1Y6ZA

Middle domain of plasmodium falciparum putative heat shock protein pf14_0417
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
242
Chain Sequence
PIWKQDEKSLTENDYYSFYKNTFKAYDDPLAYVHFNVEGQISFNSILYIPGSLPWELSKNMFRGIRLYVKRVFINDKFSESIPRWLTFLRGIVDSENSKMLSIINKRIVLKSISMMKGLKETGGDKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEFYSINSGDKKTDLDSYIENMKEDQKCIYYISGENKKTAQNSPSLEKLKALNYDVLFSLEPIDEFCLSSLTVNKYKGYEVLDVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords heat shock protein, putative
total genus 78
structure length 242
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y6zA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y6zA02
1Y4SA 3HJCA 2GQ0A 2O1VA 3PRYA 5FWKA 2O1TA 2IOQA 1USVA 1Y6ZA 2CG9A 2O1WA 2O1UA 1USUA 2IOPA 3Q6MA 3Q6NA 2CGEA 1Y4UA 1HK7A
chains in the Genus database with same CATH superfamily
4N0EA 4B7UA 4MO9A 5C34B 2KPOA 4MV4A 2HIAA 2WJAA 3WYEA 1QQBA 4IHKA 1WE2A 3KAKA 3ZGOA 1PZNA 2OENG 3L8YA 3ZU4A 1EE2A 4BCCA 5BNZA 5BV7A 4YCDA 1JZTA 5JQGA 3RC8A 3O92A 3DXZA 2WUFA 2OOSA 1SKUA 4YPFA 2EZ4A 4EI9A 4OXQA 2UVPB 1U8XX 1PGNA 4YAUA 3R9WA 2NO0A 1JNXX 2QRLA 4H17A 2W00A 1NW9B 1UPFA 1ZVJA 3QFSA 3GLIB 3NYWA 2QBYA 2Q1XA 2MSEB 3AW9A 4RSMA 2MHCA 4ERXA 3RAEC 2XUDA 3AP2A 5E0OA 3UATA 2YWGA 3HPRA 3VNVA 4L7QA 3TQQA 3BE5A 2ALJA 3NIWA 2VPYA 3AFGA 1KS9A 3U1KA 2IYFA 4LRXA 5FOVA 3KB2A 5T64A 3MBIA 5JCPA 1UDBA 1YVUA 3UW1A 1I9GA 3PE6A 1BDHA 2XT9A 1REQA 3QTTA 5BWOA 4JBNA 4P08A 4J2TA 4QDKA 3LUJA 2OHJA 4HN2A 5F9FA 4KPUB 3ZQ6A 1GRVA 4P80A 2PH5A 4WH0A 3HL4A 3LVBA 1M2VA 3GEHA 4GFDA 3IVCA 2OGWA 1KYVA 3P4UA 4HI0E 4QOHA 4ZEOA 4YRQA 4UEQA 3NONA 1L5KA 3REQA 4WXEA 4DDHA 1QTIA 2AUMA 1IM2A 4LVCA 1TX4B 4LSZA 1UXOA 4I46A 2VYFA 5DM0A 1KU0A 1W1IA 2QVZX 4UU1A 5FTNA 4ZVPA 3WGGA 4N3CA 5HM8A 1NWHA 3DB2A 3OAAA 3R3UA 1R27A 1WPRA 3PXGA 3TAXA 1OYOA 2NVBA 1DKOA 2JD2A 3OTIA 3K9NA 1VLQA 1KAEA 2CCJA 4TXNA 3H1GA 1VE9A 3IBGA 1AB5A 1UH5A 3M6FA 5G40A 4ZCSA 1E1RD 3RJZA 4B7CA 4DCNA 1BX1A 5SZKB 3RABA 3PD0A 1V8FA 3DKKA 2DUNA 2PIAA 4Q4CA 4YRNA 2NSYA 3KC2A 1ZONA 4IIEA 2P40A 3LVRE 1PZGA 4ZZ2A 4OEHA 3WGKA 5EHQA 5HNKA 2XXBA 4HFNA 1SURA 1ISPA 3W8FA 4U8GA 1EP2B 2VG8A 3HCPA 2ENUA 4G8DA 3D7KA 4B45A 4PIVA 4N7JA 3QNMA 4V2UA 4CKYA 2O9JA 3L02A 1RJ9B 4KYTA 1C3OB 1QWOA 1K8XB 1OA0A 3M33A 4UE3S 2RHCA 3ZCSA 4LFCE 2IEBA 4D02A 4ER3A 2O8EA 5G0UA 2DRIA 3ESXA 2X36A 3HULA 4X65I 1N7GA 2JZOA 1ECPA 4NYIR 5COAA 4F8YA 4X8LA 4FC6A 2IDKA 3COPA 2NU7A 3NW9A 2A9OA 3GYGA 1DLIA 2VCHA 3UH0A 3DYIA 1UT8A 1ZY2A 3G89A 3LWDA 3QW4B 4HUQA 1E5QA 3G7UA 5B6JA 1JEAA 4GF5A 3X2FA 2E85A 3D6VA 3Q0IA 4J4HA 5J5AA 1KWGA 1FJGE 4KMRA 5KNLA 4GNRA 4B7AA 1TEHA 2CFTA 1Z25A 2PGXA 2AN9A 4JJ8A 4EUFA 2VEDA 5CEFA 2LCFA 3RT1A 3OLYA 1Q3TA 1M2OA 2C2HA 2H4HA 3D8BA 4NFHA 2J9YB 2W2KA 3DFIA 5LXTF 1QBGA 2X1LA 4IGIA 1GT6A 1LW6E 1XF9A 4NJEA 5SICE 3RYTC 3UWOA 2HD4A 3RNLA 4C0LA 1MA0A 3EDCA 3HI6A 4JG4A 3KKEA 2AJ8A 3GGPA 1JLMA 1Q12A 2KS6A 2IYXA 2L19A 3GR6A 1KETA 3PUXA 1ZH6A 4PNHA 4AECA 5JFOA 4B6PA 4MJXA 1SXGA 1RXVA 5TPWB 1CQJB 5CG1A 721PA 2R2GA 1AQJA 1D6JA 2H59A 1E99A 5DX1A 3NG1A 1JN0A 4C4TA 4IZOA 2JI6A 2X3YA 3A6HA 5J63A 3NWPA 2XGMA 1U3DA 5IXSA 4CF7A 3QBDA 5JYCA 5I4IA 1SRRA 5BWBA 2A33A 4K05A 2VQFB 4XKJA 2PTHA 1TMKA 3LUHA 4J6EA 1OI4A 4XUDA 3R7NA 2C1ZA 3LX8A 4DJEC 2BFEA 2ZR9A 3NWOA 1Q7BA 5G41A 3BULA 2WHPA 1O0BA 3C14C 1KFJB 4H1VA 1EP1B 1MU0A 2D5IA 3L5KA 4P5DA 4Q15A 4W5TA 4COKA 1VSBA 3GWZA 4B17A 4LK2A 3A9CA 1A9ZA 1GU7A 3OT1B 1USGA 5KNBA 2OB1A 2VQEB 1CUUA 5TEWA 2CL5A 2CD7A 1S8NA 4P92A 4BJ5A 3F73A 1Y1TA 2IHNA 2HRRA 4IZJA 3T1HE 3KXIA 4ZHQB 5KNDA 4S05A 4HEHA 2Q1YA 1ECJA 2YFKA 1GNTA 3M6XA 1J8FA 4G0WA 1BHJA 1J7KA 2MT9A 4LJAA 4C01A 5CDYA 1YRQA 2V2VA 3E5NA 1CY4A 2FPGA 3M4XA 5BSGA 3BWVA 1GAXA 4MOWA 3QYAA 5KTOA 1T15A 1J5PA 3P0EA 4WV3A 5JAHA 2GBFA 4M9RA 3JZDA 3G9TA 2AI2A 5KTYA 3G5UA 5C46F 2ZQ5A 4X85A 3ADBA 3RFUA 2J0UB 4WESB 4PLYA 2O2IA 4E70A 2J0UA 2DJIA 3DTYA 4HB2A 1WCWA 4WESA 5JI2E 2J4CA 4AWXA 4HXGA 3V2UC 3TRKA 4C76A 2E4AA 4GRAA 3ITEA 1DCFA 1EM8B 2R97A 2NT3A 4G24A 4YHHB 1UMDA 1AQNA 1EEXB 1C3XA 4HAIA 4ZQHA 1Z5BA 5FB3A 2JHCA 3USES 3ECCA 4UBKA 2XMZA 3DMTC 1OWPA 4WE3A 3RYHA 4UE6A 4DJTA 3JD3A 3AI7A 1T5HX 2B2XA 3EOBI 4DMRA 1ISJA 3KQVA 4ITRC 2HMVA 3PC7A 2JGDB 5HS4A 4EKEA 4M87A 3HJCA 4X20A 3S1AA 2GEVA 1MPTA 4K0RA 5K09A 4CDRA 1PR2A 4GXQA 4PG7A 4HJXA 3OJXA 3VKGA 1I80A 1F8FA 1VHTA 1RWVA 5FFMA 3U7EB 2WKRA 3ZIDA 4JASB 1JHYA 3C87A 4NYJR 4KXNA 4O1HA 3SNHA 3SHWA 1GEGA 2G7ZA 1AQYA 5IMBA 1JG2A 1EFVB 5K36A 1HM5A 2IHYA 4M0FA 4QT4A 1I2DA 1W73A 1WU7A 4AKTA 2XCQA 5KX5F 2ZRAA 4CLOB 3I53A 1COZA 3SX0A 5K8IA 1A6FA 1I2AA 1ZJ5A 1H73A 5K8JB 1T9ZA 4Y9RA 3LKZA 1JHRA 2QTFA 1HQDA 4JJFA 1QV6A 3BA1A 1TTPB 2I7CA 3C0KA 1QNFA 3A1WA 1THMA 3DEHA 4XAQA 3V7YA 2Z5CA 4BKOA 3JQPA 3ND6A 2B9EA 1LTHR 8GPBA 1OXXK 2QU8A 1ML4A 2ZJZA 4UVGA 3UEOA 4DBZA 5D5QA 1UEKA 1SQGA 3VYUB 4QFCA 4EKGA 3OU7A 1BX0A 3PDIA 1F3LA 4ZQCB 4BU0A 5DX0A 1CY6A 3I9MA 4L4ZA 5AWFC 2O2JA 3ZU2A 3CX4A 2FXVA 2B7LA 4LJ4A 4P3PA 2XMCA 3RRFA 2QGFA 4V39A 1JLLA 1HYQA 3QJ5A 4R1TA 1SAYA 4IHJA 1TM1E 1L5QA 3B70A 1Z4NA 1OXTA 3O8BA 3K32A 2BR3A 5JD6A 2XYGA 2EP5A 2C5BA 2WD8A 4R01A 2QN7A 1H66A 5AVOA 4N5HX 4WQMA 3E1KA 2P5SA 1RPNA 4MB2A 5JZOA 1NV9A 1TLTA 1XCLA 4GZMA 5JO0A 5ICMA 5LP6A 4BO8A 4P0QB 3ILYA 3WQQA 5F9HA 5LMCA 1XZFA 4DA6A 2BFOA 2HBQA 2RHBA 4C05A 4C4OA 3OJ0A 1QGYA 4MWBA 4QQRA 1LSSA 1PZXA 2RH4A 1MEJA 1PJZA 2VDMB 4MARA 3AHHA 4KQHA 3PE4A 1QZXA 5D3MA 1DAEA 1JHPA 4KAAA 3H5OA 3PG5A 4NFSA 4AZTA 1PJTA 1UMBB 3GFFA 1EA5A 1C30B 1JGTA 4RZHA 1VIYA 2BKVA 4I14A 5TB5A 4CRWB 1LF5A 1AN9A 1NLUA 4GSLA 5IWAE 2DPLA 2UZ3A 3I0MA 3PVSA 4GUDA 4P4LA 4CM9A 1KDPA 4UHBA 1EXVA 5G4KB 1FSSA 3W5IA 1SPBS 1F8XA 2RAPA 2OAP1 4IV5A 2GPSA 4GICA 4WINA 4YC7A 1SU7A 3L7NA 4MW0A 3RS0A 2XMDA 4AKHA 3LAWA 1P44A 1Y4AE 2IXDA 3MCTA 4B4DA 1D6NA 2IFTA 2V6JA 4RMIA 1QORA 3MWFA 4IH1A 2VBIA 4E2WA 3SYNA 3R3JA 5DSZA 5A4MS 5E95A 5DJ5A 4IHJF 2H57A 1US8A 2XB4A 1ZLYA 3R4VA 1T2UA 1G21A 1YCFA 2DPYA 4IZIA 4JJ7A 2GD0A 2EX1A 1USWA 1LB1B 2YC4C 4ISBA 4OQQA 4XCXA 5E7IA 4AKSA 1E9RA 4MV1A 3ZWBA 1Z7GA 1XYYA 2CKMA 3IR6A 4IICA 4AY3A 5JEAC 2OFFA 1TT5B 4MVJD 1SQ6A 2WLSA 5KOJB 1H6DA 1XDDA 1U2TA 3PL5A 3DTVB 1UJ2A 1TM3E 4NU8X 5J4LA 4IQGA 3AX6A 4N82A 3N5KA 3Q1KA 4Q4AB 1K6IA 2LR0A 3P2JA 3L1UA 3FROA 2AC4A 2V7EA 1H93A 4AVYA 5C7LO 1T1IA 1QNLA 1DL5A 2FG7C 2FW7A 1N5OX 1PO7A 1Z18A 1V11A 4BVKA 3DEKA 1NULA 3MGGA 4C0JA 1RDFA 2VHUA 3DUWA 1EIZA 3HKMA 3NHAA 5DTJA 2HPHA 3NB0A 4JI2E 3HY4A 3IQGX 4ER7A 1KI1A 4KWCA 4U1RA 4K0KI 1IRIA 1W34A 2XMBA 1A9YA 2C38B 1I4TD 1GPYA 2Q6LA 3DE5X 1HO3A 3G9QA 3R3HA 4II7A 4Q12A 1TEVA 3PHIA 4YCCA 2PKXA 2P68A 5KQPA 4R8KA 4GVXA 1X13A 1Y6RA 4TTIA 3L7AA 3TR5A 1CQPA 1JPNA 5AHKA 2AWOA 2OZPA 3B1ZA 4CKBA 4UPVA 1FEZA 4RW0A 4KR2A 4HACB 4JUFA 2JEAB 1BMDA 3BE6A 4EDHA 1Z22A 2H2WA 3H18A 4PAWA 2OCKA 4LJ6A 4NU6A 5EE5B 1FMCA 1Z0TA 3LLVA 1Z68A 4JT2A 4L9RA 4WBXC 4MGHA 2IYWA 2R79A 3MMNA 4H27A 2OZEA 1ZMXA 2FTKE 4R9VA 3PC8A 1ICEA 3PFHA 2I55A 2WD7A 4A8JA 5F2NA 3IJ5A 1GUAA 3RUCA 2BUCA 2PM8A 3CA8A 4YRRA 2IWHA 1LV7A 2N9UA 4ACBA 1JKXA 3ZWNA 1TKBA 2O2GA 2OORC 5T67A 3ZI0A 1C9KA 1Z7BA 1FRVA 4GM1A 3J80C 4H6WA 1XXHB 2JNWA 3OEHA 4R51A 1E4EB 2B5WA 3OM8A 3IP7A 5CCXA 3KYCA 2QVLA 1Z26A 2FZGA 1B4DA 2GJ4A 5EZYB 1T0BA 3DBRB 4YAJA 1SOWA 4EAQA 1OYPA 2VQSA 5FA6A 3F71A 4XVUA 3NANA 3R8XA 2YWCA 3WRYA 1MX3A 4E6PA 2I1VB 1Z3CA 1J0XO 4DV2E 3RYFA 3UHAA 3JQEA 3SS7X 4O4HF 3U7IA 1EGMB 3DUFA 3QEAZ 2CNOA 5AJWA 5F4ZA 1D4AA 4EY3A 4HFMA 3VBEA 1HDYA 2JFOA 4WFIA 3A06A 4JX8A 5AP9A 1GN8A 2SKEA 2VOJA 1X7ZB 1IULA 3DL7A 4ZEVA 2G88A 2QA5A 1JV2B 4I1RA 5EKWA 3BICA 2H1LA 1XF1A 4F4DA 4RZ2A 2WDPA 4Q4LA 1BN6A 4K8RB 5EIFA 3VR1A 3BXEA 3BCHA 4XTCS 2F1HA 4I55A 3HLYA 1U9IC 3CT4A 2QROA 2IPOA 3RYIB 5FEUA 1WB6A 3IR5A 3KJXA 4GQAA 2J09A 4ND6A 4GM4A 3FI9A 4DUPA 2W90A 3SQNA 2EFHB 2P91A 2BA0D 2E4WA 2NTVA 1UBUS 4EDFA 4U2KA 2A9PA 3AR3A 4K87A 4RK4A 5AK6A 1Y42X 1Z5PA 2AZDA 3ONEA 1TCVA 4Z4EA 2NO6A 1AUQA 1WLYA 1IAVA 3MFQA 4BO9A 4IDNA 4EW3A 4IIVA 5CFPA 4KMOA 2PVCA 2W2VA 3OZCA 3L7MA 4DRXB 2FEOA 3NJRA 4KYUA 5C51B 4IRMA 2QLMA 2YZGA 3MEQA 3AM4A 4DADA 4Z1MA 1C8BA 1Z34A 3R3SA 1K6EA 1NDQA 2HXYA 2JFVA 5JSKA 5I3ZA 1VCIA 3UJDA 3WHIA 1H22A 1SXJC 2PMDA 4JR0A 4DG5A 1KEZA 5DYGA 4X64E 4ZIRA 3II6X 1ZVKA 5JEEA 4JI0B 4LZWA 5FYDA 2Z8ZA 4B1FA 1NXQA 4FTWA 3K5HA 1T4CB 4WADA 3UT0A 1HE3A 3VPDA 5CDGA 1UANA 4OX9B 2MSLA 2OAEA 1BX3A 1PX2A 1XTQA 3N9IA 3ID6C 4K5QA 4GU5A 3PITA 1GQRA 1FXSA 3UTDA 1WPXA 5BW8A 5GADl 5I7RA 1GGJA 2E18A 2CUTA 1SD1A 1GARA 3TMKA 4RSHA 3IDZA 4UD2A 2NOAA 3ENQA 2ZWOA 3KQMA 4DBLE 5A1TA 4OYYA 4JLVA 3S2ZA 3WX0A 4F2PA 3KZNA 1RJEA 3EY9A 4GVPA 4RENA 1X7XA 5KOYA 4YUYA 1U0NA 3TLKA 2A5GA 4M0EA 3KWMA 2XUQA 1WVGA 4AL4A 1ZN7A 4FYMA 4Y30A 1XK7A 4M0LA 4UQLA 4OGWA 3HUFA 5LWHA 5AT1A 3OJWA 5YASA 3VA7A 3S6JA 3MG9A 3WK8A 2P2YA 2JFQA 4FEYA 4R6WA 3OESA 4JYCA 3LKDA 3H42B 4AJ2A 1EX6A 3CPJB 2P9QA 1NWCA 3N8GA 1XPRA 3EEOA 4LZZA 5DHRA 3B51X 1ZI9A 3FB1A 4NABA 4GRIA 4FBGA 4BQSA 2GZSA 3MK31 2WWHA 4CQMA 3NKLA 1K8QA 4X00A 1DTWA 2HWKA 4D1YA 1TA9A 1W52X 1PV4A 2ZPUA 4M86A 1H0RA 1Z12A 2QORA 3RHSA 1OT5A 1OXSC 4D0SA 2ZRIA 2AQHA 3M3DA 1DDOA 1AKEA 3GUZA 2ZJ6A 4QEKA 1J2YA 2GEDA 3AJRA 2YN4A 1VLHA 1KI6B 2PSSA 3ZQJA 5LIRA 2B37A 3OUTA 1IBMI 2CL7X 3HJUA 1HKHA 5KVSA 4RJKA 2C5GA 1CTQA 4LA4A 4JI2I 2PBRA 3GDWA 1B2RA 4RGQA 3ETEA 1RYYA 4ZDIA 5ERYA 2LP4Y 2Y1XA 4D9CA 3GFOA 2F17A 1L3CA 1VPTA 1N5DA 1Q7RA 2BGUA 2O8NA 3EBLA 5BN4B 2ZJ0A 3RW9A 3E2IA 2Q0SA 1A8QA 2FJPA 3UV3A 4ZEWA 4JI7I 4DB4A 1C4KA 1MOZA 4E5UA 1M0TA 3DXYA 4W7SA 4BVLA 1BRMA 2UKDA 5ABPA 1VYHA 4XGNA 2A5DA 2OBXA 2FKNA 2VHVA 3UGKA 3KOOA 3R77A 4JU8A 3A32A 2Q3DA 2X8BA 3G88A 4WUTA 4DG8A 1Z0KA 5H4GA 2QENA 2UUAE 3Q3EA 5BVGA 1K66A 16PKA 1OGYA 2Q3CA 3BCUA 3NHRA 1OGIA 4LRYA 3CRQA 4M3NA 2X7HA 2IGTA 2EOAA 2YHAA 4L02A 3F4LA 1IEQA 2D1YA 2ZYUX 3OBIA 4LI0A 5DCYA 1WW2A 5FJIA 4TVSA 2TMYA 3C5WP 3ITDA 3N2KA 5DSXA 2ZWAA 3D4OA 4TTJA 5J23A 2TECE 4ZZIA 1QYCA 1DIGA 4I9HA 4F12A 2GCEA 2YXLA 2OC4A 3GF4A 3GLLA 4ND2A 2Q6OA 3HLTA 4UXJA 4FCCA 2CXTA 4D6YA 1LDBA 2WJWA 3KJEA 1O8BA 4XPIA 3UW3A 4CR8A 5JAOA 1Z0FA 5HA5A 1WV0A 2D1FA 3HL0A 2C2MA 3GARA 4U7GA 1FB5A 3D8UA 5G53C 1UEJA 1L7QA 1VJTA 1YNOA 4WGFA 5U4QA 2Q4RA 1CIJA 1NMYA 1MIHA 3DG9A 3PBKA 1Y48E 1K8RA 2EFGA 3B20A 1TJNA 1P0CA 1TMYA 1Y8RA 1CQIB 3K0CC 4Q37A 3STHA 3TEFA 2V97A 3NYIA 3UAYA 1L7BA 3BE8A 1JIVA 2J4FA 2M1XA 5BNFA 1VTKA 4DR5B 1WQ4A 2FPRA 2HJSA 5E4TA 2P5YA 5HP4A 3AUXA 1XEXB 4LV5B 1CG6A 4A10A 1TZKA 3R1IA 4DLUA 1F7VA 1R12A 3A6FA 3KJQA 5IBQA 4PAMA 5LMNB 5GWXA 4F60A 1DS6A 2C4VA 3V48A 3A1FA 4YLGA 1YDMA 3AGPA 4FZ3A 3VQTA 4IZJD 4JI6B 1NRJB 2WPDA 3OQPA 2AJDA 4AJEA 1WMBA 2P1ZA 3EUAA 1R6TA 3DZGA 2A8YA 3O84A 4FP9A 4IH9A 4MINA 3ZGYA 3S44A 3F9CA 4AUEA 2YOGA 4TQGA 3WAJA 5KAMA 1T2AA 1YQEA 3C8DA 3L43A 3BKXA 2EEZA 1MNQA 2E6UX 1BJTA 3M5CA 1PVDA 2X13A 3VR2D 5EXPA 4L6AA 4R7GA 3RH0A 1UWKA 5GONF 1XO1A 3LW7A 3G0OA 2EKPA 4B8ZA 4KR9A 4MU0A 4M1SA 4UOQA 2H2GA 3RS4A 3VSAA 1VKOA 2AF3C 3GV0A 3O47A 3KSUA 3PI7A 3W78A 1I1HA 3U61B 1N78A 4HVAA 3AQIA 1RKVA 2GVDC 1T2VA 1AK2A 1XL0A 3VBCA 3AEUA 4CCWA 4RKYA 1VL8A 2ZRFA 4YALA 1ZOSA 3QXCA 2C82A 4CQJA 2O3RA 4YMWA 4LECA 5CFLA 1BAPA 3RTEA 4TXLA 1FTSA 4YR7A 2FZVA 3GH1A 3D7SA 4URYR 2UXBI 2QT9A 1V1RB 2XMSA 2Z2KA 2NV0A 2I54A 2QY9A 3FWPA 3IIKA 2JLYA 3ND5A 1CF2O 4LG1A 1VRVA 1EDOA 4CU5A 1TK3A 1O94A 4I50A 1LPMA 2IHVA 4QUAA 4GPAA 3LC0A 1F6WA 4UTGA 1RKQA 2QJFA 4IR7A 4JQCA 4I3GA 4YRIA 4YV2A 3LGSA 1LPNA 1Z17A 5CVCA 2ZSKA 3RSQA 1FIUA 3VGJA 3PWTA 4HB4A 1HNZE 3UHMA 1G3IA 1ODLA 1P4GA 2GRAA 3FUWA 3MT7A 2J7PD 3C7TA 3QPCA 3I3OA 3FFAA 5H16A 5HJ5A 5GONA 1XJCA 5CJPA 3UICA 3EGIA 3CZAA 3NM6B 3ET4A 4UVHA 2JJYA 3KV3O 4MS1A 4OB6A 1RRPA 3T3MB 4CIXA 2XOXA 2H3EA 4EEZA 2B1QA 3BTOA 4GKKE 3H1FA 4F21A 1WEKA 3QXGA 2ZBFA 2UXDE 1KYWA 1K3TA 4PCLA 2GTIA 4DJFC 1H5QA 3Q5DA 4A0SA 3E0XA 1F9AA 2BOVA 5MHTA 2ZBGA 4WECA 5HYVA 3PJDA 3TL6A 2D00A 1LW7A 4B46A 2VS1A 1MG7A 3IOEA 4AZ3A 5HTOA 1SCJA 4NH0A 3ZWKA 5FBVB 5I47A 4S1PA 1NKTA 4PSVA 1MU5A 1EX7A 5A4JA 3W7AA 3SQOA 4MHTA 1FUYB 1J7JA 1K97A 4L22A 3QX9A 1ND5A 3DMTA 3WGIA 3H11A 2VPTA 4Z5XA 5KREA 3EIEA 4AJ1A 3G2IA 4TYWA 3UWMA 4AUNA 1BS9A 2ZI3A 3HH8A 4OGFA 1LRJA 1MAUA 2O23A 3HA5A 1EH5A 1G0NA 2BZGA 2RE8A 3FHOA 1HMPA 1USKA 2A5FA 2V58A 3N05A 2GA9A 4XYLA 4MKFA 5B58C 4PXSA 3TRHA 2HCBA 1ODIA 5F5XA 1HEIA 3J80Q 1CE8B 1DIAA 4YY3B 5FX2A 4B3SI 1YS4A 4J7AA 4D41A 4ZI5A 5JECA 1NJ2A 4P93A 1E62A 3EH2A 1NVGA 3JYOA 2WHEA 3REFA 1O87A 3LBFA 7ADHA 2NZXA 1TIKA 1JAYA 3KELA 4PRLA 2JE6A 4C08A 1ZNWA 1GR1A 1US8B 1EB8A 2JE6B 1T1JA 1Y60A 3PGA1 5D6NA 3SYKA 1UZMA 4NQRA 3CVVA 1QKIA 1S3IA 4TRNA 4MDFA 2X1HA 4QAQA 1X1RA 3KS9A 4Y2YA 4LC1A 4EELA 3U7RA 4OX9I 4Z0HO 1YK1A 3WHPA 2R6AA 2VJBA 3PYMA 4RAQA 3K2IA 4JI0I 2HSGA 1R74A 2ET6A 2VRNA 2Z8XA 3CLKA 4M98A 4PLCA 1FMTA 3ZJ4A 1KO7A 4YR9A 1NM5A 3GAMA 2RHTA 3HN7A 4D99A 3THXB 2QS9A 1JSLA 4P84A 4UU0A 1K7FB 4B7ZA 2IXGA 1JSCA 2IIVA 3D9QX 2HRDA 2WOJA 3R3XA 1GTMA 3BGVA 5G0VA 3NHLA 3PHCA 3K6KA 3ANTA 4FNOA 3WU5A 2IH5A 4LBYA 5K0CA 1QFJA 4E5MA 1YI8A 1H2ZA 2WKSA 2JEBA 1U0RA 2B25A 2I76A 1PIWA 1VL1A 3LCVB 3C2QA 5EZYF 5IVIA 1IMOA 4TXHA 4CGZA 2ZJ4A 3FPLA 2PGOA 4MUGA 1E59A 2VA8A 2IE0A 3OFKA 3R5JA 3SM3A 4AJOA 4UAGA 4Q3EA 4A2PA 2IYLD 4AO6A 1Y9AA 4MQFA 1ILEA 1IY1A 1VJCA 1UXGA 4TKMA 3WKCA 5E9WA 3SEZA 4DPWA 4TN5A 4J3NA 3Q7PA 2YOFA 5UKDA 5BN1A 5KQGA 1QGUA 3K0AB 1Y6QA 1QHEA 1KKUA 1SKQA 4OAQA 3KQLA 5GZ6A 2DHQA 1WAMA 1H0SA 1EVYA 3KKNA 5ESWA 4RESA 4A7PA 2RAUA 1L3IA 2Q29A 3I4CA 1CVIA 1JI0A 4QJ4A 2W58A 3N7AA 4LOJA 1AKNA 2C4TA 2NQ8A 4R41A 5CT6A 4DLLA 5AIBA 3WE7A 4NXMB 1I36A 3IEMA 1W93A 1JA0A 2J3KA 1RYFA 3PFFA 1XTBA 5EE0A 3BORA 5HQJA 2AK2A 2YJ5A 2UV8A 2HK7A 3GPIA 1X9GA 3JPYA 4M22A 3MYRA 3A2NA 1KPIA 3OE7D 5JBNA 1H05A 2NN6B 3A4IA 1IN4A 4F86A 2W0SA 5JEDA 1GNSA 1HTWA 1XMVA 1Q0SA 3G0CA 3ZVLA 2FETA 4IOKA 6ABPA 3BMCB 4BA1B 4RV9A 3QVTA 3UM9A 1OBOA 1OX5A 3JQ9A 5GJWC 4PFJA 3IKVA 4NU0A 1H23A 5CYPA 4CN8A 2LTAA 2ODWA 1KZGB 3PUIA 1MABB 3TLGB 4RFVA 2AD1A 3MWGA 3LO8A 1E1QD 1DQYA 5DRRA 1AUXA 2H4WA 3EOAI 4O4LA 2BA1G 3NJ4A 4WLVA 3V6LA 2HNBA 7GPBA 1T4DA 5BSWA 1ZD4A 2HFKA 1ZS9A 4W5OA 1XPOA 1OJ4A 2IEIA 3T1VA 4ZI7A 4Y2TA 3BIXA 2PAFA 1EKXA 2EHDA 3PCRB 4O4JA 4RL4A 1KGDA 1P1HA 1NJ6A 5FNVA 4OLBA 3C97A 3CF4A 5E8RA 2A14A 3C6XA 2B9VA 3EPRA 4X92A 3FDJA 2CYAA 3H5LA 1IN8A 2I22A 1UP4A 3SCZA 2OV1A 4LFAB 1ST2A 5DRYA 3W1EA 4YT4A 4MR7A 2G4VA 4RHCA 5BV0A 5MN4A 5FA5A 5I9BA 5D6OA 3TN7A 3W2FA 2D8MA 3DBLA 3KE8A 3JRXA 4UVIA 1J5EE 4CKEB 2WF8A 3PWSA 4NZPA 5E6UB 5SYAA 3ZV6A 1EWVA 2G9RA 2O8VA 2VL7A 4B6FA 4HUQB 4IIXA 2QG9A 1YUNA 2Y05A 4P98A 2P2ZA 2YW2A 3ZIUA 1TQ4A 4E5VA 3ZK7A 1G42A 2XA2A 4RKQA 4CZ2A 3C6MA 4W99A 3FUXA 2HHHB 4R40A 1PKPA 4I2VA 1W96A 1E2JA 1W48A 1PV1A 3GJ7A 4FSDA 5BN5B 4YXFA 3U3DA 1GYQA 1W30A 2IPXA 1CY7A 1DPFA 5JANA 2BDEA 4MYHA 1H8HA 1CDOA 2B8EA 2DULA 3KKKA 4BYGA 1PE0A 1I94I 2JAUA 1G8YA 2RGWA 4R1OA 3T94A 5AFSA 3G1TA 3Q12A 5EJIA 4XJTA 3VZCA 4YCLA 5IK2D 1UFKA 2LVBA 4KI7A 4Q9NA 1UPCA 3LPCA 1Z0IA 1G64A 3O38A 1FJGI 2J0EA 5HZKA 2PE5A 1FFWA 4LRQA 3UAWA 4W7IA 2A5JA 3URMA 4F4FA 5I7WA 1KI2A 1PSZA 3VOBA 1ZGBA 3WAKA 4GI7A 4HDNB 4BN4A 3MJSA 2R8BA 1XTIA 3ZV4A 4BLPA 2D0OB 3KT3A 3S5UA 2Y67A 3NBZC 3N3BC 1W9MA 5AOBA 4PZEA 1NF2A 4OVKA 5L3SA 2I2AA 2VYQA 1J0DA 1U7UA 4L8WB 5EHXA 3LS2A 4FFLA 1OBVA 1WXEA 3WMFA 2PLWA 2V7QA 4OQPA 2Q3JA 3REGA 2I3BA 3H0EA 3FDZB 4JBYA 1CY1A 1IDN1 1E2KA 3CUWA 5AVJA 1C80A 1VPVA 2BR2B 5JCJD 4FCTA 5JVDA 4ZTZB 2IUYA 2RHLA 2V03A 3FBWA 3E61A 2J0SA 3ICCA 2IOQA 3KTAB 1B3RA 2YRXA 3FWZA 4G01B 1JAXA 3QOYA 2BLLA 1FW6A 1QCCA 2ZTLA 3LUCA 1AHPA 3DLTA 4R2KA 2PRSA 3KBOA 2C2XA 4WL0A 2X76A 5J1SB 4IUCS 3VV3A 1NUQA 4BASA 5C80A 5SZJA 3VNAA 2QSJA 2AXEA 4NRDA 4QTUB 4OPMA 5K8VA 1X0XA 3ECAA 4XJSA 4PW0A 1ISFA 3MERA 2J6HA 1D2CA 4C6TA 4RZ3A 4GR9A 3PYGA 4I81A 1VL5A 2XLCA 4LSWA 4WOBA 1KRHA 1U02A 2FPWA 3I83A 3TUIC 3U13A 3U60B 3AI1A 1W8DA 1WA5A 2OK8A 3TS1A 3V7NA 3VPAA 1TK9A 2BP7B 4PX3A 1KXZA 3I9V6 4F93B 2HI0A 3JY6A 4NATA 4COOA 2J87A 1DXOA 1J09A 2NACA 3DR5A 4KOAA 3V8NA 1M1YB 1O6BA 3B1FA 1DAKA 4ZVVA 2NSHA 1LSOA 3PDUA 4XQGA 1MXFA 3AB7A 3VUEA 3WK6A 4UOEA 3UUGA 1Z56C 2DEJA 2OHVA 3JU3A 3JAMC 1L7AA 1JHUA 1JLKA 4G25A 4JJKA 4LDAA 3MIZA 2C96A 5G0WA 3ZCXA 1MHPA 3CE9A 2O8BA 3EIXA 5DM4A 2G63A 2PKEA 2XGSA 4Z7OB 1FJ2A 3BFKA 4ZTBA 5MN5A 5GIOE 3EEFA 4PLTA 3Q15C 3L5OA 4HNAA 5LM3A 5JRJA 2FZEA 1ESNA 4ND8A 3N58A 3HZRA 2G6TA 4KQXA 4MCAA 2H52A 1SZJG 2JGNA 3VHLB 2PX3A 3O3MB 4IXTA 4UC0A 4MVJF 1TJ4A 1ZJYA 1HDGO 3DHWC 4R83A 1LPSA 4ED9A 2ZRJA 4R68A 4UTPA 3CHYA 2YZMA 2UXCE 3F96A 2CMFA 4XLZA 3WV5A 4DA8A 1AGYA 2JFHA 2PLNA 3K9QO 3MUOA 3SIXA 3VC3A 1O77A 4EUEA 3ZJ5A 4QBKA 1NGSA 3LQKA 2JCGA 2QAGB 4BE7B 5IYZB 2WMDA 3WBBA 4B4OA 4B48A 1NW8A 3GNLA 4I5GA 3C1OA 3TCXB 4H3HB 2SCUB 1YT5A 1X1QA 2BFNA 5HILA 4Z9YA 3PTZA 1N2SA 1AKWA 1YFKA 5DWDA 3O8NA 4PPFA 3JR7A 1ZM3A 1QDLB 3GEPA 4BMOB 1A77A 1FYVA 1UK9A 2ZW9A 3L6BA 3IMEA 3B7PA 2CZGA 3CCFA 1GQQA 4C5AA 2W11A 1DJOA 4X3PA 1BQ3A 3RVPA 1KZHA 1K4KA 4TMVA 4OQXA 4NZMA 4CMIA 2JZNA 2YWJA 1NI5A 4HQ6A 3T8YA 1KC3A 2BE9A 2ZYHA 4OIFA 3UWKA 1ZESA 4LJKA 1V6AA 2EDAA 3MAAC 4J6FA 1UC5B 2RGBA 1YIDA 1B43A 4GEKA 5FLEX 1XD9A 4B32A 4KWHA 2IU4A 2UXBE 3AR2A 4F06A 3JQQA 4D6XA 4TV8F 1HC7A 1YNSA 1QRAA 3C4QA 5H59A 3X1WA 4DARA 2E5LB 2O3QA 4L4YA 3MB8A 1MJHA 1Y9DA 3RAGA 2QX8A 5FEMA 1XZQA 3CZPA 1VI2A 1HSOA 1YDWA 3QI2A 3S7TA 3ZE0B 1SQ0A 4MWTA 4KUGA 4Z4CA 1FK8A 4LDRA 1CYEA 1XB2A 3A11A 2UUBI 1DIOB 3ONDA 3QLEA 1YZYA 1Y3CE 3K4HA 4GOND 5U9CA 1ZWKA 2I6FA 4JHXA 1VPLA 1ZN9A 2FWMX 2JEYA 4K9RA 2BJWA 5J58A 1VBFA 4L0QA 2VK4A 4QZVA 2DJ5A 1QVZA 3NI2A 5BSFA 4FDVA 3PHJA 4AROA 4ZHQA 2E4ZA 3TZHA 2IBSA 4LYEA 3CWQA 1KRWA 4Z7CA 2FWRA 2FZ4A 3NBUA 3IMGA 4JWTA 2AGVA 5FWDA 4AY4A 2GPNA 4MDTA 2F64A 4E03A 1Y63A 3DULA 1KJQA 1WMFA 1Q21A 2QN6A 2D1TA 3AY7A 3R6DA 4IGKA 4PAGA 1NBMD 1GV1A 3SP1A 3OOEA 3VMFA 3RC7A 5K8UA 1Y7TA 1TYDE 1KZ1A 2AOXA 4TZTA 1N5LA 1W9HA 3OU2A 1PQ4A 2CHVA 3JYQA 2MSKA 3P4YA 3GVPA 3D8NA 1MX9A 3FTPA 3MRSA 4L0MA 3BB3A 4Q0MA 4EFDA 4BLRA 4LYAA 5CB4F 4FFRA 2UUCB 3AH8A 1MAAA 5ILQA 4ML3A 4HPJB 3EVGA 4A8PA 5I7SA 2TYSB 3KJNA 3UK2A 4KXLA 2CZ9A 1KYIA 3K0CA 3ENKA 3LX4A 1Y1LA 1GAWA 4BCBA 1EVIA 2AW5A 4YP0A 3PYFA 1IB6A 2GZRA 1A1VA 3PLAE 1BHQ1 1V37A 5JCOA 1R6XA 5FBLB 4YCMA 4QM7A 4AY2A 3UHPA 3QEOA 3P3GA 1L7OA 1MC8A 2AKYA 4UHJA 5JDIA 2TSYB 2QZPA 1QK4A 4DR3I 2H3HA 1T1EA 3LDGA 5DNWA 5F7JA 2HCTA 4BQOA 3IEVA 1YI0A 1U4NA 3EMKA 4UHKA 2ODNA 3NYQA 4V3BA 4NOJA 3PQ4A 4EVSA 1NVWQ 1QO0D 1MTZA 4B84A 2V74B 2EHJA 3EWNA 1YJ5A 1FFEA 4RIIA 3RHFA 4AJ4A 2MTBA 1P9WA 1RQLA 4L9AA 1U2EA 4BNFA 3SKYA 3GY0A 3E3MA 4PZ9A 5C3UA 2FMUA 3P26A 2APJA 5CBKA 4TVBA 4MKHA 1HNWB 1VE6A 1YZQA 2WI8A 4V0NA 3EDMA 4GX5A 5KTTA 4KOEC 4HGYA 3TJRA 3DGEC 3ZW9A 3EW9A 4J9UE 1U7TA 3SDBA 1P91A 2BYTA 1KYQA 3Q8XB 2ETXA 1NR1A 2R3SA 2OOKA 1VB5A 4KWIA 2W48A 4TMWA 2JFBA 4BVJA 4CTKA 1KYYA 3ZNNA 1Y33E 1JA9A 2E82A 2QTTA 1GWNA 4YA6A 5IT4A 1UKVY 4RC9A 3H2HA 1NY6A 4EFLA 4QHYA 3ESBA 1YBAA 2O0HA 5K4HA 1P19A 4BIMA 2QL6A 3RSZA 1FDUA 2HT1A 5CBPA 5CDSA 2Q2NA 5GZ3A 1GAQA 5JNRA 1CNEA 1K98A 4ENRA 4OO1A 5HCIA 4E3ZA 1TZCA 3FSGA 3G1UA 2OMEA 1YC5A 5CA1F 1FFDA 1YR6A 3AP3A 2J3QA 4M0DA 4BNDB 2RI0A 3HDTA 3HJGA 2VDJA 5T3YA 4NMLA 3TCNA 1XRSB 2P90A 2W8BB 4ID9A 4IDGA 3WGJA 4Z49A 1U5CA 3IQFA 4RV4A 5KSPA 3A1CA 2Q99A 4IO0A 3WGMA 1J0EA 4B6GA 1G7RA 5EQJB 5TQVA 3FOZA 4MW4A 5TRTA 3Q7EA 2OHHA 4FOOA 4D9EA 3QM1A 4OATA 4DSUA 1X86B 1B3BA 3D4IA 3WMGA 3ZXYA 4CTOA 3R5TA 5COBA 1PLKA 2BZ1A 3A0UA 3NQ41 5AUNB 2E1RA 1CUGA 3N75A 4HB3A 4DZRA 5K3OA 4AX8A 1G20B 4CLRB 1S8OA 2WFMA 5I48A 3OTOB 2JS7A 3NHYA 1LLUA 3GBSA 1YL5A 1P2BA 1KIFA 3MT9A 3BXFA 4H9GA 1N33B 1F8GA 3H8JA 3NEAA 4RK5A 2C1EA 3FLBA 1NJFA 3HCRA 5IDXA 4HO1X 4X8MA 2W2NA 1MLDA 2GUGA 3L7KA 3Q3IA 4F4HA 1LWOA 1PGPA 1GKIA 2Q5JA 2OBYA 2XD9A 1WUJS 2J7KA 5INTA 1FNNA 4L5JA 3RK0A 3QUSA 1RQRA 3OZAA 1BXZA 2DPMA 4U2GA 4HVLA 2G76A 2A1UB 1SVUA 2F43B 3R7LA 3UJNA 4ZK2A 2QSZA 2VAWA 8ADHA 1V5IA 1M8PA 1SUDA 1Z6TA 1C3JA 2H1RA 3ETJA 3OJLA 5LU9A 1M76A 2QJRA 4HHEA 4F84A 1PX0A 2C9YA 3LUKA 4UMDA 3KXDA 3PEFA 4LTMA 3U3XA 4J0EA 1OX6A 2XVXA 5AVXA 1B7GO 4JUIA 2ZE5A 1GNRA 4IEFB 3K70B 4X66E 2QYSA 4A03A 2F00A 4CKCA 1U2ZA 3CNBA 4PXYA 5LOVF 1KHHA 3DBOB 4UULA 1IJEA 4H7KA 4I1PA 4NE2A 4E12A 1Z4JA 5TE9A 3VR6D 2LW7A 5AJTA 2QRPA 5EWMB 2ZUSA 4KR0A 1QCYA 3E27A 2DB3A 3DEFA 4RY2A 4UATA 3BRCA 3KDAA 2XMPA 5K36B 2SICE 4LJ5A 2DVMA 1HE4A 1YMQA 5CW1A 3JV7A 2BFEB 4P2BA 2Q3HA 4U2CA 5FUVA 5IMSA 4NFYA 1I2ZA 1OLUA 1SRQA 3P9CA 4KZPA 1R5NA 5CFQA 2FH5B 3IP9A 1FPQA 1JL3A 4LY9A 3RARA 5FFFA 1Y4SA 1RI5A 3BRQA 3MBKA 4Y0VA 2OPHA 4GGPA 2RHRA 1L9XA 2X8JB 5JNUA 1DX9A 2EL7A 2QG4A 2OHFA 2JIRA 4BBAA 4N76A 2J6IA 4QEDA 1ZDMA 5T6BA 3CTPA 4HPXB 3Q9SA 2ATXA 2ES4A 1PSDA 1N7JA 2VT6A 1A95A 1SBHA 1VG0B 3I01A 1AT1A 3LBYA 3OD1A 3LW8A 1RJFA 3TSYA 5IVPA 3DCYA 4JQSA 4ARAA 3GP5A 1PK8A 2A1TR 3ITNA 3LKVA 2X0DA 2AOTB 2W9XA 1D1PA 2JLWA 1MX1A 3BWBA 3PZRA 1IQRA 4R4JA 4EY6A 4FFBB 1F2DA 4NBSA 5IXJA 2YHIB 3AYXB 3U7HB 4DV5E 3LUDA 3F6EX 4LF7B 2DUMA 2YN2A 3ZDXB 4YAKA 1AZSC 1NU8A 3AUTA 3DW3X 3RUPA 3TNLA 3WQRA 2I66A 1JR2A 1U9ZA 3C43A 4MIYA 3W04A 3GB9A 4H3VA 4DNQA 2ZPAA 5G3YA 2PNZA 1HNXB 1PR5A 3TRJA 4FSHA 2JJ1D 3ORRA 4OK5A 1MG0A 2QM7A 2CMDA 2OTCA 1HRDA 3VH1A 5IAOA 5KSZA 1EFRD 3DDZX 1ZINA 5E2IA 3RIXA 4ZZ1A 1M2HA 2HEGA 4LHWA 3SQXA 4KUEA 2F9LA 3LGXA 1DXQA 4OUKX 4OHUA 4UJ5A 2WYIA 1DVRA 4TZKA 4HTAA 5F51A 3ZK8A 1PUJA 4DIOA 6GPBA 2W2MA 3VI4B 2BA1D 1DBIA 1YZFA 3GJSA 4O5OA 4MGIR 4X91A 3WXBA 1C29B 1S2MA 3CNQS 4OV6B 3V97A 5IWAI 2CG9A 3QWHA 5EHZA 1J2RA 1KE1A 2Z5FA 3UC9A 2LJPA 2O3SA 2JBHA 1RKUA 1RWBA 3GAAA 3HDYA 3K8QA 1JQ5A 2HWYA 5CTAA 4RPKA 4DN6A 1KDVA 2WJ6A 4NCKA 4NESA 5LQKA 4B40A 4QOGA 1ZYUA 4YUXA 3NTXA 4JI4E 5B3LA 2ZB7A 2P8SA 3MCVA 4W7HA 3UGQA 3UJ6A 1WWKA 4EGQA 3BUSA 5ENDA 4UNRA 1CQJA 2EKZA 1AM4D 4XVCA 2Z1DA 2XXAA 2ZRPA 4DC1A 1YR3A 5AR1A 4J3JA 5HQ3A 3ZDBA 2DR0A 4C4RA 1XROA 4KEAA 4U7FA 5DSTA 4B5LA 5DT2A 2REQA 1DC7A 4MGZR 4BXOB 2XBLA 1QYWA 3I5UA 2DPHA 5EJ6A 1LUAA 2E1PA 2QTAA 1NJ5A 3RWMB 2Y1FA 2D8AA 2ZYDA 5EUBA 1XZLA 3I5XA 4CW7A 4DRXA 4DIKA 1TECE 2AI1A 3D7RA 4KC0A 1FDVA 3RIYA 2FN8A 4MAMA 3CSUA 3HK2A 4BTEA 1NN1A 5BYJA 1QTQA 1EA7A 1E1CA 1T2DA 1KVKA 2A0KA 3NEPX 1O1YA 5EWLA 4OK6A 3OETA 4IILA 4FZVA 3DOFA 1SVIA 2HMSA 4LWPA 3H9EO 4NBVA 1CERA 1Q0ZA 5IT9C 1XT6A 2FHSA 4G4SO 3MMXA 4BP1A 1EFCA 2W2QA 1IU9A 1A9XB 4Q6BA 4CL2A 3R9XB 1XMQE 5FLKA 1WB4A 2PJRA 1CKEA 4KU4A 3A9RA 5DI3A 1H74A 1VKZA 3GEEA 1T29A 3WYBA 1P18A 2AE2A 2PUGA 1UOEA 1QH8B 3WIUA 4AMVA 4MS4B 4FDTA 2Z6VA 5THXA 4OSOA 4NCIA 4I1VA 1R6MA 4XUGB 1V3VA 4CMBA 3WB9A 2WU3A 4ALLA 2DKNA 5DI9A 4GBED 4DSOA 3U4GA 3JVUA 2ZIZA 5G4LA 4QQ8A 3H2JA 3EIUA 1T26A 5I51A 1VP9A 2XUIA 1RWPA 1DRVA 3CCCA 1WS6A 2XCOA 1YOVB 1ZMTA 5AVTA 1I6KA 4DYVA 3PUHA 4CF6A 1IJFA 4OQEA 4FEAA 3NFRA 1DCTA 4JWKA 2QYOA 5LC1A 5BQFA 3A6JA 1JS1X 5BT8A 1CP3A 3VKVA 3BIOA 4FYVA 5IS2A 4TQ9A 4LF5I 4EJ2A 3PJFA 1L5MA 4F1JA 1A7UA 1FXUA 1UBKS 1OPXA 2BFFA 2ZIFA 3PX3A 4RNCA 3ZE2B 1CR0A 4BNHA 3TW8A 1U0JA 4NZYA 5AKGA 4G6ZA 2Q1WA 4JSYA 4UHFA 1B41A 2PR7A 3MCWA 3I61A 4PG6A 1ZGCA 4TL6A 4YX9A 1L5HB 3HE3A 5GMEA 1EVJA 2RDMA 2RB5A 4IS2A 4DV1I 1E8NA 3SC2A 1NVEA 3JQRA 1VDZA 5KVAA 4PHHA 1ADJA 1N2CB 1ODSA 1VKNA 2AOUA 5WRFA 1ZD2P 1Q5PA 2PUFA 2QAGA 4OMFG 2D1RA 4E31A 2QU7A 2BEJA 1VFNA 2EWWA 4NPCA 3IE0A 3VYTB 1DRJA 2PQMA 5LMUI 1CVRA 1ZUHA 2IZ1A 2XH8A 3ENVA 3RUDA 2Q5OA 1Q6ZA 2GVNA 5H9WA 2H1CA 3JQDA 3RE1A 4EB6B 3QFFA 3EE6A 4PO9A 1EUZA 1P39A 3OI7A 4JZYA 5F64A 1T8TA 2YRFA 2F4VE 4JMPA 4LJRA 1RPTA 5BO5A 2IH4A 1OE0A 4FCWA 4FMDB 4TS4A 1WULS 2NQTA 3VUFA 2OHGA 4IFDB 1W4BA 1PBNA 1NSFA 3RC9A 4Z54A 1WXQA 1F0PA 1MEOA 3MPUA 4EHBA 1IBLI 1NIJA 4YCJA 3A1EA 5CAEA 5AI0A 2XEXA 3TBKA 3L8MA 5CUQA 1J2JA 2YVUA 5TDHA 4LYGA 3PXXA 4C0BA 3N87A 2HUNA 1BFUA 3AUAA 2ZKLA 4NCNA 2COEA 2HFUA 2C88A 2CBGA 3RJMA 3TW4A 1S9DA 4DT1B 4EYOA 4Q3DA 1KGSA 7REQA 3MT0A 2Y1WA 3UHFA 4NCHA 1KEEA 4URXR 2BMJA 3DR3A 4NS1A 1XE3A 4QHTA 4LOMA 1LS1A 4CWAA 4WNIA 3QEJA 5I8PA 5A0VA 3U1TA 3UMCA 3TMYA 3THOA 2XSZA 1W7AA 5C32A 2HA4A 4K26A 3RFTA 3DT9A 3X1ZA 3K70D 2E87A 3FKSA 1LDYA 3RRXA 2WQZA 1ZI8A 1MFPA 2BIFA 3TJZA 3NWEA 4Q18A 1XJQA 1DBRA 3SZMA 1GQ2A 2EQBA 4M89A 3Q9UA 2Z2ZA 1WU8A 1XMOE 2GFHA 2GM5A 3DNFA 3I05A 2PLAA 3KQYA 5JQGF 4IJWA 3KV1A 4CMKA 4IJ6A 4MP6A 3BXHA 4L27A 1KDYA 3RGGA 3ZIAA 5FOTA 3RKRA 3AY0A 3VU9A 1JPJA 3FYTA 3FSEA 4JLKA 2BMFA 4B43A 13PKA 3TAHA 3OC6A 4HRVA 1Z4QA 1V6CA 1OCEA 4DR3E 5DXJA 5KKAA 4NZ9A 2IERA 5EMHA 1OSNA 1XA0A 1ULSA 3OCUA 3OP4A 1TUEA 3MA0A 5JMWA 2EATA 4H3SA 1A2OA 2DFKB 1OH8A 2NZVG 1PUXA 2BGTA 3PICA 2XQVA 3QY9A 3FMGA 1WP4A 2YJGA 3QUTA 4XM1A 4OBEA 1NVFA 1UAGA 2E5WA 4MMYB 2OXIA 2O52A 1G16A 3PL1A 1JA1A 3KR1A 3LLUA 4OHZA 4YP1A 1E3IA 1P33A 3U62A 1YRLA 3SHTA 1PFVA 4C3ZA 3DAPA 5FH9A 2D2IA 4H77A 3G0HA 3R3YA 4XFKA 1JSXA 3QU9A 4LEIA 3R09A 2OG2A 5DIFA 2WTEA 1CY2A 2JKZA 5BN5A 3UMYA 4QLAA 4QWWA 1JJ7A 4FFVA 3ZWXA 2PQ6A 2FDXA 4X65E 4HYTA 3GJZA 4QPDA 3VPXA 4JQOA 4KIFA 4MI3A 4W8GA 5AKEA 4KGVA 2WJHA 2O5EA 1GPJA 4HGNA 2X7IA 2D1SA 1ESEA 4WK6A 5L4NA 1QIFA 4B85A 4TT8A 1UADA 2DFNA 2WTMA 4ARUA 3AZOA 3K1AB 5AYVA 1B8VA 1M9NA 1R8JA 2DWCA 1U8TA 1ISGA 3KLMX 5J5VA 2VQFE 1O3YA 5BV2P 1BQ4A 4LYDA 5HFJA 3O7WA 4FIZA 4E30A 5EWJB 1EU1A 1Y8RB 4ND5A 2YIJA 4GLFA 4C9BA 1JEYB 4TXJA 3FTDA 1II9A 4DV3E 4UDNA 4PN7A 3AVYA 4BUCA 5KJ1A 2F67A 3HY3A 4DEYA 1RRFA 5EKTA 2CL0X 1N1EA 2XHZA 2Y0BA 3PNOA 2HHLA 4KFCA 1JEQA 3U9SA 4MA0A 3IMFA 5EHNA 1PS0A 2WYUA 3EODA 1JR4A 4XIYA 2A9KA 2P41A 3CF6R 3ZCQA 2HIHA 4WLEA 3HXKA 4JB8A 3ZDCA 1FF9A 1L2TA 1N0VC 1VRCA 3B5JA 3KTAA 2I99A 1G1AA 1HDCA 4PPQA 3LQYA 4RD1A 5LQUA 4CIDA 5IVDA 1TPZA 1PSWA 5E7MA 1KK0A 4H3KB 3VXKA 5JAUA 1NHGA 3F3YA 4D0LB 5JJ5A 1QAMA 4MUKA 1VCMA 4J3FA 3L8DA 1DCMA 4PGMA 3T3OA 1E4EA 1W88B 3GUYA 5BR7A 3OIFA 1AGNA 2QZSA 3AHGA 3DOCA 3C3DA 1RTTA 1CRWG 4LBZA 4RLQA 5AHXA 5FOXA 4EZBA 2QRKA 1QYXA 2VRCA 4L8VA 1W2HA 2EX0A 3TXYA 5DF1A 2J9RA 1Z47A 1X7WA 1KYZA 4JOQA 1CUJA 3LHIA 4IMIB 4RF2A 5FORA 3ST7A 4NE7A 2P7IA 4ID3A 3EPLA 3I42A 1SK9A 5EXTA 1E0AA 1LVUA 3GELA 1JQJC 1G0OA 5KWEA 1CV2A 1N3IA 3A31A 1UKBA 2FRXA 4FJ0A 2FQYA 4RK0A 1A7JA 1W29A 4B3CA 1MOSA 2QZJA 3ETNA 3HKDA 3KWLA 2HHHE 3PENA 4DR4I 1PQUA 3HJNA 2GD6A 4RFSA 2W6ID 4L4SA 3SMVA 3E4DA 3IOCA 4QEZA 1MVLA 1Z5AA 3HJHA 3OY7A 3R5KA 2I87A 2JK0A 2P2LA 4MUBA 2MSWA 4FDMA 4IZ6A 4N6OA 3WDLA 2ETVA 3GJYA 3PE3A 3M70A 4QARA 4JVLA 3DBLB 2JC3A 3RAPR 1RP1A 1Y37A 2HIGA 2ISSD 1YZUA 2EP7A 2W93A 2Z83A 4JKOA 4ZEXA 1KMHA 3HN6A 3PUVA 4U9UA 5F2KA 1N36I 5I9MA 2WWXA 3T4XA 3MUEA 4FNGA 4LF5E 4ZYTA 4AIDA 4ZPXA 4MU4A 3K0AA 4NBUA 2GNPA 3ENZA 3LOUA 1KQGA 5BYBA 4F1KA 4QOIA 3N59A 4LFBB 4IFDA 1JWAB 1MDBA 1XU7A 2QY6A 1KDTA 3I2IA 3UCXA 2IX3A 3Q3GE 2BY4A 1SWWA 3V1YA 3GJ0A 2XNCA 4M9ZA 4U00A 1XZJA 4V2IA 4X8OA 5F3RA 5LL6P 2YZKA 4KE9A 5EFOA 3AUFA 3HEMA 4AS3A 2NU6B 3BSSA 2GD2A 4CQLA 3BPSA 3CRW1 2IS6A 3L8CA 4EVRA 1XD8A 3IT3A 2ROQA 3AF4A 3IRUA 6REQB 1W4LA 3B82A 3IHWA 3L93A 2FLWA 3WGVA 3OCWA 3PNVA 1PDWA 2EL9A 3GCWA 3TBHA 5AVUA 1L1QA 1J21A 5B53A 3TM5A 3VFDA 5KNCH 1QK3A 4IJVA 3UFXA 1KERA 3MTBA 3AUYA 3WLMA 5C7YA 1M1NB 2CXQA 4OM7A 2I6XA 3IAEA 2P3SA 1TW2A 5G02A 4X62E 3FUVA 3PGVA 1V1RA 4TWAA 5IDQA 1DU4A 1WXDA 1T9CA 1MX0A 3FCUB 1BSVA 3PC3A 1CSEE 4PYKA 4Y9TA 4MMXB 2XPCA 3H2KA 3H8WA 1XMSA 4M37A 3IPYA 3ICEA 3GX1A 3SX2A 2PUJA 3BQNB 2CYBA 3DT6A 1ZUD1 2ISCA 1NPYA 3MRVA 4FDLA 4FOTA 1FC0A 4MS3B 4Q93A 2KWIA 1BVYF 1XG5A 2B8NA 2XE8A 1L5RA 3A37A 5F12A 5FPSA 2XMRA 3E7DA 5D2CA 2FGKA 3F2IA 3GJ8A 3LP8A 3IQDB 2FOIA 3FG9A 3PUWA 1NJGA 3RO7A 3GDHA 2Q4EA 2JT2A 4NAVA 3GEGA 4QDXA 4RHEA 5EVCA 3WRXC 4PZCA 3SYRA 3PT9A 4EQZA 1BE6A 1H5NA 1WCIA 2GHQA 2DCUA 3E84A 4D8TA 4WKOA 1I2CA 3ELDA 4EG3A 5ITSA 1ZGGA 5TMPA 1KAQA 1EK5A 2E5FA 4K9QA 4AW9A 2QN9A 2ZI5A 2W6MA 4MP3A 4TL9A 2JAQA 2VDRB 3GMIA 3MHTA 3DPIA 3AILA 2WWIA 5EKXA 1NQ5A 3THYB 5HXAA 1G7TA 4L5CA 1AN0A 2M32A 4B81A 2VZLA 1Z6XA 1Z2CA 1SCNE 1MO3A 3BMNB 2I8AA 4O5AA 4RQBA 1H4VB 2ZJOA 4DV1E 3HB7A 4P8RA 4WW0A 3LMKA 5EE3A 4K6KA 2WQ6A 3EH1A 5FLXQ 1E3TA 4ITUA 5CB4B 4BTLA 3KKZA 1MOQA 4BNZA 1K6XA 4MQ5A 4WI1A 2H92A 1QIEA 1SCKA 3N2YA 3JS5A 4NOMA 1N2EA 2FMHA 5JSZB 4DV7I 1EFDN 1ULAA 3FTEA 3ACCA 4ER6A 5FTLA 4DGQA 1BDBA 2ZZMA 5KWJA 1IG0A 1C81A 3KYDB 2IU6A 4BP8A 4UCFA 1HUQA 2BGLA 3GDFA 3P9SA 3AVVA 4FWGA 1LBQA 1P0FA 1PL7A 3UKJA 3FNBA 2NLOA 1FZQA 1TAHA 1KVUA 1A4IA 1Y89A 3FRIA 4JVOA 4PO8A 7AT1A 1BXGA 1OOEA 4OFZA 3U19A 2VUIB 4L28A 1NVUQ 5C8XA 3W2HA 4CM3A 2PTGA 5E6UA 1V16A 3OZXA 2PT6A 2FW0A 4WNAA 3SZUA 2WM3A 3HXPA 4ZHSA 3VNSA 3ZE7A 1AO3A 4EYKA 4E5YA 5NULA 1JR3D 2K5UA 3TIGA 4U5QA 4JI1I 4JKYA 3AI2A 4JV5B 3K8OE 2QL7A 1XMQB 1E7QA 2E37A 3K6RA 2RGRA 4GZ3A 4C4SA 5LXTB 2WNRB 2IYTA 4V02A 2VZ8A 5ALWA 3CISA 2PO0A 2EJTA 2HC9A 2MU1A 2XADA 2JAPA 4FYYA 4ILEA 2W2KB 2Z8YA 4ZCPA 2YZNA 1NXTA 4UQOA 5HS6A 2QUIA 3O93A 2DX7A 4ZRDA 4LQLA 4AYXA 3IE1A 2R1VA 3ABOB 5KPJA 4HACA 4GOMD 3OECA 2H0RA 1E3EA 4BZWA 4Q3NA 4CXMA 4AULA 2KSQA 2WSSA 5DEOA 2EFJA 1J06A 4LMRA 2RHHA 5HKAA 2RH8A 5EI5A 1XEAA 1RAAA 1ZXBA 4PGGA 2HT6A 3H3XA 2LGJA 2YDYA 4KVAA 4IM7A 2IUUA 2B4YA 2HREA 5CLHA 3EPPA 3ZHUA 2F62A 2QNRA 1O94C 2OEPA 3HXOA 3V6MA 1E79A 4JV5E 2FEAA 2RBEA 5ES4B 3UXEA 5FLXA 2IJGX 1L5FA 2X77A 5GJVC 4ASUD 4AMUA 4P3OA 1G7SA 3A26A 3ZHSA 3CS3A 3LJKA 3AV3A 3I2HA 2OBMA 1F1JA 4PC6A 3JVEA 3V2GA 3D31A 5A5DA 3C24A 3E2MA 4HEA1 2WJ3A 3E82A 2FN4A 3AM5A 1CY8A 4B6RA 1UBJS 4LSMA 5AM2A 3J80A 1A5ZA 2R6DA 4ZAVA 2I4NA 3SU8A 3BWDD 1V0JA 3QWIA 2WT8A 3WFZA 3UJPA 3V32A 2EKLA 2BJHA 2ISQA 1MX5A 1NVDA 2CNWD 1NLYA 1ODTC 3MJRA 5I7HA 4O3MA 4BPRA 2IH2A 1J49A 5A2QC 1Z13A 2N1MA 1CY0A 3G2JA 4G97A 3TL2A 3X2EA 4F5WA 1X7ZA 3RRBA 3DC7A 3G2PA 1UWLA 4DV4E 3COVA 4LF4I 1YDFA 2Q3FA 5BUZA 1DELA 5IYZA 2DC1A 2DWPA 2FMKA 1P9LA 1R0LA 4R2WA 4BFSA 2R00C 1PVVA 2J1LA 3P97A 2X4LA 1H1DA 1C8VB 4CLXA 3QT5A 1GSOA 3FNHA 5LQJA 1BVHA 3EZ9A 4DILA 2LDXA 3A25A 2DLNA 421PA 2HF9A 2AQIA 4RPGA 1LPPA 2VR1A 3ZV5A 3CGGA 3E3OA 1RM4A 1EWKA 1SBYA 4HNSA 1E9EA 1N2CA 2PYDA 1F48A 4DDMA 4B3ME 4MR9A 1GTVA 5B4UA 1H2RS 2J6BA 5EJ4A 4RHUA 1Q7GA 3O8OB 4X6YA 4K9DA 4PFQA 4U5XA 4MS3A 1AIPA 4MROA 2HBRA 1J25A 2AH5A 3CBGA 3FAZA 4JJAA 3FCYA 4MV6A 2WMOB 3OG9A 5BNWA 1V35A 3CVOA 4O2AA 1WHSB 3IKLA 2P9TA 2P9FA 1I3NA 3G2OA 4XW2A 4MDEA 3TXXA 2JVJA 3W5CA 3G5TA 3SVZA 3S81A 1PTJC 2G4CA 3N2IA 1ZSVA 4LFCB 1N6LA 3L7CA 1ZM4A 3SIRA 1QH0A 3OLQA 4KXUA 4UBLA 3IVAA 3I8XA 3D8RA 4FVTA 3HCNA 5FI0B 2EFEB 3CNLA 5CAEB 5C2JB 2XZDA 4BQRA 5L8VA 3WP1B 4RF5A 2V0GA 3FHLA 1XZKA 1ABFA 2O7NA 2JKVA 2C8LA 2VK8A 3IYLW 3OU6A 4F0JA 1J8MF 2H6EA 3LDUA 3W6OA 2PN1A 4PBRA 7REQB 2K2QB 3F5DA 3B6JA 4BNVA 1T8UA 2WZBA 4NNPA 4WX2B 5F73A 2V9CA 2YFHA 1NOJA 3FVTA 4INOA 4O3FA 3KVVA 4MR8B 4PZYA 4R8MA 3QVXA 3JWEA 3OFVA 3QE2A 3K0SA 3C3AA 1FS4A 3PR2B 4KQVA 3SG0A 4Z1OA 4PRVA 2NN3C 5KO2A 3TD6A 3L0IB 3F78A 1GQYA 1QPBA 4YP9A 3LCCA 2W2PA 5T4BA 2PLRA 4US0R 3R75A 3HO8A 1MORA 2HSZA 3A2MA 4J1SA 4N8SA 1QVRA 3WO0A 1PD0A 2GZ3A 1PUIA 4FYPA 2UYYA 1JFVA 4FFSA 4MEJA 4BNKA 3Q9LA 1ZSNA 1A8HA 3RADC 5H81A 3HGTA 3I73A 3JVDA 4KKVA 2XI4A 3C3WA 3S2SA 4PRXA 4GKVA 3DEJA 3RBXA 2W6PA 3AXTA 3KTFA 1ZGZA 2O8CA 2WAOA 4D9BA 5I9SA 3L46A 5L3ZA 5TGDA 4LF7E 4MWEA 4JDUA 4LVOA 1MC5A 1D9ZA 3FPGA 4BZQA 4CKXA 4WDQA 2QX7A 1RZRA 4YAFA 3ZTTA 2YHUA 2GPWA 5FOSA 4UTZA 1Z45A 2BKXA 3LHSA 1MUUA 2BGIA 1UPXA 3MOGA 4J4BA 5L3QB 1EXDA 1NMZA 2IOHA 3RHZA 3PNKA 3GGOA 2FR8C 3IUJA 2NVUA 3MLBA 4KBGA 1G20E 4RZSA 2IYSA 4PU9A 2A3RA 2R6GA 4HQRA 3SQMA 1FQJA 4NC9A 3FPFA 1H6BA 2Z2YA 1YE3A 4BMZA 4C0WA 3ADCA 3QF4A 4UEKA 3BBPA 4DCSA 2OGUA 1J70A 3K05A 3DNMA 3IMCA 4O4LF 4QVKA 5CH8A 1BXRB 4Z9BA 4ZU3A 2BRUC 2UZ0A 3VJLA 3WL3A 4JA0A 4NX2A 2X7JA 2GX6A 1O6CA 3P71T 2I4OA 3LHFA 4DA0A 2IYEA 1GGMA 2XTZA 4W1SA 4Z4QA 1AH2A 1LFDB 1TGYA 3E23A 4UBJA 3QTBA 4QDOA 2BFMA 4BWVA 2OZVA 3CZ9A 1L4FA 3GUCA 2GNOA 1D2AA 3NIGB 1TT5A 1K63A 3MAJA 4CI0B 5DNLA 4WCDA 4GZ6A 3ZD6A 1VI5A 1I94B 2O06A 3QWBA 3GC6A 1G3UA 1QGUB 4L8FA 4HT3B 1E63A 2EGUA 3ZOZA 1WUKS 1ZR2A 4MB0A 2L42A 1VM6A 3EXHA 4JC4A 1T3SA 4LQ4A 1QRUA 1X42A 1AV7A 1ONPA 4N3GA 4P4SB 1NKVA 3UYKA 2QW1A 4C2BA 2B4KA 3AL3A 1YZGA 2DHCA 3MYYA 5DISB 5JAQA 1L5LA 4IDCA 3C3XA 4NFLA 4ZVLA 3RVNA 2R66A 5AOAA 1U28A 4EUNA 1X1BA 4ZVIA 2XKAA 1A5BB 1XMIA 2V7UA 3G1WA 4MVJH 3PUKA 1M2JA 4KVZA 4X1IB 3R41A 5I4CA 1XHFA 1XLUA 4K1LA 2RJOA 5EMLA 5KC9A 5JDCA 3GN2A 4YK7A 1JQEA 3D59A 3DUFB 3IULA 2C39B 4V0QA 1CJSA 4NK4A 3F6CA 2DPGA 2VZ0A 2OA0A 2I91A 4Q66C 3TLGA 4JI8E 2G1KA 3GN1A 3GLFA 4RS3A 1XNQE 1VG8A 3A4TA 3WIDA 1JMVA 3TOVA 4BLQA 1JEOA 1OLSA 1VE1A 2H1IA 3GT3A 3HUEA 4N3BA 1BVRA 3TB6A 5LPNA 3DD1A 4MUNA 1WKCA 2WJGA 2WWVD 1D0SA 1Y1KE 2VP3A 4BLOA 3QX3A 4YHHI 1T9HA 2XW6A 2ID8A 3ICPA 2BVNA 3PPXA 5DNVA 3TSZA 1YZLA 1NVBA 3JAWB 4WZAA 2OSBA 3ZS8A 3EGVA 5KYWB 4RORA 3MCZA 2HA2A 5KOIA 4KX5A 1QGZA 4FFBA 1E1QA 3H5AA 3TLEA 4K0KB 1Q7TA 3I5MA 4F4CA 2G06A 3D43A 1CUHA 3L4SO 5REQA 5TIIA 3WP0A 2M2IA 3EF3A 1L7DA 2AN4A 5CDFE 4G1MB 3ELYA 4R81A 5ED4A 5CITA 1TYEB 4DXAA 4DV6I 1Y7HA 3KM0A 2W0MA 5B64A 3UK7A 1PFQA 2PCJA 5HGXA 3VR5H 1TLLA 3WKDA 3NHKA 2R5WA 2VF8A 3HB0A 5EJ9A 1OFIA 2YJZA 3ZXSA 3L84A 2LWIA 3VKHA 2QUJA 4LYFA 3CY6A 3U80A 1ULTA 5A0TA 1ZW1A 2IGBA 2NZ8A 4LOLA 4RO0A 1KNQA 1QGOA 2UUBE 3DFUA 1EFVA 5DCWA 4OG2A 3BC1A 3AHEA 4D3DA 4DLTA 4QPZA 1GYRA 1O5IA 4X7PA 2BSAA 1J8YF 1KOJA 3SSOA 2FW9A 5GMOA 5IF9A 2Y4OA 3QH4A 3BL5A 1Y8QB 2Z56A 2B1GA 4L0DA 4RTMA 1LXCA 1NUPA 3PPVA 3TEMA 4RM2A 1KO8A 4EO7A 3PFNA 4YO7A 3HBAA 1SEPA 4Y2JA 1G2IA 4ZXPA 3SZOA 4A2QA 9LDBA 2ID9A 1C5KA 5KCMA 1OYWA 5ER9A 1PQWA 5B7NA 2AIRA 3D7LA 5MN6A 5HJ7A 4DV5B 2RH9B 2COKA 3U3JA 3WKAA 4BKMA 3PFGA 1DC8A 1P1CA 4BVEA 1SC3A 4D9FA 3VU1A 3H1TA 2O0JA 2YRWA 3LGAA 3HXLA 3OKAA 2P4HX 4HQLA 1AXEA 4ZOLA 1OC2A 1D07A 2IA5A 1U4OA 1VMAA 4HNGA 4IUBS 4G07A 4D81A 1WCYA 4L51A 5DM60 3WDSA 3K5PA 2ZSDA 3EUWA 2F3PA 2Q28A 2SNIE 1SU6A 1ZG3A 1E1CB 3K3PA 1SY7A 1V2HE 1WMEA 3HBFA 3IVXA 2D74A 4FWIB 4KQ9A 4X95A 3IA7A 1R4ZA 1I1QB 4PBSA 5FA8A 3UWDA 4ZCRA 3AEQA 5LD2C 4B3MI 4M2LA 3HYSA 5F7ZA 3SXUA 2C54A 3TFOA 1EQAA 4PNZA 2JKYA 1KBQA 4LF7I 3K96A 3N86A 4A0RA 2V2QA 2JFFA 2YQ5A 3DF9A 2XZPA 4EPVA 3D3JA 4MP8A 1X7DA 4M9QA 4IGAA 4Z7QB 2PKQP 3FOEC 1TTHA 1FYXA 3PSHA 3D4JA 5JO9A 2YYAA 3AQ4A 1M72A 1RBMA 4I9GA 1IBRA 4M0MA 4RPFA 1I7QB 4S04A 2QJOA 4LRUA 2H4XA 3AOEC 3RODA 1B0ZA 4H6VA 3L4BA 3M81A 1R0KA 1I13A 1NNUA 3NBAA 4DXHA 2V2ZA 2P9BA 2TMKA 1C4XA 1CXZA 1MR3F 4I0WB 4XLLA 2FMIA 5H1YA 4DLBA 2E49A 4UARA 4A8JB 1VI6A 3KAPA 2G77B 5JWHA 3RBAA 2R6FA 3OY2A 1IN1A 2W2XA 3JWGA 1B0UA 5BURA 2XVAA 2F1DA 1OLOA 2ZWPA 4DQXA 4F56A 3RPEA 2ONKA 1Z37A 3QKWA 4J07A 2UZ1B 2JLZA 3SHVA 5F9MA 3TTXA 2ZU0C 5LZ2A 3UB2A 5HHTA 2AOTA 2YOHA 1OFTA 3GD7A 4ZVKA 4AYWA 1VDMA 5TPWA 1YL6A 2V6MA 1LJUA 4YJHB 2O8DA 2YKGA 1AS3A 3BH0A 2CMHA 2GTPA 4KQJA 3JQ6A 5AM3A 2WD9A 1XDSA 1XL1A 3RYFB 1UDSA 2IYNA 2BONA 4XVQA 1M8FA 3N2GB 4RS4A 5SV2A 5TMEA 4QGBA 4E22A 1WUTA 4YQFA 3HDGA 1OIXA 1NQXA 1M6VA 2NYUA 5EZSA 3HB1A 5G0SA 1ORIA 3D64A 1DIRA 4S1NA 3I62A 1V11B 2ZRLA 3UTCA 2WWYA 3VTZA 1MIOA 1PJ2A 1MIOB 1VXRA 1ISRA 3L4JA 4WZ6A 2G80A 3IT0A 4XSGA 4MVJE 5K6TA 1OLUB 1UEIA 2QVBA 2OXEA 3QVGB 4RCYA 1L8QA 1JSZA 4KLNA 4YJ2B 3PK0A 3SLKA 1U8YA 2J4DA 2JCYA 2FI1A 4KLCA 2W37A 2X15A 3P2OA 1SCDA 2A2ZA 3BHJA 1RQ2A 1PYGA 3Q7TA 4RCVA 2YHSA 2BE7A 1CR6A 4O4HA 4UXIA 4MIEA 4DNPA 5ALIA 4A4DA 3AJ8A 5A9SB 5KTSA 5C8YB 4HYYA 1LTKA 3FHTA 1OAOC 1XAIA 1T3LA 3RU7A 2JEAA 1S9HA 3KPUA 1F8YA 2P11A 3NJ8A 2V3WA 5ALNA 3W90A 4DV6B 4GDFA 4O6VA 2HO4A 3DHYA 2PD4A 4P3KA 3HSYA 3SZLA 4HOYA 4ESOA 2QR3A 1ZNXA 3UO8B 4L57A 2II6A 5FTWA 2WU1A 5A7HA 4ZCMA 1OJLA 1S6YA 4HBGA 4OBXA 2ZSIA 3V4FA 3VU0A 4I08A 3UWSA 2NTEA 3HWRA 3UJ8A 5B5SA 4B3RB 5ICGA 3WMWA 4OI2A 4PVDA 1FFCA 3GJXC 5DGDA 1Q50A 2QTNA 4B3XA 4R0NA 3T3EA 1U90A 1Q95A 4S3MA 1M5RA 4XA8A 1AZWA 2B4QA 3UMSA 621PA 2O07A 1IWBB 3DBRA 5BW6B 4LF6E 3A58B 2YL2A 2WF6A 3JQAD 3H2ZA 3GGSA 1S8FA 3H7AA 4ZGWA 3IDFA 1JJFA 3H1BA 4M1YA 2ACWA 2FSUA 4H60A 3CW9A 3TTSA 3DOHA 1P1FA 2H00A 4DKXA 4ZCQA 4LOIA 2PGAA 2NP7A 2ZRBA 2JCXA 3F47A 3NR2A 3IEUA 3KJIA 4EA6A 3FKQA 4E4RA 1FZTA 1HQKA 1N9GB 1VHDA 1UZUA 3PDHA 2XIQA 5KYYA 4TSFA 3ZY2A 2QTRA 4HGQA 2RB4A 4M55A 5H3CA 1QDUA 2JZCA 1RPZA 3HA7A 3W2IA 4WLOA 5BPHA 4EB6A 4ARZB 1I7PA 2Z5CB 4BB5A 4DV6E 2ZQYA 2CW5A 3M9LA 4NOKA 5DM2A 1KOLA 2Z08A 1J24A 3PXEA 5AXAA 2BWJA 4JYAI 2MDTA 2X3UA 2JI4A 2ZI4A 3FHJA 1YRAA 3VKFA 5J2TF 4Q21A 3HZZA 1JLSA 3L05A 4DV3B 4MQEA 1Y6GA 2HOQA 1LJLA 2OCGA 3WLLA 1G8JA 1OILA 1SBTA 2GCNA 3CVJA 1BFKA 3OF2A 4Q3CA 1JQLB 4IIHA 5HKBA 3D3WA 3DMGA 1Z8FA 3TI7A 2WVJA 4KXMA 4ALIA 1GRNA 2ZR8A 3IFSA 4MMZB 4JEMA 3WGLA 5KJ6A 4HAVA 4FE7A 5KJEA 2RHWA 4BNMA 1UINA 6REQA 3ZQUA 4EG7A 1XQ1A 3AEYA 4OYHA 3T1YI 5CW2A 1ZJ4A 1G8SA 4MHSA 2GXUA 3ZWCA 3L6CA 2I1LA 3FE2A 4L4XA 4MW2A 4EX6A 4FIDA 3L4KA 1I1NA 3ACBA 4IIJF 3A9VA 3NOVA 3EQ9A 4Y0AA 3WHLA 4AQDA 1K6MA 4P4NA 4ANFA 4PHGA 3KXPA 4KFSA 2IF0A 1M0EA 5AXCA 2FX2A 5C4IA 1Z28A 9ABPA 1GNLA 3PS1A 2A1TS 3BX1A 3NIBA 3G8AA 4C07A 4FINA 1C0EA 4S35A 4KXFB 2QTBA 1JLRA 3F8WA 2D0IA 1F0KA 2AFRA 1R9JA 2AFIB 3DDWA 3OIVA 2BJVA 2YWHA 3PNSA 4JP1A 2ZRNA 2D3WA 3KUKA 2BTOA 5EVJA 3ZN2A 4CM4A 4DRZA 1G59A 2GCPA 3M49A 3BQMB 2B2NA 1KAOA 1Y6ZA 2NO1A 3PFKA 5KDDA 2W83A 3PUJA 4WLNA 1N6HA 3AM3A 2UYGA 4GZLA 4M8IA 4PONA 1UDOA 1FNSA 3HDQA 1TJ5A 1E4OA 4IF6A 5TJ9A 1K86A 5EIBD 3OLZA 4EMSA 5AESA 3S2YA 1GU0A 2X8AA 4CG3A 2A2CA 4NXNI 1EUCA 1VHQA 2BHTA 2Z9DA 5CA0B 2XF8A 2LKCA 1W88A 4XWAA 2C83A 4BQNA 3HJFA 5A04A 3GLGE 2AC2A 5F7XA 5EJ2A 5BP7A 5EJEA 1JDVA 1KSJA 2C4KA 1TU4A 4EOGA 4BMSA 4DPMA 3BZWA 4LPFA 1X7WB 2QT0A 2IHZA 3OQIB 3SSAA 3RB8A 1DJPA 4EPRA 4B3FX 5TF0A 2BT4A 3P0IA 2H9AA 3B7GA 4YCSA 1N2OA 3H04A 5THQA 4POAA 1M8JA 1QHHB 3FDXA 3HJTA 4AP9A 1UBEA 2HTEA 3GCDA 1GG9A 3O2SB 5J47A 4JITA 2EG9A 5J9FA 2Z95A 3NBKA 1ZN2A 2YX1A 1U2GC 3O8LA 2AC7A 2VLBA 3SHQA 2G8LA 4QBTA 3O83A 1HNZB 4TL8A 1B2LA 5ALQA 4CV3A 1DJMA 2O8BB 2QTWB 1HURA 1MKYA 2GKSA 2BFAA 3GEBA 2VDPB 3IT1A 3VC1A 3I1YA 2C57A 4MJLA 3M7IA 1K88A 2HLDA 1AMOA 3OQMA 2R5NA 1UWCA 2NV6A 2G3YA 3G6WA 2JANA 1CUFA 2IDMA 3H5RA 3P5BA 3QVJA 4Y3UA 3UFBA 4LFAE 4I6JA 4CFZA 3ZZ0A 3HA3A 4MU3A 1QIHA 2VJKA 2I4TA 4QSHA 4MYTA 1GFIA 5F7OA 1A4XA 3ZWWA 1K2VN 4E1AA 4HUTA 3B6EA 1MOPA 1WG8A 4ZQGA 3OEED 5DLPA 4YJKA 1LSJA 4FCVA 4IYJA 3UMMA 1UDXA 3OA2A 1GKUB 1M6YA 1RWMA 1V16B 3SF0A 4BZPA 3OJCA 2IYVA 4FI3C 4U9HS 4BRSA 3P0FA 4EJ6A 5A03A 1G6KA 3QFHA 3Q8WA 2I2BA 1YU9A 3QXSA 5L7WA 3MN1A 2WP8B 2BV3A 4GVLA 1SXQA 2X7XA 2GJAA 3LY8A 3TW8B 4B0OA 4XRGA 2VI5A 2F4NA 3QKSB 4IKOA 3QJYA 4UT4A 4E21A 5ELLA 2PUDA 3PC8C 4USMA 2HNAA 3BMCA 1NBIA 4WBNA 2NQ2C 3SJUA 2QMZA 2VP2A 3FPEA 5DZSA 3REOA 1OC4A 2P3QA 5D3KA 1WY5A 2YQ4A 3DVSX 1QFSA 2IK8A 1WL8A 3G2QA 3O75A 1ZGAA 2E48A 4GH5A 3QFTA 1GCIA 3COYA 3CPEA 4HKTA 5E4FA 5DX8A 4WASA 4IHAA 3NM4A 3I58A 4TMFA 1X8XA 4TKUB 2ZB8A 4OQFA 1XEWX 4X9XA 4XIJA 1Z74A 2QLNA 3I0NA 3PIDA 5DWVA 4GKKB 2CJWA 2B8TA 4N49A 1DQNA 1UJ6A 2Y4NA 3D7MA 3JQGB 4YTEA 5ALOA 2P8JA 3TOSA 1ZUNB 4CT0A 2C7OA 3ZWDA 1RWNA 5AK3A 2BMEA 1FXWF 2ODEA 1U1IA 3WNBA 1C1XA 3C6ZA 3VPSA 4BMNA 4MIKA 2CHEA 3EMDA 2Z3WA 3QKUA 1B76A 1MH9A 3KFVA 2VSXA 3DD6A 5K6AA 2X6TA 5FULA 1ID1A 3KVYA 1I6MA 2R1ZA 4L76A 1NMEA 2GLTA 3DAFA 2XWSA 4LXTA 1YE5A 1KI3A 3DOOA 2GHIA 4I50F 4N03A 2CXXA 5FNZA 1DTSA 3ZJYA 4WXRA 3CCBA 2BFPA 3EGWA 1XJ0A 3DE7X 1DAIA 1S2GA 1FTQA 2GJKA 2H8GA 3HXTA 1X7HA 1L0BA 1SG6A 2JCBA 1S4QA 3H11B 3Q7SA 2W4MA 4TV9B 4ZRNA 2Q4TA 2X0FA 2XZTA 3ASUA 3V7WA 1W4CA 5AVVA 3U4AA 5CG2A 2PGNA 5L45A 2JLCA 1JJIA 2QL5A 2VBGA 1L5WA 3FGNA 1JBKA 5C4GB 3VJMA 3NWBA 4DGSA 1IHDA 1T2EA 3C39A 4LN1A 1THZA 3OZWA 5TNXA 4TMKA 5IT0A 1GPWB 2OXRA 3KHKA 4DXDA 2IPLA 1WBDA 4GKJI 5FP0A 3I9LA 4C3UA 3JALA 4DV1B 2G72A 4F6LA 1NXSA 4CL0A 5DYWA 4CDGA 3DMRA 3O3OB 1HT3A 1SXJA 1D0IA 1TU3A 5IUNC 2FCAA 3I2YX 2JATA 2X1VA 3M7ND 1JXOA 3OCVA 4MI6A 3USCS 4Y0NA 4B09A 2R11A 4RD2A 2JARA 3W7BA 3NEYA 1EFRA 1RSZA 3IDQA 3HCOA 3KQSA 5JDCC 5TMDA 2FUG6 1XEWY 2KM1A 3A6DA 3DO5A 4YJGA 3TTYA 2OB2A 4DOMA 4FMBB 2HDOA 2HIMA 3BSYA 3ILSA 1XN4A 5B55A 6CHYA 3CT6A 3INGA 2G71A 1TC1A 4QO7A 4Z7NB 1NDUA 2FWBA 3IS3A 5G0TA 4X62I 2EQ5A 3TIVA 5HDBB 4LF8E 4BLTA 5IAKA 3Q0EA 3WQHA 5AVZA 4NLLA 2DERA 2G6BA 2G9QA 2AFVA 3N0WA 3FLMA 3BSWA 1UBOS 3DT8A 4OI1A 1POXA 1USVA 1XLTC 1YUBA 3TQHA 3Q1LA 3X3HA 3DPUA 4HRYA 4EYSA 5CFOA 1CF4A 4XM2A 4HGZA 1B0PA 4FOPA 5CDTA 1Y7LA 4DHEA 3DLHA 1VIVA 4FWBA 3CZQA 4DZTA 1QR6A 3HBJA 4JLOA 3SNKA 2V1UA 4AY6A 3T7EA 4UTNA 4V1CB 3AU8A 1RAIA 4J2OA 2GASA 1PR3A 4GLJA 1P8JA 2H31A 4M54A 3GD5A 3A8TA 1IATA 4M0CA 4IIGA 5C1BA 3IUQA 4B35A 2HSWA 1UBMS 5F4BA 3FYUC 4FGUA 3GLIE 2E4VA 2W6CX 2PS1A 4FU0A 4HB0A 2O1TA 4RANA 4RVNA 1IXRC 3BWEA 3RFCA 1KJZA 1E20A 3P96A 4IIUA 3B78A 2W6NA 1ZP6A 4YAEA 1O8CA 2VHYA 4OB7A 3V8VA 2WU4A 3EZ7A 1T5TA 5DI3B 1LCIA 2V5UA 4NPAA 3CEJA 4MVJI 1P1RA 3AJ9A 1CZKA 1WP9A 3I8SA 4O2LA 4D74A 3TX2A 3WFIA 3RBVA 1OYVA 2A67A 3CZ5A 4QLOA 2HJ9A 1W4AA 2Q5IA 4J4TA 3ED5A 4AP6A 4EMUA 3SKXA 1E3SA 1C9EA 2MR5A 4QE3A 1P6UA 3LPLA 1XLWA 3BRWA 5EGNA 4I6GA 1EVEA 1WV1A 3CJQA 4OXRA 2LUOA 4PHFA 1FTNA 4J9VA 1DOZA 4RVUA 1F5NA 2VSOA 1ODKA 4LX8A 4Q9HA 2JBWA 4ZWNA 1GG8A 4MNTA 3G2MA 1G3RA 2J6CA 2X2OA 1EFKA 1GLNA 1ADCA 1RFGE 3GP3A 1X39A 3IBSA 2CF6A 5FWKA 4AF8A 4HDOB 2YCLA 5DT9A 3CJTA 3KAQA 1G5RA 2D2VA 3DF7A 3L7DA 5JS6A 1NG1A 3O03A 2PO2A 2YIMA 1HYEA 3K0KA 3HYNA 5K2MA 1HWYA 4JLMA 4WSOA 4X1OA 5EEHA 2QN3A 1PEDA 5K3FB 4WD3A 4RA6B 2X9LA 1CB7A 3V2IA 2YJNA 3O3CA 2ODTX 2WWTA 2XEDA 1K3FA