1IBKE 3ZM7A 1Y60A 4LFCE 5JEAB 3P3GA 1HNWI 4FN5A 2C39A 4FWDA 4OX9I 1HNWE 2A2DA 2IESA 4B3RE 2NN6F 4OO1E 1R6MA 2WNRB 4IFDF 1HNXI 4DV5I 2Z5BA 2HFUA 1HK7A 1USUA 4DR5I 1IBKI 2PO0B 5IWAE 2VQEE 4WUCA 4BA1B 4LCHA 4DR1I 4MYTA 3PYDA 4DV2I 2UUAI 4JI5E 4DU8A 2X7IA 1NHJA 1Z59A 2GS8A 2BM0A 2HFSA 3T1YI 2UXDI 2Z5EA 4JI1I 3PYEA 4FW4A 5K36C 3GCMA 2HK3A 4WUDA 5DRRA 4OX9E 4FWHA 4DXLA 4DV5E 3PYFA 4LF5I 4JI7I 4LOMA 5EKWA 5GMDA 4KHPI 4JI0I 3ZKBA 2PO1A 2F1DA 5FWKA 4PRXA 4DUYI 2AJ4A 1S4EA 5LMNI 3B8HA 1XNQE 2F4VE 2A2CA 2Z5BB 3J81Q 4IS9A 4QNJA 2GQ0A 3M85D 1H74A 1NHIA 4JI8I 4AQYE 3ZKDA 4IZKB 5C0XC 1HNZE 1Z0GA 1ZXNA 3V5RA 5FLXQ 1Z0BA 1N32E 4NBQA 1EA6A
chains in the Genus database with same CATH topology
4LF6I 2E5LE 3P06A 5LMUE 4LF8I 3ZZTA 4DV4I 4IZJA 1FJGE 1Z0TA 2PNLA 1XHKA 1Y4UA 1Y6ZA 4Z7YA 4JYAE 4JI8E 1PIEA 4XTJA 4DV7E 4LF7E 4DR5E 2CG9A 2BM1A 4JYAI 4DPTA 4B3SI 4JG4A 3OTOI 5A2QQ 1HNXE 3H4LA 4DV3E 1N34I 2IOQA 3QT7A 4JI7E 4PRVA 4GKKE 1N32I 2ZITA 4USMA 1U2RA 4JV5E 3F0NA 3QT8A 2UXCE 4LF9E 2UXBI 3J80C 3B78A 1D6TA 4X62E 2Z5CA 4NXNE 4X65I 4HY1A 1MU5A 4FW9A 1J5EE 1H72C 4LF7I 2F4VI 4DV6I 3CWVA 5LMUI 1FI4A 4JI0E 3QT6A 2CZ9A 5IT9Q 2UUBE 2UUCE 4LFBI 3K85A 2O1VA 4YY3E 1HNZI 4RPFA 2Z5CB 1KKHA 2ZM6E 1S16A 3T1HE 5LL6R 4DR7E 5A2QC 5BR8I 1ZM3A 4KHPE 4R1FA 4DU7A 2HHHE 4JI2I 2HK2A 2J7KA 2BV3A 4B3TI 3QT5A 4JI4E 1IBME 4B3MI 1XMQE 1MG7A 4YY3I 3JAMC 3K1JA 4DR3I 4DR4I 4K0KI 3OTOE 1I94I 4DR2I 4HACA 1KIJA 1H73A 4NXMI 4DV1E 1Z5BA 3LPSA 1PVGA 1RREA 4DR1E 4JI3I 4ZVIA 1PKPA 1XMQI 4IZKA 1ZM2A 3M6AA 4X66I 3LNUA 4LF4E 4B3TE 2E5LI 4DPWA 1Z5CA 5GMEA 4GKKI 4YHHE 1KTVA 1J5EI 3V2UC 5BR8E 2PNMA 4DUZI 1FWLA 3HJCA 2HHHI 1USVA 4B3SE 2V2ZA 4JI6E 4DR7I 1ZM9A 5IWAI 1Z0EA 4MYUA 1I94E 2VQFI 2ZM6I 2NPFA 3JAMQ 3Q6NA 1N36E 1N33I 4JI3E 1Z5AA 1FKAE 1N36I 2O1UA 4P7AA 1N33E 2V34A 2UUCI 4URLA 4DV0E 1NHHA 2LJPA 3PYGA 2UU9I 3PRYA 1HR0E 2R42A 1HR0I 4UT4A 4K0KE 1Z0CA 4X65E 4LFAE 2VF3A 3WU6A 4USKA 1BKNA 3ZZ0A 3B82A 1KVKA 1A6FA 3GONA 1UEKA 4WUBA 4X66E 5IT9C 4HYMA 1N34E 3J81C 1Y4SA 2Q2EB 4DV7I 3HULA 1H7SA 2EFGA 4JI6I 1FNMA 3T1HI 2O1WA 4HACB 4DR4E 5LMNE 2V2VA 2V8PA 4PU9A 3WU4A 1ZXMA 4DR6I 4GKJE 4YHHI 1FWKA 2HKJA 5L3JA 1N0VC 4LF6E 3J7AG 5FLXC 3D4JA 4JI2E 3WU5A 1XMOE 4I3HA 4JI5I 1XMOI 2WW4A 4LFCI 1H7UA 2IOPA 1XNQI 4DUYE 1XNRE 2R3VA 2DEIA 4Z7CA 4DV0I 1QZRA 4LF4I 4EMDA 4N3OA 4DR6E 4GKJI 3J80Q 1IBMI 2XEXA 4HXZA 2ZBKB 4DV1I 3Q6MA 1MX0A 1RR9A 1EI1A 1XNRI 1N0UA 4KQVA 2UUAE 4DV2E 1ZM4A 3ZZUA 4JI1E 1OJ4A 3T1YE 1B63A 4NXNI 2HKEA 4X62I 4JV5I 2VQEI 1K47A 1Z0WA 4DPUA 2UXCI 1B62A 1DARA 1IBLI 4B3RI 1Z0VA 2VQFE 4DV3I 3WU3A 3LTOA 4DV6E 1ELOA 3Q1QA 2O1TA 4ED4A 4X64I 4NXME 4X64E 2V2QA 1FJGI 4DV4E 4DR3E 2UU9E 2E1RA 4LFBE 2UUBI 4UTGA 4LF5E 4FWGA 4LF8E 4IZJB 2X36A 4B3ME 2DEJA 4JI4I 1IBLE 4P52A 2CGEA 4M1KA 2UXDE 4AQYI 1NZ0A 4IZJD 4DPXA 4LFAI 4DUZE 4DPYA 4LF9I 3J7AM 2UXBE 2OI2A 3K17A 1WUUA 1VISA 4DR2E 1IBKE 3ZM7A 4LFCE 1HNWI 4FN5A 4FWDA 4OX9I 1HNWE 2A2DA 4B3RE 1HNXI 4DV5I 2Z5BA 2HFUA 1HK7A 1USUA 4DR5I 1IBKI 5IWAE 2VQEE 4WUCA 4DR1I 4MYTA 3PYDA 4DV2I 2UUAI 4JI5E 4DU8A 2X7IA 1NHJA 1Z59A 2GS8A 2BM0A 2HFSA 3T1YI 2UXDI 2Z5EA 4JI1I 3PYEA 2HK3A 4WUDA 4OX9E 4FWHA 4DXLA 4DV5E 3PYFA 4LF5I 4JI7I 5GMDA 4KHPI 4JI0I 3ZKBA 5FWKA 4PRXA 4DUYI 2AJ4A 1S4EA 5LMNI 3B8HA 1XNQE 2F4VE 2A2CA 2Z5BB 3J81Q 2GQ0A 1H74A 1NHIA 4JI8I 4AQYE 3ZKDA 4IZKB 1HNZE 1Z0GA 1ZXNA 3V5RA 5FLXQ 1Z0BA 1N32E 1EA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5C B;  2Z5E A;  2Z5B B; 
#chains in the Genus database with same CATH topology
 4LF6 I;  2E5L E;  4QNK A;  3P06 A;  5LMU E;  4LF8 I;  3U1K A;  3ZZT A;  4DV4 I;  4IZJ A;  1FJG E;  1Z0T A;  4J3D A;  2PNL A;  1XHK A;  4OO1 C;  1Y4U A;  1Y6Z A;  4Z7Y A;  4MQY A;  4JYA E;  4JI8 E;  2PNZ A;  1PIE A;  4U3D A;  4OO1 A;  4XTJ A;  4DV7 E;  4LF7 E;  4DR5 E;  2CG9 A;  2BM1 A;  4JYA I;  4DPT A;  3L7Z B;  4B3S I;  4JG4 A;  3OTO I;  5A2Q Q;  1HNX E;  2C39 B;  3H4L A;  4DV3 E;  1N34 I;  2BA1 D;  2IOQ A;  1R6L A;  1VI7 A;  3QT7 A;  4JI7 E;  4IFD E;  4LCG A;  4PRV A;  4GKK E;  1N32 I;  2ZIT A;  4USM A;  1U2R A;  4JV5 E;  3F0N A;  3QT8 A;  2UXC E;  4LF9 E;  2UXB I;  3PS3 A;  3J80 C;  3B78 A;  1D6T A;  3L7Z A;  4X62 E;  2Z5C A;  4NXN E;  4X65 I;  4HY1 A;  1MU5 A;  4FW9 A;  1J5E E;  1H72 C;  3GME A;  5JEA E;  4LF7 I;  2F4V I;  1UDS A;  4DV6 I;  3CWV A;  5LMU I;  3CDJ A;  1FI4 A;  1RHY A;  4JI0 E;  5ELW A;  3QT6 A;  2CZ9 A;  5IT9 Q;  2UUB E;  3PS2 A;  2UUC E;  4LFB I;  1UDN A;  5DNX A;  3K85 A;  2O1V A;  4YY3 E;  1HNZ I;  3DD6 A;  2WP8 A;  4RPF A;  2CVE A;  2Z5C B;  3GLL A;  1KKH A;  2ZM6 E;  1S16 A;  3T1H E;  5LL6 R;  3P76 A;  4MU3 A;  2PO1 B;  4DR7 E;  5A2Q C;  5BR8 I;  1ZM3 A;  3NZK A;  4R1F A;  4KHP E;  5K36 D;  4DU7 A;  4ISA A;  2HHH E;  4JI2 I;  4OO1 D;  2BR2 A;  5C0X F;  2HK2 A;  2J7K A;  4LPF A;  2BV3 A;  4B3T I;  3QT5 A;  4JI4 E;  1IBM E;  4B3M I;  1XMQ E;  5C0X E;  1MG7 A;  4YY3 I;  2BA0 G;  3JAM C;  3K1J A;  2BA1 G;  4DR3 I;  4DR4 I;  4K0K I;  4AIM A;  3OTO E;  3CDI A;  1I94 I;  2PO0 A;  4DR2 I;  4HAC A;  1KIJ A;  5DRP A;  1H73 A;  4GQU A;  4NXM I;  4DV1 E;  1Z5B A;  3LPS A;  5C0X B;  1OYP A;  4IFD B;  1PVG A;  4FW7 A;  1RRE A;  5K36 A;  4DR1 E;  4LCF A;  4JI3 I;  4ZVI A;  1PKP A;  2WNR A;  1XMQ I;  4IZK A;  1ZM2 A;  3M6A A;  4X66 I;  3LNU A;  5DRO A;  4LF4 E;  2GO3 A;  4B3T E;  2E5L I;  4DPW A;  2C38 B;  1Z5C A;  2PO2 A;  4MDT A;  5GME A;  4GKK I;  4YHH E;  1KTV A;  4AM3 A;  1J5E I;  2JEB A;  3V2U C;  2C37 A;  2VES A;  5BR8 E;  2PNM A;  1OYR A;  4DUZ I;  1FWL A;  3HJC A;  2HHH I;  4BA2 A;  2IER A;  1USV A;  5JEA F;  4B3S E;  2V2Z A;  4FW6 A;  5DRQ A;  4JI6 E;  4DR7 I;  1ZM9 A;  5K36 B;  5IWA I;  1Z0E A;  4MYU A;  1I94 E;  5EL9 A;  5C0X A;  2VQF I;  2ZM6 I;  3P3E A;  2NPF A;  3JAM Q;  3Q6N A;  1N36 E;  1N33 I;  4JI3 E;  1Z5A A;  1P42 A;  1FKA E;  1E3P A;  2O1U A;  4P7A A;  1N36 I;  2V34 A;  4MU0 A;  1N33 E;  2UUC I;  4URL A;  1XXE A;  4DV0 E;  4BA2 B;  2GO4 A;  1NHH A;  4FW3 A;  2LJP A;  3P3C A;  3PYG A;  2UU9 I;  3M7N G;  3PRY A;  1HR0 E;  2R42 A;  5C0X D;  1HR0 I;  4UT4 A;  4K0K E;  1Z0C A;  4X65 E;  4LFA E;  2VF3 A;  3WU6 A;  4USK A;  5K36 F;  4AID A;  1BKN A;  4U3B A;  3ZZ0 A;  3B82 A;  1KVK A;  1A6F A;  3KRN A;  3GON A;  1UEK A;  4WUB A;  5K36 E;  4X66 E;  5IT9 C;  4OZE A;  4HYM A;  1N34 E;  3J81 C;  1Y4S A;  2JEA A;  2Q2E B;  4OO1 B;  3H1C A;  4DV7 I;  3HUL A;  1H7S A;  2EFG A;  4JI6 I;  1E3H A;  1FNM A;  3T1H I;  4IFD A;  2O1W A;  2J65 A;  4HAC B;  4DR4 E;  5LMN E;  2NN6 A;  2V2V A;  2V8P A;  2JE6 A;  4IFD C;  3UHM A;  1UDO A;  4PU9 A;  3WU4 A;  1ZXM A;  4DR6 I;  4GKJ E;  4YHH I;  1FWK A;  2HKJ A;  5L3J A;  1N0V C;  4BA1 A;  4LF6 E;  3J7A G;  5JEA D;  2C37 B;  2JEA B;  5FLX C;  3D4J A;  4JI2 E;  3WU5 A;  2BA0 D;  2C38 A;  2PO2 B;  1XMO E;  4IFD D;  4I3H A;  4JI5 I;  1XMO I;  2WW4 A;  2JEB B;  4LFC I;  1H7U A;  2IOP A;  5JEA C;  1XNQ I;  4DUY E;  1XNR E;  2R3V A;  2DEI A;  4Z7C A;  4DV0 I;  1QZR A;  4LF4 I;  4EMD A;  4N3O A;  5JEA A;  4DR6 E;  4GKJ I;  3J80 Q;  2O3Z A;  1IBM I;  2XEX A;  4HXZ A;  2ZBK B;  4DV1 I;  3PS1 A;  3Q6M A;  1MX0 A;  1RR9 A;  1EI1 A;  1XNR I;  4MU4 A;  1N0U A;  2WP8 B;  4KQV A;  4OKG A;  4DV2 E;  1ZM4 A;  2UUA E;  3ZZU A;  4JI1 E;  4MU1 A;  1OJ4 A;  3T1Y E;  1YHC A;  1B63 A;  2JT2 A;  4NXN I;  2HKE A;  2JE6 B;  4FW5 A;  4X62 I;  2VQE I;  4JV5 I;  1K47 A;  1Z0W A;  4DPU A;  2UXC I;  1B62 A;  1DAR A;  1IBL I;  3B4T A;  2NN6 C;  4B3R I;  1UDQ A;  2NN6 E;  4OO1 F;  1YH8 A;  1Z0V A;  2VQF E;  5DNL A;  4DV3 I;  3M7N D;  3WU3 A;  3LTO A;  4DV6 E;  1ELO A;  1OYS A;  3Q1Q A;  2O1T A;  4ED4 A;  4X64 I;  4NXM E;  4X64 E;  2PNZ B;  3HKM A;  2AE8 A;  2V2Q A;  1FJG I;  1Y5Y A;  4DV4 E;  4DR3 E;  2UU9 E;  2E1R A;  4LFB E;  2UUB I;  4UTG A;  4LF5 E;  4FWG A;  4LF8 E;  2NN6 B;  4IZJ B;  2X36 A;  4B3M E;  2DEJ A;  4JI4 I;  1IBL E;  4P52 A;  3M85 G;  2CGE A;  4M1K A;  2UXD E;  4AQY I;  1NZ0 A;  4IZJ D;  3U1Y A;  4DPX A;  2NN6 D;  4LFA I;  4DUZ E;  4DPY A;  4LF9 I;  3J7A M;  2UXB E;  2OI2 A;  3K17 A;  1WUU A;  1VIS A;  2BR2 B;  4DR2 E;  1IBK E;  3ZM7 A;  1Y60 A;  4LFC E;  5JEA B;  3P3G A;  1HNW I;  4FN5 A;  2C39 A;  4FWD A;  4OX9 I;  1HNW E;  2A2D A;  2IES A;  4B3R E;  2NN6 F;  4OO1 E;  1R6M A;  2WNR B;  4IFD F;  1HNX I;  4DV5 I;  2Z5B A;  2HFU A;  1HK7 A;  1USU A;  4DR5 I;  1IBK I;  2PO0 B;  5IWA E;  2VQE E;  4WUC A;  4BA1 B;  4LCH A;  4DR1 I;  4MYT A;  3PYD A;  4DV2 I;  2UUA I;  4JI5 E;  4DU8 A;  2X7I A;  1NHJ A;  1Z59 A;  2GS8 A;  2BM0 A;  2HFS A;  3T1Y I;  2UXD I;  2Z5E A;  4JI1 I;  3PYE A;  4FW4 A;  5K36 C;  3GCM A;  2HK3 A;  4WUD A;  5DRR A;  4OX9 E;  4FWH A;  4DXL A;  4DV5 E;  3PYF A;  4LF5 I;  4JI7 I;  4LOM A;  5EKW A;  5GMD A;  4KHP I;  4JI0 I;  3ZKB A;  2PO1 A;  2F1D A;  5FWK A;  4PRX A;  4DUY I;  2AJ4 A;  1S4E A;  5LMN I;  3B8H A;  1XNQ E;  2F4V E;  2A2C A;  2Z5B B;  3J81 Q;  4IS9 A;  4QNJ A;  2GQ0 A;  3M85 D;  1H74 A;  1NHI A;  4JI8 I;  4AQY E;  3ZKD A;  4IZK B;  5C0X C;  1HNZ E;  1Z0G A;  1ZXN A;  3V5R A;  5FLX Q;  1Z0B A;  1N32 E;  4NBQ A;  1EA6 A; 
#chains in the Genus database with same CATH homology
 4LF6 I;  2E5L E;  3P06 A;  5LMU E;  4LF8 I;  3ZZT A;  4DV4 I;  4IZJ A;  1FJG E;  1Z0T A;  2PNL A;  1XHK A;  1Y4U A;  1Y6Z A;  4Z7Y A;  4JYA E;  4JI8 E;  1PIE A;  4XTJ A;  4DV7 E;  4LF7 E;  4DR5 E;  2CG9 A;  2BM1 A;  4JYA I;  4DPT A;  4B3S I;  4JG4 A;  3OTO I;  5A2Q Q;  1HNX E;  3H4L A;  4DV3 E;  1N34 I;  2IOQ A;  3QT7 A;  4JI7 E;  4PRV A;  4GKK E;  1N32 I;  2ZIT A;  4USM A;  1U2R A;  4JV5 E;  3F0N A;  3QT8 A;  2UXC E;  4LF9 E;  2UXB I;  3J80 C;  3B78 A;  1D6T A;  4X62 E;  2Z5C A;  4NXN E;  4X65 I;  4HY1 A;  1MU5 A;  4FW9 A;  1J5E E;  1H72 C;  4LF7 I;  2F4V I;  4DV6 I;  3CWV A;  5LMU I;  1FI4 A;  4JI0 E;  3QT6 A;  2CZ9 A;  5IT9 Q;  2UUB E;  2UUC E;  4LFB I;  3K85 A;  2O1V A;  4YY3 E;  1HNZ I;  4RPF A;  2Z5C B;  1KKH A;  2ZM6 E;  1S16 A;  3T1H E;  5LL6 R;  4DR7 E;  5A2Q C;  5BR8 I;  1ZM3 A;  4KHP E;  4R1F A;  4DU7 A;  2HHH E;  4JI2 I;  2HK2 A;  2J7K A;  2BV3 A;  4B3T I;  3QT5 A;  4JI4 E;  1IBM E;  4B3M I;  1XMQ E;  1MG7 A;  4YY3 I;  3JAM C;  3K1J A;  4DR3 I;  4DR4 I;  4K0K I;  3OTO E;  1I94 I;  4DR2 I;  4HAC A;  1KIJ A;  1H73 A;  4NXM I;  4DV1 E;  1Z5B A;  3LPS A;  1PVG A;  1RRE A;  4DR1 E;  4JI3 I;  4ZVI A;  1PKP A;  1XMQ I;  4IZK A;  1ZM2 A;  3M6A A;  4X66 I;  3LNU A;  4LF4 E;  4B3T E;  2E5L I;  4DPW A;  1Z5C A;  5GME A;  4GKK I;  4YHH E;  1KTV A;  1J5E I;  3V2U C;  5BR8 E;  2PNM A;  4DUZ I;  1FWL A;  3HJC A;  2HHH I;  1USV A;  4B3S E;  2V2Z A;  4JI6 E;  4DR7 I;  1ZM9 A;  5IWA I;  1Z0E A;  4MYU A;  1I94 E;  2VQF I;  2ZM6 I;  2NPF A;  3JAM Q;  3Q6N A;  1N36 E;  1N33 I;  4JI3 E;  1Z5A A;  1FKA E;  1N36 I;  2O1U A;  4P7A A;  1N33 E;  2V34 A;  2UUC I;  4URL A;  4DV0 E;  1NHH A;  2LJP A;  3PYG A;  2UU9 I;  3PRY A;  1HR0 E;  2R42 A;  1HR0 I;  4UT4 A;  4K0K E;  1Z0C A;  4X65 E;  4LFA E;  2VF3 A;  3WU6 A;  4USK A;  1BKN A;  3ZZ0 A;  3B82 A;  1KVK A;  1A6F A;  3GON A;  1UEK A;  4WUB A;  4X66 E;  5IT9 C;  4HYM A;  1N34 E;  3J81 C;  1Y4S A;  2Q2E B;  4DV7 I;  3HUL A;  1H7S A;  2EFG A;  4JI6 I;  1FNM A;  3T1H I;  2O1W A;  4HAC B;  4DR4 E;  5LMN E;  2V2V A;  2V8P A;  4PU9 A;  3WU4 A;  1ZXM A;  4DR6 I;  4GKJ E;  4YHH I;  1FWK A;  2HKJ A;  5L3J A;  1N0V C;  4LF6 E;  3J7A G;  5FLX C;  3D4J A;  4JI2 E;  3WU5 A;  1XMO E;  4I3H A;  4JI5 I;  1XMO I;  2WW4 A;  4LFC I;  1H7U A;  2IOP A;  1XNQ I;  4DUY E;  1XNR E;  2R3V A;  2DEI A;  4Z7C A;  4DV0 I;  1QZR A;  4LF4 I;  4EMD A;  4N3O A;  4DR6 E;  4GKJ I;  3J80 Q;  1IBM I;  2XEX A;  4HXZ A;  2ZBK B;  4DV1 I;  3Q6M A;  1MX0 A;  1RR9 A;  1EI1 A;  1XNR I;  1N0U A;  4KQV A;  2UUA E;  4DV2 E;  1ZM4 A;  3ZZU A;  4JI1 E;  1OJ4 A;  3T1Y E;  1B63 A;  4NXN I;  2HKE A;  4X62 I;  4JV5 I;  2VQE I;  1K47 A;  1Z0W A;  4DPU A;  2UXC I;  1B62 A;  1DAR A;  1IBL I;  4B3R I;  1Z0V A;  2VQF E;  4DV3 I;  3WU3 A;  3LTO A;  4DV6 E;  1ELO A;  3Q1Q A;  2O1T A;  4ED4 A;  4X64 I;  4NXM E;  4X64 E;  2V2Q A;  1FJG I;  4DV4 E;  4DR3 E;  2UU9 E;  2E1R A;  4LFB E;  2UUB I;  4UTG A;  4LF5 E;  4FWG A;  4LF8 E;  4IZJ B;  2X36 A;  4B3M E;  2DEJ A;  4JI4 I;  1IBL E;  4P52 A;  2CGE A;  4M1K A;  2UXD E;  4AQY I;  1NZ0 A;  4IZJ D;  4DPX A;  4LFA I;  4DUZ E;  4DPY A;  4LF9 I;  3J7A M;  2UXB E;  2OI2 A;  3K17 A;  1WUU A;  1VIS A;  4DR2 E;  1IBK E;  3ZM7 A;  4LFC E;  1HNW I;  4FN5 A;  4FWD A;  4OX9 I;  1HNW E;  2A2D A;  4B3R E;  1HNX I;  4DV5 I;  2Z5B A;  2HFU A;  1HK7 A;  1USU A;  4DR5 I;  1IBK I;  5IWA E;  2VQE E;  4WUC A;  4DR1 I;  4MYT A;  3PYD A;  4DV2 I;  2UUA I;  4JI5 E;  4DU8 A;  2X7I A;  1NHJ A;  1Z59 A;  2GS8 A;  2BM0 A;  2HFS A;  3T1Y I;  2UXD I;  2Z5E A;  4JI1 I;  3PYE A;  2HK3 A;  4WUD A;  4OX9 E;  4FWH A;  4DXL A;  4DV5 E;  3PYF A;  4LF5 I;  4JI7 I;  5GMD A;  4KHP I;  4JI0 I;  3ZKB A;  5FWK A;  4PRX A;  4DUY I;  2AJ4 A;  1S4E A;  5LMN I;  3B8H A;  1XNQ E;  2F4V E;  2A2C A;  2Z5B B;  3J81 Q;  2GQ0 A;  1H74 A;  1NHI A;  4JI8 I;  4AQY E;  3ZKD A;  4IZK B;  1HNZ E;  1Z0G A;  1ZXN A;  3V5R A;  5FLX Q;  1Z0B A;  1N32 E;  1EA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...