1Y6ZA

Middle domain of plasmodium falciparum putative heat shock protein pf14_0417
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
242
Chain Sequence
b'PIWKQDEKSLTENDYYSFYKNTFKAYDDPLAYVHFNVEGQISFNSILYIPGSLPWELSKNMFRGIRLYVKRVFINDKFSESIPRWLTFLRGIVDSENSKMLSIINKRIVLKSISMMKGLKETGGDKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEFYSINSGDKKTDLDSYIENMKEDQKCIYYISGENKKTAQNSPSLEKLKALNYDVLFSLEPIDEFCLSSLTVNKYKGYEVLDVNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords heat shock protein, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
total genus 78
structure length 242
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y6zA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y6zA02
2CG9A 1USUA 2O1UA 3Q6MA 3HJCA 2GQ0A 3PRYA 1HK7A 1USVA 2CGEA 2IOQA 2O1WA 2IOPA 1Y4UA 1Y4SA 2O1VA 5FWKA 3Q6NA 1Y6ZA 2O1TA
chains in the Genus database with same CATH superfamily
1R3UA 1XZ8A 4KDRA 2HIGA 2X1VA 1X1CA 3EC1A 2GLXA 2GCOA 3ZE8A 2WD7A 4GBMA 4TTJA 2B4YA 1RI5A 2WUDA 1BCSB 1TA9A 4G0YA 1LPOA 1E6LA 4TROA 3NM4A 4MS1B 2A8YA 5K36D 3AFOA 3CG0A 2WKSA 3CW9A 4QQKA 2JW5A 3GJ7A 4Y2QA 2IZ1A 3GPBA 5LBUA 3BFKA 1UJ6A 3PIRA 4ZI5A 4OB6A 2NSJA 1PNOA 2HUNA 1PTKA 5LMNE 1ZJ4A 2J9RA 3I8XA 4X20B 2Q7DA 3VYWA 1U3DA 2MSKA 3TZHA 4BXOA 2C4MA 3OTWA 2WYUA 3DGEC 4D45A 4A2QA 2A0YA 3OLCX 4B2PA 4N0QA 2AG1A 1I6MA 3E3NA 1XDSA 2YJGA 5F4BA 4EEKA 1UDQA 1H22A 1NATA 1Q7CA 1SHKA 4OQLA 3KRNA 1LLUA 3UMYA 4W1RA 2WSSA 2O23A 1V45E 1Z5OA 1BHJA 1IHOA 2GK6A 1RBYA 5T57A 1P61B 1YL5A 3V33A 3ZWVA 1MMFB 2O54A 1Z4OA 2FRXA 2PD3A 2ZI6A 2ZRGA 1UPCA 4BMSA 5IXJA 3KLBA 4ENWA 3GNLA 4PFKA 5C8ZA 3CE6A 2YBEA 3TGPA 2CXPA 2R9VA 3BCUA 4NJEB 2H7XA 3QFTA 5EIBC 5K01A 1UAAA 3L6EA 3G0GA 1K66A 1PUJA 4LOKA 5C4MA 1XZAA 5DNLA 1Y6RA 5CG2A 3CNBA 5EE9A 4U00A 4CU2A 5CA1B 3O8QB 4DR1B 2FFBA 5HS4A 1PK8A 4JY7A 2C3MA 4GR4A 2J32A 1N75A 2QM0A 3IKMB 4D3XA 1MOPA 2ZE5A 3WHIA 1KC1A 4W5NA 3LRTA 2A1TS 2JGJA 4YY3E 4YMLA 5IG2A 5JE8A 4JL6A 4NXNB 2GN0A 2I4TA 4NFSA 2AXNA 1SK8A 5AKHA 3ZX5A 5I7WA 4P7BA 3KOMA 3ROFA 1KKHA 4AIMA 1H73A 1T9BA 2JL1A 2P5SA 2VDPB 3LHKA 4I50B 5K1ZA 3OQJA 3CRRA 3SR4A 4DFDA 3PS3A 4L9WA 2J0UA 1VSVA 3FUUA 2AYZA 2WWIA 1W30A 2WSSD 4NONA 3TLKA 1P42A 2I7CA 3HJFA 4FLMA 2C2GA 3AEUA 3IJ5A 4EO4A 3PIIA 3HFGA 3ZD8A 4MQUA 5LQDA 2SKCA 2BFCA 2NO9A 3NHMA 2H5IA 2IS4A 3CPEA 4HVCA 4WK6A 3OZUA 4G0OA 4Q3NA 5JW6A 3U3MA 2WIGA 1AB5A 5JATA 2XNKA 1LVHA 1YQGA 4TWBA 1NQOA 3LUKA 4BLRA 4CLXA 5EJ4A 1E3LA 1UDBA 1U5BB 1GFWA 1Y1SA 4OO1A 4FNAA 1J8QA 5E1OA 3G17A 1BA3A 2PZKA 3IA2A 4PLCA 3OCCA 1Z7YA 4OQXA 2NN6C 1GGFA 1OHHA 1IJFA 4MV0A 2XKAA 3RI3A 3JARA 5FOTA 2C59A 4BE7B 1MXHA 3AUYA 2VEDA 4TVBA 4HMOA 3STWA 2Q2NA 4CV3A 4LF4B 2GWHA 4X6LA 3MAAC 3DBHB 3KQTA 1H3FA 2XUGA 2PPVA 2YX1A 4DG8A 1XZCA 2H18A 2BEWA 4JI1E 1BTOA 1K92A 1LSSA 3WKEA 3I3SR 5KTYA 2C77A 3INYA 1XA4A 3THXA 1T35A 4GR5A 2I99A 2Z6UA 5CA0B 3MLEA 4P3KA 3J81k 2AD5A 4H1UA 5H80A 3OLWA 3E4DA 2IW1A 4EFLA 1UFKA 1U2EA 4YJ3A 4HPJB 4Y9DA 4L2IB 3SYLA 3RW9A 2EKDA 1YULA 2WF5A 2Q3EA 5GVRA 1VKJA 1MAWA 4YCNA 3UJ9A 5JZOA 3LT5A 4FW5A 4KNYA 5EXDA 2ZRJA 1DCMA 2GRJA 1GGVA 2V74B 1QONA 2AN4A 1NBOA 1Z4PX 2GAAA 3KT3A 2VDRB 4MVWA 1J9EA 1NQUA 5KCMA 4D6PA 4DUGA 3ELUA 4H4DA 4J6FA 1QRRA 1ZNWA 1UPBA 2P9HA 2RI0A 4R5HA 4AXBA 3DKVA 2HA6A 3F71A 4GMKA 1NONA 2PUCA 5LP6B 2DLNA 3R4VA 4PRYA 3K9BA 4YCCA 3K53A 5LN1A 5GOZA 1FTGA 2HDWA 3PCXA 3IC5A 5AW8A 2BIFA 4X1IA 1FVFA 2A84A 2JKVA 2OORA 3LX4A 4MAFA 4G0ZA 2WU0A 3VKWA 4B5KA 3SIRA 2UUCI 3GT7A 3DTVA 2X7JA 4KGZA 3SD7A 3T4EA 2V3CC 1N5LA 1Z0GA 1FNMA 1VLLA 1BDBA 2HHAA 3SSMA 4L7QA 4Q21A 5J4LA 3HXOA 4EG6A 1OBOA 1VZ2A 2XE4A 2GAIA 2GTHA 3HP1A 2F9MA 1P2FA 2J3JA 3F97A 4MUBA 1GA6A 4ZVVA 1YI1A 3TJZA 4BGVA 4DLKA 1R0CA 5BQFA 5D51S 5DMXA 3ANNA 2V58A 1RRVA 1W4BA 5KEIA 4IGFA 2IK8A 4OI4A 1XOIA 4RKRA 4FLEA 4OL0A 4EMUA 3GJTA 1LLCA 4IHQA 3RFTA 5K8VA 3D3KA 2C7QA 4A36A 6ABPA 1J0DA 2DH5A 3O83A 3N6XA 4MKGA 4P4SB 5B2FA 4DPXA 3NC1C 4DUGD 1QX4A 3EGXB 7AT1A 3UXEA 4GRDA 3U09A 1ZK1A 3A2MA 1G5RA 2MR6A 4ML3A 5HILA 3T38A 3RYCB 3P2JA 2BMAA 2QTTA 2GKGA 1PDWA 1YASA 1BE8A 1BMDA 1ZVKA 2Q5FA 1FSPA 1R64A 1T1SA 1GZDA 4UD6A 1JMVA 2B9EA 3OJ0A 5HA5A 1BN7A 3BOSA 2HMSA 1IAQA 4QM6A 2QVGA 3GUCA 1Q7TA 4U7GA 1R8QA 3R7LA 5G53C 2ZS7A 3EEIA 5F35A 3L1UA 2WJPA 2ZR9A 3F9RA 3PZBA 4FSXA 5CPBA 3VR4D 2BHLA 2GBLC 2QN8A 4NJMB 2X5KO 3Q87B 2TSYB 3LOPA 2QGFA 3SJUA 3O4VA 1C50A 4D4JA 1XTJA 4B2IA 3BGIA 4I3HA 3M7ND 2WA1A 4H0CA 1FMTA 3HGQA 1XCLA 3SKVA 4V0KA 1DRJA 2Z6VA 3BCRA 4II3A 1Q0TA 3X1YA 4ZCIA 3MPUA 1WXGA 3ZM7A 1DG1G 1XCGB 2FW7A 2RDMA 4DLUA 3OFNA 1JPVA 1ZK0A 1J8DA 2B7BA 5BW8A 3LUAA 4NS1A 1PJ8A 3G59A 4NYIQ 5GONF 3UCXA 3V5NA 3WRXA 1X74A 4W8HA 1SULA 3FR7A 2QTCA 4FHZA 1Q1NA 2E49A 4HDOB 1H23A 4IMIB 4DUZI 4B7CA 3WIEA 2AK2A 5KJEA 5YASA 4DCNA 2FW1A 1E3PA 4C04A 3HWSA 3WIBA 4BLSA 1WSDA 2PUHA 4ERNA 3R9XB 1E9CA 4NNPA 3OJOA 3K16A 3KJEA 5FUQA 5LIPA 2OI2A 3GMEA 1D4AA 1N6OA 1Q3TA 1E1YA 2PSJA 2V96A 2ZRNA 3EFOA 1U04A 2W90A 3LIPA 4QPZA 4U6SA 1PBTA 4JT8A 1USIA 1P44A 4IMPA 4E5DA 1X8KA 4KN9S 4B4KA 1UWKA 4A27A 1FJHA 4RPLA 1R37A 2E5LI 4CGYA 1X8XA 3LBNA 3NORA 3ZE2B 3DOFA 3EISA 2Z9DA 4IHAA 4C88A 1HYQA 1K9VF 2R7KA 3WNDA 1E94E 3IUQA 1WZ2A 2OV3A 1JU9A 1E8DA 4LF8E 1HXHA 4GQUA 3J80A 2ZJZA 2JD0A 3DEFA 5D86A 2IL1A 3GBSA 3Q85A 1UK6A 4Q05A 2VDJA 5JCOC 1K1EA 4XTJA 3MW8A 2H0AA 3RSZA 4QYMA 5DTRA 1EM6A 3AQIA 1SEPA 4G5GA 2GS8A 3PBKA 4RW0A 2FUNB 2G4VA 2D2FA 5JRZA 2NZXA 3UT0A 3ESDA 4PTYA 2RIPA 5CDSA 3TBHA 4ZZIA 5HIKA 3IE2A 1ZD2P 1H5UA 1KVTA 5GY7A 1P1KA 2G9ZA 4CV0A 3QLTA 1RWKA 1Y60A 5F2KA 3KM0A 4FFOA 3AIMA 1IMJA 4JH0A 4MV6A 4QU0A 2A5LA 2XUIA 3KT6A 3TB4A 1AY0A 2ZT5A 3L7CA 5E38A 1E1LA 1M2HA 2QL6A 2NYVA 3V4LA 4B74A 3ABIA 3IUYA 2XSZA 1RHRA 3QZUA 4J75A 4DLAA 1UWCA 2FFJA 2GZHA 3W8NA 3ANYB 3MM4A 1JUDA 4JJAA 1QHNA 1SUPA 4L5AA 3FNFA 3VMMA 1KH2A 4MU3A 4M76B 4A5SA 4DJAA 9ATCA 4KK4A 4QLOA 4RF4A 3H1EA 2WLSA 3ROPA 3G8AA 2BISA 1JR2A 1YIDA 3MT7A 4G86A 3U31A 1Z82A 3GCMA 4K1LA 4BPBA 2HU5A 4LBVA 4DV7E 3A04A 2IVZA 3D5TA 4QT0A 1BS1A 3FMGA 4HDSB 5M04A 2CY0A 1CD5A 2DHQA 1M1ZA 3DKRA 4JJ8A 1EBFA 1U9JA 3VSDA 4YX9A 4IIVA 2XR1A 1N6KA 1OWPA 4MHSA 4BGEA 5ISMA 4AG6A 2ZTHA 3LUFA 4IEIA 4RVHA 3GN2A 1T43A 1VLQA 2A94A 1DNPA 2F55A 4MR9B 2XBMA 1T8YA 4YECA 2IY7A 5A2QA 1RLIA 1O03A 5DM2A 4IDAA 4CEJA 4JP2A 2ICAA 1WSWA 1ZH0A 5FBRB 1VKHA 3N3BC 1TF5A 4A8JA 3L46A 4PLZA 3CN7A 1L5LA 5J4KA 4I3GA 3TLZA 4BB6A 4WPGA 3BGDA 1KDRA 1QOPB 1D04A 1N6IA 3ROKA 3LFHA 2HN9A 2CK3D 4Z8XA 4QGFA 4Q4JB 3X1XA 3TI9A 4ZAZA 2ZWAA 1NRXA 1P9WA 2ILTA 2P2GA 4LJ8A 5CNIA 3UB2A 1W29A 5BYAA 5LQNA 1AUQA 1WUHS 4KJXA 5DRTA 4BBAA 2P1DA 3NBMA 3FCXA 5DWQA 5IBCA 1EMDA 4LYEA 4CMJA 4PSUA 2RGNC 1A50B 2HYDA 3K09A 4C0WA 3HR8A 3MXTA 2H3EA 4D25A 3PDHA 1RJDA 3E8MA 3JVEA 2XD9A 4XWOA 1RFGE 3DVLA 5EJ7A 5LKRA 2K87A 1FE8A 2OHFA 1X1AA 2NO0A 4LQ4A 5AHKA 2NPFA 1SXJB 2QTMA 2B78A 4EMDA 2GCEA 2GGSA 2J0EA 2QAGC 3LX5A 3GCWA 4IFTA 4UTGA 1AQNA 2FWRA 1RQGA 3KU4A 4MQBA 2JIBA 4L16A 1O87A 2CDCA 1ISIA 1A77A 3E22B 3KR1A 3V2GA 4PPYA 2WG2A 4ZT3A 2JEBB 1S02A 4MU1A 1PNTA 2QLTA 4LF9B 3B78A 1HZJA 1TADA 3HI6A 3IEPA 2BH9A 4ZIRA 4KX3A 1XF1A 4RK6A 4UC0A 2FOXA 2GEFA 2I4OA 3N7TA 5JH7B 3MERA 2AMJA 2XUOA 3FPSA 2FEKA 4C6TA 2XCOA 1RJEA 5AW7A 1G42A 5G0VA 1KJ9A 1QIDA 2V7UA 3C3KA 2VUIB 4B32A 3H11A 5KTSA 2R87A 5KZMB 4HDRB 4B8WA 4X00A 3V8QA 2TMGA 3HDYA 1RDFA 3K0HA 1XMQI 3K1AB 3KYDB 5U9CA 1VB3A 2VHEA 5SZKB 2N1MA 2Y2UA 3MEQA 4Y0AA 1Q16A 5DFAA 5LDGA 4K6OA 5JEAA 1VE9A 4UUBA 4TTSA 3E0QA 1N34I 1B8OA 3J81C 2RI1A 4NZ9A 1ADBA 4P58A 4XSHA 3UKOA 3C1TA 2WOOA 4ESOA 3WC4A 5KSWB 1ZOSA 5F2EA 5L3RA 4CEHA 1S16A 1P17A 1EGAA 5CA1F 2A1TR 2H4XA 2FPOA 3NIWA 3FD8A 1CKEA 3AY3A 2RHJA 3GUZA 4KV9A 3SIPA 5J23A 1NGSA 1MW9X 1PV2A 3VR1A 4D82A 3S1AB 3FYDA 1BH6A 2XCQA 1JG4A 5AUQA 2Y1DA 3B9BA 1A2QA 4AIIA 4GIBA 5KWEA 3MYYA 1S2IA 5CVCA 3H2KA 4DR6B 3ORQA 4GOJA 2HQSA 3OBBA 3PQFA 3W1VA 2FEMA 3AHJA 3KJZA 1YS9A 1HQDA 1I32A 1CJVC 1NBIA 1I30A 3FHJA 4J2TA 4NMWA 3RVLA 4J9UE 1Z22A 3W05A 1BU8A 1D2GA 1C7RA 1SIUA 1FF9A 3D1LA 3DMTC 3OZEA 4IS3A 4Y1GA 2VSFA 1H85A 1DKPA 4DBVO 3PT9A 1GKUB 3JQ8A 4FX2A 5P21A 5BR7A 4ZQEA 2JRCA 1F7VA 2QJRA 3L3BA 5JEAD 3QYJA 3ZHOA 4WEQA 4ZI3A 1PJTA 3R3UA 4DYVA 1QORA 2ZJBA 2HK6A 1E2MA 4Q3DA 1BHO1 1DZ3A 3IQXA 1A9TA 3WQQA 4C7KA 4EWLA 1ZGCA 3WZ2A 3AL3A 5IT0A 2OBBA 2P2DA 5KSZA 1UDRA 3EGDB 4GD3Q 3EBOA 3LUHA 5BYJA 3ZUGA 4WJLA 5C3MA 4QWWA 2LIVA 1HI9A 4BMCA 1BWRA 1Q5PA 3FPCA 1YRHA 3L8GA 4Y98A 5HF9A 1G7CA 1T6ZA 3PE3A 3QI7A 1CZKA 1SY7A 3QFRA 1U3GA 3DAYA 4YRJA 1XXHA 4U0KA 2ZUEA 3RASA 1JDBC 1NW4A 4R9NA 4GGPA 5IZ4A 3VH2A 3MOGA 4O5OA 4B3SE 1BX3A 4EECA 1R66A 3IEUA 2A5FA 4IQ4A 1RS0A 2IESA 1JTEA 1BZYA 4I46A 1C9JA 3LFUA 3ICVA 4MQLA 2AH5A 4X7MA 3KKQA 3K96A 5JXIA 3OPNA 2WDPA 2IV3A 1KYYA 1LVUA 3MA0A 3Q98A 4D97A 4DUYI 1JS1X 3PUXA 3AKYA 4DR7B 1N1EA 2NADA 2ZULA 4HQ0A 2DFKB 4IS2A 2Z6QA 2W2KA 3T5AA 1Z36A 3LUPA 2ODQA 4DAOA 5HGXA 3M4JA 2YZGA 1W6RA 5DYWA 4LCFA 1DKUA 2GZ1A 3OAAA 4JP5A 2YH2A 3DDWA 4KL8S 4KU4A 3ACDA 2HCBA 3IOEA 3WFZA 3SF8A 3JQ6A 3QBJA 4ZVOA 2WJIA 5A6VA 2P7IA 3HLTA 2PG3A 2HSWA 8ATCA 3ROQA 2RAVA 1PUXA 2IHJA 5AI6A 1N33E 1T0HB 1ZJZA 3LJKA 5BRJA 1RWMA 5KWVA 3STYA 4Q7QA 1SD2A 2D0IA 1QQ7A 1Y3DE 3GLHE 4WD3A 1X70A 5GP1A 5HMMA 3UMRA 2HXSA 2I29A 1DO8A 3GNTA 3T1TA 3AETA 4M0LA 4OHKA 3CS3A 3DSRA 1W36D 1GM5A 4BVGA 3WGZA 4NOLA 4YO7A 4IKEA 4YHHE 1OFUA 3AUFA 5ED0A 2HBZA 1Z3CA 1KP2A 3T61A 5LYJA 5AW4A 4JI2B 1QHFA 2AZDA 4LFAI 4H1TA 2Y8EA 3VOSA 3X44A 4TGLA 3HL0A 3TXYA 1E2IA 5EVJA 5TSDA 4QELA 1GUDA 1B8UA 1W4CA 5KI6A 2XHEA 3M6MD 1W5TA 2RG7A 1XMOI 3H04A 2ZJ8A 4KQCA 3PFNA 4LC9A 4OHZA 1Z6TA 5DHTA 4EYGA 1ZK3A 5ERGB 3LI2A 3KQHA 2XNDD 1SIBE 5GMDA 1R16A 4WL0A 3G1TA 1E18A 3JD4A 1Y6GA 3OD5A 4ICIA 1NSFA 2RGEA 1X77A 2VT7A 3FDXA 1QGZA 1DG9A 3SJZA 2C04A 2VK4A 4H7IA 1GAQA 2PKXA 4UW9A 4CDMA 2IS2A 4HAUA 2Q4EA 3LCUA 1GKYA 3IUSA 3AESA 2QMEA 1IVYA 1VYTA 3CMMA 2GTPA 4OJTA 4Q66C 5A0FA 5ABPA 2WWFA 1CR2A 1KEZA 2G9QA 3SYRA 4KMRA 5HF8A 3I9KA 5HOEA 5EFZA 3DFIA 3DEYX 1OREA 3E23A 4P5EA 4PNZA 5AM4A 2GB4A 5J4HA 2EFHB 4G5QA 5KYGA 2G77B 3QVGB 1XZHA 1U02A 2RKBA 1PSDA 5T6MA 1EUDB 2PGDA 2OAGA 1PZGA 5THQA 2DLDA 2ZQZA 4U0JA 1S2NA 1A27A 2A67A 3PRJA 4HL6A 5EERA 1UDOA 4IDQA 3ZCQA 5E7IA 2CHVA 4NENB 1I24A 3LPNA 1Y80A 2GBPA 4Q19A 5DX1A 1TYCA 3AUKA 4W5QA 5DHQA 4EA6A 3AO0B 2WOJA 3BF8A 3V7WA 1JPJA 1MRNA 1A5SB 4Q9DA 2IELA 3QJ5A 4ECEA 2CMKA 3IDFA 3SC3A 1OA1A 1WTAA 2IEZA 2GUGA 2QTVA 3N8NA 4M0DA 3GDGA 5FUBA 2FMFA 4JMPA 2XODA 2ZITA 2XGSA 3MILA 1H2EA 3EFHA 4NP6A 1F8UA 4P86A 1O0BA 4J03A 4PQFA 4AURA 3A4YA 4L5JA 3H1FA 3LWBA 3HA5A 3LDUA 4QTYA 1PO7A 1OX6A 1UMBB 4XI9A 2MMCA 4BNJA 3OZ7A 4B3JA 5KJCA 1RXCA 4ZVNA 1P2VA 1R9NA 1FFGA 1U28A 4BNVA 4B85A 3H7AA 1XNRE 1KPHA 1V8BA 2I8CA 3CG4A 4GKKE 4OI2A 1Z0JA 5LOVA 5EXXA 3BWYA 3MJRA 4YHBA 4N0MA 2BR2A 1KY4A 2VKQA 1T9KA 4M6WB 1U2SA 3BE8A 4PS1A 5E6RB 3MRVA 1AQYA 2ODEA 3GDHA 3JYNA 2Q4OA 4GW3A 5DNWA 2A4MA 1R74A 1W44A 3L7DA 3WKCA 1Y5NA 3ZHYA 2SKDA 2CDRA 4B87A 1PE0A 4EG1A 5BNZA 1PR4A 1UPUA 1JNXX 1GRCA 1GG8A 1VYHA 2JEZA 1FX0A 1UMDA 4HI0E 4JLBA 4PANA 1BJTA 1H5QA 1KGSA 3C3JA 3FVQA 4DARA 4IJVA 4WX2B 1ZJWA 2RD2A 3QKWA 3AI7A 2EW1A 2YJZA 4BNTA 4O5AA 4WE3A 4W1SA 1O95D 4J2OA 3KU1A 3EEQA 1P3JA 3EZ9A 1X0VA 3QVXA 4OQZA 1O58A 2NXWA 4HX2A 4OGFA 4ND1A 4DR1I 2YWHA 1NMSA 4L5CA 4ED9A 2XQIA 3EDYA 2Y71A 2EBHX 3PT5A 1Y4DE 1EDBA 3SYTA 1RRGA 3KLNA 3RYHA 2AOTB 3ERCA 5BSWA 2JBHA 5I7UA 4MP8A 1BWPA 1KVKA 3C6ZA 3FGPA 4ND5A 1VSBA 2GZ2A 3C8UA 1C3VA 2RHGB 2Y1EA 3PTAA 2QRVA 5G40A 4M0CA 1Q1GA 3U7RA 3UCEA 3PZRA 2O8VA 3GRKA 1ZIOA 2BEJA 4PO1A 1IB0A 4LMRA 3KYJB 1GHTA 5AM2A 4RVCA 1YJCA 2WE8A 2H2DA 3IR5A 2QGNA 2YXLA 3M85D 3JASA 5BN5A 2EJWA 1W2WB 1XNGA 4XAQA 3LZCA 2WQZA 1TYBE 3Q1QA 4P7FA 5E7MA 3W6PA 1FJGB 5E1BA 2R3SA 2R5WA 4GPIB 2GRUA 4M0PA 1AGYA 1PJZA 4KLCA 4IFDA 4NYMQ 4OOEA 3K0FA 5EAIA 5IJ0B 1XF9A 3DL0A 2CL6X 3DONA 4KVGA 1RKBA 4RZ2A 1V9LA 2QR3A 2VS1A 1Y7LA 4WOPA 1OWOA 2VHYA 1WZEA 5JO9A 4BRWA 4ETIA 5BSVA 1P7VA 1MLDA 2W00A 2RGAA 3HDVA 4BDSA 4DLLA 3P0RA 2W2TA 1V11A 4A9AA 2QPLA 2J5QA 4K9DA 2B30A 1Q2UA 1UXJA 3JV7A 1K75A 2V7XA 4LX8A 4B3RB 3E9NA 3EXHA 2FPGB 1X94A 4OBWA 5DULA 4LF4I 1JAYA 3W5JA 5IEJA 1NZFA 4R2MA 2BEVA 3EXEB 1TZ2A 3Q5GA 5GQSA 3DL4A 3ESQA 3H5WA 1KRWA 2KBFA 1LEHA 2I5PO 4ZEOA 3L7NA 4XRRA 2HCFA 1YJ8A 2VJOA 4KKVA 4QICA 4S2UA 5DSXA 5AR1A 1R3DA 3A28A 1D4ZA 4XQGA 2VWPA 1UBUS 1OSNA 2O5CA 3U9LA 3MWFA 4I14A 1KDTA 4KQFA 3F2VA 1IUPA 2CLDX 3IJPA 1OJLA 3QWBA 3RT7A 3BWEA 5EUCA 4IFDD 4RY9A 1FTYA 3NXSA 2R6DA 1KZGB 2FLKA 3FLEA 2L19A 2CLCX 2J87A 2WZBA 3NT5A 4P31A 3R7SA 3VOAA 4D5EA 4DQ0A 5KYWB 3KP1A 5A4KA 2A78A 1XBTA 3VO1A 1FA9A 4UUOA 1ECFA 4D42A 5F7ZA 2ZUSA 2JEAB 1TQDA 1YR6A 3F3SA 5ALJA 5A62A 1YK1A 3PYMA 3MRSA 2YZKA 2OOKA 4BZWA 1E4OA 3Q3GE 3NYRA 3WA6A 1MQ9A 2QL7A 2QRQA 4P38A 5F4ZA 3A3KA 3ZXSA 1IBRA 3GGDA 4GH5A 1Q50A 1ILWA 1QHIA 4HYMA 1MA3A 1YHZA 5CAEB 2XMZA 4A0QA 2C2KA 3KVYA 5K99A 1QRDA 1EK0A 1GDHA 1E6KA 4M1WA 3NDIA 1EJ2A 1QYDA 4JYAI 4JT2A 4Z7CA 2YY6A 4PNPA 1A76A 1G0OA 4GYJA 4GKJI 1TVEA 2Q41A 2VLBA 3WOHA 4DQKA 1BS2A 4F4JA 2PRYA 5T4BA 1ZIYA 4C4AA 2I2BA 4LUCA 4LY9A 5DW3A 5EZSA 4JI8B 2QXUA 2WD9A 4HN4B 4MULA 3WMFA 3DKKA 4HLCA 3DQPA 2R66A 1M2VB 1KFBB 2CUKA 3CY6A 4RGYA 4TMWA 5D5HA 4E5VA 1P0CA 2BRUC 3JRNA 5IDXA 2AFHE 1QP8A 4ITVA 4A92A 3NHRA 3TECE 2XB6A 5FTWA 2XNCA 3PI6A 2JAQA 1XTUA 2JFQA 1LUAA 1TECE 3Q9SA 4IIBA 4OB8A 1PL0A 4L28A 5MN5A 1DAKA 1W8IA 3G1UA 3JWPA 3PWTA 1MJHA 3T54A 1MX1A 3PQCA 5EXEA 5TT0A 2XVZA 2P4HX 2F48A 4LHXA 4HAZA 1IYZA 2C84A 4OREX 2E21A 5BMVA 3RAFC 1VG9B 3DB1A 4NCIA 4ZCLA 4X54A 2DECA 3I1YA 3ZS8A 3QEJA 1HE8B 1RRFA 4LFBB 2Q1YA 1Z33A 1T6BY 3DUFA 2QLFA 2QVZX 3FDZB 4FGJA 1FDVA 1BX0A 5JD3A 1QH0A 3E35A 1SQ6A 1KHTA 2VHJA 4Z4FA 4EHIA 1LRJA 2J6BA 5ICFA 2QQ0A 4HDMA 2IOFA 4I0WB 1QJ4A 3O7MA 2PXHA 4FHFA 4L3VA 5G0UA 3JAKA 1E6WA 4XPIA 2VQFE 1L4NA 4TV8B 4MVJH 4NPHA 2HHHE 2A5YB 1JH9A 2BCEA 3R7WB 1BQ3A 1M6VB 2ZVJA 3SE7A 1IAVA 5LZ2A 4TYWA 2OILA 4EDFA 2V0CA 5BR1A 5IPFA 3LV8A 5A4AA 4J0HA 2OBXA 5KOYA 3U56A 4URWR 2GEDA 2EL7A 2OD7A 3IDZA 2VQ3A 3U39A 2PLNA 2X1MA 3IH5A 3U4QB 3ONDA 1DG3A 4XX0A 5CB8A 4G0VA 1B42A 1L4LA 1UM9A 4MRPA 3VNBA 1LGYA 2X5OA 3I01A 3DVRX 4WLOA 4R40A 4TMTA 4LVUA 3AK4A 3TCNA 5J2TB 3CIFA 1C3OA 1Z47A 3AI3A 3IHKA 5HHTA 1VYUA 3P94A 2IZ7A 1WW2A 2XTJA 4NG4A 3IAM1 3ZDQA 4EJ2A 5LZ7A 4IUYA 3M1IA 2PFGA 4CIAA 2BI7A 2XDWA 1E9RA 3RWMB 1ORIA 1RE0A 1U81A 4QC2A 1UOOA 1YR2A 4HRXA 4OHWA 2OBFA 1U2RA 4WNAB 1ZU5A 4RSHA 2WNRA 4CM8B 4W9NA 2JDIA 5CVTA 2VH2A 1Z3IX 4UHBA 1JI3A 1DQPA 1GTL1 1ZW1A 4UVGA 4RETA 1TQHA 2ZPAA 3GJ0A 3DDCA 5CHEA 2CUZA 5GOTA 2QV7A 2B1IA 1Z2DA 2ZGVA 3BAZA 4L6CA 2PJDA 5EUMA 1R18A 3I83A 4E70A 1Z0CA 5C46F 1Y34E 1OTXA 3KSBC 5CB6A 3IA7A 2LKCA 1R5OA 5CVUA 1U4SA 1U7OA 3P9YA 3YASA 3F7NA 4QUKA 1N78A 2M6LA 5LZ8A 2CYAA 1PSWA 2XHZA 2DPGA 4BUCA 5T4EA 1TT5B 3DKPA 2AFIE 4O2BA 4B3FX 1EA7A 2K6GA 2RGDA 3ETNA 4DF3A 1GPJA 2YIMA 4PSVA 2DCMA 2H1FA 2WZCA 2ZSDA 3RAGA 5FHQA 1RHYA 3AEZA 4ZOCA 1SZDA 3OUTA 4O3MA 1WD5A 2O3SA 2CVPA 2OXEA 2RHWA 3TZCA 1YRAA 1AC5A 2NAPA 5IJ9A 1G5FA 4NK4A 1P4AA 4OHFA 1BS9A 1D8AA 1K6MA 4R8MA 2I6XA 2F9FA 1IBKI 2ZAMA 5DP2A 1S3GA 5H3CA 3SLKA 8ABPA 1N77A 2WJYA 1J0BA 4OFXA 3VR6A 3I5YA 1YC2A 2FX2A 1SOVA 4O25A 3IOCA 5JWRA 1FU8A 4G5OA 1YQDA 2ZCUA 3I2KA 3R6DA 5LUAA 1SPXA 1FDTA 2IYTA 2NYRA 4RUKA 5IWCA 4D9JA 1ECGA 2Q46A 5CT4A 4DV3B 2O2YA 1R27A 2VAWA 1QRTA 3PRHA 2H9IA 4QPDA 2CVHA 3RUEA 2FVXA 3K32A 1RC8A 3KB8A 1CRPA 2VH1A 2YXBA 4ZZ0A 2I2CA 1E3MA 2XKKA 4UJ3A 1ZQ9A 1Q0ZA 5AWFC 1ADJA 1ZUNB 4KR3A 1SRQA 4LNUB 5FNVF 4Z3OA 1ES9A 1JLRA 3NRJA 1SPBS 1MUUA 4AYWA 2O8DA 2X8AA 4P0QB 3HJGA 5LFAA 1A6FA 3BXPA 5ESRA 4A91A 2FR8A 4R51A 5K0NA 4ER0A 4BEVA 2VZEA 3JQAA 2EKZA 2GN1A 4YP9A 1YTUA 1MR3F 3KVRA 3PHJA 4UNSA 2VJCA 4HUQB 4A5OA 4AJHA 1E6EA 5JD4A 3FWNA 3KPJA 3TW8B 4BLPA 3EEOA 2IPNA 3E9RA 3KEMA 2Q5QA 3NRBA 2YW2A 1Q1ZA 4WJKB 4WZAA 5FYDA 3RU9A 3SAJA 1E3EA 1FNSA 1YQEA 1P9OA 2UUAI 4L8WB 2BFPA 1JLMA 3CT4A 2CV0A 4Y3UA 4POAA 1NI3A 3ICQB 1J2TA 1PVVA 1A9YA 3HU3A 4B48A 5EWLA 4WLVA 5KTOA 1GRNA 3UJPA 5KTTA 2F4VI 4Q1AA 2IOFK 3G2IA 3KV3O 1OWLA 3WBFA 3QVTA 4DSTA 1ISSA 4X66I 2CZGA 1S6YA 4FOPA 4KWIA 4JC5A 3AW8A 1RPTA 4YCMA 3K92A 5ITSA 3EMVA 4G4GA 4TMVA 4XEUA 1HL7A 2WFLA 3ULKA 2QRPA 3VC1A 3VRHA 2AF3C 1SG9A 4JJ6A 3UWOA 2O19A 2CMDA 3TJMA 4IZKA 2MSLA 4LSGA 3W7BA 4KFTA 4C7OB 3DLBA 4G3XA 5KQLA 4RPFA 2IZ0A 2WSIA 2DQ4A 1DUSA 4ALMA 1HFKA 1TM2A 2ZJ2A 5EKWA 3JQAD 2JAPA 4E3ZA 3VH3A 4WLNA 4BECA 4ER6A 1T3LA 3N0RA 5TPWB 4B4WA 4MU0A 2PGAA 2XBUA 3GHHA 2YC2C 2BZGA 3N7UA 4BFXA 1BD4A 2O7NA 3O8OB 3GP8A 1JT9A 2PA3A 3QKSB 5AH0A 5LMUB 1CRLA 2XZTA 2V97A 4FUTA 1B73A 2O0KA 3QEKA 4NJOA 3EBPA 3B89A 3TSAA 3TW6A 5LXTB 3JAWB 3EF0A 2QG9A 4TZKA 4YRGA 3PC2A 3S1LA 2O2HA 2TMDA 4JVLA 3T94A 4MTCA 3VHXA 2HMTA 3WICA 9LDBA 1DJQA 4KQJA 2EZ4A 1M1YA 1WP4A 3T0GA 4F85A 2FZKA 4WKOA 3A6LA 3M6XA 4QKQA 4BY9E 2BM0A 3DBRB 4YJGA 1OF1A 3FYUB 4J9VA 4LXQA 2HK9A 5ECYA 4CKEB 5ILOA 3KEGA 4LPSA 3TBFA 5KYUB 2CKMA 1DADA 1R50A 1REQB 1WMSA 3EDOA 3HHEA 4GOMD 1FCJA 1HZZA 1KR2A 1NE2A 3K8YA 5AICA 1GQOA 4YUAA 5IKEA 4C30A 3K9CA 1PG5A 4TVKA 1HMYA 2BF7A 4RAQA 1G3IA 2MJLA 3O4FA 3EA4A 1NMYA 4BLTA 4EITA 2JCSA 5KYYB 2IX3A 3TF5A 3UGQA 2XDYA 2ZZMA 1Z59A 2AUMA 3RLFA 5C1IA 1F8XA 4QUBA 5SICE 2CHGA 2R85A 4BEJA 4R3WA 3IIKA 1IRIA 2Q5IA 1E2KA 4IY1A 4QUJA 1N0VC 1NXVA 1PLLA 2N46A 3T7KA 3V1TC 3TMYA 4C0QC 3ADOA 3VAAA 1RMYA 4TKZA 3CISA 4H15A 1U7ZA 3IR7A 1GNLA 4BRZA 4YAGA 1C4WA 3LUDA 4FQ7A 3WYCA 4P7JA 2PA0A 2O2EA 4LXUA 1NASA 4N0DA 4RHEA 5B6PA 4N6GA 1T2NA 5TJHA 4D0LB 1YVRA 4CIWA 5C7YA 3H97A 1RCFA 1JIQA 3PNKA 1Z9BA 5LCXA 3K8QA 1SOMA 4RC9A 1PAUA 3KSDO 3WB9A 1QAOA 3HR7A 1BFUA 3NAGA 4KPGA 5TEWA 5T41A 1DIHA 1H66A 1OBFO 4DNQA 1J23A 2PXCA 3VDRA 1HTBA 1CUCA 4EOGA 4A0SA 2FX3A 3EUFA 4EPYA 2NP6A 2ATCA 5EP1A 1WDWB 3AGQA 4OOFA 2Q5OA 5DM4A 3HNPA 5AVUA 3C6XA 2QHXA 5AHWA 3ZHZA 3U7GA 3EXIA 3COSA 2IWHA 3CZCA 3CX3A 2JFNA 4ZI7B 3JQEA 1OVMA 1SCUB 4PLYA 5CRIA 5D6NA 1PK9A 4ND2A 4MO9A 1A8QA 2AQ8A 1ZL2A 2JANA 1GZSA 3EHDA 2OR3A 2O05A 2A7XA 4HX9A 5IHXA 4L4ZA 3UT5A 5D85A 4IHKA 4K6MA 1IHXA 5FPYA 2GNPA 1X1EA 1JU3A 4ACAA 4QUIA 3PKZA 4BX3A 3KHKA 1WDLA 2VTDA 2A9OA 2EBWA 3VQTA 3DMFA 4I8DA 1SBQA 3SXJA 4ZYYA 4OX9B 2FVYA 1BEZA 4FYXA 1YTLA 2X9NA 4HLQB 1AKYA 3A1CA 5U1PA 2B4RO 1WNTA 3RV3A 3U1TA 4CMGA 5CFZA 2R1TA 1Z0FA 3RF7A 5CLLA 3TKAA 1G63A 3PFBA 2HNBA 2PO1A 5DIZA 3RJMA 2GPNA 4FEGA 4BO3A 3PQ2A 3T9EA 1KS2A 1Y63A 3NU1A 4PTZA 2DWUA 1G1MA 2J65A 3PVZA 4PV7A 4E5NA 1QKKA 2W43A 3G0IA 3IAXA 4P8RA 1W46A 1YZLA 2UV8A 3OF5A 1T5TA 3HDTA 4MI6A 3WB2A 4EVSA 1FMFA 1PYDA 1MENA 3LTOA 4X3CA 4LVNA 5LB2A 1HNWI 1P2BA 3MJFA 4IH9A 3O1HB 1BMFD 3NVAA 4I2VA 2PH5A 1FUUA 3PFKA 5K5EA 3RC2A 1EDDA 5IT9Q 2DQYA 2V5AA 1U8ZA 1YRYE 4MUFA 3WKBA 1SU6A 4J8PA 5K36B 3D8UA 3DE5X 4TQ9A 4FCCA 3L6DA 4JJKA 5CUQA 2A1IA 3RO7A 4W7IA 4U2FA 2P90A 1VZ3A 3FRIA 4ITRC 2DZDA 2HTFA 3K0CC 5L3SA 3D3NA 4XR9A 2EFCB 4GOXA 3ICPA 1OWNA 1E2QA 1OXSC 3N0WA 3PD7A 3UAVA 3LLSA 1KE2A 1KU6A 1MEEA 4JC8A 4CTKA 2A0UA 2XVMA 2OV8A 2EFEB 1ZGBA 4D8VA 4MRRA 4CCAA 4PXYA 2BFFA 1SD1A 2NP7A 3W4KA 3WRYC 1BE1A 4ZDKA 4LF7E 2IE8A 4BJ3A 3EQ6A 2AJLI 5AW6A 5G3ZA 3L8ZA 4DC9A 2OENG 3OFJA 3DD1A 3R8XA 4DJJA 4LWPA 3FETA 3Q9UA 1K4KA 1NF2A 2ZBRA 2AW3A 3ZW8A 4G0QA 2YQ5A 4X90A 2ZIFA 1V41E 1T2CA 4CZ2A 4YRKA 4BASA 2NTNA 3DZKA 5GZ1A 3JRWA 4HEQA 3NASA 2FLVA 1GL6A 4FJ1A 3ZNQA 3RFXA 2GCOB 3Q8MA 1QGDA 4E22A 2GM3A 3L02A 3RS5A 1T5BA 1E0KA 1QTNA 2AD1A 2L82A 1C4OA 4I1UA 4FX5A 4ISCA 3UQZA 2I76A 1QCCA 2UUCE 1WMEA 3AVOA 3LE8A 3L0BA 1CUUA 2ZANA 3EA5A 3K0KA 4UUMA 3SHVA 1M0TA 1ZMTA 2PLRA 3DG9A 3M70A 4ZTBA 3KKOA 1QPGA 4U6NA 3IOMA 3MSXA 4JYCA 5EJGA 4D8UA 3QBDA 1QO0A 4BXOB 5D2CA 3TOCA 1WB6A 1JBEA 2VP0A 4L22A 4ALKA 2G5CA 4ROTA 2ZKIA 3P32A 1XDWA 1JDPA 1XHKA 1NTRA 2BGMA 2I8LA 2UVPA 3A36A 1YJ5A 3CZMA 3FCAA 2A9KA 1WCIB 3GRPA 4HWGA 3PHGA 2JK1A 4Q9JA 2PZMA 2ENWA 3BQ9A 3GPCA 3L8FA 5BUQA 3VZRA 1IBMB 2NZ2A 3VSCA 1P31A 2V1XA 1L7VC 4WTOA 1OH5A 2AMYA 4A4DA 4AT1A 4DB2A 1NVDA 4XOIA 1ZMBA 3IQEA 3U4GA 1UQRA 2QJOA 2M6RA 2DEJA 3RUAA 1XTVA 2MINA 3IRUA 2PMWB 4GR9A 4M2LA 2VNHA 4V0OA 5H81A 5TGZA 4CQMD 5ITWA 1XRPA 4IX9A 4TLDA 3RT1A 4AB1A 4LNAA 1ZH4A 2YOFA 1B4DA 1O96A 4QGBA 1Z8FA 2Z3ZA 1JAZA 4MZDA 5E7JA 4TOIA 1D5CA 3VSBA 1E3WA 3P52A 3SM3A 1Q44A 2WTEA 4UM5A 4BO9A 2JLVA 2PRKA 3PHCA 2P6OA 3OMLA 2IGBA 3OP1A 1W5EA 1Z29A 1JJBA 2ETXA 1JDSA 3JXEA 2JCBA 5E1MA 3JYLA 5ES4B 1P0FA 1QFSA 2JI7A 5EIHA 2HSDA 3IKJA 2AX3A 4MQEA 2WIKA 5GJCA 2YY7A 2I03A 1IG3A 1PR5A 4B34A 4FPXA 2IHVA 1NPDA 3QLVA 4NVRA 5ENVA 1B41A 2X36A 3PUIA 5DTMA 4TS1A 2H85A 2J45A 3C70A 3EFEA 2IEBA 3IAS6 2J0UB 1Y42X 1RWPA 4FZRA 4Z6KA 2RMKA 2YKGA 1QSGA 3FBTA 4MWSA 2BFCB 1XZLA 1J7KA 1G8HA 4DUZE 3ZZNA 1A04A 1FDOA 5DRYA 4G6ZA 2PPLA 1VE1A 4PIMA 4WT7A 1OUMA 1WA5A 3GDOA 1UDCA 5ADWA 1Z6QA 2IBSA 1DQNA 5CM8B 1RYZA 4OBEA 3LP6A 3PX2A 1E3JA 4L8LA 5B3JC 3OPXA 1IHYA 2P41A 3E7FA 4NS4A 4W6ZA 4C3VA 1AGXA 4E32A 4CLRA 4J07A 1NVGA 2BMWA 1AG9A 4AJIA 5C0XA 3JARB 3QKRA 4ARZA 3BRQA 2QTFA 1P7WA 3R5KA 5CFPA 1K5PA 2E5LE 4C4OA 3DWGA 2ZYRA 3MFYA 3QEOA 2IYVA 2Z04A 4LV5B 3TQQA 1JEAA 1PWXA 3N8DA 4CW7A 1VG1A 1PTJC 1FJGI 3L7KA 2B8TA 2CB9A 3DCJA 3SX0A 3EASA 1C0PA 1C0KA 2R42A 1TKBA 3HP4A 4QREA 4F38A 1RMTA 2BEWB 3KELA 2R6GA 3RU2A 4RTRA 4J16C 2OK7A 2RAPA 3HEBA 3THXB 4MPJA 3LYLA 3IUPA 3DO6A 3KYCB 3TTVA 4DDUA 1QU2A 4Q48A 1CSEE 1G2QA 1MFZA 1V4NA 4KI7A 4IICA 1IJEA 4LHVA 5U4QA 2PGLA 3OJWA 2Y2VA 3LSTA 4YJ3B 1GPBA 5LBTA 1L6RA 2ABWA 2I1LA 1Q57A 2NPIA 1P0IA 4HNGA 1TPYA 2LNDA 3D6TB 4B3RI 4MCHA 1MX0A 1U9IA 4RIEA 1DKMA 1BKYA 2E4ZA 3ZHSA 5DNDA 4PS0A 2Y92A 3ANMA 4QRHA 2C2OA 3NZKA 1CU1A 1VL0A 3DFFA 3ILVA 3GGGA 1VC2A 2VT2A 3OZAA 4D9EA 1A1VA 4YRQA 5LQJA 3LPLA 5C0XD 2JGEA 4PIPA 5H0IA 4B6EA 4Y0VA 2I1WA 2UXDB 1LPSA 2E4UA 1XLTA 1RFLA 2VPWA 4CG0A 3KUDA 2JGMA 3W9SA 4D56A 5BSTA 3X3HA 5JC1A 4TLAA 1WPGA 1GN8A 3MMNA 3LW7A 2W2PA 1R6UA 1ZGZA 4KIWA 1P9NA 4LRQA 3RC1A 3ZHRA 3PS9A 1YBMA 4UBOA 4X1IB 2DWCA 5AI8A 4BAGA 3G6WA 4UVHA 1FTNA 3SX4A 3K4HA 5DOVA 4X62I 2K2WA 3DT8A 1M33A 4UPVA 5FOWA 3ZQKA 1JHUA 1FSZA 1GEEA 3BHIA 2XGGA 1GPNA 3G8DA 1QIHA 4K40A 5CMLA 1C3XA 5CH3A 2D62A 3QV1A 2VJDA 1TB4A 1DJNA 4GICA 3KTFA 1VJCA 3HI4A 3K15A 3FWZA 4NBWA 2PRJA 2ZYTX 2ZDGA 1KWKA 3I1IA 4U2EA 1TZKA 1VG8A 1WUTA 2D8AA 3V8RA 3KJXA 1IIBA 1Q0LA 2BFDA 4BU1A 3K0AA 1NI4B 4AD8A 5CT9A 8AT1A 5MGBA 4EPRA 3WLKX 3QT6A 3IMCA 1C8LA 3ZBUA 4OFWA 4QRIA 3LTNC 1T2VA 2HCJB 4XGQA 3OECA 2F6RA 4CG3A 2EHDA 3P4YA 5AXCA 2HRDA 4J0KA 1Q2XA 3B9QA 3TAHA 1L9KA 3VH4A 3H4LA 3NCHA 1X1RA 1H3EA 4S1OA 3THSA 3K2EA 3OOJA 5L7YA 3EIHA 3AG5A 4RS4A 3BZUA 3JWEA 1GRVA 3HUFA 3DDOA 8LDHA 2JIDA 4G81A 1Z2PX 3IHWA 4BV3A 3T9AA 4YR7A 2I91A 1IB6A 1ZUD1 4GI2A 4I4TF 2ZRDA 2AOXA 4D02A 5EL0A 3TQOA 3I9OA 1D2MA 1A2BA 3PPYA 4ALNA 4DSNA 4YREA 1BKNA 1RR9A 1XP5A 2UVQA 4PGHA 2D00A 4TLLB 3V1KA 3ZTTA 2VATA 3MHTA 5IJXA 5ECWA 3M4YA 1GTMA 4C3UA 2ZDQA 1GADO 2H31A 3VHRA 2OV6A 3UK6A 1NVEA 4LQCA 2ZJYA 1RLJA 4MU4A 5CYOA 4CLHA 4CTOA 3AXSA 2CSXA 3K1TA 3TLEA 4YMIA 2ASEA 2JLUA 3R5JA 3WQSB 2R4UA 4DRXB 4YRSA 3ILXA 3R3HA 2FW0A 3HCWA 2JHPA 4DMUB 4TVSA 2Q4RA 2ISSD 2HPVA 4ZMSA 2BLNA 3ZY3A 1NJSA 1M2FA 2IU6A 3MCTA 4OUKX 2BMEA 2JFPA 2JFVA 3DLTA 1Q92A 1XMQE 4A6PA 2AVNA 3WKDA 4RA9B 3EFOB 3KUCA 4JQOA 2G07A 1MZPA 2HHJA 1KEWA 1LX6A 1ZC3A 1N34E 3DQQA 2M9MA 3CGGA 3DLPX 3EH2A 3GO4A 4PC3A 4REMA 4ZWNA 3WXMA 4D9MA 2PZFA 4CM5A 1V5EA 4NMMA 4NF2A 5LL6P 1I0IA 4P83A 3QKUA 4CR6A 4RELA 4N5IX 2LDBA 3FTPA 3TJRA 4R1MA 1CUEA 2ZYUX 1LF0A 2QD5A 3QF4A 2N75A 1Y1KE 3OBIA 1AKTA 1PKPA 3C7AA 3Q72A 4QOSA 2UUBB 3TLJA 3Q7IA 1YL6A 1OROA 1NN5A 1OFTA 1ORWA 1MOZA 3BB4A 4M8SA 5EINA 2RB4A 2O3RA 2VHVA 2F2TA 2IYXA 4UUQA 1I4LD 4PYJA 5JSYA 4LZJA 5K0SA 4OAOA 2RH8A 3AOGA 2PNZA 1UXOA 2O52A 3M2TA 5I4IA 2J7KA 1FDUA 2G8NA 2OKCA 1ZO8A 3PNBA 5FP0A 5TQ0A 2XT9A 1HRKA 3CW8X 1CR4A 1B8VA 3HRKA 3L6CA 3LP8A 4LOAA 4QJ3A 2HK7A 5IYZA 3KFXA 1LTKA 1TF7A 1DPFA 3IXMA 5B1EA 4F06A 3X1DA 5M29A 2V5UA 3H05A 5L7TA 2JKYA 4U3JA 4ZN6A 4WIAA 1OYVA 4ID9A 2CE2X 1ILEA 5LU9A 1Z17A 3SVZA 4WOBA 1BAPA 2R1ZA 3O95A 2H2AA 3NHKA 2N3ZA 4OSOA 4CI9A 1YZNA 2J3EA 1JZQA 4YAEA 2DKOA 3EZYA 1IY8A 4UCQA 1LQTA 2R8OA 3VDXA 3CKYA 3RB8A 4EZEA 2QNRA 1UT6A 2IU4A 5AI9A 3GMTA 3ONEA 5BW4A 4KPEC 1JA1A 1KDVA 1BXRA 4BV9A 1C3LA 2R60A 4N6NA 4NNJA 4WLEA 2FWIA 1OZFA 3Q3EA 4D98A 2DT5A 4FEYA 1WHTB 3PUZA 5TGTA 3HUEA 4J1SA 4PX5A 1B7GO 1SCIA 2CVOA 4V2UA 1F12A 1LTHR 4BNKA 2XMBA 1Y4SA 1RAGA 3EIQA 3IKTA 5TX7A 3TNJA 3ZY4A 3MAJA 4DV4E 5K36F 1NF3A 5HMLA 4BO1A 1NAIA 4DUYE 1Y3BE 4OIMA 3TSYA 1LSJA 1FUEA 1HNNA 3BA1A 3AB7A 3N8HA 3QXJA 4YT5A 5FA8A 4C1NA 5IK2D 4JXZA 1GWNA 4Q03A 4R9SA 4Y2PA 1UINA 6YASA 5DNUA 2NYAA 4OB7A 3NDBB 3LX8A 3STTA 4D41A 4TQAA 2CN1A 1P6XA 4BLOA 4DXHA 4M36A 2H11A 2WWTA 4NAVA 4RM3A 2UYHA 1WMDA 1KVRA 3LD9A 2NU7A 2HGZA 1DB3A 4X7RA 1TVMA 1GZHB 4MXDA 1Z5GA 3AI1A 4LF6I 2BSAA 3NALA 1GU0A 3WBKA 4ZCSA 2QU8A 3G68A 2AKAB 2Y05A 1HR0B 4G23A 3I4LA 1IWBB 3TBKA 1U0TA 4C5BA 2Z1DA 3FNQA 3HJUA 4ZT4A 4OK3A 3NJ8A 3UTCA 1YR9A 2Z09A 1JLSA 3CIOA 1ODFA 5GAJA 4M8LA 2YWGA 5KKCA 3MIZA 4KRYA 4PC6A 4WASA 3HVKA 4JEHA 3V4PB 4GKVA 1QO9A 1ZJJA 3LK7A 4JP3A 4PR3A 4LFAE 1EVZA 3WSVA 5AESA 1TQ8A 3HBMA 4PAGA 4PC7A 4G25A 2WM9B 3EARA 4V03A 3FSJX 3V1LA 4R4JA 4V3BA 3SFVA 3V8VA 4RD4A 3JYHA 4ZO7A 3KXLA 1XL1A 2BKUA 1XRMA 1XMOE 1KO8A 1KS9A 4QBHA 4BVFA 1THMA 2Q62A 2IT1A 4MYHA 4XLLA 5HTOA 1CEYA 4G1FA 1U5AA 4FHEA 3DP7A 3G2LA 2B7CA 3COVA 5AKXA 2H7VA 5JC8A 5TXGA 1FDWA 2ZRBA 3BE4A 2VJLA 3IPAA 4LQLA 1X7WA 1G4UR 4OJQA 2FF5A 5DYIA 3VUFA 3GMIA 4JI7I 4C6TB 1NW3A 2R68A 2NN6A 4B80A 4JMLA 4ZOBA 3WHKA 5CBPA 4FW8A 3QPWA 3H11B 1OD6A 2VJAA 1S4QA 1Z7WA 3EPJA 1NXXA 3CKLA 5AW3A 3UG6A 2XYHA 1UADA 2REBA 2GETA 2V6BA 4B1FA 3E0XA 4H6XA 1IBCA 5JEAB 2JH8A 3BEOA 1IZZA 2FSFA 5IM5A 3RUHA 3B6ZA 4CL3A 3I45A 5DT9A 1GQYA 1HDEA 5JCJA 1KIJA 4GECA 4CEHB 5EKXA 2OXIA 3KYIB 2OGZA 4RU1A 3Q8LA 1JDUA 2Q8PA 1ZI8A 1IG0A 3IVGA 3C15C 4NOKA 4E1AA 1U3CA 1QVVA 1I7LA 1HY3A 4NXMB 4CMIA 1L5GB 1UBSB 4F45A 5L3JA 1TM5E 4JB8A 1RJGA 1AKUA 3DZHA 2B69A 3HL4A 4AP9A 4IZIA 4YFYA 1OXUA 3NTUA 2O6HA 4MRVA 2YMMA 3W4IA 3HXQA 2QLNA 1A9XB 4MW9A 1RI2A 2JJ1A 4BYGA 1WUUA 5HUQA 5JZMA 1WBJB 4RDCA 3EGEA 1O5OA 2JJQA 1K8QA 4DM4A 1IN1A 1DTEA 3IIIA 1GRRA 4IJKA 4J0FA 3FPLA 4RD3A 5TC4A 4JI6B 1L5FA 1UK9A 2GYWA 3LX6A 4J0CA 2IHUA 2J3HA 4NZMA 4EW2A 1GZ6A 4YWJA 1XNQI 1YDHA 8ADHA 3JSXA 5I8WA 2V6MA 4D5GA 1Z73A 3B1WA 5FDFA 3AM3A 4YLEA 2J67A 3JQ8B 1G21B 4J6EA 1GL7A 1JKFA 3LY5A 3NCTA 3B5IA 4P7KA 4BKQA 5JDIC 3C3CA 1KKUA 3UK0A 4EUEA 4J0IA 3WG9A 4MUAA 4R68A 1PR0A 1OX4A 2Z5BA 2BEUA 4EY8A 1MJNA 3C14C 3CEHA 3RFFA 4RVGA 5JALA 4D0SA 3DE2X 5AVSA 1R0KA 1US8A 2JJYA 2QQEA 2FCRA 3H6KA 5E4TA 2JLYA 2WFZA 3H1TA 4RJIA 5HE8A 3BJZA 1Y33E 5I45A 2P9BA 3J7TA 1T3ZA 1XXHB 2Q1UA 2B83A 3T7IA 1XCJA 4J4HA 1OYWA 3H1GA 1X7ZA 2JJ1D 3H1CA 1GO2A 4KVAA 2C0QA 3HM2A 1GGEA 1V4BA 2NO6A 3H4TA 1FLNA 3OA2A 4E03A 4EEZA 3CRMA 3V2UC 1MC1A 3HY6A 2OCBA 4ZJYA 2O0HA 4DDHA 5G41A 2UXCI 3VJLA 3C3DA 2O1SA 1XO1A 3MHPA 4W7SA 2O1TA 3AWDA 4YDHB 4L85A 2DPLA 4NZZA 1WULS 1EPUA 2W2KB 4DR1E 1XTTA 5F9FA 2MU1A 3BSFA 4UNQA 4ZZ3A 4EH1A 1XNHA 3AMVA 4WESA 3N2ZB 3GD7A 2JS7A 2X41A 3CF6R 4KO8A 5ETJA 3S6JA 4N41A 3S7TA 3WYGA 2O2GA 3KQPA 4EFMA 3SF8B 2IC5A 1G3MA 2ZR8A 2J46A 3USES 5L4SA 3EWIA 1CDZA 3E84A 3LXMA 1JPNA 2DBZA 4YAJA 1CY0A 3M5PA 2OFPA 3VGJA 2GBLA 2C5GA 2W98A 4MP6A 1CERA 3AYZB 1K2WA 4YDSA 3KXIA 4Z9XA 3D4PA 3A9WA 3PDJA 2NMVA 2H8GA 2H48A 5CEJA 1AV7A 3AETB 1YKGA 2XIJA 5INTA 3A9UA 3ND8A 2TMYA 2WJVA 1SBHA 3N86A 1M7BA 2R86A 3KTAA 5LYJB 4D3FA 2PT6A 3KHSA 3CZRA 3K70C 5IT9C 4OX9I 1DU4A 3WOVA 3JQCA 4JUBA 1RAAA 2BAGA 3S40A 1GSHA 3N58A 1JEEA 2IIBA 4NCJA 4UZEA 3SU8A 3UJHA 5HIAA 3KJNA 5JPDA 3NBUA 2XQVA 4N82A 3G8BA 4O4JB 2X7IA 4TWIA 5A03A 4S2EA 2P78A 5I6DA 4XWWA 1LH0A 2LBPA 4MCAA 4OL9A 1EVYA 4BO5A 5FPQA 1T1IA 4RGQA 1L7RA 1VYVA 3OQNA 5K3CA 3G6KA 2VBCA 3JYPA 1IN7A 4BPRA 4D9KA 3HQ4O 4HXGA 3OE1A 2EJCA 2IGTA 1QIKA 4KRGA 1MGPA 1V1JA 5I8ZA 4C6HA 4DIKA 3UPTA 1YQUA 4O4IA 3AZPA 1QAMA 2X1HA 3HFJA 4K9LA 1N32B 1IWOA 3AHEA 3M82A 5IZCC 3DNPA 2INGX 4U2KA 1NDQA 3L0CA 3AFHA 5K0ZA 5DM70 5K05A 2YQZA 3AESB 1D2CA 2EDCA 4OY3A 3KSAC 3C43A 3VPFA 5DCWA 3DHWC 3UANA 5HBGA 1LZKA 1UJNA 1FU7A 2WG0A 4MV7A 2YHBA 2ZBDA 3FDIA 3WV5A 3LY8A 1E66A 1JVBA 2RKOA 4KHZA 4ZZ2A 1UC5B 3WWYA 4E5UA 3LWZA 4KLAA 5DXJA 4YWHA 3W2TA 4K1XA 1J9ZA 4MV1A 3VC3A 3KTOA 3JTEA 1CIJA 2IHBA 1CQZA 5HTKA 2ZTLA 4KQGA 5JCOA 1HT1E 1OYOA 1SVNA 1ZLXA 4TWAA 4U8GA 3LFTA 2BP7A 2F00A 3RC3A 3FLAA 5AW5A 3UMVA 4M54A 4Z7YA 4OYHA 5FADA 3E58A 4XVRA 4YJDA 3FB1A 3TDKA 2PMKA 3B6KA 3RHZA 2CEAA 1WCYA 2NVBA 5ALDA 3O03A 1KNXA 5K51A 5DGIA 2PQMA 4IO0A 2PL5A 4XM2A 4IFEA 2OEPA 3ABOB 3SBEA 2E85A 3VU0A 3W1WA 4QNRA 2BDEA 2RG1A 4Y1EA 1YE8A 4B3TI 4MX8A 3T3DA 3C3YA 1QRAA 3GT4A 3GYBA 1ZI9A 3WGGA 2NUBA 2PWBA 4YUZA 1PFUA 4Z9YA 4JYAE 1XN4A 4HDAA 3SHWA 3LF1A 3ABQB 3N5KA 4HAYA 5GADl 5P8WA 2Y66A 2WB4A 3KD3A 1EQUA 1GQQA 4GKJE 3TR6A 2OP0A 1M2KA 2EKQA 3AZOA 4KUEA 3ZE1B 1U1IA 4WOCA 3KE9A 3DMNA 1PW5A 4RHCA 1QH1A 3FKQA 3IB3A 4CTNA 5A3SA 2M6KA 4EKNB 4ZXPA 1CJBA 2OCGA 3PXBA 4XUEA 3GLFA 3U40A 1CETA 1ZHFA 3KZVA 3QJGA 2K2QB 4JLNA 2PUWA 5PNTA 4EVRA 2DFLA 1QWSA 2QTNA 4JGIA 4ZRDA 2ESRA 4EYQA 1W59A 1VECA 3FYTA 2BA0G 4OQMA 6REQA 2VNJA 4RD6A 5LOVB 1R1DA 2GEKA 2NT4A 2V6GA 2BR2B 5CDUA 1IBMI 4A8JB 2Q6KA 1EFKA 3BORA 5IS2A 1GTRA 1BWQA 2P6NA 2Y1LA 4PZEA 3CCCA 4WZ6A 1NKSA 2ZROA 1ID1A 4ZU3A 2QIOA 4MWCA 5K20A 4AKGA 5BOVA 5JY6A 4GPD1 2Z1MA 2Y67A 2PUJA 1I3CA 3DZBA 4BO8A 1UMDB 5K7SA 1W2HA 4FD3A 4JI0B 2EZ8A 1XA3A 2EZTA 3R9WA 4JI3I 1MFPA 1IZ7A 2I4MA 4L6IA 3CO5A 1ATZA 3H4VA 4YCAA 2A2CA 1ZKMA 1HNXB 4II7A 1JV2B 3AUSA 4MW0A 1AURA 2FXVA 4EY5A 3N74A 4LXIA 3I53A 3L9XA 1EUYA 4UOQA 3RYHB 3BWXA 1XHEA 4DQUA 1YRBA 1Z16A 3UT6A 4I99A 1I94B 2C03A 1HOXA 1W34A 4MRSA 4EG4A 2QRVB 2HH9A 1VDMA 2RGNA 1XD2A 4ESEA 4JS0A 5B64A 2OCAA 1Y4UA 4S0XA 1SXGA 4EL5A 1E32A 2C8JA 4QVKA 2OAEA 4KXQA 3JASB 5BN5B 2DJ5A 2QD2A 1ESNA 3G7UA 4XJTA 2QAGA 1M1XB 2ODPA 1PZEA 3QXGA 1L5WA 4PXSA 4UTRA 2XUDA 4EKIA 5E2AA 1QIFA 4IFDB 3I37X 3RROA 1EGMB 3GPIA 3K0FB 5HQTA 1FYFA 2FSUA 2OP1A 5KU1A 1ZFNA 5J5CA 3FGNA 2ZI4A 2WTUA 2IX9A 3R0VA 5LIRA 1J2JA 1NIJA 4XVUA 1N92A 3VZSA 1KVQA 1GDDA 1KYZA 2EP5A 2OHJA 3F3MA 4HFNA 3VR6H 2F3PA 4E4TA 1M5RA 3EPHA 1R0BA 1AE1A 4LIPD 1B6RA 4ZO9A 3FWYA 1LX7A 1JHVA 5JYCA 2DBRA 1LLDA 1NJGA 2AN1A 4A1FA 1C9KA 4QU9A 1BGWA 4BUZA 2BEVB 3O1JC 5L4LA 2O3TA 3U26A 3USZA 4ZOLA 3ZIDA 1RSZA 2HRQA 4PY2A 5K6TA 3J81A 4YGXB 2Q3FA 4OK5A 5FPHA 4M37A 3L6UA 4H7HA 5AW1A 3U16A 2YHAA 3A26A 3HCNA 4PFSA 3CNHA 4TXNA 3V46A 4XTRA 3NM5A 2RHCA 3AIKA 2VFAA 1XE3A 1M7HA 4HZGA 4Q9HA 1N9GA 1RAFA 4BWYA 2NTJA 3KJQA 3M1LA 3PDIA 2NV0A 3OZGA 2J3DA 4YRFA 3X43A 1DUIA 1ICIA 4TUYF 4EATA 3ETHA 3RJ5A 1QB8A 3UMMA 4MIKA 3D31A 2Q29A 5EIWA 3R20A 2YBDA 1EE2A 3IP1A 3DZCA 1N7GA 3ZE6A 2H2FA 2NYUA 2ZM6E 3ANXA 3DOOA 1NQ5A 3KOOA 4L76A 3FPAA 4R1PA 2IEIA 4RV9A 4LX0A 5B53A 3OY7A 4CHTA 1YQWA 4ILKA 5FL3A 1E62A 3DMTA 3I6QA 3MJVA 2R5NA 4ZV9A 3SX2A 1IBKE 2GJSA 3V80A 5JFOA 3ND6A 4JWTA 3ZTYA 3LG2A 1RHJA 5BSRA 3SXUA 3WYNA 4BTLA 3N7AA 1EVEA 1YONA 4YT8A 4G56A 1MGOA 1Q7EA 2CXHA 2GF9A 2PS1A 3ET5A 4B43A 3RSQA 3VVCA 4FW3A 1SBCA 4ZICA 2GJ8A 3GPLA 5LD2C 4N8EA 2QLMA 3KPWA 1B00A 1W4LA 1C2YA 1OA0A 3FKSA 1LBIA 2XUPA 4QLAA 4YMWA 1PFGA 1TW3A 2WSLA 1KI9A 1DAHA 1E61A 4INJA 4JI5B 4HQOA 2FNAA 2DCUA 1BFDA 3IAFA 2VSYA 3ETDA 5CB4A 2C95A 3M6AA 1KHHA 2QUJA 4PF1A 3JVUA 1T9DA 5GGYA 4AFNA 1TRHA 4QODA 2H1OA 5C7LO 5KQSA 2HMAA 1FVOA 2JAWA 3DVSX 3JVVA 3KFLA 1CE8A 2WW4A 2PX5A 3L0ZA 1AO3A 3B60A 4E51A 1Q95A 2WD8A 5JXGA 1NJ8A 3WWOA 3QBEA 3M4NA 4G8BA 1D5WA 1QYCA 2FFQA 4JBXA 3VNSA 4GE3A 5CR9A 4BNDA 5AHXA 4EB6B 2IXGA 2Y4OA 3IHTA 5BMVB 2UUPA 2XQFA 2PTGA 4RIIA 2PXAA 2UUAE 2OXTA 3V4SA 1YJXA 3IT2A 1WBBA 3WJ2A 1ST3A 1GKIA 3Q4GA 4XIIA 3OPYA 2C7GA 1YCHA 3LPDA 3P45A 1W0KA 2VQDA 2GPBA 3ZHBA 4XCVA 3THYA 1V8FA 2IQ5A 3O90A 2F4VE 1DJPA 5KQGA 4NAHA 1T10A 2DBYA 3IPRA 4X66E 3G5UA 5FBVB 3K9NA 3JAKB 1K3TA 3PCTA 4ED4A 4DA8A 5A4DA 3ADBA 3I2IA 3CKKA 5LMZA 5LLTA 2BH2A 3R09A 5GMEA 2V9PA 2XB9A 3LQYA 1U0LA 3OICA 4HJRA 3B1FA 4F3NA 2OGUA 2ONKA 3QXCA 3LF2A 3ZGOA 1Q6YA 1P4GA 4Z0PA 3STHA 4AS2A 4IJUA 4EARA 3REGA 1W19A 5T4FA 4K3VA 4DLWA 2DKNA 4F6RA 3EC2A 1ZK4A 1T1JA 2BPOA 2P7HA 1T9GS 1ZMOA 4L0CA 2DUJA 4R84A 5KX5A 1Z4KA 3OE4A 3L07A 1EFVA 1JG2A 1QV7A 4EELA 5CCBA 3CPSA 4J29A 4LTDA 5KSPA 3BWBA 3FI9A 1NW9B 2BSXA 3G2NA 3I62A 4BEBA 1C3OB 2JGKA 3M9WA 2AJCA 2Z8YM 3DCNA 3OQHA 2OCKA 1YDGA 4LTNA 3GJZA 5E4JA 1W0KD 1GSAA 4PX2A 5AD1A 3IEKA 4C01A 5JQGF 1I6WA 3VPHA 3C8ZA 2FMXA 2BMDA 2J3QA 4PZAA 3UCFA 5IKPA 5M5BA 5DBGA 4K88A 1RVV1 5DTJA 4QDXA 1V48A 1P3Y1 2JLBA 3CR3C 3DE3X 2GA8A 3ENVA 4QPNA 4PO8A 1NT2A 2CBXA 2OZLA 1IEVA 4IMJB 4WN3A 3FUWA 1ZH6A 2E4XA 1UBOS 2WU4A 3CCFA 1DFHA 4RKQA 3E27A 4UFNA 3RSCA 3RRYA 1HYHA 1H2ZA 1I1OA 1MO3A 4KQWA 4OQ4A 5C8YA 5THXA 5JT1A 3RQIA 1M6YA 4EHKA 5ARBA 3PNLA 5BQXA 3Q3JB 1P39A 1HH4A 3R5SA 4L50A 4MR7A 4XCQA 2II6A 3PR3A 1E8MA 4V0LA 3V97A 4GO1A 3FBGA 5F3WB 3FBWA 2VP9A 3MTQA 4PRXA 1VJRA 1Y1TA 1QH9A 1INLA 4ND7A 2WF7A 5FJIA 2VC2B 3NGXA 3WLOA 4WCVA 4BHTA 1S1CA 3TLYA 3GIDA 3IOYA 5ADHA 2R1VA 3RVRA 2LJPA 4LW8A 3AJEA 4K6GA 1OYSA 4FEAA 4Q3AA 4Y18A 1E1KA 2I2AA 4V0SA 1GKLA 1KSFX 2J9GA 5KMGA 2FGKA 2VQEI 3CONA 2P2YA 5HCNA 5K3DA 4LHSA 1KSHA 3VU9B 1WB4A 1SKAA 5IJ9B 3K35A 3PDWA 4RCVA 1RYYA 1S8OA 4KAJA 3RTGA 3ZOZA 4BNGA 1L7MA 2IKSA 5KTPA 3I5XA 3EAGA 3P9IA 4P7GA 3OMXA 4O4JF 1HM5A 2A4KA 1ORHA 4FONA 4GVLA 3S2UA 4ZQCB 4BNIA 4H6PA 5L8VA 1PKEA 3HCPA 2OA0A 2AXEA 3HXMA 1JIIA 1LK0A 3B1KA 1S3FA 2IYSA 2BI4A 2LCFA 1VKOA 3H2IA 2KW5A 4TWJA 1U99A 1Y3IA 1UJMA 1D8TA 3H2BA 5K0LA 4E5KA 4BMZA 4TZ0A 4PLPA 3BSYA 2GJ9A 2PX2A 3UAOA 3QEBZ 5K6AC 5FB3A 1J0CA 4O8CA 1TVCA 2X6RA 2W42A 4DV2B 4FC6A 2O8DB 4KQ2A 1ATIA 1O89A 4BMVA 3V00A 1P1BA 1Z07A 2FZLA 3LBYA 4QXRA 5TF4A 4YT2A 4LSMA 3A4LA 2A3RA 2PVCA 3VR0A 3BF7A 4K6FA 4UE2A 5BN1A 4FM9A 1TC1A 3JQAB 5DGCA 4G24A 1SBTA 2DETA 5JNWA 2YYYA 3GRVA 4BWVA 2KQUA 2GD0A 3PITA 4O8ZA 1FFXA 5HOQA 2YR0A 4K8OA 3VJRA 4I1SA 1E2FA 1FP4A 1TKCA 4WZAB 2NG1A 4KOEC 3SZRA 4QIHA 3WP0A 4BBPA 3UHAA 5JZSA 3MYRA 5HZHA 1HF3A 3ABSB 1AN0A 4KWEA 2OFFA 3ZV6A 5FBKA 2PZBA 3MT9A 3NX4A 2R8YA 2VJNA 2J0VA 5HPYB 3DDSA 3G0OA 4OKSA 2I2FA 2PZ8A 1AQJA 3II6X 5BUCA 1VCIA 1AS0A 1F14A 3PC8C 1XFAA 1HNWE 3NYQA 5AVKA 3THWB 4D1YA 3O9MA 5IH7A 4BA1A 3DPUA 5BVHA 3EA0A 3Q2OA 4TXMA 1ANKA 1SZCA 4QLBA 3OF2A 5ECDA 2WFLB 2PWPA 1G16A 2VHUA 1W5AA 4M4SA 1NVUQ 4O4LF 1DEAA 1F0PA 1Z08A 3H17A 3JQFC 4HO1X 3I09A 1D2HA 2F90A 3MCWA 4PPNA 3OKFA 4QULA 3AVYA 4IVNA 5ERYA 1J8YF 1G8AA 2HV9A 5FBWB 4QGSA 3GEHA 3N2KB 1S7GA 1G7RA 2LKDA 2GYVA 3QT8A 1HQCA 4FFRA 4ZYWA 3G8CA 4ZU1X 5T5QA 5I9IA 1G5TA 1NQTA 5JY1A 1LDYA 3HJRA 4JUCA 3I28A 5C4GB 3SBXA 1M74A 1KH1A 2OCPA 3N0XA 1ZXLA 1WXEA 4WA7A 5K3BA 3L4KA 3WO1A 2LW7A 4UOZA 4TXJA 2OSVA 4R1NA 4RF3A 4ZQFA 2PKQO 2ORIA 1MJFA 2C0PA 2P6PA 3HSYA 4N39A 4Z9BA 4OBBA 4BCBA 4CXMA 3VHXB 2V59A 3B5JA 2O7VA 2ZXEA 4FFPA 4QTXA 4XD7A 3ZLBA 3FGZA 4DILA 2X0RA 3K85A 4DMCA 1ZVQA 2BFEB 1M1YB 3EVZA 2VYND 3MUOA 3NHUA 3SJCA 1TYEB 3T1VA 3W7AA 1KEVA 4YJGB 5AVQA 2CGEA 3BIFA 2R3VA 1V7QA 3NHZA 1WD7A 5F7XA 5IM4F 4BLVA 4H7KA 1KIMA 4FIZA 2OVBA 4RLQA 1TFRA 1WXHA 2IEDA 5IABA 5TNXA 3HO8A 4NG5A 4WNIA 4XFJA 4K5QA 3SPXA 4ZHQA 4D96A 3C6MA 1FZQA 2IF2A 3TQIA 3TIFA 2BSQA 1W8DA 1DSSG 2ASVA 4LWOA 4DDMA 1N9ZA 5KYUA 2YMPA 1MQAA 3UWKA 4KK3A 1WTCA 2TYSB 3MVEA 4RVSA 4B7UA 5C3UA 3GLIB 1N5DA 2YWEA 4U2BA 6GPBA 3HMQA 2Z8XA 1ECPA 2G0TA 3EVDA 3Q5DA 1R9MA 1TYAE 1MU5A 1M3SA 3BAFA 3ON5A 1ZHOA 1TM1E 2RAUA 4TMYA 4TTRA 3MIIA 3LYUA 1JHXA 1YZ3A 1Z0AA 5ENZA 3UNXA 2BM8A 4B6GA 5BMOA 3KQNA 4OLBA 1TFUA 1WG8A 1V35A 4GZMA 3UJ7A 4LBZA 2C2ZA 1GITA 3JD3A 3MSCA 4QL3A 3WLJA 3ZXYA 4MARA 3ZKBA 1LZLA 2VWGA 3CBGA 1V8ZA 4IFDF 1IUNA 1ZAKA 1XTBA 3KLMX 3VHQA 5BY2A 1PKXA 3M3PA 1H3NA 5HXAA 3BXOA 1YE5A 1MC5A 2FQQA 2BKVA 4OYYA 4ARVA 3AZQA 5LUBA 3BD9A 2BKEA 1VHQA 5TRTA 1I5RA 5AVXA 3IT0A 1ZSYA 2W37A 3FDJA 1OIWA 4CV1A 3VX3A 4H7DA 3PNQA 4A0FA 1NA5A 3RK0A 1Y9ZA 2M1ZA 1T0UA 3ZZUA 1KFEB 2QNIA 3EX7C 1JHMA 1YOBA 4GBED 1PDVA 2W71A 4XQ0A 1DHTA 1ST2A 1E7WA 2BRUA 1DC3A 2XCUA 3VU1A 2IHYA 3I2GA 1XAJA 3O74A 3GUVA 5FI5A 2O57A 4ZZ1A 3ELDA 1L7NA 2GRAA 1S8AA 1O0SA 1U11A 5FX2A 5J43A 2Q99A 4MW5A 3BFXA 3EF3A 3L4BC 5LU8A 2N0SA 2BMFA 4HGZA 3T4UA 5JMTA 4B3DA 1AXEA 3NM6B 1G8SA 1XHLA 4QOEA 4WW0A 1YA8A 5IHPA 1OXKB 5KWSA 4QAQA 3OZVA 1KMQA 3TW4A 1XTIA 2ZPUA 1WOYA 4EYKA 1N6RA 2OO3A 2DFVA 5E9AA 3ZUPA 2GO3A 2R1TB 1IZ9A 4D2IA 1FWKA 3AVPA 1PIWA 2PO1B 1TEXA 5EHZA 1JIUA 3H1PA 4I5IA 3UAWA 5CEEA 4H6VA 3LC1O 1UBCA 3IBGA 3U3KA 4M0FA 1EFPA 2A9JA 1TGYA 4FT4A 5EMLA 3ENWA 2BELA 4KSBA 1WZIA 1OI2A 2D06A 2CZCA 3MUFA 3BN3A 4FNGA 3W5AA 1DAPA 1TT7A 1P33A 1FJGE 1KJJA 2XWSA 4KBYA 3WYEA 5FWXB 3SLGA 2ORVA 3WR5A 5JCPA 4DV5B 2PGJA 4GC5A 1NUAA 3SHQA 4RTOA 2AE2A 2YCLA 3CU5A 4L0QA 3HB4X 3DHNA 4XIJA 3QENA 2VWQA 2B3TA 3N8KA 1ND6A 5JVDF 3A9TA 2H8KA 1KY2A 4RV5A 1Y5LA 3B38A 3U48A 2CMFA 5HM8A 3VPBA 5DBHX 4RQAA 3ZC3A 5AUPB 2IYOA 5DH9A 5L3SB 3AFNA 1O8CA 4EPVA 2HKJA 2E3JA 1HDIA 1JYEA 3PJEA 1ZISA 4NBSA 5J1TB 1L5OA 5KVVA 5HJ5A 1E4VA 2WKQA 1YJBA 2DTDA 4Q7KA 4R2WA 1JVNA 2BFFB 4MOWA 1EVQA 1R8SA 5TB5A 1N36B 1T0IA 4H7JA 2WJJA 4OMDA 4GLBA 3GJQA 5JD5A 3C3XA 4LRSB 1N32I 3OOHA 3T5MA 5DRRA 3PPIA 1A5ZA 1RBMA 2WUGA 1JKJA 2AFVA 3Q9NA 4EB3A 3T5GA 4F56A 2SBTA 2RH5A 4UBMA 2PSDA 5ES3A 1XD9A 3RYFB 1EGVB 4FKMA 2NN3C 1EFCA 1YR8A 3S81A 3QU5A 4OPMA 1PGJA 5JJ5A 1QVAA 3ILYA 1P7CA 4BJHB 2QN7A 1Z7EA 3VPAA 1W1WA 3R5HA 1JFSA 1TYZA 1ZXBA 3PR2B 2BHNA 2C5SA 1C30A 4H60A 4IUBS 4BN4A 4EVQA 3OQ6A 1Z0TA 2X76A 4LJRA 4YRTA 3TFQA 4X62E 3WXBA 2ACEA 4FWTA 4GKJB 4WBSA 2ZS8A 3N70A 3BRCA 4X44A 5JTUA 3GZNA 3AHHA 1YMVA 3D6FA 3WLMA 3ZNNA 1L6IA 3EULA 5H9VA 3EVFA 1O6BA 1OE0A 4CQJA 3HBNA 2CLFB 2UVPB 4M8NE 1YRLA 2VZLA 1ACMA 4QQ8A 3W3ZB 3IQIX 4Q4DA 2RGXA 3RHFA 3CDJA 5SY4A 5C35A 3KEQA 3R77A 3MGAA 1MHPA 4PZ9A 1UKYA 3HKBB 2QW8A 1DBPA 4JYZA 3D6HA 4IIXA 3BXZA 3X2SA 4ZJUA 2PAAA 4EPTA 3RHSA 3QNMA 3V48A 3MFQA 3Q7QA 3FFXA 1H42A 3WK9A 1N8NA 4MV9A 5HRAA 1D4FA 2NXNA 3DZDA 3ST7A 4J0DA 2VSOA 3IO5A 1B3RA 4ARSA 1CY6A 3G1WA 4OTZA 4QARA 4F8EA 2FA9A 1DIGA 1O96B 5EPEA 3VV3A 1SNYA 2JIQA 1FBNA 3E3LA 4LJAA 4IZ6A 2YYAA 2HA4A 4DLVA 3HYCA 3OX3A 3W6NA 1Z5AA 1V8OA 2GPAA 4CPDA 1AU9A 3P8ZA 3OJFA 1K4MA 2VHWA 1HURA 4DA0A 5A4FS 1TNDA 4JAVC 3KLPX 4C5CA 2ZUWA 4AI6A 2PBRA 4FDUA 5I4CA 3EIUA 3HDJA 3NHPA 3O3CA 4OQDA 4ESHA 1OXBB 4Z5XA 2VTBA 1JEJA 4TQGA 2R84A 3ASUA 3LDGA 1U1GA 2FPUA 3ZIUA 4RMNA 3KQUA 1KERA 4CYMA 4UNIA 2FN8A 2K4MA 1CRQA 1R4MA 3WJAA 4NE2A 3L4SO 3VMFA 1MEOA 3L77A 3KHTA 4G1EB 5DPMA 4JI0I 2QL5A 5H3HA 4YJFA 5DEIA 4QYWA 3R0ZA 2PYZA 4M0KA 2ZJ5A 3F5FA 5EN4A 2G28A 1QIIA 4HAOA 4GZ5A 4XVHA 5BT8A 2PUEA 3OSUA 1L1EA 3CH5A 1FXWA 1E3QA 3UOGA 3GLHA 4S1VA 3LRXA 1GU7A 1K86A 1ZH2A 4LDNA 1JXQA 3L40A 4MW1A 4U8HA 3CLRD 4XARA 1MORA 4LJSA 1WXDA 2MSCB 4DR4I 3MXOA 4CMCA 1F3LA 4G5YA 1QNFA 3A6KA 1GR1A 1MA0A 1TYDE 4WVFA 4F96A 4GX5A 4QO8A 1BIFA 2ZJ7A 3V3TA 4EZBA 2JAOA 4JEMA 2GSDA 1I94I 3NTXA 2I3GA 1XDZA 1HUQA 3P20A 4B45A 2R4TA 4CLRB 1CQJA 2G9VA 2JLSA 5C0XB 5K3SA 4BOYA 4DBZA 3QKRB 2HDOA 3T06B 1F4LA 4ARZB 1ETUA 1XPRA 5FOSA 2I6TA 1T4DA 2HHCA 3ER9A 2WB2A 4YASA 3TEFA 2QUAA 3ZH9B 2QE7A 1HLGA 1J24A 3L8CA 1NF8A 3OQVA 4TMZA 5SZIA 3I9MA 2V34A 3ZY2A 2VDOB 3GI1A 4AO7A 6CHYA 3LOQA 1DKNA 4OHVA 1MB2A 2LRHA 5EXPA 4YUXA 2YVAA 4G1CA 3UXYA 3KX2A 4L3OA 1XQ9A 2JBAA 2FN3A 3AV0B 5GJVC 4PNEA 3I8OA 3ZI0A 1G20E 1DI0A 3KWJA 2RCYA 4KO2S 3WYDA 3BXFA 3O47A 2V7EA 5CFLA 5EC8A 4TYNA 4MWEA 1OZHA 2NNWB 2YMLA 3ITEA 3AINA 4KQKA 4KQXA 4L4XA 3IQDB 2JC3A 2QVLA 5AKKA 4B71A 1QGOA 3FJOA 4YP5A 3IX7A 3MJDA 3ZCTA 5IX8A 3C4VA 3PEFA 2ERYA 5BV0A 2Q5LA 2IZZA 3GLTA 3KVNA 3K1YA 3LZ6A 3QUTA 5LDHA 3DWIA 3UATA 1F0YA 1T26A 3WLEA 4WLFA 2AI3A 3SQXA 4QX6A 4ZK6A 2P2ZA 1C9YA 1KXJA 1SKBA 4HBZA 1O4VA 2IWRA 3ACBA 4OH1A 5KREA 1CYDA 4Y7CA 4GQBA 3DAPA 1SA0A 4MA0A 1I6KA 4E1BA 2EC5A 1FWLA 1P77A 3CLTC 4G9BA 1W94A 3A27A 2C5EA 2OBYA 2PNLA 4L5IA 2ZSIA 3A6ZA 4Y1RB 5CJJA 2YXPX 1H2FA 2YUTA 3O3NB 4IGKA 4WBNA 5B30A 5KO2A 5HGJA 2PZGA 1KP3A 4LJ6A 1SKYB 2DH6A 4FYYA 2JEOA 3V7UA 2QT0A 3B13B 5B6JA 2P9FA 5JRDS 4G67A 7MHTA 1HKHA 1KZ6A 4LOIA 2ZRPA 5AOCA 1L8LA 1Z4IA 2EFJA 3V7YA 1QRUA 1UJBA 2OL4A 2OLEA 5CT6A 2RK4A 3ZV5A 2MYTA 2C5LA 4FYMA 4PC2A 5FPPA 3PYGA 5AO9A 4XX1A 4R2HA 1RCTE 2BFDB 1K6IA 3T5CA 1UKBA 2IV2X 3MWLA 3BQNB 1XVUA 2FDCA 2C7BA 5JS1A 1Z5NA 1KOLA 4KUHA 5K8IA 1QYIA 2X5NA 4KO4S 3ZW9A 3HVJA 1ZITA 5U4XA 2H29A 4I9UA 3SZMA 2W2LD 3LXRA 2VF7A 1NXTA 3Q88A 3QEMA 2QN9A 4JQSA 4LF6E 2BZ1A 3PSHA 4KN8A 2QBYB 1MVLA 1P73A 1E5LA 3NONA 1YS2X 4M22A 1HT2E 5C5IA 3LO5A 1ZRHA 5LQSA 3R3VA 2XOXA 3WQHA 1NW6A 1PVGA 2E9SA 3WZMA 4NPAA 4DZTA 4CGZA 3NATA 1P74A 1N2JA 1Z62A 2AX4A 3C5WP 1GZ4A 3PG5A 4GI1A 4ZAYA 4UEJA 4JV5B 1FL9A 3TNDA 3HKMA 4FWHA 4MKHA 5C4IA 3SHTA 2DWQA 4GNKA 4L8FA 5HZGA 3NAQA 4OYLA 1Y98A 1ZUIA 4ZANA 2B20A 4JUFA 4QUEA 3AJAA 2UXBE 2FOLA 1PJAA 3QI2A 3X2EA 2E82A 4G4JA 2UVDA 1KO1A 2LDXA 3AH8A 4I4IA 4KFCA 5B3LA 4DPWA 2AC2A 3AUAA 4MV4A 5L3VA 1GRQA 3KOYA 3VBEA 4A2CA 3CUTA 4JHLA 2OV1A 3RC9A 3FOAA 4XGIA 3EPLA 3P2IA 3QUBA 3KB2A 2L17A 4JI7E 5AI0A 3SR3A 1J0AA 2Y0EA 5I7RA 2PUAA 2I4IA 5B2ZA 4C1BA 4QUHA 1MO6A 3IS3A 4C3OB 3QPBA 4IPTA 4L95C 3UIEA 4P34A 2QG4A 1C1XA 4F4HA 2QSZA 4AMYA 1SVUA 4NCHA 5REQA 5ELLA 5IKXA 1JKXA 1V9SA 1RYNA 2D13A 3CINA 2CL5A 4X65B 4G2NA 2G83A 2VZ9A 4WK4B 5IP5A 5EP4A 4HTFA 3KQQA 2CFTA 2NSYA