2Z5CB

Crystal structure of a novel chaperone complex for yeast 20s proteasome assembly
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
147
structure length
106
Chain Sequence
ISYEFQTHKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLYQVVTKLGDSADPKVPVVCVQIAELYRRVILPQFSLLISMSSKIWNDFGKLVFVLKCIKDMYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/hydrolase
molecule keywords Protein YPL144W
publication title Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 106
sequence length 147
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF10448 POC3_POC4 20S proteasome chaperone assembly proteins 3 and 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.90 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2z5cB00
2Z5EA 2Z5BB 2Z5CB
chains in the Genus database with same CATH superfamily
3GONA 3PS3A 1UDOA 1Z5BA 4MYTA 2C39B 1NHJA 3PYDA 2Z5BA 1WUUA 1UDNA 4X65E 1N36E 1RR9A 2PO2A 2PNZA 4JI4E 2F1DA 4WUCA 3B78A 1FJGI 4OZEA 4DR4E 1Z0WA 1XNRE 2C38A 4B3SI 1Z59A 5LL6R 1IBME 2GS8A 3LNUA 3F0NA 2CVEA 5JEAB 2UUCI 1S16A 3K1JA 4DR7E 4DPUA 4LFBE 2BV3A 1B63A 1HNZE 5GMEA 4JI8E 3B8HA 4DV3E 5K36D 2A2DA 2NN6C 1XNRI 4DR4I 4MQYA 4LF9I 4FW6A 1IBMI 2C37A 5FLXC 1XXEA 5BR8E 4LFBI 4DPWA 1NZ0A 2GO3A 2CZ9A 2VQFE 4MU1A 4JI8I 3V2UC 4DV3I 4OKGA 2JT2A 1Z5CA 4JYAE 2PO1A 1XMOI 5FWKA 5BR8I 1B62A 5C0XA 3JAMC 4IZKB 2VQFI 4RPFA 2V34A 3L7ZA 4FWGA 4YHHE 3QT5A 4MDTA 1K47A 4OX9I 4DV1E 4JYAI 4DV5I 2GO4A 5C0XC 2E1RA 5JEAF 1Y4SA 2UUBE 2UU9E 2O1WA 2VQEE 4PU9A 4YHHI 1USUA 1OYPA 2AE8A 4LF8E 1EA6A 2E5LE 2PNLA 2EFGA 3J80C 4N3OA 1R6LA 2Z5CB 4AQYE 2HFSA 1MX0A 2UXBE 5EKWA 2UUBI 2UU9I 2X7IA 4GQUA 4M1KA 1HR0E 4JI7E 2NN6F 4USKA 2PO0A 4IFDE 4LF8I 4NXME 5LMNI 4IS9A 4DPTA 4JI0E 4AQYI 2UXBI 3H1CA 3K17A 2DEJA 1HR0I 1XMQI 1FKAE 3NZKA 2X36A 4DPYA 4MU3A 1Z0CA 3K85A 5C0XD 3QT6A 4JI0I 4FWDA 4LFAE 3M7ND 2OI2A 4FW9A 1H7SA 4KQVA 4BA2B 2BR2B 5GMDA 3CWVA 3P3EA 2JE6B 5C0XF 2HK2A 5JEAA 5IT9Q 4LFAI 4BA1B 1KVKA 1KIJA 2NPFA 4HACB 2WNRB 4U3DA 2BA0G 4ZVIA 5JEAC 2HKEA 5ELWA 2ZM6E 3T1HI 3B4TA 3M85G 4LCHA 2GQ0A 4FN5A 3J81Q 4MU0A 4HY1A 2NN6A 4AIMA 5DROA 4X65I 4DR6E 1N36I 4LOMA 4IFDC 4JI4I 4JI6E 2ZM6I 4J3DA 4R1FA 1KKHA 1Y60A 3CDJA 4IZKA 2IERA 4LCFA 2J65A 4AIDA 2Q2EB 4MU4A 4DR6I 2ZITA 4IFDB 4DXLA 1RREA 4JI5E 3QT8A 4JI6I 2BA0D 2V2QA 4DR7I 4YY3E 3P3CA 4Z7CA 3M85D 1H72C 1HK7A 1R6MA 4AM3A 1S4EA 1HNZI 4OO1E 4LCGA 4LF4E 3KRNA 3QT7A 1EI1A 3ZKBA 2ZBKB 4K0KE 3ZM7A 5JEAD 4IZJA 4QNKA 4YY3I 1Y5YA 2BA1G 2Z5CA 4LF5E 1FWLA 1ZM4A 4KHPE 2O1TA 5LMUE 4WUDA 4X64E 4LF4I 4LF6E 1Z5AA 4K0KI 4JI3E 3J7AM 2IESA 5EL9A 4JI1E 2WP8A 2UUAE 4NBQA 4LF5I 1FWKA 2NN6D 1ELOA 1ZM2A 1UDSA 5IWAE 4DR2E 4ED4A 1BKNA 3GLLA 1UDQA 4X64I 4I3HA 4DV1I 2VF3A 4QNJA 4LF6I 4IFDF 4URLA 4JI3I 5K36E 3Q1QA 4HYMA 4JI1I 2UUAI 2VQEI 1NHHA 1HNXE 4LF7E 2JEBB 4B3RE 1PKPA 4DR2I 4FW4A 3ZZ0A 4DV7E 4P52A 3DD6A 4BA2A 2E5LI 2BR2A 3OTOE 2V2ZA 3PYFA 4OO1C 5A2QQ 1HNXI 4LF7I 1IBKE 1DARA 2C39A 4B3RI 1QZRA 1VI7A 4JI7I 4FWHA 4BA1A 4DV7I 1H73A 2BM1A 4IZJD 4NXMI 1H7UA 4DV4E 1ZXNA 4HACA 4DV2E 2PNMA 2V8PA 1N0VC 1I94E 4OO1B 4PRVA 1MU5A 1VISA 4FW5A 5DNXA 4GKKE 3HKMA 1YHCA 3ZZTA 4B3TE 2HK3A 4DUYE 4UT4A 3P76A 4DR3E 1A6FA 2NN6E 2R3VA 4JI2E 3LTOA 4DV2I 4X66E 1I94I 3M6AA 4HXZA 3J7AG 1PVGA 4DU7A 5DRQA 4DUYI 4JG4A 3WU3A 1P42A 4DR3I 2V2VA 2JEAB 2VESA 1FNMA 2CG9A 4P7AA 3WU6A 5A2QC 4IFDA 4JI2I 2HFUA 4ISAA 4X66I 2IOPA 3WU4A 3P3GA 2DEIA 3P06A 2O3ZA 3V5RA 1FJGE 1D6TA 3ZZUA 5L3JA 4B3SE 5FLXQ 4B3ME 5K36B 3PS1A 4DR1E 4OO1F 1OYSA 1H74A 2UUCE 3PYEA 5C0XE 4Z7YA 3GCMA 4EMDA 5IT9C 4GKJE 3T1YE 1Z0TA 4DV6E 1U2RA 4LF9E 5DNLA 1Z0GA 4B3MI 4FW3A 4DR1I 3JAMQ 4DUZE 4USMA 2AJ4A 3LPSA 2F4VE 2R42A 1Y4UA 2Z5BB 1KTVA 3J81C 4GKJI 1J5EE 3T1YI 4JI5I 4DV6I 2PO2B 2PNZB 4DUZI 4DPXA 4X62E 1XMOE 3CDIA 2F4VI 4WUBA 2HKJA 2JEBA 4IFDD 2BM0A 4U3BA 2C38B 3U1YA 3D4JA 1PIEA 2Z5EA 3J80Q 2NN6B 1J5EI 1Z0VA 1YH8A 3H4LA 4OX9E 1NHIA 5K36F 1HNWE 4DV5E 4DV0E 4X62I 4KHPI 1ZXMA 5LMUI 3PYGA 1OJ4A 1ZM3A 1N32E 3Q6MA 1UEKA 3Q6NA 1USVA 3HJCA 4DR5E 2XEXA 1HNWI 3HULA 1FI4A 1Y6ZA 2C37B 2BA1D 4OO1A 2O1VA 4JV5E 5DRRA 4DV0I 1E3PA 2LJPA 5IWAI 2UXCE 3ZKDA 1N32I 2JE6A 4DR5I 1Z0EA 2J7KA 2PO1B 5LMNE 4JV5I 1MG7A 2A2CA 4IZJB 5JEAE 5C0XB 1ZM9A 2O1UA 2UXCI 3L7ZB 3M7NG 1N0UA 1N33E 4DU8A 3U1KA 1Z0BA 3B82A 1XMQE 2JEAA 2WNRA 3OTOI 1OYRA 3GMEA 1IBLE 1XNQE 1RHYA 2WP8B 1IBKI 4MYUA 1XHKA 2WW4A 4PRXA 1N33I 4NXNE 4LFCE 3PS2A 4FW7A 4DV4I 2HHHE 5K36A 1N34E 2UXDE 3UHMA 4XTJA 1IBLI 1XNQI 4GKKI 4LPFA 1E3HA 3PRYA 4B3TI 2PO0B 4NXNI 4LFCI 5K36C 2IOQA 4OO1D 2HHHI 5DRPA 4UTGA 1N34I 2UXDI 2CGEA 3T1HE 3WU5A
chains in the Genus database with same CATH topology
3GONA 1Z5BA 4MYTA 1NHJA 3PYDA 2Z5BA 1WUUA 4X65E 1N36E 1RR9A 4JI4E 4WUCA 3B78A 1FJGI 4DR4E 1Z0WA 1XNRE 4B3SI 1Z59A 5LL6R 1IBME 2GS8A 3LNUA 3F0NA 2UUCI 1S16A 3K1JA 4DR7E 4DPUA 4LFBE 2BV3A 1B63A 1HNZE 5GMEA 4JI8E 3B8HA 4DV3E 2A2DA 4DR4I 1XNRI 4LF9I 1IBMI 5FLXC 5BR8E 4LFBI 4DPWA 1NZ0A 2CZ9A 2VQFE 4JI8I 3V2UC 4DV3I 1Z5CA 4JYAE 1XMOI 5FWKA 5BR8I 1B62A 3JAMC 4IZKB 2VQFI 4RPFA 2V34A 4FWGA 4YHHE 3QT5A 1K47A 4OX9I 4DV1E 4JYAI 4DV5I 2E1RA 1Y4SA 2UUBE 2UU9E 2O1WA 2VQEE 4PU9A 4YHHI 1USUA 4LF8E 1EA6A 2E5LE 2PNLA 2EFGA 3J80C 4N3OA 2Z5CB 4AQYE 2HFSA 1MX0A 2UXBE 2UUBI 2UU9I 2X7IA 4M1KA 1HR0E 4JI7E 4USKA 4LF8I 4NXME 5LMNI 4DPTA 4JI0E 4AQYI 2UXBI 3K17A 2DEJA 1HR0I 1XMQI 1FKAE 2X36A 4DPYA 1Z0CA 3K85A 3QT6A 4JI0I 4FWDA 4LFAE 2OI2A 4FW9A 1H7SA 4KQVA 5GMDA 3CWVA 2HK2A 5IT9Q 4LFAI 1KVKA 1KIJA 2NPFA 4HACB 4ZVIA 2HKEA 2ZM6E 3T1HI 2GQ0A 4FN5A 3J81Q 4HY1A 4X65I 4DR6E 1N36I 4JI4I 4JI6E 2ZM6I 4R1FA 1KKHA 4IZKA 2Q2EB 4DR6I 2ZITA 4DXLA 1RREA 4JI5E 3QT8A 4JI6I 2V2QA 4DR7I 4YY3E 4Z7CA 1H72C 1HK7A 1S4EA 1HNZI 4LF4E 3QT7A 1EI1A 3ZKBA 2ZBKB 4K0KE 3ZM7A 4IZJA 4YY3I 4LF5E 2Z5CA 1FWLA 1ZM4A 4KHPE 2O1TA 5LMUE 4WUDA 4X64E 4LF4I 4LF6E 1Z5AA 4K0KI 4JI3E 3J7AM 4JI1E 2UUAE 4LF5I 1FWKA 1ELOA 1ZM2A 5IWAE 4DR2E 4ED4A 1BKNA 4X64I 4I3HA 4DV1I 2VF3A 4LF6I 4URLA 4JI3I 3Q1QA 4HYMA 4JI1I 2UUAI 2VQEI 1NHHA 1HNXE 4LF7E 4B3RE 1PKPA 4DR2I 3ZZ0A 4DV7E 4P52A 2E5LI 3OTOE 2V2ZA 3PYFA 5A2QQ 1HNXI 4LF7I 1IBKE 1DARA 4B3RI 1QZRA 4JI7I 4FWHA 4DV7I 1H73A 2BM1A 4IZJD 4NXMI 1H7UA 4DV4E 1ZXNA 4HACA 4DV2E 2PNMA 2V8PA 1N0VC 1I94E 4PRVA 1MU5A 1VISA 4GKKE 3ZZTA 4B3TE 2HK3A 4DUYE 4UT4A 4DR3E 1A6FA 2R3VA 4JI2E 3LTOA 4DV2I 4X66E 1I94I 3M6AA 4HXZA 3J7AG 1PVGA 4DU7A 4DUYI 4JG4A 3WU3A 4DR3I 2V2VA 3WU6A 1FNMA 2CG9A 4P7AA 5A2QC 4JI2I 2HFUA 4X66I 2IOPA 3WU4A 2DEIA 3P06A 3V5RA 1FJGE 1D6TA 3ZZUA 5L3JA 4B3SE 5FLXQ 4B3ME 4DR1E 1H74A 2UUCE 3PYEA 4Z7YA 4EMDA 5IT9C 4GKJE 3T1YE 1Z0TA 4DV6E 1U2RA 4LF9E 4B3MI 1Z0GA 4DR1I 3JAMQ 4DUZE 4USMA 2AJ4A 3LPSA 2F4VE 2R42A 1Y4UA 2Z5BB 1KTVA 3J81C 4GKJI 1J5EE 3T1YI 4JI5I 4DV6I 4DUZI 4DPXA 4X62E 1XMOE 2F4VI 4WUBA 2HKJA 2BM0A 3D4JA 1PIEA 2Z5EA 3J80Q 1J5EI 1Z0VA 4OX9E 3H4LA 1NHIA 1HNWE 4DV5E 4DV0E 4X62I 4KHPI 1ZXMA 5LMUI 3PYGA 1OJ4A 1ZM3A 1N32E 3Q6MA 1UEKA 3Q6NA 1USVA 3HJCA 4DR5E 2XEXA 1HNWI 3HULA 1FI4A 1Y6ZA 2O1VA 4JV5E 4DV0I 2LJPA 5IWAI 2UXCE 3ZKDA 1N32I 4DR5I 1Z0EA 2J7KA 5LMNE 4JV5I 1MG7A 2A2CA 4IZJB 1ZM9A 2O1UA 2UXCI 1N0UA 1N33E 4DU8A 1Z0BA 3B82A 1XMQE 3OTOI 1IBLE 1XNQE 1IBKI 4MYUA 1XHKA 2WW4A 4PRXA 1N33I 4NXNE 4LFCE 4DV4I 2HHHE 1N34E 2UXDE 1IBLI 4XTJA 1XNQI 4GKKI 4B3TI 3PRYA 4NXNI 4LFCI 2IOQA 2HHHI 4UTGA 1N34I 2UXDI 2CGEA 3T1HE 3WU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5E A;  2Z5B B;  2Z5C B; 
#chains in the Genus database with same CATH topology
 3GON A;  3PS3 A;  1UDO A;  1Z5B A;  4MYT A;  2C39 B;  1NHJ A;  3PYD A;  2Z5B A;  1WUU A;  1UDN A;  4X65 E;  1N36 E;  1RR9 A;  2PO2 A;  2PNZ A;  4JI4 E;  2F1D A;  4WUC A;  3B78 A;  1FJG I;  4OZE A;  4DR4 E;  1Z0W A;  1XNR E;  2C38 A;  4B3S I;  1Z59 A;  5LL6 R;  1IBM E;  2GS8 A;  3LNU A;  3F0N A;  2CVE A;  5JEA B;  2UUC I;  1S16 A;  3K1J A;  4DR7 E;  4DPU A;  4LFB E;  2BV3 A;  1B63 A;  1HNZ E;  5GME A;  4JI8 E;  3B8H A;  4DV3 E;  5K36 D;  2A2D A;  2NN6 C;  1XNR I;  4DR4 I;  4MQY A;  4LF9 I;  4FW6 A;  1IBM I;  2C37 A;  5FLX C;  1XXE A;  5BR8 E;  4LFB I;  4DPW A;  1NZ0 A;  2GO3 A;  2CZ9 A;  2VQF E;  4MU1 A;  4JI8 I;  3V2U C;  4DV3 I;  4OKG A;  2JT2 A;  1Z5C A;  4JYA E;  2PO1 A;  1XMO I;  5FWK A;  5BR8 I;  1B62 A;  5C0X A;  3JAM C;  4IZK B;  2VQF I;  4RPF A;  2V34 A;  3L7Z A;  4FWG A;  4YHH E;  3QT5 A;  4MDT A;  1K47 A;  4OX9 I;  4DV1 E;  4JYA I;  4DV5 I;  2GO4 A;  5C0X C;  2E1R A;  5JEA F;  1Y4S A;  2UUB E;  2UU9 E;  2O1W A;  2VQE E;  4PU9 A;  4YHH I;  1USU A;  1OYP A;  2AE8 A;  4LF8 E;  1EA6 A;  2E5L E;  2PNL A;  2EFG A;  3J80 C;  4N3O A;  1R6L A;  2Z5C B;  4AQY E;  2HFS A;  1MX0 A;  2UXB E;  5EKW A;  2UUB I;  2UU9 I;  2X7I A;  4GQU A;  4M1K A;  1HR0 E;  4JI7 E;  2NN6 F;  4USK A;  2PO0 A;  4IFD E;  4LF8 I;  4NXM E;  5LMN I;  4IS9 A;  4DPT A;  4JI0 E;  4AQY I;  2UXB I;  3H1C A;  3K17 A;  2DEJ A;  1HR0 I;  1XMQ I;  1FKA E;  3NZK A;  2X36 A;  4DPY A;  4MU3 A;  1Z0C A;  3K85 A;  5C0X D;  3QT6 A;  4JI0 I;  4FWD A;  4LFA E;  3M7N D;  2OI2 A;  4FW9 A;  1H7S A;  4KQV A;  4BA2 B;  2BR2 B;  5GMD A;  3CWV A;  3P3E A;  2JE6 B;  5C0X F;  2HK2 A;  5JEA A;  5IT9 Q;  4LFA I;  4BA1 B;  1KVK A;  1KIJ A;  2NPF A;  4HAC B;  2WNR B;  4U3D A;  2BA0 G;  4ZVI A;  5JEA C;  2HKE A;  5ELW A;  2ZM6 E;  3T1H I;  3B4T A;  3M85 G;  4LCH A;  2GQ0 A;  4FN5 A;  3J81 Q;  4MU0 A;  4HY1 A;  2NN6 A;  4AIM A;  5DRO A;  4X65 I;  4DR6 E;  1N36 I;  4LOM A;  4IFD C;  4JI4 I;  4JI6 E;  2ZM6 I;  4J3D A;  4R1F A;  1KKH A;  1Y60 A;  3CDJ A;  4IZK A;  2IER A;  4LCF A;  2J65 A;  4AID A;  2Q2E B;  4MU4 A;  4DR6 I;  2ZIT A;  4IFD B;  4DXL A;  1RRE A;  4JI5 E;  3QT8 A;  4JI6 I;  2BA0 D;  2V2Q A;  4DR7 I;  4YY3 E;  3P3C A;  4Z7C A;  3M85 D;  1H72 C;  1HK7 A;  1R6M A;  4AM3 A;  1S4E A;  1HNZ I;  4OO1 E;  4LCG A;  4LF4 E;  3KRN A;  3QT7 A;  1EI1 A;  3ZKB A;  2ZBK B;  4K0K E;  3ZM7 A;  5JEA D;  4IZJ A;  4QNK A;  4YY3 I;  1Y5Y A;  2BA1 G;  2Z5C A;  4LF5 E;  1FWL A;  1ZM4 A;  4KHP E;  2O1T A;  5LMU E;  4WUD A;  4X64 E;  4LF4 I;  4LF6 E;  1Z5A A;  4K0K I;  4JI3 E;  3J7A M;  2IES A;  5EL9 A;  4JI1 E;  2WP8 A;  2UUA E;  4NBQ A;  4LF5 I;  1FWK A;  2NN6 D;  1ELO A;  1ZM2 A;  1UDS A;  5IWA E;  4DR2 E;  4ED4 A;  1BKN A;  3GLL A;  1UDQ A;  4X64 I;  4I3H A;  4DV1 I;  2VF3 A;  4QNJ A;  4LF6 I;  4IFD F;  4URL A;  4JI3 I;  5K36 E;  3Q1Q A;  4HYM A;  4JI1 I;  2UUA I;  2VQE I;  1NHH A;  1HNX E;  4LF7 E;  2JEB B;  4B3R E;  1PKP A;  4DR2 I;  4FW4 A;  3ZZ0 A;  4DV7 E;  4P52 A;  3DD6 A;  4BA2 A;  2E5L I;  2BR2 A;  3OTO E;  2V2Z A;  3PYF A;  4OO1 C;  5A2Q Q;  1HNX I;  4LF7 I;  1IBK E;  1DAR A;  2C39 A;  4B3R I;  1QZR A;  1VI7 A;  4JI7 I;  4FWH A;  4BA1 A;  4DV7 I;  1H73 A;  2BM1 A;  4IZJ D;  4NXM I;  1H7U A;  4DV4 E;  1ZXN A;  4HAC A;  4DV2 E;  2PNM A;  2V8P A;  1N0V C;  1I94 E;  4OO1 B;  4PRV A;  1MU5 A;  1VIS A;  4FW5 A;  5DNX A;  4GKK E;  3HKM A;  1YHC A;  3ZZT A;  4B3T E;  2HK3 A;  4DUY E;  4UT4 A;  3P76 A;  4DR3 E;  1A6F A;  2NN6 E;  2R3V A;  4JI2 E;  3LTO A;  4DV2 I;  4X66 E;  1I94 I;  3M6A A;  4HXZ A;  3J7A G;  1PVG A;  4DU7 A;  5DRQ A;  4DUY I;  4JG4 A;  3WU3 A;  1P42 A;  4DR3 I;  2V2V A;  2JEA B;  2VES A;  1FNM A;  2CG9 A;  4P7A A;  3WU6 A;  5A2Q C;  4IFD A;  4JI2 I;  2HFU A;  4ISA A;  4X66 I;  2IOP A;  3WU4 A;  3P3G A;  2DEI A;  3P06 A;  2O3Z A;  3V5R A;  1FJG E;  1D6T A;  3ZZU A;  5L3J A;  4B3S E;  5FLX Q;  4B3M E;  5K36 B;  3PS1 A;  4DR1 E;  4OO1 F;  1OYS A;  1H74 A;  2UUC E;  3PYE A;  5C0X E;  4Z7Y A;  3GCM A;  4EMD A;  5IT9 C;  4GKJ E;  3T1Y E;  1Z0T A;  4DV6 E;  1U2R A;  4LF9 E;  5DNL A;  1Z0G A;  4B3M I;  4FW3 A;  4DR1 I;  3JAM Q;  4DUZ E;  4USM A;  2AJ4 A;  3LPS A;  2F4V E;  2R42 A;  1Y4U A;  2Z5B B;  1KTV A;  3J81 C;  4GKJ I;  1J5E E;  3T1Y I;  4JI5 I;  4DV6 I;  2PO2 B;  2PNZ B;  4DUZ I;  4DPX A;  4X62 E;  1XMO E;  3CDI A;  2F4V I;  4WUB A;  2HKJ A;  2JEB A;  4IFD D;  2BM0 A;  4U3B A;  2C38 B;  3U1Y A;  3D4J A;  1PIE A;  2Z5E A;  3J80 Q;  2NN6 B;  1J5E I;  1Z0V A;  1YH8 A;  3H4L A;  4OX9 E;  1NHI A;  5K36 F;  1HNW E;  4DV5 E;  4DV0 E;  4X62 I;  4KHP I;  1ZXM A;  5LMU I;  3PYG A;  1OJ4 A;  1ZM3 A;  1N32 E;  3Q6M A;  1UEK A;  3Q6N A;  1USV A;  3HJC A;  4DR5 E;  2XEX A;  1HNW I;  3HUL A;  1FI4 A;  1Y6Z A;  2C37 B;  2BA1 D;  4OO1 A;  2O1V A;  4JV5 E;  5DRR A;  4DV0 I;  1E3P A;  2LJP A;  5IWA I;  2UXC E;  3ZKD A;  1N32 I;  2JE6 A;  4DR5 I;  1Z0E A;  2J7K A;  2PO1 B;  5LMN E;  4JV5 I;  1MG7 A;  2A2C A;  4IZJ B;  5JEA E;  5C0X B;  1ZM9 A;  2O1U A;  2UXC I;  3L7Z B;  3M7N G;  1N0U A;  1N33 E;  4DU8 A;  3U1K A;  1Z0B A;  3B82 A;  1XMQ E;  2JEA A;  2WNR A;  3OTO I;  1OYR A;  3GME A;  1IBL E;  1XNQ E;  1RHY A;  2WP8 B;  1IBK I;  4MYU A;  1XHK A;  2WW4 A;  4PRX A;  1N33 I;  4NXN E;  4LFC E;  3PS2 A;  4FW7 A;  4DV4 I;  2HHH E;  5K36 A;  1N34 E;  2UXD E;  3UHM A;  4XTJ A;  1IBL I;  1XNQ I;  4GKK I;  4LPF A;  1E3H A;  3PRY A;  4B3T I;  2PO0 B;  4NXN I;  4LFC I;  5K36 C;  2IOQ A;  4OO1 D;  2HHH I;  5DRP A;  4UTG A;  1N34 I;  2UXD I;  2CGE A;  3T1H E;  3WU5 A; 
#chains in the Genus database with same CATH homology
 3GON A;  1Z5B A;  4MYT A;  1NHJ A;  3PYD A;  2Z5B A;  1WUU A;  4X65 E;  1N36 E;  1RR9 A;  4JI4 E;  4WUC A;  3B78 A;  1FJG I;  4DR4 E;  1Z0W A;  1XNR E;  4B3S I;  1Z59 A;  5LL6 R;  1IBM E;  2GS8 A;  3LNU A;  3F0N A;  2UUC I;  1S16 A;  3K1J A;  4DR7 E;  4DPU A;  4LFB E;  2BV3 A;  1B63 A;  1HNZ E;  5GME A;  4JI8 E;  3B8H A;  4DV3 E;  2A2D A;  4DR4 I;  1XNR I;  4LF9 I;  1IBM I;  5FLX C;  5BR8 E;  4LFB I;  4DPW A;  1NZ0 A;  2CZ9 A;  2VQF E;  4JI8 I;  3V2U C;  4DV3 I;  1Z5C A;  4JYA E;  1XMO I;  5FWK A;  5BR8 I;  1B62 A;  3JAM C;  4IZK B;  2VQF I;  4RPF A;  2V34 A;  4FWG A;  4YHH E;  3QT5 A;  1K47 A;  4OX9 I;  4DV1 E;  4JYA I;  4DV5 I;  2E1R A;  1Y4S A;  2UUB E;  2UU9 E;  2O1W A;  2VQE E;  4PU9 A;  4YHH I;  1USU A;  4LF8 E;  1EA6 A;  2E5L E;  2PNL A;  2EFG A;  3J80 C;  4N3O A;  2Z5C B;  4AQY E;  2HFS A;  1MX0 A;  2UXB E;  2UUB I;  2UU9 I;  2X7I A;  4M1K A;  1HR0 E;  4JI7 E;  4USK A;  4LF8 I;  4NXM E;  5LMN I;  4DPT A;  4JI0 E;  4AQY I;  2UXB I;  3K17 A;  2DEJ A;  1HR0 I;  1XMQ I;  1FKA E;  2X36 A;  4DPY A;  1Z0C A;  3K85 A;  3QT6 A;  4JI0 I;  4FWD A;  4LFA E;  2OI2 A;  4FW9 A;  1H7S A;  4KQV A;  5GMD A;  3CWV A;  2HK2 A;  5IT9 Q;  4LFA I;  1KVK A;  1KIJ A;  2NPF A;  4HAC B;  4ZVI A;  2HKE A;  2ZM6 E;  3T1H I;  2GQ0 A;  4FN5 A;  3J81 Q;  4HY1 A;  4X65 I;  4DR6 E;  1N36 I;  4JI4 I;  4JI6 E;  2ZM6 I;  4R1F A;  1KKH A;  4IZK A;  2Q2E B;  4DR6 I;  2ZIT A;  4DXL A;  1RRE A;  4JI5 E;  3QT8 A;  4JI6 I;  2V2Q A;  4DR7 I;  4YY3 E;  4Z7C A;  1H72 C;  1HK7 A;  1S4E A;  1HNZ I;  4LF4 E;  3QT7 A;  1EI1 A;  3ZKB A;  2ZBK B;  4K0K E;  3ZM7 A;  4IZJ A;  4YY3 I;  4LF5 E;  2Z5C A;  1FWL A;  1ZM4 A;  4KHP E;  2O1T A;  5LMU E;  4WUD A;  4X64 E;  4LF4 I;  4LF6 E;  1Z5A A;  4K0K I;  4JI3 E;  3J7A M;  4JI1 E;  2UUA E;  4LF5 I;  1FWK A;  1ELO A;  1ZM2 A;  5IWA E;  4DR2 E;  4ED4 A;  1BKN A;  4X64 I;  4I3H A;  4DV1 I;  2VF3 A;  4LF6 I;  4URL A;  4JI3 I;  3Q1Q A;  4HYM A;  4JI1 I;  2UUA I;  2VQE I;  1NHH A;  1HNX E;  4LF7 E;  4B3R E;  1PKP A;  4DR2 I;  3ZZ0 A;  4DV7 E;  4P52 A;  2E5L I;  3OTO E;  2V2Z A;  3PYF A;  5A2Q Q;  1HNX I;  4LF7 I;  1IBK E;  1DAR A;  4B3R I;  1QZR A;  4JI7 I;  4FWH A;  4DV7 I;  1H73 A;  2BM1 A;  4IZJ D;  4NXM I;  1H7U A;  4DV4 E;  1ZXN A;  4HAC A;  4DV2 E;  2PNM A;  2V8P A;  1N0V C;  1I94 E;  4PRV A;  1MU5 A;  1VIS A;  4GKK E;  3ZZT A;  4B3T E;  2HK3 A;  4DUY E;  4UT4 A;  4DR3 E;  1A6F A;  2R3V A;  4JI2 E;  3LTO A;  4DV2 I;  4X66 E;  1I94 I;  3M6A A;  4HXZ A;  3J7A G;  1PVG A;  4DU7 A;  4DUY I;  4JG4 A;  3WU3 A;  4DR3 I;  2V2V A;  3WU6 A;  1FNM A;  2CG9 A;  4P7A A;  5A2Q C;  4JI2 I;  2HFU A;  4X66 I;  2IOP A;  3WU4 A;  2DEI A;  3P06 A;  3V5R A;  1FJG E;  1D6T A;  3ZZU A;  5L3J A;  4B3S E;  5FLX Q;  4B3M E;  4DR1 E;  1H74 A;  2UUC E;  3PYE A;  4Z7Y A;  4EMD A;  5IT9 C;  4GKJ E;  3T1Y E;  1Z0T A;  4DV6 E;  1U2R A;  4LF9 E;  4B3M I;  1Z0G A;  4DR1 I;  3JAM Q;  4DUZ E;  4USM A;  2AJ4 A;  3LPS A;  2F4V E;  2R42 A;  1Y4U A;  2Z5B B;  1KTV A;  3J81 C;  4GKJ I;  1J5E E;  3T1Y I;  4JI5 I;  4DV6 I;  4DUZ I;  4DPX A;  4X62 E;  1XMO E;  2F4V I;  4WUB A;  2HKJ A;  2BM0 A;  3D4J A;  1PIE A;  2Z5E A;  3J80 Q;  1J5E I;  1Z0V A;  4OX9 E;  3H4L A;  1NHI A;  1HNW E;  4DV5 E;  4DV0 E;  4X62 I;  4KHP I;  1ZXM A;  5LMU I;  3PYG A;  1OJ4 A;  1ZM3 A;  1N32 E;  3Q6M A;  1UEK A;  3Q6N A;  1USV A;  3HJC A;  4DR5 E;  2XEX A;  1HNW I;  3HUL A;  1FI4 A;  1Y6Z A;  2O1V A;  4JV5 E;  4DV0 I;  2LJP A;  5IWA I;  2UXC E;  3ZKD A;  1N32 I;  4DR5 I;  1Z0E A;  2J7K A;  5LMN E;  4JV5 I;  1MG7 A;  2A2C A;  4IZJ B;  1ZM9 A;  2O1U A;  2UXC I;  1N0U A;  1N33 E;  4DU8 A;  1Z0B A;  3B82 A;  1XMQ E;  3OTO I;  1IBL E;  1XNQ E;  1IBK I;  4MYU A;  1XHK A;  2WW4 A;  4PRX A;  1N33 I;  4NXN E;  4LFC E;  4DV4 I;  2HHH E;  1N34 E;  2UXD E;  1IBL I;  4XTJ A;  1XNQ I;  4GKK I;  4B3T I;  3PRY A;  4NXN I;  4LFC I;  2IOQ A;  2HHH I;  4UTG A;  1N34 I;  2UXD I;  2CGE A;  3T1H E;  3WU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...