1Y6ZA

Middle domain of plasmodium falciparum putative heat shock protein pf14_0417
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
242
Chain Sequence
PIWKQDEKSLTENDYYSFYKNTFKAYDDPLAYVHFNVEGQISFNSILYIPGSLPWELSKNMFRGIRLYVKRVFINDKFSESIPRWLTFLRGIVDSENSKMLSIINKRIVLKSISMMKGLKETGGDKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEFYSINSGDKKTDLDSYIENMKEDQKCIYYISGENKKTAQNSPSLEKLKALNYDVLFSLEPIDEFCLSSLTVNKYKGYEVLDVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heat shock protein, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
total genus 78
structure length 242
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y6zA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y6zA02
1USVA 2O1VA 3Q6MA 2IOPA 3Q6NA 3PRYA 2CGEA 2CG9A 1Y6ZA 2O1WA 1USUA 1HK7A 3HJCA 2IOQA 1Y4UA 1Y4SA 5FWKA 2O1UA 2GQ0A 2O1TA
chains in the Genus database with same CATH superfamily
1O08A 1O77A 3JR7A 1II9A 2CK3A 2J9FB 5HJ5A 3AR6A 3TLCA 2FRDC 3EWAA 3TSOA 1CUJA 3OQBA 3PGJA 4MVJM 2GYWA 4DR4I 1GV1A 2AD1A 2WUEA 2H8KA 4O33A 4LK2A 2GAFA 3UMSA 2Z2KA 3U4HA 1EU1A 2GVNA 4FGZA 1JKJB 1NVDA 3CF2A 4KMMA 1R0BA 3H87A 3RBVA 3W1VA 2ZVJA 3JRNA 2HCTA 5K3BA 2K7FA 1EWVA 3BJRA 3L7ZA 2O3JA 4ZODA 1TEHA 2EIHA 4H0NA 2WFZA 5EYPB 4J4BA 2N1MA 3HEBA 5J4LA 4AKTA 3FUUA 3TLKA 1JPJA 4BBZA 2QF7A 4PIMA 3BRWA 2QTTA 5T8KC 3WK9A 2YY6A 1YFJA 2EKZA 4XDGA 3U19A 5IT9C 1QF9A 3H97A 5DI3B 1OXVA 2DUUA 1QIKA 1IQPA 3OCCA 2GZHA 4AY3A 3PL5A 1C7QA 2FMIA 1DBVO 4M9ZA 4MMZB 5F9MA 3AONB 1WUIS 3UXHA 4B3TE 5LZ5A 3EXG1 2I6XA 4MR7A 1XQVA 2CVHA 4UXIA 1CJVC 4IOMA 3RBAA 1AKUA 2DG2A 4PN3A 5BN3A 1Z34A 4CLRA 1CR0A 5C51B 4BX9A 2OOKA 1K8XB 2VYVD 3FLBA 2MDTA 4IIGA 1N3IA 4B40A 3RSLA 3MMSA 3ZJ4A 5ETJA 1RKUA 4HOYA 4RPFA 1YBVA 4BRUA 2ZJ3A 1YNOA 4FM9A 2GCOB 3D9QX 3K9BA 4LDPA 2JEAA 1ZIXA 4CDRA 4C0HA 5MGNA 4I0WB 4WLEA 1WCYA 2JK1A 4X7MA 1QPZA 3H1PA 2A33A 4P7AA 2H1LA 4OKSA 5DISB 3S44A 1KO4A 2QYSA 2VG8A 2OBFA 3RV3A 1HG0A 1FTNA 1WD7A 1GFZA 1RJEA 4KXUA 3LGAA 4BN4A 1H2RS 4PPFA 3N0TA 5BSGA 3ZE9A 3CXUA 4MARA 2G3YA 2G88A 2BY4A 3HR7A 3N6XA 4TROA 3RRFA 3W05A 4DMKA 2PA0A 3U6KA 1CEQA 1R3UA 1M10A 4QXQA 3KPYA 5AVWA 1FFXA 4KREA 2E9SA 3PCRB 4WJLA 1U2GA 4AZ3A 4DIOA 2AQHA 3IP9A 4LJ5A 5K8UA 2P35A 4UU8A 1TMOA 1VP9A 4E5UA 4EKGA 4YA6A 3KQUA 1HC7A 4PZDA 4D7AA 4GMKA 4NTZA 1MMFB 5JNUA 1KI2A 1AM4D 3AFIA 2GDJA 3F98A 3T06B 3VKVA 3E9RA 5LWHA 4E5PA 2HCBA 1F38A 2YWGA 4HXZA 1XDSA 5AM5A 3X2SA 2R96A 5EUMA 2AG6A 3GW8A 1X7XB 3KR2A 5CMLA 4DBLE 3DHEA 3KQQA 2ODQA 3GA0A 3GVPA 3IAM1 2R62A 2XNDA 4P4SB 3FHJA 2DLNA 3SC4A 1QNLA 2VO1A 1HBJA 3NIFB 3NVKI 3F71A 3H6GA 4P32A 4CN9A 1XMXA 3WC4A 5HE9A 3L7DA 2GEJA 1TM3E 1F3OA 5DHQA 1JPNA 1UPXA 5CLGA 3DWGA 1U7HA 1UWCA 2PH3A 4U7TB 3HKBB 5EIHA 3SP1A 1VIDA 3V00A 3PIDA 4B7CA 1LDGA 1IXZA 2B36A 5IYZA 5JH7B 3AM5A 4EGSA 2A1TS 4D8YA 2PIAA 4G8CA 3FUTA 4U3DA 4UEJA 3CJQA 1ZCFA 5T4FA 3STTA 5DBHX 1C4OA 2H3EA 1YS1X 3T7CA 5ERYA 4Q66C 1JFFA 1X80A 4LTNA 3OE7A 3NG1A 4EY7A 1HKUA 2EKQA 4FNOA 5C52B 4M1WA 1AHNA 5ERXA 1KMQA 4AIDA 2NZUG 3D1VA 1JAHA 4NBKA 2NV2B 2FW6A 2IHYA 2IS2A 4L2IB 1ZJ6A 2ICAA 2QPAA 4EHJA 1AQJA 1FW6A 4KPYA 4LF7B 2GJSA 3A6ZA 3O8DA 4G0NA 3SZMA 3SC6A 4JBGA 2Y1CA 2KM1A 4I4NA 1Z4LA 2R8ZA 3PIIA 4OMFG 4UUOA 2I4OA 2EKDA 3VZBA 5AQ1A 4CCWA 3F49S 3CX3A 5KU7A 4HVLA 2CXRA 2IXDA 3OHSX 3BDIA 1VI5A 1GPLA 4Q47A 1XEXA 4QPPA 3OD5A 3QSGA 4UTXA 5C3UA 1ND5A 2HMTA 3RVOA 4C4XA 2PMFA 4ZI7B 1JR2A 4U9UA 2NU8A 1QAMA 2XVYA 5EXXA 4R1QA 4EI9A 1A50B 1IOWA 1J20A 1EHCA 2E48A 2W22A 2Z4TA 3N07A 1NQOA 4N39A 3U3RA 1P45A 1Q7BA 4BLQA 4F4CA 1RHUA 3NZKA 1OI7A 4GMFA 1Y3FE 1KGSA 4QUGA 3T7TA 1UPCA 3HYLA 3ZDXB 3JQBC 1U1DA 5AW9A 2CNLA 4U7PB 2XUJA 2PZLA 4YHHI 1X1BA 3PPIA 4RIGA 5MN6A 1AGRA 5A7GA 1EFUA 2R2GA 1J49A 3N5CA 3WAJA 3FCEA 2B5VA 1QGUB 2HHAA 1XI2A 2ZSIA 4JN6B 2QTCA 3K1TA 4UZFA 2AR7A 2FP4B 1TZBA 1A5ZA 1USWA 2ZB8A 3OKPA 1IQUA 4BL5A 5AUOB 4BKRA 2XRZA 1BH6A 1RZ3A 2E89A 1JHXA 3U44B 5K8LA 1IHDA 4UPDA 3K05A 4CTKA 2F62A 1QCYA 2NYUA 1SRQA 3G82C 1FVOA 1E2QA 4LF9I 1AOXA 3L8GA 4E4TA 2K2WA 1TCCA 4HWOA 4JXJA 4RQUA 1GCGA 5B2ZA 5BURA 1RMYA 3OQ1A 3QBEA 2JAPA 3TW4A 5J9FA 4BQEA 1IDOA 4ZALA 3QXJA 3D6HA 2EWMA 3J81C 3ZGLA 2IX9A 2FV8A 5G1NA 5C7LO 1P0MA 3RF6A 4DEXA 1I13A 1H2EA 5J5CA 2GHIA 3ZE8A 4JJ7A 3QVUA 4ZJUA 1G3MA 4ZI5A 3SZ3A 3PJDA 1LVGA 1YI8A 2BKVA 2QUZA 1H4VB 4MW4A 1KQFA 3QW4B 4CW7A 5DN6D 2I9PA 1AUQA 4IF4A 2AOXA 4O1MA 2Q5QA 3EIFA 5GTDA 4ZRMA 2EHJA 5EPOA 3L4JA 1U31A 1P61B 2O59A 3ZI7A 4RS4A 3OQOA 5ILQA 5DHRA 4YCMA 2Q0XA 2OB1A 1DPGA 4QREA 2PXHA 3A36A 1EEXB 3ZWCA 2P67A 1T2NA 2BBOA 4JI5E 4ZHQA 1TFRA 1G8KA 4U3BA 3JPYA 2WQ6A 2CNOA 5EZYA 1GRCA 4JB2A 3THXA 2WSIA 3OEHD 5CB8A 2ASEA 4L3OA 1ORDA 3DL2A 3A3OA 3G9QA 4YAJA 3UF0A 2WDPA 2XUAA 3U7RA 3B6JA 3UM9A 5EUBA 5K0ZA 1DCKA 1B2LA 3MF4A 1JHVA 5DBOA 1V4VA 5HG0A 2J41A 3DZJA 1QH0A 1AV7A 1OAKA 1Q17A 2NADA 1D0VA 2BCEA 2WU1A 2BV3A 4FOPA 1W0CA 4CEJB 2I54A 3HTXA 4M22A 3AESA 5EWMB 2IHJA 3TRJA 4RENA 3I9FA 5SYMA 2IX3A 2Z43A 5E8RA 5K3CA 1OWNA 2JHGA 3LVRE 2IU0A 4EMDA 1GU0A 2JI8A 3H99A 1BMDA 3WLAA 3IBSA 1PUJA 3HRIA 3EEOA 1TC1A 2CFSA 4X62I 1NXQA 5FTMA 3RTBA 4EL5A 1SBZA 1ULTA 1UWLA 2HOQA 1XOIA 3ZGNA 1YBMA 2XWBF 1XJCA 3M4ZA 3W1WA 5CYGA 4W99A 2VJNA 4REQA 1US8A 2DETA 5HKKD 3KKMA 4B3SE 3EEBA 2V7EA 3EARA 4AKEA 3TTSA 8AT1A 5KNDD 4IZ6A 1OJ4A 3OHMA 1A2QA 2X5OA 1G8HA 1DC4A 5I8WA 2YZ7A 1IY1A 4BGIA 1BD3A 4U63A 3RIXA 1UBTS 1EK1A 1TMKA 3MN1A 3N3AC 4JYBA 4MRMB 5GV7A 5B6PA 2XDWA 3P26A 2VJLA 1Y9JA 1HDGO 1HNZE 1T6XA 2FHPA 2CZ9A 3AG6A 1KQ3A 3C16C 1B41A 2H08A 4RA9B 2Y92A 5C1PA 3QVJA 4AF6A 1WXXA 2IQ5A 4YUVA 2OWDA 1QIJA 3WQQA 1NY6A 3B38A 1DLJA 3Q3IA 2QLNA 3K0BA 4HEQA 1AJEA 1QC5B 1QHHA 3LFHA 4Z7NB 3GUHA 3RG8A 1JQLB 4PFQA 1SU8A 2C42A 4WPGA 4Z2YA 1JQEA 1YB1A 1P2TA 3ADOA 3IEUA 1JIXA 4C6HA 1GSIA 2ZOSA 4LE1A 2R9VA 1NRIA 2FPWA 3KX2A 4B0OA 1PU2A 2P2NA 5JXGA 1CYEA 3OESA 2ZCVA 1VFNA 4D8VA 3EHDA 2OPHA 3BILA 1PV2A 2PBRA 4A15A 1PQ4A 2G9QA 3P0EA 1JALA 2WM9B 3CPJB 2P79A 3L0CA 5LB4A 2EEZA 5BR1A 3ZLBA 2B7BA 4CIWA 2OZPA 3HXMA 2BCGY 5LMNI 2EGHA 3BD8A 1KIMA 2K6GA 4CF4A 2P6UA 4LC1A 4AS1A 2UUPA 3J7TA 3T0IA 4HJXA 4J0JA 1SXPA 1AMOA 2A9FA 1YULA 1U0NA 4BP9A 4E2WA 1MQ9A 4FKBA 3Q9SA 4JC4A 3ICEA 1VYVA 3LBHA 5DULA 1I5RA 3ZVLA 5L3VA 4HRYA 4IJ6A 4PAQA 2J6IA 4OLBA 1Y3AA 4PW0A 5CFLA 2OXFA 3I5AA 2VATA 5D51S 2ATVA 3M9LA 4XB1A 3CVYA 1S3FA 4A0HA 4OQFA 1JDVA 5CVEA 4HL6A 4QGHA 1GZHB 2HPAA 4M88A 2GPTA 2VQFB 1VJDA 2PL1A 3SJUA 1JQKA 1FRZA 1TXGA 3QOYA 4LNUB 1W96A 1FC0A 3QA3E 3GVHA 1M67A 2HLDD 3WJAA 5IT4A 3IDAA 3DFFA 3OEWA 3VC3A 4IFDE 1D5WA 3BXXA 2QRQA 1PYGA 4QNMA 1XNQI 3ZDFA 3DTVB 1J0BA 3V32A 2NQ2C 5F4BA 2ZTHA 1U28A 1YDFA 2CB9A 4ND4A 3S81A 4M8KA 5K0FA 2WJPA 3DM9B 1OOEA 1NW3A 1UDXA 4PTYA 1W85B 2BKEA 4BE9A 5C4IA 5IT0A 5J23A 1F2DA 1Y60A 1CUFA 1GLVA 1WAMA 3CQ9A 3NGLA 3OMLA 4LW8A 2PIDA 2W93A 3PGKA 2HTEA 3A1CA 3IRUA 2TYSB 4RK7A 3TRIA 5I9LA 3OE1A 3M4XA 5E95A 1I0ZA 4CHGA 2ZCUA 5G53C 4E31A 4RTKA 4UNRA 3OE5A 2ECPA 2PX0A 1AZTA 1N5DA 4W8HA 5KTPA 3WGVA 3TG8A 3HB5X 4RKEA 3ULKA 1P0IA 3P5BA 1FB5A 2XAUA 3H1AA 4U8HA 3OE4A 1HEUA 2J1LA 3IVMA 1FP4A 1XYYA 4JWTA 1L7MA 5FPYA 3WLRA 4DR6E 1EFAA 2Q5JA 1UPBA 2BWJA 4MU3A 1SRRA 2GN4A 1E59A 4JJIA 1ETUA 2N46A 1IXSB 4XPIA 4D56A 1DKPA 5IMSA 3PQ6A 2X36A 1HE8B 4IIYA 1HFKA 4KQMA 2GTPA 1TTPB 1Z88A 5LBTA 3QKUA 2GXAA 3L40A 1LQTA 1UT6A 4ZARA 4KRXA 4FWIB 4DUYE 1LDBA 3I09A 4MW0A 3LAWA 1ORTA 4IDCA 4MVJI 2BFCA 3V4LA 3W4IA 4BMVA 2B5OA 1THMA 4Q7EA 3CR8A 4URXR 2JJYA 1ESMA 1SFRA 2PS9A 2VYQA 1Z6YA 1ZHOA 2VF7A 1GRRA 3GFPA 4RY2A 3UFXB 3DR3A 4YCNA 1OHHD 4YALA 3P2KA 3PWKA 5HX7A 4HH0A 1C4KA 3IB3A 4X1OA 1XXEA 4DV2I 1H8ED 4FHFA 2P8JA 1XMOI 2PK3A 4U3JA 1T8RA 1JKFA 4ID9A 5KYUB 3INRA 3PA8A 1IHXA 1N7GA 2ET6A 4JUFA 1QR6A 3BIOA 3R3XA 1JHPA 2JCSA 3DUFA 4FI3C 4D4JA 3KR9A 3ZY6A 2YXBA 4FX2A 1LXCA 1BDIA 4FDLA 4FYPA 4XEUA 3WIOA 1MH9A 3NHFA 3KOZA 2Z2XA 1IXRC 1J21A 2FEAA 3E1GA 3I1IA 4KH1A 4E32A 3WQBA 4MOWA 2FG6C 3C3XA 2VRCD 5AI6A 1EAMA 1IU9A 5DZSA 1ESZA 2YCBA 1XHFA 4MIKA 1ZJWA 1BFUA 2AHOA 3GMDA 2BFNA 2V7TA 4A0GA 4HSEA 1ECBA 4M21A 4LY3A 3ZNOA 5IAKA 2UXBE 3GJ7A 3K0EA 5JI2E 3QVOA 3X1DA 4G1BA 1ZGCA 3G2HA 4N7RA 2Z1NA 1AQLA 2DJIA 2XE6A 1GSOA 4QL3A 2ST1A 3ROXA 3ELBA 3GUVA 3RS9A 5CAEA 3TPZA 4BU0A 5KTSA 1Q7EA 9GPBA 4YRKA 2NUBA 2IPAB 3LKVA 1OASA 1S4QA 3A9UA 4TMFA 4ZO9A 3UK2A 3SD7A 5B3LA 4I8IA 2F59A 2IYRA 4JP3A 3A9WA 10MHA 5IHXA 4S05A 3I2IA 1OX4A 2Q4TA 2R7MA 4Z51A 2AN4A 3FPEA 4WK4B 4KXXA 2HH9A 2V9CA 5KYUA 5JD6A 1J5PA 4HJRA 4RS3A 1FYEA 3H5NA 2TMGA 4CI9A 3KZXA 2ZAYA 5TXGA 1PR0A 4WUVA 1EGAA 4BLSA 4CI0B 3S8EA 2AXQA 1TUIA 1Y9DA 5B1DA 4WJKB 4B85A 1IMOA 4DJAA 4B75A 2XGSA 2YMQA 4CM4B 3PFWO 1ZONA 4GF5A 1YE5A 4IZJD 3E3NA 3FDFA 4G0OA 4GNRA 4PYLA 5BYAA 4YRIA 4M6WA 2NU6B 1KJWA 5LYJB 2GN6A 5C8YF 1D1QA 3WOVA 2VSXA 1IPEA 3MRSA 5TLSA 2EG5A 4U4AA 2PT9A 3GFRA 5C18A 2VP4A 3ME5A 3HYRA 5B6JA 5ALZA 2XT0A 1B63A 4W1SA 2IW1A 3E9NA 2GWRA 1F9EA 2PJZA 3NCHA 1LLCA 4D3SA 2CK3D 3B48A 1M8FA 5JD5A 3RUPA 5DGTA 1XO1A 2HTFA 5D7NA 3AXSA 4LGVA 5A9SB 2P9BA 5DOZA 1EJ0A 2XEDA 3F9CA 1CNMA 3PXBA 1L1EA 3DDUA 1ZW1A 4CLHA 1UBHS 2NO9A 1H74A 4XYBA 3CG0A 1RXVA 4DA6A 1NF2A 3B52X 5EERA 1S8AA 1O2DA 3UJPA 4RPKA 5FBQB 2IYXA 5CEJA 5AHKA 2DLCX 4FFLA 1O1YA 5C0XE 1JW9B 1UCFA 2AI3A 4MVJA 4HMQA 4BVFA 4IZJB 2O14A 4BIIA 2D5IA 5CFNA 1X13A 1SG0A 3Q8MA 1WXHA 2B9EA 3CGWA 3BWMA 3QYFA 1SUFA 3HQ4O 1YHYA 4WH0A 2DUMA 1E1DA 3KQHA 2X77A 2YV4A 2X9LA 2O52A 3GOHA 4PM4A 5E7JA 3TNDA 2FB9A 3PFCA 1M0EA 1O6CA 4HHEA 3L06A 3R5FA 4YRZA 2OYSA 3X1XA 4NXMB 1HMYA 1EUQA 3G5TA 2WILA 1C2YA 3S7TA 3U39A 1QH9A 4G1CA 3HV0A 4QDOA 2E2WA 2W0MA 3K7EA 3OFNA 3BL5A 2IEGA 4KLZA 3AF5A 3W7AA 4DB4A 2C20A 5LP6A 1PHPA 2OCGA 2ZIXB 3L0DA 3W8DA 4D0LB 3LJKA 3H5AA 4W4TA 3ZWKA 1Q1ZA 1ZY2A 6NULA 5JPDA 3ORQA 1TO1E 4ZIRA 5F7XA 3DG9A 5ELMA 4W6ZA 5CCBA 2BI8A 5FLXC 4PICA 1L7OA 3HKDB 1IULA 2WG1A 3NR2A 5KEIA 3RKSA 4KWTA 4OA8A 4ALJA 2B2XA 4BNXA 1KP3A 1G9SA 1ULAA 1WEHA 3KTOA 3D8TA 1MHTA 1SBIA 5IVHA 3BT7A 5KX5A 2QNIA 4H3SA 4DWWA 1AS0A 1IM5A 4LDZA 3BTVA 1JECA 4N49A 1HE3A 4LCGA 1E1QD 1NURA 3CUEF 3O8RA 4ND8B 1SC9A 4JUIA 3K4PA 4I1OA 2EXXA 2ZW9A 4KEAA 121PA 4D9KA 1NY5A 3NATA 1NSTA 3DULA 2HRRA 4HRAA 3T0FA 5FORA 5BSRA 3I42A 1E6WA 2ZBGA 3IDFA 4LN1A 1IBMB 2WU0A 5F7ZA 3DC2A 1O87A 2HB6A 3A9TA 3VPGA 1GTSA 2E5WA 1LI5A 3IVGA 3SQOA 3NTRA 1XZKA 4N82A 4MGZR 3A4MA 1VG1A 1U28C 1YMQA 1OJ7A 2LKCA 3CO0S 5G40A 2PWYA 4E08A 2JVKA 2WG2A 1EDEA 2B4KA 3LIIA 3LCVB 2K4MA 3NNDA 5J5VA 4ZTUB 4DR7B 3H1GA 3JSXA 4PZ9A 4V0LA 5IVPA 3WHLA 1VQ1A 2WIDA 3GIDA 4IKEA 2XNDD 4X92A 1ZZEA 3TPFA 4DV5E 3C3JA 3K20A 2DR0A 5TEWA 3ZBPA 2P9HA 4OYLA 1P1CA 4JI8I 4MDFA 3OU7A 3JRWA 4C0QC 1MAWA 1S2OA 5HZMA 5T4EA 1CUYA 4RTNA 4HFNA 1GZ4A 1DAOA 1ZUNB 3O74A 4G56A 1FXWF 5KYGA 1R9MA 1BQEA 3JVEA 3WYGA 2QTAA 3CCCA 4AY2A 1MB4A 5J5AA 3N75A 3NCTA 1R9GA 5CB4A 1P1FA 1PJ3A 1QWSA 2RCNA 5BR4A 4IIFA 5J47A 2I2FA 4QRIA 5K36E 1MV8A 2ZM6E 3OCUA 4DRXB 1Q6ZA 1Y8QB 3O3NB 1JHAA 4X54A 1YDHA 4USMA 1S8FA 1WD5A 5DWQA 2PLAA 3VSEA 1U02A 4PLTA 4GOJA 3RABA 1M6VA 1KTVA 2UUOA 4GW3A 3RIYA 3DBLA 1AQ6A 3SBDA 1EH5A 2FSHA 4ZYXA 1OH6A 4E1AA 3F3KA 4EUEA 4CFSA 1L4YA 1RM0A 3O2QB 1A8PA 5DPMA 3C6BA 4FK8A 4WMLA 5G1OA 5K8TA 4LI3X 1ESNA 2WTBA 5JC8A 3DOJA 4WXPA 4Q9LA 5IEBA 4WZBE 3BKWA 1KZ6A 2NSLA 1ZD3A 4DADA 1CUXA 3A1UA 3PGXA 3F3YA 5FNZA 3K32A 3ND6A 2J0QA 4D42A 2GEDA 4EUFA 2VXCA 2GEUA 3V4OA 2VESA 1IQ0A 2ZSEA 2IIBA 3RK4A 3W6OA 2YMLA 1ZFNA 4OTZA 1PGQA 1BVRA 3MJCA 1ACJA 1UQTA 3WNDA 1Z6TA 1OWPA 3TVDA 3U3KA 4EPTA 3VAAA 4M0CA 4CKZA 1L7DA 4XQGA 5EEHA 2AFHB 3N0RA 2WTAA 1U2PA 3ADDA 1AGYA 1HNWE 5AKKA 2FMFA 1VHWA 1PK7A 1E64A 4GMHA 1THGA 3W5AA 3KB6A 4V03A 3WX0A 1RLMA 5D3MA 4DCPA 1WF6A 1QFJA 4N18A 3IOBA 4ARZA 4IMJB 4ZYWA 1G98A 4JLWA 3UATA 2VHQA 3D3WB 5FUQA 3KYJB 2XYHA 1Z3IX 3PTZA 1CP3A 4KGVA 2P77A 3QNUA 3FYCA 3AK4A 3PNPA 1E2LA 3FCAA 3CRW1 4JQYA 2VJCA 3VMFA 5AVYA 3RNOA 3UBMA 1E77A 2R60A 3ZD6A 2HZ7A 1J00A 1TTHA 4WBNF 4EHHA 4UBMA 3SHTA 3N05A 4W82A 1MABA 1VG0B 3FMGA 3A25A 3JWIA 4P8RA 1KWGA 4FKZA 4PV7A 1KJ9A 4DC1A 1GPBA 1MC8A 4NZ9A 3AF0A 1Y9AA 4QODA 1VZ2A 2D1SA 1NM5A 3I9NA 3VDXA 3SC3A 3OPNA 3A1DA 2F1KA 3QQPA 5SY6A 5FEUA 3IR7A 621PA 3ETDA 1VSQA 3DV9A 3EVEA 2JZOA 2G9UA 3FNGA 2C0PA 5LZ9A 1VLJA 2VXOA 2VTKA 3U7GA 3TUIC 4A6XA 2WB4A 2FHSA 3B1JA 3UMVA 5D7BA 4EA6A 5ALVA 4EW3A 2FFRA 3A4TA 3EZ9A 3TXXA 3WDSA 2PX3A 3X43A 2A2CA 2C8JA 3AV0B 2VNAA 4IDAA 1FYVA 2C4NA 1EFPB 1TLTA 4ITUA 5MFZA 4GFDA 4EHAA 2QAGB 4RTJA 4RU1A 1GTG1 2IUSA 4DAEA 4YJ3F 4MAFA 5ICFA 2GZ1A 1PZMA 1U7UA 2Q1TA 5BW5A 2VF4X 2NU9A 3CZPA 2VT2A 4D5GA 3KKEA 2P9JA 2VQ6A 1A96A 2EF1A 3BBPA 3P0IA 1CNFA 2R68A 3T1TA 1B43A 1X15A 3DHWC 3R3VA 4JHXA 1S4MA 2D4HA 4J76A 5J2TF 3M2PA 4IDHA 4M9CA 1ZRSA 2R66A 5EA2A 3LTNC 2BE9A 1QXSA 1XIVA 2RAFA 2WPDA 3JWGA 1MAHA 3BRQA 4DDHA 1F2UA 5K0NA 3TUZC 1NOKA 3VH3A 1GJRA 4ZC1A 1SXGA 3SICE 4UHEA 4N4AA 1BDMA 2QYHA 4HQOA 2JNWA 1SHJA 4AU1A 2ERXA 3KZCA 4DLBA 1ONOA 4NCNA 3WGUA 1MEEA 5KYWB 2ZJ6A 1DTWA 2XB4A 4TYYA 1O03A 1GQ2A 2M32A 1U0EA 4HBGA 2O07A 2XGGA 1GNRA 2G06A 3NV9A 5BYBA 4NENA 1K27A 3EF0A 1H69A 1G3RA 3IQEA 4J07A 5JXWA 2V58A 1UFVA 3ZPXA 2BEWA 4GKBA 4K6KA 1FRVA 1RYFA 2F8TA 2I6UA 2CXPA 1N2CA 5ESXA 4ZCQA 2FOIA 2QMEA 5EE0A 2O6HA 4XYGA 1UJ2A 4KQVA 5F33A 4DKJA 1U7WA 2WWFA 3JQ6A 4LYGA 4MRVA 4DLNA 1MCZA 4NG5A 1ID1A 4OAQA 2E5LI 4QNJA 2JBHA 4RF4A 2FW1A 5GGXA 4LISA 2CWDA 2VC2B 2X58A 1VKOA 3I8SA 4EECA 2AN1A 4M1OA 1YB4A 4ZEVA 2EYUA 1UJ4A 2EL7A 2ID7A 1ISRA 3BK2A 1FBTA 4HWTA 3EEIA 4JY7A 1E69A 1NAHA 1E5DA 1N33I 3EDMA 3PFIA 2FWPA 1W30A 4IHJF 4MKZA 4UJ5A 2FFHA 3KB2A 2P2GA 1XNRB 3ED5A 1USVA 4W5WA 1ZK4A 3NC4A 3CH5A 4QFCA 2WNRA 1DMSA 1EVEA 3TNLA 1JX6A 3Q0TA 3W5JA 2P4QA 3U2QA 4HNQA 4QGBA 3R6LA 1E4EB 4QUDA 5LOVB 1P4AA 3L6OO 1T9CA 5DB4A 4MUKA 4G1EB 3K9LA 1M2VA 2DQSA 1POWA 1R66A 3FY4A 2W6MA 3GRFA 1XLTA 4C78A 1ZVMA 2ECQA 3D8NA 4GXTA 3WWPA 3W2EA 5B4VA 1CCWA 3TR5A 4PEVA 5AUPB 1T3GA 2G08A 1GN8A 4BWVA 4QDZA 4X6YA 4ZXPA 4DV6I 3KSZO 3D7MA 1E99A 1TU0A 4WGGA 1L4LA 3AEYA 2OK8A 5K1ZA 4Y2HA 2X0EA 2WD9A 4LVUA 3HUFA 2KYRA 3B6EA 2X1HA 4FFWA 4MWZA 1UZAA 2J9YB 2W2XA 3B1YA 3HXKA 1ZEJA 3QYPA 4AN1A 5HZKA 3FOAA 3VUFA 1HSOA 5ITWA 1GPDG 4CR7A 3JQCA 2HKEA 2RHHA 2OBNA 3M1IA 3SF8A 4DZZA 2IHNA 4RVSA 3EGIA 4LF9B 4AICA 1P33A 1U8TA 1P75A 2OL4A 4RW0A 4HNHA 4Z6KA 1GITA 3FPKA 1VHTA 3G79A 4B8YA 1OE0A 3CY6A 3FYDA 4BNDA 5FBKA 2DHEA 4Q3DA 1NNUA 3UMFA 1J2RA 1RADA 3GLLA 3L0YA 4WY8A 2G1KA 4ZQIA 1NN5A 1ATIA 4JR0A 2D8MA 4L6AA 1FNBA 4S1NA 4U7GA 5EMNA 3RHSA 1E3QA 3A11A 5AUNB 5JISA 5KVVA 2EQ5A 5KSWB 3PK0A 1OFUX 3PS3A 4E70A 3SEQA 3VYSB 2WG0A 5BUSA 5HK9A 1K6EA 2VDNB 3TPCA 2RONA 3FG9A 5EMHA 1ADJA 1E4OA 1PVVA 3O4VA 3W2IA 3ABIA 4Y67A 2NNWB 3D43A 3M2TA 1REQA 1ZHHA 4LRWA 4V0MA 3M83A 5F1OA 4YECA 1CD5A 3PUYA 4R2IA 3VO1A 3RVKA 5LJLA 2HU5A 1KJZA 1XQ9A 4YRBA 3H9UA 2ZYGA 4RCZA 5L3JA 4O4IB 3DJFA 4RORA 3FWHA 3I0ZA 1CP2A 3LZ6A 1WW2A 2AJDA 3JWJA 4I66A 5PNTA 3FSEA 1FDIA 4R8VA 1JEJA 2WFLA 4HPJB 2O8EA 4JJ6A 4C87A 4MB2A 4GGPA 5CXUA 3LT2A 2ZFUA 3MWEA 4JT4A 2C04A 1P6UA 3O31A 4MITA 4EW6A 4RAQA 4AJOA 3GPLA 2O1SA 3ODGA 3O8OB 1MJNA 2P69A 2WOOA 4O59O 2P2YA 3B1ZA 2CVZA 2H9IA 1NLUA 3EPRA 2JT2A 2BFEB 2SHKA 4N5IX 3ZN2A 3GA5A 4YRPA 4E0BA 2DPMA 2Y1GA 1BTOA 3FCUB 1J0XO 4A2QA 4S04A 2AOWA 4DR3I 1P7VA 4P52A 4U0JA 3EDQA 5CLQA 4KYTA 4HAZA 5IUJC 4PIPA 4C89A 4CJXA 3GLHE 1DKNA 3I9LA 1X9HA 2A0KA 3NORA 1E5XA 3C6QA 2I4NA 2MSWA 4RPHA 5IC4A 3AP1A 1IL0A 8ADHA 1MXHA 2XTNA 3CLHA 2OLEA 3K2QA 3WB1A 3BXZA 4OHFA 2VDOB 2AW5A 1QUEA 2Q3LA 4LEIA 1BOOA 4PYIA 3OPYI 4YREA 4UE2A 2WF8A 1NVXQ 4LYHA 1XRPA 1YC2A 4HR7A 4E7PA 1XMSA 2Q4OA 3GP5A 3K5WA 1WZCA 1ULZA 4ZOEA 3ZXUB 5TIIA 2QTGA 1BN6A 5HMMA 4EJ6A 4JI3E 1JKIA 1V47A 2WDZA 4S24A 1FDTA 2P3OA 1OLXA 5HWSA 3QTTA 2F9FA 4ON9A 5UKDA 4OHBA 1N2GA 2Z08A 3QUTA 1J1IA 4DJJA 1WUUA 1IIRA 5D86A 2B78A 3EG9A 4TMKA 2HZBA 4IFDF 3E3OA 4A91A 3ZHRA 1E18A 2PNZB 3IIIA 1RMQA 2NVUA 4ZAGA 1CUUA 1NM5C 3KYDB 4DGQA 5JNSA 2HJVA 2VUIB 1GU7A 3PU6A 1UXIA 1EK0A 3ZDQA 4IAOA 5T3YA 5KNBH 4QGFA 4RTOA 2YS6A 4HB2A 1S7GA 5DI9A 1PLLA 4AO8A 1A97A 1Y1QA 3ZE0B 1DG1G 4XYLA 4C7OB 1G42A 4UNIA 5I9MA 5ALOA 2NUAB 3UA3A 4TT3A 1YQWA 1BJTA 1EDOA 1FPMA 2I6QA 3DF9A 4KQ1A 1KPIA 1WZEA 2YXPX 1NJ6A 4AJPA 5JYDA 3DD5A 1T3SA 1T36A 3G8CA 3N0VA 4MA0A 1YUMA 5FPSA 3UJ7A 4B45A 2Y2UA 3SXJA 5BMVF 2R86A 3LUAA 4KI7A 4YAOA 3I73A 4TRJA 2V6BA 1YRBA 4LFBE 3NWJA 5DYGA 4AJHA 1VHLA 2AFIA 4R1UA 4EWLA 4B7AA 1XA3A 2Z2ZA 3N8KA 1QZUA 3AEZA 4IGIA 1EHYA 3K6SB 3G59A 4D25A 1ZRHA 3PFBA 4V24A 1XZFA 4U7HA 1RZRA 1U5AA 2CSXA 4E5MA 1IM8A 1E3HA 3DD6A 1DO0A 1MB2A 3K0AA 5HF9A 4CBVA 3SSNA 3HN2A 3OBBA 4TQGA 4CF3A 5LMNB 2UU9I 1GL3A 4QBKA 4CIYA 3HXTA 2O5RA 4BU1A 2X23A 3EA4A 3ILSA 3R6WA 1L4MA 4OYHA 3TFQA 4MPPA 3RRBA 4HDRA 1TUBB 2BVNA 2RDMA 4FDMA 3CZRA 4JHLA 5AW4A 1TCUA 1FVFA 4ETNA 5KKCA 4BLUA 3T1YB 2OCIA 4PGFA 4A2PA 2PS3A 3O7MA 3QPCA 4M49A 2AV6A 3EYAA 1WDLA 4HQLA 5H3CA 4ESOA 4WLOA 1F2TB 5DIFA 3E15A 1E79A 1WHSA 5AI4A 2XF2A 2J9XB 4JX8A 2D0OB 2E18A 4FHZA 4L78A 4G09A 4B44A 1GGVA 5A2QC 1ETHA 2YZNA 4EGFA 5JNLA 4Y0NA 5KQSA 1YIOA 3HPQA 4D4KA 5KYXB 1ZM9A 3D4BA 4YR7A 3LC2O 4IHAA 1J2JA 4HAXA 4ZT7A 1FDVA 2G17A 1MU5A 5GZ6A 3U1TA 1Q14A 4RGVA 1SPXA 2A8YA 1NFRA 4JYPA 4RTMA 2A9OA 2ZBKB 2BKXA 3O1LA 3LL4A 3SBEA 2WK1A 4QLOA 4QEKA 5B2FA 1V96A 4TRMA 2UUBE 2O57A 4P5DA 3WWYA 4UM9B 4X65B 1VJ5A 1GUZA 4JCOA 4MVJD 4G97A 4B3ME 1BQ3A 1NMZA 3FPLA 4HZGA 4L27A 3VOTA 3MM4A 2PQ2A 3K6JA 3MPUA 1SOVA 3OFKA 3PQ7A 4PTLA 1Z4IA 2JRLA 4U6NA 2JD2A 2XBUA 3QX8A 4BYMA 1YJQA 5FTNA 4FHCA 4KQJA 3R0IA 4XGKA 5I45A 1GVNB 3PYDA 5F5LA 1SO8A 3MWDB 3DZ8A 2VDWB 1CE8B 2JGLA 1KZ7B 1VIVA 4Y1EA 2WBLC 1P0PA 3OFND 2LXNA 1FPQA 4JB0A 2QTFA 4L4YA 4P31A 4Q9NA 4WERA 3IQFA 5T6MA 3RSCA 4DXAA 4EDFA 2MT9A 2Y0EA 1IZ8A 4IRUB 3IERA 1XLTC 2AQIA 1LRJA 1M33A 2BJVA 3OQJA 1QVVA 2R1TB 1Q74A 1CKEA 1RKXA 4FZVA 4GBJA 5JAZA 5IBCA 1P2SA 4ER3A 1C0EA 2V4MA 5JBIA 2IOYA 2FQ1A 5JNVA 4CU2A 4P54A 3R24A 4ZK6A 1W0JD 5B4TA 5A6SB 5K03A 5DGIA 5KQRA 1ZZGA 3E3LA 2WJVA 2E85A 2JIPA 3INNA 3JU3A 2D62A 3SNHA 2JARA 2FWRA 3EDCA 3DO8A 2C59A 2HRQA 2ZE6A 5CA1F 1YKSA 2PUWA 3L7MA 1W5SA 4MI1A 4NBNA 3RJTA 1FU8A 3UMGA 1FX1A 2ALJA 1RACA 5KVCA 3G1WA 1RLOA 4X90A 3GNTA 2HD4A 4LHVA 5CXSA 3W7VA 4X66B 1F51E 3PJFA 4WCFA 1T0BA 2DQ4A 4LZNA 2IPXA 1N36I 3TZLA 1XSEA 2V7PA 4M1EA 3EEFA 2Y68A 4NBLA 1MT0A 1NVMB 4Z4QA 3GC6A 4J1TC 4CIXA 2ZPUA 4CM8B 3LQFA 2PWAA 3DMRA 1P4HA 1SHKA 3JASA 3LCMA 5FWKA 4QDJA 2FOXA 3QOWA 3ZNQA 4HD8A 2XXAB 5LMUE 1SM4A 2WIKA 2C9DA 3UFBA 1EGHA 1XN4A 3R2JA 4HO1X 5ESRA 3Q7EA 1MP0A 2DMRA 2F8MA 2G40A 3N76A 1YFKA 3L7CA 3AGQA 3B1VA 1E5VA 2C5AA 4XARA 3WLPA 4TOIA 4EZBA 1RRCA 3T9CA 2JD1A 4GPIB 4P4GA 4C3UA 1RR9A 2EBFX 1Z5ZA 2RBEA 1H6BA 2D1RA 2W4MA 4LJAA 3FGOA 5K0BA 4R5MA 1HT3A 1BE1A 4X00A 4ODIA 3BMOB 2GJKA 2J67A 2C37A 3Q87B 4YNBA 1KDZA 3F97A 3RK0A 3NJRA 2IT1A 3W9SA 2VKQA 1KAMA 1M1YA 4QUHA 5E3HA 2B2CA 3JD0A 2A5LA 2B83A 4R98A 1XXLA 3A1SA 1FWLA 1GXSA 1GG5A 1LF5A 2TS1A 3ABOB 5FOUA 5LZ8A 4OQZA 4ZPXA 2DLDA 2M6SA 5F3DA 2BFAA 1WR8A 1CZRA 1J9ZA 4DA7A 1K66A 2HAEA 2WQ7A 3DVRX 2HHHI 1KVUA 1V1JA 4OXNA 2PH7A 2GO1A 4YB8A 1YIAA 4P4TA 1AD2A 1NG9A 1JHOA 4RSHA 3OX3A 3ENWA 2DEJA 1XG5A 3LF2A 3NHSA 4Q21A 3TW6A 2SKDA 4DLSA 4O63O 4EPYA 3O73A 3DH0A 1NBMA 4BZWA 2VPZA 3FH0A 2RGUA 3L6CA 2HXGA 3DLAA 5FWAA 2CCGA 5G0UA 4BCDA 4PCVA 2CBXA 1WDKA 2JIMA 3KCQA 1HLDA 1JIIA 1SC4A 3IAEA 5FPHA 2JGAA 3ZE7A 2P40A 3DFKA 2DPGA 4MI6A 4A8PA 1JLLA 2O2XA 5LD2C 2O8BA 3BZWA 2QZ9A 2JVJA 1NJ5A 2JANA 4RDHA 4D99A 1DX4A 1WJGA 3ISTA 3KG2A 2BZ0A 1EX6A 3GEBA 3I5MA 3KZVA 4TVBA 3F90A 2LCQA 1JS1X 4FNGA 4GGOA 5H3LA 1J5EE 3OMXA 2YV2A 4Q1CA 2DFNA 5TPZA 4L8WB 4E12A 4RMGA 3IUEA 4MKFA 2REQB 4UHKA 4HRXA 2OXIA 4PRLA 1ZH0A 2O3RA 2V98A 2OMKA 1I4TD 2CLIB 3FNHA 4W6QA 5JASA 2MR5A 3FI0A 1YRQA 4BGUA 5KJFA 3CT4A 2XUOA 3NUGA 3AI1A 2V4UA 4I6GA 2CVEA 1L7PA 2IE8A 1Z5UA 3NDJA 3G23A 4DFDA 4DHEA 3M5PA 5BPFA 5LA6A 3OZAA 5K0JA 1HNNA 1TYEB 5C7IO 1GD1O 2JJ1D 3B12A 1PFWA 5CM9C 2A57A 1R16A 5LLDA 2W2NA 4U8GA 4YQEA 3CX4A 4G5OA 3NRBA 3R7WA 4P4LA 4UHCA 4J0DA 5CNIA 3D2BA 1TCAA 2OSVA 4EP1A 1V8DA 4WACA 1SKYE 4R5HA 4KWEA 1FTQA 2I7DA 4QO7A 4DV0E 1SUSA 4PSDA 4QJBA 1XROA 2GAOA 4EFNA 3R20A 4DV7I 4JJGA 2QR2A 2XUGA 3HP7A 4HXEB 3H42B 2BOVA 3R3ZA 1WKCA 3AHFA 4G5GA 4H17A 3NAGA 3JYQA 1A2BA 1CUDA 1SC6A 1MIOA 2KX7A 4HYTA 5I6DA 6AT1A 4OLAA 1TUGA 5IF3A 4FFBB 5ELXA 5KTYA 5DK6A 4CM3A 5EJ4A 1ISGA 2UUAE 2Q0QA 2QLBA 4IGAA 2AZDA 3FBTA 3H1TA 4M53A 1Y6GA 3GY0A 1AN0A 3M4NA 2R87A 5K01A 2ZT8A 1KVRA 3VPBA 2VTVA 1T6YA 1LS1A 3H2ZA 1OZHA 1YR8A 3EBLA 5K4AA 4DLZA 2CUKA 3EIXA 4TTPA 4DDMA 4I1RA 2QD3A 3GFTA 3QU2A 4HQNA 3SZUA 3V7WA 1H2XA 1PFQA 1AKQA 4OHXA 1KHHA 3O82A 3SIWA 2AHRA 1TD1A 1VCHA 4EKNB 4C7MA 2YYYA 4O2AF 4BQQA 9LDBA 5GOZA 2IUFA 4BAUA 4LOLA 1YR3A 3W9YA 4Z9YA 4MV5A 4WKPA 3OJOA 2IDJA 3AI7A 4G8DA 2UYYA 2C5LA 2IESA 2FPIB 2WPDD 3I9V6 2UZIR 2I1WA 2EFYA 2QE6A 1NIPA 2EZ4A 3BJMA 2OR3A 3TNJA 3KE9A 1R74A 1G5TA 2QSZA 3KUUA 4IJQA 4NYIR 4P58A 5JO9A 3GG9A 2ZJAA 4F2DA 3HGMA 1RWOA 2ZB3A 3EOZA 3K5PA 5DTJA 3S1SA 1EWRA 2PVPA 3I9MA 5AJHA 5C8YA 4ZJYA 1NWCA 2Y6UA 3GUCA 3SWWA 2FPUA 2UAGA 4TKVB 5DX8A 5DNXA 4UTOA 2IV7A 1NVTA 2ORVA 4ZZ2A 4INZA 5D5QA 1JZQA 1QQ7A 4UT4A 2VP6A 1YDEA 3I1FA 3KHUA 4OM8A 3GFBA 4B5LA 5GY7A 3N70A 5JQWA 3O4GA 1J7JA 3GUZA 3PUXA 1LNQA 3H3JA 1IONA 1II8A 4DM7A 4CMHA 1YS7A 1JWLA 1M34B 1DG9A 1P5JA 2RAPA 5H80A 4GRIA 1GZ6A 3G68A 3IKMB 5C5IA 3DHVA 4W1QA 1QX4A 2P4SA 4GC9A 3TSYA 4BLVA 4W5QA 1Q0QA 3KJQA 2J3LA 4HZIA 3WL7A 1J4AA 1WU8A 3BTOA 3WL3A 4IGEA 3RIHA 1E1KA 1CHDA 4AB1A 3J81k 5KWEA 1D4FA 4XM1A 5AVJA 1YACA 5ENVA 3ROTA 3KL2A 2QT9A 1Z7BA 4Q1VA 4JQCA 4BMZA 1I7PA 1RMTA 3P4XA 4KAAA 1DJPA 1FY2A 2EDAA 1G291 4RO0A 1T5OA 3COPA 1M0SA 1EJ2A 4P34A 4UEWA 1BCRA 4GWGA 4YRGA 1W19A 4JT9A 2EDCA 2GO3A 4L72A 3QTBA 4CCYB 5AW1A 2CJWA 2H17A 4KQIA 3RAPR 3EEYA 3MUOA 2R2AA 4QVGA 2XCIA 3ASZA 1ORVA 3TN7A 3EMDA 3ZH2A 4KIUA 4BFVA 1BDHA 2FSPA 2O4UX 2IUYA 1WP4A 3RVLA 4EFMA 2HMYB 3STXA 3CVUA 3E84A 4HB3A 1ISIA 4K9SA 4NULA 4U00A 1PQUA 1RWXA 4B4UA 1QIMA 2XA1A 6ADHA 2O2SA 2ZRAA 3DFUA 4BA1B 1OD6A 2DBRA 2P9ZA 4OMUA 5CP8A 2FWNA 3WLEA 1Y5NA 4LCBA 3MJSA 5F2OA 1VSTA 4XW2A 4WCFC 1NMSA 1CUVA 4G89A 4AK9A 1CZKA 3IAHA 3OTQA 4LF5E 4BGEA 2AZ4A 2B8EA 3K4QA 4H18A 1DFHA 2X0RA 4QYIB 4BQOA 1N2IA 2W6JA 3TYXA 2VNSA 3K16A 4CKEB 1UBUS 1GA6A 2F7SA 4K6HA 3P9IA 4B34A 4CETA 4JYZA 4IINA 1SUIA 3TOVA 3GJ5A 3PXAA 2D54A 3TZQA 3UPTA 4PLPA 3Q7PA 4Q1FA 4QAJA 4DR2I 2MWMA 2ZYIA 1WO8A 5F3RA 2EARA 4C4AA 4G0MA 1UMBA 3DO5A 3I8OA 3ILXA 1NJGA 3OTHA 4G41A 2B6NA 3P97A 1E6LA 1LUAA 1FP7A 2GJ9A 5I9BA 4YRAA 2FMXA 4OYRA 1XTZA 5HTKA 3T9FA 1KOFA 4QJIA 3F8SA 2CZCA 2RHDA 3RYHB 2D06A 2BF7A 4MYHA 5FPQA 1YMUA 4KZKA 3AL0C 3FNFA 1N5MA 2FK8A 3RIMA 4CR6A 1JNXX 1UBSB 3PE3A 5KNCH 4D6PA 1KSJA 2ZWPA 1SUBA 3GHYA 3D8HA 4PYRA 2J6CA 3LW7A 4IO0A 3BHMA 1W7AA 3KIPA 3WGIA 4RSGA 2W2KB 3DMDA 1IY8A 1KNXA 4XWTA 3ZHVA 4YCBA 3FVVA 3TKAA 1KIAA 1JSZA 1EUDA 2Z5FA 1RCTE 2NWQA 2W42A 3TIIA 1YFLA 3A05A 2OFXA 5IVDA 4RHFA 1CR2A 1EJ6A 4FBLA 3A6PC 3M70A 2F3SA 1XQWA 2UVPB 2O1UA 2VTBB 1Z2EA 2RH4A 1UEKA 3DTTA 4QARA 4CF5A 3K72B 1VKRA 2Y9MB 4MLZA 3QI7A 1UDAA 2PZ8A 2GCPA 5AW8A 1TO2E 3HDJA 3OZUA 5KI6A 4BO8A 3LKZA 2HA6A 4PC2A 1BSVA 2IU3A 3WBBA 2ASVA 4JBLA 3I5UA 4TVSA 5M5BA 4P80A 2OGUA 3FX2A 2ZRBA 2PJDA 3ER6A 5FRDA 2WTUA 3F2IA 1D7AA 3B1XA 4NJMB 3RFTA 4JLSA 5K3FA 2XQGA 4F91B 2QRMA 1CFJA 1M1UA 1UKVY 2A5JA 1VPTA 1IJBA 2HUPA 4HLQB 1A88A 3GGGA 2GT1A 5TVGA 3RANA 3HB0A 3K1AA 4OKNA 1VXRA 3VR6D 1EHIA 4BFYA 4ZCIA 1EPUA 1WMDA 4UKDA 3ZTWA 1W36B 2RC5A 4HDMB 3SKXA 4KO1S 4BHTA 5KNDH 2WOJA 1SQ0A 5DGCA 1AY0A 4B43A 2H4YA 2PUGA 2VOJA 4IUYA 3P3CA 4MYUA 1PT6A 3HSSA 1JEAA 4AULA 5AJWA 3LCCA 1NQWA 3OJLA 4HQRA 1OU4A 2B8WA 3BGOS 1CZHA 1VDZA 1JILA 4JMLA 4C07A 2BA0G 1I1NA 2QMUA 3QE3A 4ZV9A 4BMCA 1MR3F 2QU7A 2W8ZA 3DOIA 2H57A 1C9KA 4DCGA 1F1BA 2RGCA 3GPBA 4GQUA 2NVBA 4O25A 2OHFA 1YH3A 5JC1A 1GGJA 5TMBA 2Q8PA 4EI7A 4JIMA 3WMGA 3E61A 3UT5B 3OJXA 1GTRA 2QQ0A 4BO6A 1N8TA 4RD1A 5HBRA 4CKWA 1QGOA 2GESA 2XQJA 1CUZA 4JLAA 1A7UA 2POQX 2EFJA 3H4MA 5DT2A 1NV8A 1PGPA 2J46A 1SZPA 3FOBA 2DRIA 3IDOA 3NYIA 3KOYA 1T4GA 5CITA 2C5FA 2Z8XA 1YJ5A 4JK3A 1QTNA 1JDPA 2QPLA 1NBAA 2JJ2A 1CQIA 1A2OA 4FONA 5FUXA 1DBRA 1G63A 1LLQA 2WPNA 5JSHA 4HVCA 1CF4A 3DDOA 1T3LA 3ZGVA 3KWMA 2QXUA 3KUDA 4KIWA 1DWPA 4A82A 4Z0PA 1Y98A 5LQAA 1W1IA 1W93A 1T9BA 1JDTA 1M54A 1Z5NA 1N33B 2FWMX 3VZDA 3U9TA 1N2EA 2WT9A 3MD9A 5JYBA 5BMOA 1DRJA 1Z0IA 4EABA 3PEVA 2QQEA 3OCWA 5CX1A 1UWVA 3CU5A 2B4YA 1FMTA 3EVZA 3I6IA 4RK4A 4YAFA 4JI5I 3X2EA 1SU6A 3KKZA 1KNQA 4EI2A 1XZDA 3I9KA 4WBNA 4OBXA 1KOGA 1UZLA 2GS9A 4QGGA 1AIPA 3PVZA 3GJXC 4JI6B 4B7XA 2CWWA 5AM4A 5MF6A 1ZN9A 1E5QA 4G0ZA 3M6VA 5KOYA 1W2WB 3H1CA 2NXWA 2QN8A 2Z1MA 2YJ4A 3A70A 5ENZA 5AVUA 4Q3NA 5HM8A 3MIIA 4R7TA 4JV5B 2PYIA 2V97A 3P3EA 3HU5A 1O96A 3CWQA 1I6KA 3S3TA 2J85A 5K9ZA 1CB7A 1RZRD 1BKDR 2XSZA 1NJ1A 1SC3A 3HJTA 3A32A 4C7JA 1S9DA 3QBVA 4HWGA 5JCZA 4DJEC 3A8TA 3N2GA 4WIAA 4DLLA 2WF9A 4M7RA 3PXUA 4YVFA 2WTNA 4FZ3A 2FFJA 3AUAA 5E4TA 1HRKA 1WDTA 1DX9A 3AB7A 4U6QA 5FWYB 2A94A 1QH1A 3ONNA 1LPSA 3B85A 5HA5A 1TZCA 4OI4A 3DYBA 2FTKE 5C4MA 4CLOA 2GM3A 3L1KA 3IOCA 4FCCA 4GYYA 5TT1A 4XB6B 2I2XB 2WF6A 1RHMA 1W0KA 3OQIA 1NNLA 4YJ3A 5A1JA 3GRAA 3T3MB 2QSJA 3V3TA 1T1EA 3DM5A 5LIPA 1E79D 1P6XA 1T8PA 2JE6A 1R37A 1YR6A 3BEOA 3IV6A 1U0TA 3URKA 4Z4IA 1IRIA 4D4MA 3NZEA 2GHQA 2EFEB 3GQVA 1DG3A 1RAEA 3PUZA 4CTOA 2MSNA 4IL5A 2AC2A 5J2TA 2VHUA 1RJ9B 1M0TA 4IGFA 5DCYA 4E2XA 1SOMA 2XMZA 3TFWA 3RARA 3TLXA 5K8JB 4JFAA 1PNOA 1JKXA 3O83A 4X95A 2JFUA 4FFOA 2R4UA 5DMHA 4FVTA 4L28A 4EYGA 4NJEA 3N8NA 1UK9A 1TAUA 3H6KA 3KPJA 1I3KA 2B61A 3H05A 3HPRA 1XAHA 1J8FA 3QKTA 1ZHFA 2R6HA 4XGIA 1KYYA 4MW6A 1IB6A 1W88B 2JJQA 2ODNA 4JDUA 5B1EA 3DR5A 3HNRA 1IJFA 1BE0A 1L1FA 1JEYA 3MAJA 3CONA 4FS3A 1ZGBA 4LF7E 1NFFA 3P9ZA 2C38B 4UVHA 1UJCA 1W29A 3B89A 1L6IA 2YQ5A 3ZYZA 1GUAA 1SVIA 1QK5A 2JEBB 2FI1A 5E9JA 2J65A 1APBA 2ROQA 1J2TA 4KP7A 5BN1A 2DH5A 1BKYA 1RSZA 4B4VA 2V6JA 3CKMA 4YCDA 5KMGA 1K9SA 4TQAA 1Z18A 4MK4A 5KWVA 4J8PA 1TI7A 3S29A 1T9GS 4ER7A 3BD9A 2YRXA 1KQPA 1NXWA 2AYYA 3W4JA 3L0SA 3LUCA 2Q9BA 4K81B 3O8QB 4JYCA 2GK7A 1TQDA 3DE5X 3GLGB 3U3JA 2JASA 1EIZA 3KAKA 1AZLA 4ADSG 3O4HA 4GM1A 3RU9A 4BC0A 2I2WA 4UBKA 4IHJA 3ANTA 4IZIA 4UULA 1IEQA 1MU0A 4KAFA 4LDRA 5E3JA 2UDPA 4PGMA 2BLLA 1YONA 2BAGA 2V54A 3EW9A 3M3DA 1QDEA 3KP1A 5AWFC 4F96A 1N6PA 1MO4A 1XD2A 1DUIA 2FY8A 4Q00A 4BV8A 4QGAA 3D7RA 3OTWA 3TQHA 1L4KA 4W5RA 5CJPA 4Q1DA 3UG7A 2FRVA 1V6SA 3FTNA 3LP8A 3PX3A 3RKRA 4LF8B 5H70A 2DQZA 1Q50A 2XKAA 3QVGA 4RADA 4GR4A 3NDIA 4BCBA 2GOYA 3X1YA 4RIIA 2GR9A 2Z3WA 1B76A 5A4DA 3EFBA 2H18A 2Q62A 2V6IA 2SKCA 2XLCA 2PO2A 4JA2A 1MVOA 2YDYA 3ZV5A 1MPTA 2I4LA 2BBSA 1OX5A 3DXZA 3C8UA 4TX1A 3C41J 1M76A 1NPDA 3R5TA 1IHUA 1T1IA 2OCPA 4ZQHA 5I4CA 1WKBA 1ZA1A 1QPGA 3HXPA 5ICEA 3TF5A 3QKIA 1Q1QA 2FW8A 2QX7A 2N9UA 3K73O 3NXKA 4FE3A 4D1YA 1E2KA 2CW5A 2OAP1 4F84A 1PZGA 4J4TA 1IQRA 2W71A 5EZ5A 3E4CA 2X4GA 3EZLA 2SECE 2VVTA 2GN8A 4J3NA 3ZCPA 2VT6A 1RYDA 3HN7A 3UCXA 4V0RA 3VI3B 1XKTA 5DASA 3BWCA 4DIMA 1ZVQA 3YASA 4BEVA 4FU0A 1H5NA 3OWXA 3IQWA 1A5BB 3C6YA 3I6ZA 1OXUA 1X8XA 1ZH2A 3O3OB 3UGKA 2BTEA 1CEXA 4AIRA 1U1IA 5TGDA 2NZXA 1YL5A 2Q27A 1KAOA 4YIKA 1RWBA 3D6JA 4H1WA 4RDXA 3GCMA 2NZJA 4C0LA 5KC9A 1J2YA 3RC2A 4QOJA 4QHYA 5FL7D 3C15C 1N5RA 1JJ7A 3AEKA 4DKXA 1OH8A 2X13A 4CG3A 1JPUA 2WKQA 1H6CA 1XU4A 2VZ9A 1N8NA 4OUKX 4TKZA 4UFOA 3RIGA 2BKLA 3R3UA 4U5XA 3WRYA 2D7CA 2ZJ4A 3PYXA 4GX0A 4LRXA 4QEZA 4EA9A 1XTIA 1PWYE 2FZ4A 2JFOA 3GRCA 1GPAA 1JTEA 2UU9B 3HABA 3JALB 2MSKA 3G9XA 2I4RA 3FGPA 3H11A 2PAAA 4UTVA 3QFTA 1IZZA 2RJOA 1M83A 1WG8A 5ILOA 3TQCA 1NBMD 2YXNA 3UJAA 3AZPA 4I55B 3K35A 1RQRA 3EFHA 3ETLA 3T7KA 2H65A 5ICGA 5J4KA 2BHTA 3T7SA 4BFZA 5AESA 1MZPA 4HLUA 2J87A 4UVGA 4ARAA 5KOJA 1F1JA 1MAVA 1T8TA 2BGKA 5D85A 3MFQA 1TYCA 5HIAA 1V8FA 1HF3A 1XTUA 1UJ5A 4M46A 2W4IA 4EW1A 2QM0A 3LLMA 3UHJA 4G5RA 2RGNC 3FKQA 1CUAA 4GM0A 1C7RA 2VUUA 2A30A 3L0PA 5TPZD 3T3DA 4IZKA 4QTZA 3S2IA 2XOKD 1V3QE 2F1DA 2FZKA 1V6CA 1U99A 1Q16A 2QGZA 3N0XA 3NHBA 3QF4A 3SE7A 3B5IA 3PWSA 3W3AA 1D9ZA 4KPUB 3RYIA 1DEKA 1NNI1 3CPSA 3FPJA 1JXOA 5JARA 3ZZUA 4ZCSA 5HP4A 1B00A 1BDBA 1JDJA 1CR1A 2JFFA 2O19A 3NGMA 3UKOA 1EIWA 2UXBI 4EKYA 1CUCA 4OHRA 4I9FA 4HV4A 3EF1A 1P74A 1KVTA 4O4LA 3JQGA 3LPSA 4DBLC 3B9BA 2EFCB 3Q6MA 1VCMA 1M8KA 4AY6A 2R6DA 2PE5A 5K6RA 4Q93A 1NI4A 3BE5A 3KELA 5EGSA 3VVLA 5JAHA 3E8SA 3O9MA 2W2OA 4OP3A 3UMRA 3RYFA 4D02A 4O4JF 1YU9A 1PJ8A 4IOJA 4KK3A 1WCIB 3UA4A 4CGYA 5M04A 3Q2IA 4IFDA 2N3ZA 2RH5A 1SVKA 3EIHA 4FFRA 4LC0A 4NSNA 4YMGA 5KYYB 1PJCA 4GRAA 1BG6A 3UMYA 5H3HA 3NP9A 5CRIA 3KSDO 4AKGA 3QBDA 4WBXC 1SHUX 3VNUA 1I6WA 2JI9A 4C2AA 1CIVA 4IDNA 1J9GA 4MCAA 4QICA 4LXXA 4AT1A 4WZBB 1U0OC 1DSSG 2OZLB 5KZMB 1JZTA 3LECA 5HS4A 2WZCA 5CCEA 3MJDA 4MQFA 4RA6A 2MHCA 1S96A 2YWXA 1K0UA 1TF7A 2CLSA 3LUGA 4GECA 3I37X 1IZ9A 2QY9A 4LX0A 2FUG6 2HT6A 4NYIQ 5DE3A 3C7TA 2Z9BA 1T5HX 2AJ4A 2JLRA 1JJBA 4BBJA 2Z1DA 4JLDA 3DV0B 1BRMA 3D7KA 4HF7A 3TX6A 1ZMOA 2VQFE 1Q3KA 3PF8A 3RW9A 3TL6A 2RC6A 5TPWA 4CLXA 3KJGA 3L8YA 4AP9A 4XWKA 1N36B 5G2OA 2IEAA 4C4TA 5IABA 3WO0A 1BROA 2GEFA 4RY8A 4URWR 5K8VA 4PS1A 2Y0DA 3OFVA 3M6IA 3WWDA 1NVEA 4OH1A 4ZT2A 4D2IA 1Z2DA 3L7YA 3KQOA 1QO0D 5DJ5A 3MWKA 3SMVA 2P6OA 1A77A 1VECA 2W58A 2JLSA 1OLUA 1YS9A 5BN4A 1GAEO 1KEEB 1Y8RA 3V4SA 1DKQA 2W2LA 4GUDA 2PKQP 5CU7A 1T25A 3KXPA 2DU8A 2IGBA 5EHQA 4JP8A 2CY0A 5EN4A 4I1UA 3REOA 2LIPA 3Q0EA 3OAAA 1CRLA 3V8NA 4MQBA 3U1YA 1Z5WA 1W47A 2IXAA 4H15A 3D0OA 1UMCA 1QFMA 4H7DA 2AS0A 1Z82A 2H29A 2IYNA 5K8CA 1TB4A 2K2QB 4GKVA 1X9GA 2F43B 5JYCA 2LIVA 3HEMA 3N2LA 3CW9A 5AKXA 3TAHA 2JLVA 1NUSA 1RXWA 3WIBA 1E1CB 1KR2A 2H1HA 3BM5A 1P3Y1 3NAQA 2VJAA 3LDUA 2I03A 4ZPJA 4ATNA 3CSUA 5K4GA 4NMHA 4ZO4A 1GPNA 2C84A 2GVZC 2O0KA 4F6RA 3M82A 4ZMSA 1PL7A 3W2FA 3UHPA 1Q22A 1I4LD 4HQKA 3UXYA 3WJ1A 2WJGA 5I7SA 1YS6A 5C1DA 4BP8A 1KEKA 4OK5A 3AHJA 2I76A 3BJIC 3EFOA 4L75A 2V5AA 3M9XA 2V3VA 1BZYA 2PRZA 3OOWA 1U7XA 3EJ6A 4D6XA 4TKUA 5CD1A 2B69A 3OBIA 4L8YA 2WA2A 2NPOA 1JV2B 3CH7A 3M6WA 4DA9A 5C46F 4P0PB 4JXZA 4MWTA 4PYOA 1XZHA 3W6NA 4YRTA 5B1YA 1AQIA 1N5JA 4H0FA 3A2MA 4JP5A 3FI9A 4MUHA 3R44A 1NV9A 1E3JA 1OB5A 4H7JA 1VMKA 3S2EA 4HEA1 3QIVA 4M36A 1U8YA 4IDEA 3NWOA 3ZVMA 3RRNA 2ZBRA 5E6SA 5HDBB 2HWXA 4P82A 5DLYA 4QXAA 3G0OA 5FH9A 1QYCA 4WKNA 1T3TA 4DUZI 2W6JD 1BU8A 5THXA 3AHEA 1W35A 4OXQA 4RMHA 5BOSA 1F6WA 4PX2A 1QTRA 4BBAA 1PL8A 4J03A 3MILA 3HKEA 2PO1B 4ALLA 2JI7A 1JI3A 2RAUA 2W6PA 2Q6TA 2P8SA 2R6JA 3DP7A 3EODA 3FMIA 4E51A 1R9JA 4BWYA 2C8LA 3KAPA 1ZCZA 4ICIA 2ZT6A 4DV5I 5CA1A 4XJVA 1K92A 1JFSA 2H4ZA 2YHIA 3LZDA 2FLVA 1V26A 4FYYA 2NMVA 3W5BA 5G0TA 1SAYA 2QHXA 3NWBA 1RM5A 1W4AA 4JBWA 4P35A 3V97A 5CA0F 1SHTX 4IMIB 4WADA 3V6LA 1JYSA 1GKLA 1X7ZB 3CNQS 3NHLA 4PCLA 1DV1A 4MUYA 4MRRA 4WK6A 1FDOA 3M7ND 1SMKA 2AG5A 2QL9A 3Q0IA 4PZZA 1HE2A 3BOSA 3EDYA 5ECDA 4KQGA 3HL4A 3HVUA 3TCNA 4EI8A 4G37A 1KZ9A 1PP4A 1AKMA 3PTAA 2XYVA 4HTFB 4TGLA 4CM1A 1XRLA 2ZM6I 2A0XA 2NIPA 1WB9A 2ATIA 2PPLA 1I10A 1KEWA 1DDGA 1OIVA 1WL8A 2DSTA 3SS8A 2XB9A 2XDAA 4GIBA 4GI5A 3CXRA 4L7VA 2QT0A 5EKTA 1C30B 3WRYC 1JQBA 4OKGA 5C0XA 4RHXA 3NH6A 1OFGA 2J32A 4WUDA 2PDAA 1XCBA 4NBRA 3JAMA 3UH0A 2RK6A 3A26A 3IEXA 3OJEA 4O5OA 1XXHB 2FKNA 4F0JA 1DO8A 4DXHA 1BJKA 3EASA 3DB2A 1R0YA 3FFTA 3P1JA 1NSYA 4K9NA 3WHKA 1Y8CA 4EHFA 1DOZA 1U4SA 4XASA 3GPDG 1DQPA 4JLJA 4M9XA 1GDHA 3GB9A 3KHSA 3WNQA 5DH9A 4KODA 1NRXA 4KZPA 1M66A 3MYYA 1MUUA 4FB4A 4QDKA 4HLUC 4C7KA 2NZ2A 5F7OA 3IEPA 2H4WA 4AAYA 4X7BA 1UBEA 2HBRA 4RX1A 3GN2A 3MRXA 1S01A 4HXGA 1TM4E 4MW9A 4QUKA 4RXMA 3ZQJA 4BJ1A 1BE8A 3E70C 4D92A 3QVVA 4F2GA 4BJ3A 1I5EA 2V1XA 4BLRA 1XZCA 4DC9A 1YHZA 3AF4A 4V3BA 1I6LA 3FYSA 2GO4A 5B55A 2PUCA 1U1CA 3EVFA 3F4BA 3I3OA 3V1UA 1GYQA 2OESA 3UY4A 4BPRA 1AA6A 3X2FA 3P76A 3E2MA 1ML3A 1RU3A 3IUJA 4OUDA 3EPLA 1X1CA 2J5QA 3V8VA 3PCXA 4J1QA 4FYMA 1SUDA 1N4AA 1ZX1A 2AN3A 1JG4A 2CVFA 3AO0B 3MA0A 1PS8A 2E4VA 5ALPA 2R97A 4TXNA 3KEMA 3VNVA 1RC0A 1SKBA 1JJAA 2ZYHA 3CR7A 4JYAI 3GUUA 4AUEA 4DMCA 4I8DA 2VT3A 2VHEA 1EI9A 3BQ9A 3EB9A 1GA4A 3HY4A 4E46A 3THYA 3P4YA 4PRXA 4X1IA 4M1QA 1YK1A 1LBTA 3LVQE 2F1OA 1KJJA 4NXME 2CKDA 2Y66A 3GAZA 3PC8A 1HG1A 3ADPA 4Y2JA 3TZHA 3DCYA 3ROFA 4C7BA 5HSGA 5I8ZA 2PBLA 4MR8B 4FNAA 1E61A 3L5KA 4ZO7A 4ENTA 3AW8A 3U60B 1QH8A 4B2YA 5KSOA 5BVHA 4IFDC 4BNVA 2JIRA 3TR0A 1WQ3A 1DJNA 2I29A 5B2EA 4KB5A 4F71A 1SG9A 2Q5CA 2RIPA 4PSCA 2JDIA 2XB6A 3PJGA 3SVLA 2QV7A 4YJHB 3GRYA 3C74A 1Y1TA 4WA8A 4HWSA 1PGJA 1UT8A 5F12A 5IVKA 1TNDA 2IHTA 3AY7A 4YASA 5JBQA 1YA8A 4S12A 4BZXA 3ZE2B 2GERA 1UXGA 2OUKA 4NU6A 3AW9A 4CE6A 2VPXA 4MSUA 1G17A 3V5RA 2AK2A 2PKRA 1SU7A 4RZXA 4F38A 2AOTB 2H5JA 5CEFA 4HDSA 2QIOA 1P62B 5GMEA 3UV6A 2XOEA 4MWOA 3PDCA 2L42A 2X41A 5EXTA 5L7TA 3GAMA 4GO1A 4HNAA 1CRPA 1KPGA 2ZETA 2A59A 3K09A 1T6ZA 4M1SA 1SCJA 1MRSA 1W6RA 4XGNA 5GM2A 3AHCA 4FR5A 1ENYA 1BEZA 2JHCA 3LFTA 2XSZD 5E9QA 3PUJA 3U1VA 5K36A 1T6NA 4C2TA 1MDFA 1NN1A 2J0UB 3VDNB 3BJZA 4AD8A 5JMPA 4WUCA 2YIDA 3R0QA 4Z49A 3CS3A 1IIBA 1IBKI 1ZNXA 1QHSA 1JFVA 3DLPX 5L45A 2P9YA 1R4ZA 2Z9CA 1AV6A 5KS2A 3PQ5A 4JBYA 3F6PA 4DR2B 3WAKA 2RHBA 5FA5A 4J3DA 4BXOA 2PR7A 1GZSA 2XJ4A 4DR7E 2G80A 3DLIA 5LZ4A 2P5YA 1P1HA 3AWDA 3CO5A 3V1YA 3D6NB 1UMKA 3D8SA 2VAVA 1ISHA 1T2FA 4P93A 4I4TF 3E8MA 2CNNA 4AS2A 4LZAA 1HNXE 2HV9A 1U3TA 1AG9A 1LKZA 3PPVA 1N4DA 4RD6A 5GWXA 5BRAA 4DG5A 3QPWA 1N75A 1G6Q1 5JEAB 3Q4GA 2GD1O 1N9GA 2RHGB 3T4UA 2YX1A 1Y7IA 1ULBA 2GK4A 3PT5A 3TZ6A 1S1MA 5EJ2A 2F3UA 2NO6A 1LQ2A 1RJWA 1ZJYA 3HWRA 2YWDA 2JGEA 3RTAA 4C22A 1DC6A 1GTVA 3AVQA 2PMDA 3DWEX 2O7RA 1I2ZA 2V4ZA 4IWXA 2IVZA 4NV1A 4Q24A 4LF4B 3SFVA 1KDPA 1PR1A 2G9VA 5K0TA 1Z33A 1PE0A 2GVDC 1YB2A 3ANSA 3G2NA 3NDRA 1I9GA 3PDWA 3ZCVA 2RGGA 3GLTA 1N0HA 2B8JA 1XLVA 3FTFA 3HBJA 3F73A 3TW0A 5F73A 3W04A 2EJCA 3U4QA 4TXJA 1CRQA 3TD9A 2BDTA 2LDXA 3V42A 1C0LA 1HQDA 1O9GA 2IHKA 3GA7A 4GOKA 1LDYA 5KJEA 1L5SA 1XEAA 4LXUA 3E03A 5HCUA 2XADA 4IR7A 3QLVA 4WNAB 5EJ5A 1ONSA 1GEGA 2HSWA 1SCQA 1UK7A 3QITA 1I7DA 2Q50A 4XCQA 5DX0A 3RYTC 3I72A 2Q4BA 1NIJA 2W43A 2WICA 2XITA 3FFXA 1Z3CA 4XIYA 4WK2B 1DCMA 4J1NA 4QD3A 1F0NA 3U9LA 3WQHA 4DTCA 2PU5A 5ADVA 2YV1A 2O8DB 3BG5A 4C0KA 1BGXT 1C4XA 1K5PA 1PWZA 5IAGA 4TUYB 2XMGA 3VH2A 5G4LA 4OXYA 1VRVA 3BE8A 1ZUIA 1IY9A 1KO5A 2CLOB 3LQYA 4AN4A 2BHLA 4F60A 1T26A 2RMKA 2JKYA 3VU1A 4ZQBA 3U7QB 2M9MA 1SCNE 3IO5A 3GJTA 4MHOA 2X6TA 1F0KA 4QDTA 2WJJA 3PRKE 1YBAA 4RBNA 5TX7A 4EJSB 2PR2A 1BIFA 3MC1A 1JHMA 4HXFB 2C1EA 3BFKA 3I23A 1QHNA 3LF1A 1L5ZA 3HMKA 2IWRA 4MKRA 4EFDA 2W0SA 4RZHA 4EENA 1GGMA 4RZIA 4BMXA 3T1NA 4ZJPA 1I7SB 4RMNA 5EMMA 2X8AA 7REQB 1U5BB 1DRWA 4QPJC 3J7AM 4AF8A 3H86A 5P21A 3UK6A 5J2UA 1FLAA 4A27A 4CUKA 1V9CA 5KTKA 1P31A 4O3MA 3AIIA 2O3ZA 4ZOCA 3ASUA 4BVHA 3HKCB 4FW8A 3K9CA 2GRUA 2ZRKA 4AG5A 5BWBA 2I8AA 3KUKA 5AOBA 3X1JA 4A6EA 8ATCA 1TQHA 2C95A 4DIKA 3LHIA 2H48A 2QDKA 2I78A 1BYUA 2L69A 4RE5A 5D5HA 4XWYA 4O08A 4LF6B 1G21A 2V2VA 3K4HA 3BD6A 4YMWA 5B53A 1YVUA 3C3KA 3K30A 3TIFA 4BO5A 3OIVA 4HGQA 3T1HI 1IOLA 4KXMA 3WV4A 5C0XC 1LS6A 4DLRA 3JAMC 4JLUA 4QM7A 5CLJA 4KNVA 4Q9IA 3N7UA 5EP2A 3LYHA 3HCEA 1GTL1 2X3YA 2AOUA 2AUMA 4QELA 3VX4A 2WKRA 3MGBA 3T9DA 1ODCA 3R3WA 2H85A 2IZ7A 4I5DA 5E3IA 3N87A 3PPXA 5T5QA 1GU1A 5A4IS 1K98A 1E8MA 1D2CA 1NT2A 4O6VA 3G5MA 1UJ6A 2LP4Y 1ODIA 3BA1A 5C1BA 2WEKA 4EB6A 4A0FA 2OC4A 3GUYA 1P8JA 3LS2A 7REQA 1PK8A 5HPYB 3RUAA 1JLSA 3LP6A 1GTJ1 2AYZA 4RK1A 3H2YA 5BO5A 2DBQA 2DT5A 4K9QA 4PHCA 3AL2A 3T95A 5K4HA 4JKOA 2V5UA 1Q7TA 4ALIA 3RT1A 1Q7CA 1ZLYA 3QELA 4AP5A 2L17A 2YZMA 2ZYDA 3BIJA 2OTCA 4ZANA 4WECA 5SICE 1H2FA 1VI7A 2I22A 1MNAA 1I3CA 4WN9A 1QJCA 2BGMA 3GZNB 3C3PA 2C98A 1NJSA 2QUHA 2ZWOA 5JQGF 2KLHA 1U3FA 5FYDA 5LQJA 1N32I 3FLEA 3K70B 2PLWA 1EMDA 1B4DA 2GPAA 1YVDA 2PH1A 4QBTA 3P5SA 4QUBA 4EGCB 1R8XA 1N77A 2DBYA 4JJFA 4ZGGA 4JI3I 4W5OA 2VH2A 2Q41A 1Z0FA 1EUCB 1PUXA 3ZV3A 5CDFE 3V7FA 1GZVA 5ALFA 4CIVA 2ZULA 4MH0R 1MC5A 4ZMBA 3OVMA 2DTEA 2FSVC 1J23A 1O89A 2D1TA 3HV2A 4DT1B 4RKWA 1LDMA 2LE0A 4CL8A 2B25A 4RANA 3PC8C 1FYFA 5ALDA 4IICA 4PVCA 3C8DA 4N48A 5FQOA 2QY6A 4INOA 3K31A 4PU0A 2VUTA 1XCMA 4IBOA 4YLEA 3W3AD 1FSFA 3T5TA 4EG4A 2Q5OA 1J07A 4ZVPA 4BY9E 2DX7A 5E2AA 5JBNA 1U98A 3PDJA 1TTTA 1DIHA 2IZOA 2VAMA 2Z04A 3L84A 1N3LA 2A1UB 3KKQA 3NIGB 1LSUA 3EGDA 4MUEA 2OBXA 4RM2A 4W8GA 2CNDA 5HKLA 7ADHA 3DVQX 5FA8A 4L6IA 1XNRE 1O0CA 3C6MA 1USUA 4E7OA 4X3CA 3HXQA 1HDZA 3NTVA 4HDOB 1XTSA 4LFBI 1B0ZA 1XV5A 5H83A 5IG2A 1RTKA 2CT8A 2IELA 3EYWA 4IV5A 4LIPD 4M2LA 3OIYA 1WXFA 1FXUA 2XECA 4MAMA 3PEFA 1NJ2A 3PUHA 4NLLA 5AXCA 3VR2A 4J94A 2PUDA 4DEYA 1GCUA 4TYNA 4IFDD 1MIHA 1TD9A 2PKWA 1ZC3A 2XXBA 4TQ9A 4PNEA 3E7PA 3GBVA 3KT0A 1T5DX 4G1FA 3K09C 2NO0A 3QG1A 3GYBA 4OXIA 4PFKA 2VNIA 3CW8X 1X7HA 4IH1A 3K92A 4CT0A 4EKIA 5CVTA 1DJMA 2ZE8A 3ZZ1A 5JSKA 4ZVIA 3U80A 2FK7A 1T13A 3LYAA 4O2BA 3CN7A 5KWIA 4JUCA 2R0QC 1GILA 2G83A 2OV4A 5KC8A 4AMUA 4PRYA 1CR6A 1EM8A 4L8LA 1C1XB 5IHPA 2BUAA 3UYKA 4IIDA 1LLFA 2GJ8A 3ZCXA 5ICMA 1M5TA 2ZWMA 2P9GA 1EFRD 1E6MA 2RBKA 2Q9CA 2MMCA 3OCZA 1Y81A 2ADMA 1VLVA 721PA 3FYTA 1UKEA 3RLIA 1MA3A 4LF9E 1WSDA 2PS0A 4R01A 2GFQA 2WMYA 1Y8ZA 2BGTA 3DDCA 5CHEA 4TTTS 4IS3A 4JBXA 5DFAA 4QG7A 3F5DA 1EWKA 1V5IA 2C4UA 3ZUPA 2R8PA 4NEGA 1P5RA 1DP4A 3ELUA 2V0GA 4XVUA 2PT5A 4WESB 2Z30A 3LPCA 3R7BA 3PYFA 4MRSA 3ND5A 4L0CA 3OTOI 1GL9B 2JGMA 2Q3FA 3GLHA 4INJA 4CKCB 5DIZA 1Z12A 1HOTA 4BQNA 1ISFA 2CV1A 2V45A 3OT5A 1JB9A 4B3MI 1QAQA 2W2LD 1NZJA 2Q3BA 3IJEB 4PG4A 2PANA 4MO2A 4IVNA 5BMVB 2OQVA 2UUCB 4BLWA 4NOJA 2R8BA 4EQ6A 4YMTA 3PXGA 4OGGA 2Q2EB 1WABA 4RJ2A 4ZCTA 5BV8A 5I9IA 3OAAD 1NDQA 2BFWA 4Y1RA 5HJ7A 3V7UA 4WZZA 3ZV6A 4E2YA 4ZCRA 2IERA 3QW2A 2NTJA 3UMJA 3KC2A 3O4IA 4WCDA 5H7XA 4DBZA 4I8XA 3OP4A 4ZZ0A 4NATA 3GWGA 1E9EA 4GNKA 2C4MA 4XH9B 1UMDB 4BZQA 1H73A 3KQMA 2C0QA 3FKJA 2Q0SA 2QUJA 2WW8A 1IPHA 4ISCA 3QLVC 2R5WA 3VTKA 2YJGA 1D0SA 3VDMA 2CC2A 3WY9A 1V16A 3SZLA 1G6OA 2CDAA 3IVRA 3QEJA 3AU8A 4R2MA 3ZCUA 3GDWA 3G5LA 1FNDA 5B3JA 3ZCQA 5A5VA 3R8CA 3HCWA 2Z4SA 3ET5A 1NHJA 3NKFA 3D3JA 3HRKA 1O95A 4S0ZA 5FT9A 3CRRA 1QU3A 3KYBA 4A10A 2R8EA 2W9XA 3AF2A 3PENA 4Q3LA 4HWKA 4ZT4A 4DLVA 1AU9A 2FN9A 2FWBA 2QRHA 1KSGA 3L0IB 5DX1A 4Q7LA 2JBWA 2JVIA 1RQPA 4XUGB 4ZOLF 421PA 1HOXA 1V9LA 3LX4A 1QZZA 5LDDC 3ZW7A 4KRFA 4LMBA 4IPTA 3U7HB 2FMUA 4MU4A 4X62E 2XIQA 1L5KA 1OROA 1P5FA 2CLLB 4H0CA 2IXEA 4ZYZA 3LT0A 3OQMA 1TK9A 4ZVUA 3PS2A 3RD5A 4MQEB 5HKBA 5G0SA 1TYBE 1BJRE 3MBOA 3V1KA 1YZHA 3FIUA 3SI7A 5JEEA 1E96A 1E8NA 1YZ3A 1ISSA 4MCHA 2REXB 5IMBA 4I9UA 4UFPA 3PPWA 3ZZNA 4HKTA 5A9TA 4B8ZA 3GEDA 4PG8A 1FNNA 4P4UA 1O54A 1XMJA 3LNUA 3TQTA 4D8TA 2GSWA 1FA9A 3F6RA 2CFIA 3QKSA 3R5HA 2ONKA 1XT6A 5E9AA 3MGAA 2QGFA 1IBLB 2GAJA 2OP1A 2AL7A 4IQFA 4PSUA 4O5AA 3ND8A 5IKEA 3OZVA 4YJFB 1OXKB 2GF2A 1P7CA 2YIJA 4CMCA 3UUGA 5CNKA 3PS9A 1FRFS 1LVUA 5EHGA 2AYXA 1MJGM 3PYGA 1P19A 3WGLA 1PT7A 5HCNA 4DR1B 2P65A 1N1EA 2FN3A 2FEKA 3IDZA 4R2XA 1E3SA 2AEEA 5B3AA 5BN5B 4B9EA 4P36A 2OHOA 4CFYA 4L15A 4N40A 1KY5A 4DSUA 4XR4A 4EELA 3C8ZA 4R40A 1MZVA 1AO3A 1VRWA 3GJQA 3TEMA 3UYLA 3STYA 2OY0A 1D2HA 1QRDA 2JIDA 3IAS1 1XTVA 5LDGA 1SUWA 3U3OA 2ZBUA 4NNPA 1XEWX 4DCUA 5EP3A 4HNTA 2IOHA 5CBKA 1PL0A 3EGOA 4NHOA 3IUPA 1OAAA 3AFGA 4PZUA 3KWLA 4EF5A 1GPYA 1A1SA 1KYQA 4WXHA 1O6FA 1PDOA 1V37A 4QWMA 4IH4A 2AI1A 2CHEA 3ES9A 1VJ1A 2H51A 1MG0A 4UCQA 5LMNE 2GCGA 4B73A 2GBCA 3AT1A 3EQZA 4RV9A 4RZ2A 2M98A 3DEAA 2AMLA 3DZDA 3R7NA 4FWGA 3Q1QA 3OQNA 4H6VA 3JQ8A 2C99A 3VYVA 2J4DA 2VF5X 3D2CA 4MWCA 4B6JA 3T1YE 4DPMA 4PGHA 2DP4E 2QI9C 4D9EA 5FUVA 3NVDA 3AYXB 3O1JC 4ZIRB 1TPYA 1X77A 1KJ8A 1U7OA 4P3NA 2BD0A 3IMGA 4YK7A 3AR8A 2CL5A 3IURA 1T34A 3Q3JB 4MR9A 1L1RA 3GJZA 1G64A 5DNDA 3TMAA 2C5GA 1JSXA 3VO8A 5TJ9A 3RC7A 4HZUA 3A6FA 3N59A 4DPYA 1A2KC 4O8ZA 3GOQA 2V3CC 3OM9A 3FUVA 4L4XA 3TQQA 3JAKB 1LK0A 2GI4A 3HE3A 2RKBA 4M3NA 3TM4A 4LBZA 4ZO8A 2RI1A 4BGDA 4OGFA 2C3OA 4IYJA 3PFFA 2OMEA 5DM70 3R6TA 821PA 3O7WA 5JWHA 3OSZA 4X65E 1Z0SA 1F0PA 1CS0A 1JTVA 1Z0AA 3HG7A 4C3ZA 2YJZA 3LXRA 1U1FA 1H0SA 3SN6A 4OU4A 3IP1A 1P7WA 3VTAA 4R3UC 4AZ0B 3STVA 3AHHA 4GMGA 4C5AA 1Z59A 4DNQA 1JNYA 3KPUA 2GKGA 4DVGA 3W6PA 1L3IA 4XDHA 3U4DA 1A4IA 2W6QA 2PYZA 1XR3A 4NV0A 2UKDA 4XQCA 3JVUA 1PVGA 4G07A 1AKVA 1YVRA 3DBOB 3BREA 3IUMA 3W2HA 2FPXA 4GVPA 5AVXA 2AKAB 2WSYB 2QN3A 3O5AA 1AGXA 4Q3EA 2BGUA 4YP7A 2IYAA 5DYTA 1CW2B 4I5IA 2IY9A 2P11A 1KKMA 5FLYA 4JBNA 2UUAI 1BNCA 2AX4A 3TCXB 2OCBA 1WP9A 4JVMA 4TWIA 3NHAA 3PE6A 4F4IA 2IUTA 1QP4A 3H1FA 2ZUVA 3LBYA 1KDOA 4PXAA 3EFEA 2NPIA 2CV0A 1M9NA 1QS0B 2JDID 4LX8A 5JIBA 3USZA 5ULLA 5REQB 3TSCA 2BZSA 3HFSA 4IDFA 1GGNA 1PNTA 2VDRB 2AKEA 1EE9A 5KVAA 2DVMA 5ALYA 1TZ2A 3E81A 3HBAA 4KN6A 4V2UA 1MFZA 5CT6A 2VI5A 3OM0A 3SNKA 2FQWA 3G89A 1J2EA 1I3LA 5M3BA 3Q40A 5LYJF 1GHTA 4HSGA 2IYSA 4X66E 5IWAI 2A9PA 4XIGS 1HM5A 4UCFA 1E32A 1H9BA 4ALMA 3PNVA 2VA9A 4EVIA 1KR5A 4GS5A 1D4ZA 1ZK2A 2YOFA 4HNGA 3L5OA 3K0CA 3V9PA 4V0SA 2A78A 1UZUA 4TTJA 3VKUA 3ZY2A 4CMIA 3LY8A 2WV9A 4F5ZA 4BTLA 1Z5BA 1L7NA 3QE9Y 1NVFA 1ZUHA 2Q8NA 4FE4A 2D0DA 5ELLA 3TI7A 4OD0A 3CLKA 3AJ8A 4ZO6A 3LA8A 4TTVA 4WEOA 4M89A 4BDSA 1QOZA 3TVYA 1X42A 4BTEA 1W46A 1V9SA 2Q29A 3CCFA 4H6PA 3T34A 1I30A 1VA4A 4F3TA 3TZEA 3DMPA 4BRWA 2RHMA 1QONA 4IZOA 3PQEA 4RD0A 4Y6QA 2ZRJA 1T9ZA 1VKJA 1JG6A 2BDUA 3ABQB 2IYFA 3A3KA 3IESA 3L7AA 1DBIA 3C3EA 4CEIA 1QZRA 2OORC 3HFGA 5LCXA 3JY6A 3C5HA 2Z2IA 2JHPA 4URVR 3HCPA 2C7OA