1Y6ZA

Middle domain of plasmodium falciparum putative heat shock protein pf14_0417
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
242
Chain Sequence
PIWKQDEKSLTENDYYSFYKNTFKAYDDPLAYVHFNVEGQISFNSILYIPGSLPWELSKNMFRGIRLYVKRVFINDKFSESIPRWLTFLRGIVDSENSKMLSIINKRIVLKSISMMKGLKETGGDKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEFYSINSGDKKTDLDSYIENMKEDQKCIYYISGENKKTAQNSPSLEKLKALNYDVLFSLEPIDEFCLSSLTVNKYKGYEVLDVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords heat shock protein, putative
total genus 78
structure length 242
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y6zA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y6zA02
2O1TA 1Y4UA 2IOPA 2O1WA 1HK7A 2GQ0A 5FWKA 3Q6MA 1Y4SA 1Y6ZA 1USVA 2IOQA 2O1VA 3HJCA 2CG9A 2O1UA 3PRYA 1USUA 2CGEA 3Q6NA
chains in the Genus database with same CATH superfamily
1L8AA 1W1IA 1UDOA 2WW8A 3EPPA 2RKBA 2CEKA 4KSBA 2FP4B 2J9GA 4E1BA 4NAVA 3E9NA 1Z74A 1ULBA 1EXMA 1OLUA 2W2QA 4DR6B 2PNMA 2B4YA 4RZ2A 2NUAB 2EU8A 1PJSA 4X8MA 4QJBA 2O8FA 1NXVA 3VI4B 2OKGA 3KOXA 3NM6B 4XD7D 4DBVO 3LWNA 1CFJA 1WZCA 4BWGA 4PEVA 1SXQA 4LF4B 3W9YA 1JXAA 5LMNE 4DTCA 1B6RA 3AWIA 3T7KA 4V39A 3L7AA 3VSEA 3ZQ6A 3NXKA 1ONSA 3KVOA 3D8SA 3IULA 1LU9A 2BT4A 4HY1A 4CKWA 3RYIB 3M6LA 2PUDA 1QHSA 1SCUA 2IODA 2Q4DA 3G59A 3HCOA 2FPRA 2Q4OA 4Z86A 5FR2A 3UMMA 4JI0B 5U1PA 1JHVA 2R2AA 5FO1A 2PJRA 2O0KA 3FTDA 4ZODA 1YNOA 3DZJA 3PDHA 4ZZ2A 5LIPA 4LF7I 4GC9A 1NVAA 3C7AA 4RMJA 1QH9A 1U98A 4MUIA 4N12A 1AUQA 4W1RA 5C80A 5B4UA 3T1YB 2XTMA 3GUYA 4AFNA 3GEMA 4XVRA 2FPWA 1BW9B 5TVGA 2RHCA 3HO1A 1Y6FA 3PS9A 4LG1A 4QREA 5JZBA 3O31A 4BBPA 2CNOA 3H5TA 5EP3A 4AWBA 1KZ6A 3DKRA 5AK6A 2HEGA 1QQ6A 2VYVD 1YASA 1H5NA 4MJ3A 4YY3I 3HPRA 2D54A 4JEHA 3DBHA 3AR9A 4RLFA 3WK8A 1I1OA 3G68A 5JCOC 2FRDA 5JJKA 4PRXA 2VBIA 4BB5A 4DMUB 2E49A 2WHRA 2GF0A 4CNBA 1U8ZA 2YS7A 2FX2A 2G5TA 3N7UA 2FPMA 1KOJA 1TQ8A 3TQIA 2HJWA 2GAFA 1JDBC 4OZEA 3SNHA 4DAEA 2ZDGA 5D6NA 6CHYA 1JDUA 5M3BA 3GDWA 2VP2A 1Q7RA 2X0RA 3VNVA 1KOLA 1Q7TA 1V45E 2ZPTX 1A9YA 4DHEA 1Z3IX 2JEYA 3S55A 1MG0A 1BMQA 5DYWA 4TTVA 5DTRA 3AU9A 1GYRA 1T2NA 2VF3A 1DHTA 1NSTA 2IHBA 2EQBA 2YQZA 5G02A 2O1EA 5HCUA 4OGFA 4Q3NA 3N6RA 3KOZA 4KE9A 5HF9A 5IM5A 2CL7X 2CNKA 1TO2E 4I1SA 4UT4A 4PWYA 2FSSA 4DV0I 1E96A 3B1FA 4BO0A 4O2BA 4BMVA 2B1QA 2JLCA 1YSCA 2NTEA 3QHQA 5BYJA 4ENRA 5CEEA 3IUPA 3U4AA 4ARSA 1HUQA 2NU9B 2XOXA 2VEDA 2UZ0A 1EEXB 1OGYA 2HV8A 2PFGA 2WPDA 2XVAA 3KDAA 4OI4A 4MR7B 5DRYA 2JGFA 5DNYB 2DYKA 3USCS 1JH8A 2O2GA 2OXCA 3IMFA 1IC6A 3M8KA 5P8WA 3VU1A 1U28A 2C3OA 1ZIXA 2XH8A 1KSHA 1X87A 3M5WA 5CDFE 3A10A 4U6NA 4C7OB 2NAPA 1H3FA 3TW8A 1E7MA 2HU2A 4PSCA 2PO0B 2R1TB 3S1LA 2YMQA 4L8WB 2ZJFA 3HWSA 1MIOB 1TQ4A 1WSDA 3M1AA 4GYYA 3WNCA 4BO6A 1MB4A 4TRJA 1NUQA 5EPOA 4Q01A 3U1TA 3D6TB 1S8FA 2P5TB 2PRJA 2VHZA 4AP5A 2OD7A 1MRZA 3DMRA 5EGNA 1NYLA 4Y6OA 2VSFA 1QBGA 2A57A 3ASVA 1U1DA 3KEOA 5FAKA 3M4ZA 5CCDA 4LAFA 4M36A 1Z2EA 4LRTB 3HTXA 1H73A 2CD7A 3DHEA 4IOMA 1L5QA 4JZYA 1FFSA 1TZ2A 5K51A 5C0XA 2UYGA 4LYFA 1CRZA 5JT1A 3MYYA 4EQZA 3SMVA 1PZXA 1TT5A 2P3SA 3CR7A 4D41A 4K9QA 4UDXX 3U37A 2VDKB 3CR3C 1G5RA 4FYIA 1LDBA 1RXCA 1SIUA 4GBMA 5AXDA 4ZQCB 4ZKDA 4URUR 2G6BA 4FWHA 2BCJQ 4BKUA 4RQBA 2J9YB 1R12A 1H1TA 3AUAA 1MH1A 5ADWA 2JGJA 3FLAA 3W06A 1I8TA 1SR8A 1YCDA 2WNSA 2Y9MB 3G0IA 2C2BA 2CUNA 1PWEA 1UBJS 2EKBA 2GPAA 3I1FA 3JQ7B 5G0UA 2VEOA 5SZHB 3R5JA 2ZB2A 1QDLB 3TPFA 4ZOAA 1E2IA 1GZ4A 2CLLB 4J03A 1OILA 3UN1A 3F5SA 4JR2A 3PNPA 1ZC4A 4EVQA 1A8UA 1R5OA 2JI6A 4E14A 2J5RA 3O8CA 3X2SA 4FSDA 1GL3A 3UJAA 5HYVA 2CXSA 2QRZA 4NZ9A 3RRMA 5KOHB 2WNIA 1ZXBA 3E9CA 5CFRA 3KXDA 1BHSA 5IC6A 4H7DA 1ZK2A 3MD9A 1H8HA 2EZ9A 1GQSA 3QX9A 1LBTA 1WZEA 2HK9A 3DEIA 3DMDA 5CVUA 3ZC3A 4JI2E 4AJNA 1L5HB 1K75A 2I67A 3PPIA 5BORA 1NMSA 2XE6A 1I7NA 1J0BA 3RYCB 2RGNA 2O8DA 4OA5A 5FLYA 1W0CA 1CB0A 2VQDA 2OHGA 1QV6A 2JH9A 3GMSA 4OYHA 4XPIB 4MPJA 5G3YA 4MQ5A 3GGDA 1QNLA 1U7HA 1RPTA 2G6TA 5IKMA 4KDCA 1ZL0A 1DBWA 2BTOA 3JR3A 2IXTA 4KLRA 2HGZA 4ZA2A 2DM6A 5I7UA 4DARA 1KEEB 3SXUB 1XK6A 1UP4A 1Z75A 3TLBA 4IZKB 3LHKA 3R7NA 1UC5B 1RZVA 1ZVKA 3W5SA 2YRXA 3B2QA 4LZAA 4Q39A 5J23A 1N1DA 4V0QA 1N0HA 2X0KA 4PX2A 1FMTA 1CY6A 1CB7A 2W6IA 3FNEA 3Q10A 4UM9D 4EAAA 2LBPA 4G1UC 2P9YA 2GXQA 3L7DA 2QJWA 3INTA 1HYBA 2WR8A 1TFRA 3V8PA 4WW0A 2FLKA 3I4CA 2XSZA 2HHHE 1OFVA 2IQIA 4J07A 2RGWA 1I7SB 3CBGA 4DR4B 1XP8A 1W75A 2PMCA 4EB0A 4XFDA 2ZTUA 4RFVA 3VC3A 1LQ2A 5LQCA 1EJ6A 1HFEL 1WPRA 1E4EB 1SXJC 1OVMA 2WJJA 2ZREA 1BHQ1 4RKFA 2NO9A 2CK3D 1J4AA 1XNHA 1ZXLA 3ONVA 3QBJA 3SQWA 2YYZA 4WUVA 4RK0A 5DN9A 3CLUC 4B3RE 3VZQA 5JYCA 3A6LA 3WOHA 4UVGA 1OI3A 2PNZB 2I8LA 1NVGA 3MIZA 4QUDA 3VXKA 2WTAA 2RDMA 1RCUA 3CZAA 1JAYA 1R9GA 2RONA 4DUZE 4GE0A 1GV0A 3T7AA 3DDNA 3O1JC 1O0CA 1OBHA 1W48A 2ZSDA 3QVGA 5E6SA 3H0KA 4FCTA 2WMYA 2CZCA 1E2UA 4E1VA 1S01A 2KHZA 2FZ4A 3L01A 1KKMA 1YHZA 1ZLYA 3PRKE 4R98A 4EKIA 5L40A 2E7ZA 1JFSA 2OUIA 2H65A 3IO3A 3JYNA 4FNOA 3WBBA 2FFJA 5E3HA 3HJHA 1ICIA 1OKKA 4E32A 2FQXA 1CQIB 3J80C 1NMQA 1NUHA 2KBEA 5BSMA 3VUEA 4LDJA 4GRIA 4HDRA 2TMKA 1GNRA 1X0XA 1NAIA 5HUHA 1KHTA 1E6KA 4Z99A 4AX8A 4YREA 4PRLA 3U1KA 1Z2NX 3H84A 2DR2A 3H2SA 2BBOA 5CBPB 4YY3E 1L5WA 1UDBA 1K7EB 3U4GA 4E12A 2C4UA 1J0XO 3ZHQA 4ZFNA 1L9XA 1KRWA 4B4KA 5CH3A 3WRYC 4G5FA 4RKQA 3BCUA 2OM2A 2O1VA 4PZCA 4ZT6A 5BP7A 1G5TA 2OFOA 5ADHA 4PQFA 5F2KA 1L1EA 3JAMQ 3RBVA 2ZULA 3M6FA 3GAMA 2HUNA 3M3HA 3EXG2 1UKZA 3ZIUA 3V8NA 3TKLA 2DBRA 3N70A 3D7LA 2FDCA 1OZHA 1VKZA 3KSMA 2QROA 3B6KA 3V4VB 1NP6A 3DDZX 2DBVO 1PFWA 1VE9A 4J1TC 2Y05A 1LPBB 3KNZA 3P9CA 1YB7A 3OE1A 1L3BA 1Z4KA 4KAXA 3T7CA 4B31A 5A02A 5AVTA 2C94A 1GZ5A 2BFMA 2WIKA 3CW8X 1B63A 3TTVA 2CK3A 2PZEA 3C3PA 1JKIA 3TAHA 4R0MA 2KQUA 1Z5UA 3A9SA 4MCHA 4QYIA 4C6TA 4ZI7F 4I08A 3LP8A 4BEWA 1W87A 1U2TA 3QFCA 3SICE 1NUAA 1XKTA 1XRRA 3ADOA 4RZUA 4WD3A 5ALZA 1DO0A 3BD7A 4IM7A 1VGQA 1XLUA 1ABBA 2YS6A 3K9WA 4RE6A 3NWEA 1H2HA 2MSLA 5CX1A 4D46A 1S5PA 3ETGA 3QZUA 4YCAA 1QDUA 4A8TA 3KSZO 3OQOA 3LT4A 1U31A 3R5HA 1VYTA 2AV6A 1EK2A 1DT5A 3PVCA 1SBTA 3N6XA 4PCLA 5EWMB 4Z2YA 2O2DA 3TIVA 1ZVVA 1VP3A 1FDTA 2OD9A 2UUCB 2IUYA 2ZQ5A 3ZLBA 4LHEA 4MW1A 4S1VA 1T0PA 4B82A 3EXHC 5C1IA 1JE0A 3VYSB 2P9HA 3PZBA 3BDAA 1YXMA 1PL6A 3GDHA 2FSIA 3HM2A 2QPTA 3M33A 3F9CA 1G2IA 1T9GS 1V5FA 1A76A 4A0QA 2AOUA 3DNMA 2YWRA 3LD9A 5EJ6A 1JIQA 1F0PA 1V4BA 3WK6A 4AS1A 1TEHA 4XYMA 3HR4A 2C8VA 2TS1A 4NJEA 4ENVA 2Q5JA 1SD1A 3Q8XB 1SC6A 3HSKA 1FQKA 2GZHA 2Y1EA 1LXCA 2ZRKA 3B9PA 3JX9A 4P0TA 2QPAA 4HAOA 1MEJA 3GN1A 3MK31 5LQKA 4PRVA 2CXRA 2IIQA 2BR2A 1KNQA 3OZRA 4MR9A 2ZG6A 4MS4B 2QQEA 4UNSA 5ENDA 3WQBA 4Q4LA 1JIVA 4C78A 4JJ8A 5KYTA 2B4KA 1B2RA 2D00A 4E5DA 2WQ7A 2X1VA 3EY4A 2EG5A 3NM4A 1EFAA 1C0PA 3HHEA 4UOZA 4PFSA 3IIEA 2QYOA 1OX5A 2UUPA 1EUCB 3ZWKA 4LBZA 4IH9A 5EKDA 3WIDA 1FJGI 4FYJA 5JD3A 5BOSB 2ZI7A 4EO4A 1GGEA 1R2QA 2JLAA 3ILVA 4A15A 4Q7KA 1Q1EA 1U3VA 1IOVA 3EDCA 3PFNA 4NL4H 4D4IA 3MCAA 1O94D 1YDMA 5FNVA 1AKYA 1G21B 2ZCVA 5DDIP 1HDYA 1OW3B 5KOJA 2XTZA 4BRSA 1NF3A 1OI2A 1TTHA 2PGNA 3OQVA 4IFTA 2NV0A 5FI3A 3V2UC 5IARA 4AZTA 4NPCA 1USIA 4OGWA 4PLYA 3KUCA 4ZWNA 4BS9A 2AN1A 5JROA 2J3HA 5K8JB 1BHJA 1R5JA 2AZ4A 4Z1MA 2CZ9A 4YH1A 2O05A 4V02A 4V0MA 4X41A 3VU9A 4FI3F 2GJKA 5A1JA 2Q5IA 1SELA 4QAJA 1FCJA 3ABIA 4DTIA 2WUEA 3G7SA 3K8QA 4DDMA 2EYUA 4FCWA 5B2EA 3TG2A 1J0EA 2RCNA 1B62A 3H9JA 4D9FA 1E7QA 4OQDA 3HFSA 4OTZA 1Y3CE 3FGOA 4D8TA 1Q3HA 3EARA 3UFXB 4DEXA 3SSAA 5K0EA 1ZQ9A 3FOFC 4CV3A 4ZVOA 2NN6D 3W2TA 2D8AA 5E1BA 1EJ0A 3WQRA 1EG7A 1ML3A 2H6EA 3SIRA 3SS7X 3UJ7A 1WETA 2JFZA 4FNAA 1J5EB 2FMTA 2YV5A 3PNYA 2P68A 1WY7A 4LRXA 2IIPA 3AF6A 3V8BA 1XPUA 3HDVA 2VXYA 4BAGA 1KZ9A 4PXYA 4WH0A 3HBLA 3UOGA 5IDQA 1ULUA 1KAHA 1T2EA 2JANA 3F4LA 1J25A 3NX4A 4PRZA 5A5DA 1D3AA 1JEOA 1I1QB 1RWNA 1SO8A 2X2FA 2XZDA 1IDN1 3BXPA 3N0WA 1G6HA 4KV9A 4N0QA 3T1NA 5A9SB 2EWWA 1XMSA 2VBCA 4TSRA 2CXQA 3KALA 4LX8A 3GLLA 4GR4A 3ROZA 3SI7A 1LX7A 2H7CA 4EG3A 3SHWA 2QMYA 1VA5A 1YC5A 3ESXA 4C4OA 4KN9S 2ICAA 2PO1A 3L5OA 3DEHA 1E1CA 2VUTA 1M8FA 4C22A 2SNIE 3DV0B 5HEKA 1FNMA 3K0FA 5FDFA 1JSLA 1ZI6A 4WWHA 4LHXA 1PK9A 2UU9B 2VHEA 3I28A 4QO8A 3I6ZA 1CD5A 3CZ5A 1M5RA 5ALSA 3Q5EA 3L7ZA 3N2KB 1CNEA 4QFDA 5DWQA 3L0OA 3CIOA 4DJDC 2Y99A 3BE8A 4MA4A 5HS4A 1DSSG 5BVHB 1E9SA 3FPHA 3WWDA 1RAGA 3E61A 1N5OX 4MVJG 3SQNA 1LNSA 2CUTA 3JQBA 4WQMA 1XVIA 1B6TA 4IHJB 1YAJA 4UE6A 3RBXA 5HP4A 5JEAC 2QXUA 3NONA 4JJGA 4MVJE 2QUAA 1U7PA 2RBGA 1KR5A 4HNAA 3KOMA 4NX2A 1IN1A 3RGGA 1Y3FE 3NGLA 3SYLA 2I3DA 2R2GA 2SHKA 2B8EA 5K0BA 1PL8A 2L17A 1M34E 1PWZA 1WABA 2E4VA 3H5OA 4B83A 5FO0A 4EMUA 2ZRPA 2GK3A 5DM4A 4BBZA 2I65A 5AYVA 4X61A 1KJYA 1MAVA 2GWHA 2N1BA 4TKUB 1KOFA 4U9IS 3VR4D 4LFAE 3HCEA 4HH1A 2YV1A 3WIEA 3DV2A 3P2YA 1IQUA 4CIXA 2WP0A 3LT5A 4O8CA 5KYKA 2VUUA 1LBQA 2ZBUA 1FZQA 4DMKA 4OLAA 1P2TA 2OV6A 3UK1A 1E69A 1QO9A 4L85A 3CSSA 4E3WA 2WKWA 4IDQA 4M9QA 1HPLA 2YWJA 5F73A 3MM4A 3NHWA 4Z6KA 2A9QA 4WUTA 3IHWA 4EMTA 5IWAE 1CUFA 1N3IA 2BFOA 3LC2O 2GBLC 4JUDX 1I7QB 1JPJA 1QAQA 4ILEA 3A6DA 2OQVA 6PFKA 4LMRA 4P52A 3QU9A 3QU7A 5CB4B 2YYAA 4J4HA 3TMAA 3ZGXA 1XEWY 3QY9A 3OX4A 4QT4A 1C3OB 2GDJA 2V5AA 3O3CA 5JALA 2BM8A 1UBGA 1P3Y1 1VJDA 2PRIA 3PIRA 3ZBQA 4HUJA 1YL7A 1G4HA 3DWGA 1ZU5A 2O2CA 2EAUA 1KI1A 3JVDA 3P9PA 3C8HA 3EF3A 2IQ5A 4FR2A 3MXTA 3GJ5A 3FZGA 1GNQA 2OXFA 4C4PA 3F73A 1DXYA 3BGWA 5KQRA 1T2CA 3L2OB 4CMIB 2XYQA 3LX8A 3RC2A 1HWYA 4AO6A 1RLIA 2VAWA 1AT1A 4WFKA 3WRXA 1XTQA 1HNXB 1QK5A 3H8SA 3E58A 4MX8A 3SJZA 4JYAB 1FJXA 2IZOA 3SFVA 2BGRA 2VPYA 3JQAD 3IHKA 6REQA 4X6LA 2BA0D 3BWBA 3FPGA 1QV9A 3H17A 5DNWA 5AKLA 3OT4A 4P54A 1QYWA 1V7ZA 3G8YA 4G2TA 3V33A 1YKFA 1P8AA 3HCBA 4HV4A 3R9XB 5H4HA 4IS3A 3AVQA 3KQMA 4Y9TA 4OUDA 1W5EA 3X1DA 2R11A 3MJVA 4HZGA 1PIWA 3IDQA 4MIOA 4RK7A 3FOEC 2OXIA 2DEJA 1FYXA 2JFXA 1EI9A 1EQAA 4OQEA 3MS4A 4ZDWA 4RNCA 3WLLA 3X2FA 2ZS8A 2DUUA 5CM9C 1C7RA 1J5XA 2PRYA 3Q0IA 1E3HA 3PXUA 3WLMA 1VI7A 1NC3A 2A2ZA 2YN2A 4IBOA 3KSBC 1ZSVA 5C31A 3QLUC 1LDNA 4DQXA 3G2HA 1NI3A 1ODFA 2WG1A 5KU7A 3W2EA 4TV8F 3C45A 1NUUA 2LDXA 4H1HA 4BNFA 5EWJA 1IEXA 3HYNA 4WL0A 1P19A 4UVDA 4DIOA 4MKZA 3NEYA 1Q0HA 1ZRMA 2ZBRA 3KLBA 4LE0A 4I9GA 5KTTA 2WNRA 3UAGA 4QNJA 2RGYA 3AF2A 4D98A 4ZANA 1YACA 1OV6A 4N76A 1ND5A 1YQGA 1KAGA 1P6XA 4P7KA 3WU5A 1RCTE 2PQ6A 2RI0A 3MWDA 4GMFA 1L1QA 1SKQA 2Q2QA 2D7CA 4F04A 1RWPA 5D84A 4NONA 1QRUA 4R84A 1FU4A 1Y6ZA 1P7VA 2WF5A 1S3FA 3BXEA 4HACB 4E15A 4EARA 4URVR 3OURA 3B5EA 3OC6A 4CLOA 3BJMA 2VSYA 1CHNA 4LSZA 3UAWA 1RLTA 1ZK0A 1Q2UA 2Q4BA 3ZD8A 5JAHA 1II8B 1KK2A 1LPSA 1ZN7A 3WS7A 4PSAA 1ZH0A 3GLIE 1JMVA 1DEAA 4K05A 3WA7A 1E3SA 1H69A 5MGNA 4LKOA 1KI4A 4GHWA 2OI2A 2UV8A 1JEQB 2P2ZA 1M8JA 1YO6A 5EUCA 2Z3VA 1F2TA 2V45A 5E9QA 5A3QA 1WCYA 5TPWA 4DV7B 4DA4A 2ZUEA 5BSGA 1LZLA 2I3AA 1AHPA 4QM6A 4CCAA 1XNGA 1P0MA 4L16A 4M0CA 5CLLA 1RAFA 3UV6A 5HOQA 1KQ3A 3LG2A 2EVWX 5AVKA 2AFHB 3R5FA 1DT3A 1VYUA 3DLCA 4RD6A 3ETDA 1W44A 4TSFA 1ILWA 1ZD4A 4HZUB 4UPEA 1IVYA 2GZ1A 1G64A 4DZZA 3QVOA 4EQ6B 1I2CA 3MJDA 4AJIA 5KNLA 3CINA 2GXSA 3K0FB 1QNFA 2P11A 4HPWA 4YT4A 1FDIA 3ZE0B 3P2JA 2PT5A 3ZCQA 5DNUA 1LPPA 1SG0A 4KB5A 1AKNA 4DM3A 1XRLA 5BRJA 2JFGA 1XPJA 1NXOA 4N18A 3CH7A 2HFKA 2J9FA 4YAJA 3T34A 1A9XA 4OO1D 1QO0D 1M2OA 2CW5A 3GJ7A 1UBSB 4L0MA 3IP7A 4AUKA 2G83A 3FLBA 2PT9A 3QVKA 3ZCXA 5BPHA 3VKUA 1TLLA 3NTUA 2O8DB 3DMYA 2VQEE 2QRPA 4Y1GA 2HB6A 1Z15A 1I01A 4CMHA 5B1HA 4FS3A 5ARDA 4RJLA 4JEMA 1QYRA 3GPLA 1Z47A 3U62A 10MHA 4UZFA 4IQFA 5BQOA 1RZ3A 3L6DA 2GERA 5JTTA 1Z68A 4TZ0A 1VI2A 1RPNA 4AICA 1OAKA 2HJSA 4PLWA 4W5WA 2B5OA 2V9CA 3ZHZA 4MVJF 4C29A 4KUGA 4G5OA 4M9RA 4CN8A 1U5BA 3HM9A 1E99A 3QENA 4B3BA 1VE6A 1BROA 5EUQB 4PGFA 3JTEA 3BE4A 2NYAA 5E1OA 4EB6A 4M9CA 1KPGA 1QYIA 2G77B 4Y9DA 2WKQA 5AMXA 3SJ7A 2XUZA 3OESA 4OHWA 1XRJA 4LQCA 4XWGA 2DFDA 2ZKIA 1JQ5A 1FTNA 1V16A 1YFKA 3P4YA 4UPVA 5A5EA 1HY3A 1KOGA 5JCOA 1DIOB 3JZFA 4RWEA 4QTYA 4IZKA 4KDRA 5TT0A 4L5JA 5B55A 2GEJA 4HVTA 4J6FA 4FE3A 5KTKA 2GK6A 4F1WA 4HPJB 4FW7A 1EJ2A 2H2HA 3NOOA 3LY9A 4Q9KA 3HE3A 2ONJA 2R1UA 3I6BA 3O4VA 3B6JA 3QELB 4B44A 3LBFA 3GLFA 3K6SA 2FE4A 5BXQC 4MWTA 1IJFA 3ICWA 3J7AC 4LOIA 1ODJA 3KLOA 3CMCO 5C8VA 3D8NA 4H59A 5CXQA 1WXXA 4K9NA 3DFUA 4Z4HA 2JEZA 3EVNA 1FJGE 1DEHA 1U3FA 1XXHA 2DBYA 3M7ND 3NEJA 4MI6A 2P75A 5EXTA 4B81A 1FU7A 3V1YA 3VPHA 5MHTA 3DBRB 2Q6LA 3MBOA 1QXSA 4I8XA 4C07A 4H1VA 3T5AA 1OCEA 2XCIA 5B64A 3BA1A 5HNKA 3BSYA 1N6IA 1NQ5A 1T9ZA 3DZFA 3HH8A 4MUFA 4NG5A 1E1CB 4Q1DA 3RFFA 5IUJC 2FPPA 1EFCA 1V7CA 5CH5A 2LW7A 4QT0A 2B6NA 3GEDA 4J3FA 5J1SB 2I8AA 4U0JA 4A0RA 3KOWA 3HACA 2XZPA 3SHVA 1DP4A 1DARA 2BR2B 4K9LA 2DG2A 4OKNA 3VH4A 4ZVVA 2A92A 3RIYA 3KV1A 1XCJA 1ZJJA 2CLKB 4I2NA 2G0NA 3N3BC 4B8WA 2X8BA 3RLFA 1YZYA 2R8PA 4QGSA 2VCEA 3L79A 1C1XA 4AZ3A 3H11A 2BDUA 3K15A 3JYLA 2YMMA 3U7QB 1E1RD 2XT6A 3UTCA 5TSDA 3I6MA 4MWCA 5IJ0B 5KNBD 1NVVQ 1P75A 1DPFA 1RMTA 3M2TA 1Z0KA 3K70B 3FCEA 5JFTA 2Q4EA 3B20A 4O4LB 2B9EA 2JARA 2VRNA 1TU3A 3QX3A 2GH1A 3D64A 4U3DA 3W5VA 1B14A 4B7UA 4XW2A 4OQFA 2C2KA 3L7KA 3M4YA 8AT1A 1K08A 3C5WP 3MN1A 3VBCA 2H2AA 3VSDA 5ITVA 5CT6A 5D3QA 2R8YA 3NWJA 3D4OA 4TVSA 5BNIA 3UKJA 3EPRA 2ZROA 1C30B 5DGTA 5D5QA 3TTTA 2X3YA 4LZZA 1IBKI 4DGQA 4D0RA 3BAFA 2KS6A 4G84A 1QZRA 3BQ9A 3DMFA 3ZH9B 1FFBA 4IDAA 4QU8A 4XWTA 3CVXA 3PGA1 3GLFE 1X7GA 1DUSA 4XVUA 1J5PA 3E03A 4CLOB 1T5HX 1ZG3A 3QVTA 4OHUA 4TMZA 1OFGA 1JHYA 4W6ZA 4LVCA 1FMLA 1H93A 4DV6I 3SVZA 3ZDDA 3GN2A 3IP6A 3O47A 5CNKA 5FUXA 4A0GA 3ZYZA 4CMKA 5REQA 3NV9A 4BRUA 4RPFA 5F35A 5AFSA 2PLFA 5EEHA 2FZGA 5HIAA 5GONB 1VDMA 1Z5BA 3LE8A 2P2CA 4TQUS 2GO3A 3H6GA 4TMXA 4B09A 2FFQA 1UEIA 1FUKA 3O8LA 3VR1A 3CF2A 2G04A 2XADA 1QWSA 1W581 1CZOA 1MV8A 2AYYA 3PC7A 1BCSA 4KR0A 2H2DA 1Q15A 3BMCB 3H2BA 3A6GA 4JXXA 1NBMD 2BVNA 2IBTA 5D8DA 2OORC 3FDIA 2QYHA 4RZXA 1FNBA 4LYGA 3FB4A 4HRXA 3DXZA 1PT9A 3UHOA 1SEPA 2AOUB 2I6QA 3KT3A 4BGEA 4Q16A 1MHTA 1M8KA 3K35A 1DJQA 2NU6A 5BN3B 1VM6A 3OKAA 5LQRA 2W2LD 3VPBA 2G9ZA 5FBHA 4LF8E 5CFZA 5A2GA 4EO7A 2WT8A 4FQ8A 4Z4IA 3AINA 4NCXA 1KYXA 3WLQA 3AHIA 5HBRA 1XHKA 3OTHA 2QAIA 4YCJA 3RVSA 2AL7A 2ROQA 1N9KA 1O08A 5DCUA 2HJVA 1XMQI 2H3HA 2Y4OA 2Q3FA 1XAGA 1BS9A 1W9MA 2Q0XA 3NATA 1IUKA 2MYNA 5JYDA 1JXOA 1ZOIA 4ZXFA 3W05A 3MELA 4F06A 4XR4A 5ALIA 4KIUA 5KJ6A 2PRKA 1YR2A 4GZ3A 3GCDA 4KBGA 5AM3A 5ALLA 2QMOA 3DWEX 3U60B 2G5CA 2VS1A 3H9GA 1SOMA 3N2LA 5HILA 3I64A 4MVJI 1JR3D 4H7HA 1F14A 1FS6A 3B3JA 2OGSA 1A9PA 3AETB 2J0EA 4JNCA 421PA 2VQ6A 5CVVA 2QBYB 2O8CB 1XVVA 2VSOA 4NCBA 3EAFA 3ZY3A 4HS9A 5JNUA 2Q4TA 3DUFA 2NP7A 2HZ7A 1BXZA 2YWGA 1OOEA 3SZOA 4DJTA 2G7ZA 5EHXA 2E48A 1PJBA 5LIRA 1Z0UA 4WCFC 4DNPA 3RDPA 3VDQA 1BEZA 1QH0A 2WQ6A 2QRGA 2UZ1A 4MNTA 4XQGA 4AKHA 1T9GR 4YUYA 1SIWA 3ILYA 3QTBA 4DR3B 1GCAA 1HE2A 2XYRA 3DE0X 2JLRA 1CE8B 4I6EA 4J0EA 1SHKA 3KZCA 4GLFA 1VLJA 4NWIA 3WL7A 5LMUE 5IXSA 4WX2B 3UB2A 1N3LA 2XT0A 1Y8QB 1KETA 2ZSJA 3RVJA 2VDQB 1X74A 2H06A 4HFNA 5E95A 3G17A 2HI0A 4UTPA 5LKRA 5MFPA 1FLAA 2X1MA 4LF7B 3B3QA 2XCLA 1SK8A 4N7BA 5AR1A 1NVVR 3HKCA 4OO3A 1PI3A 4YP5A 2Q9CA 3W6ZA 2Q6VA 1KZ1A 4FFPA 3D5EA 4BO3A 4WLOA 5K6TA 2J30A 4JUIA 3JVEA 1OAAA 3T12A 1BKYA 3GU3A 1DXHA 4EG4A 5I7SA 3OPQA 4XWKA 4WNIA 2QRLA 4ZOEA 4QU9A 2YXNA 3M5DA 2N75A 1ADBA 1F4PA 4HQ6A 2FUKA 1K9VF 3OC0A 3OLQA 5CEJA 3PWTA 3KXKA 4H7IA 3ZK7A 3I9LA 1H0KA 4IZJD 2C2WA 1QIIA 2V8BA 3PFFA 3VU0A 2P7HA 5EHIA 2AKEA 1H2RS 3ABZA 4KX3A 2PLNA 1ACMA 3Q85A 1NRXA 3ZW7A 4RXTA 4DRXA 1EU1A 2P41A 3P45A 2YJ3A 1NQTA 4L28A 1B0AA 4I1YA 4YQEA 1Y60A 4CMEC 4IDBA 3HN7A 4P84A 1JDNA 5CDYA 1B8NA 1TCCA 3RS3A 2LP4Y 3LECA 1AZTA 5GMEA 2V34A 4LJ4A 4XGKA 2LKDA 3TIXB 3ZWDA 1ESCA 3HGTA 4EQ6A 1VLLA 1W4CA 1GKUB 3TUZC 1K9SA 2DULA 4EMBA 3IEPA 5EUMA 5ALDA 4D81A 2VUSA 3WJ2A 4TV9F 1BW9A 3K9QO 3LW8A 1E2GA 5FIUA 2VF4X 2HD4A 2QN9A 4B6EA 4OX9B 3KS9A 1TF2A 5EJGA 4XFJA 2I99A 4F21A 3LM8A 1T43A 1H7SA 1FTYA 1VE5A 1UPTA 2PWZA 3CY6A 4OAPA 1Y8AA 2CXHA 4OQZA 5CT8A 5CTJA 4C3VA 1WHTB 3H5LA 3K3PA 1X1QA 1Z2OX 3QUQA 1KC3A 4IO1A 4OGKA 3HLYA 3HWX1 2VRWA 4KMOA 2BI4A 2FR8A 4TMYA 2YWHA 2GCIA 3CWQA 1W9HA 3GBVA 2KMLA 4O2AF 4UQPA 1LFAA 4BDTA 4DMRA 2Z5LA 2E21A 3AL0C 2A0FA 4D99A 4B46A 4RDXA 3G2NA 1ORVA 1ZKMA 4NFYA 5IW8A 5AUOB 5SYMA 4FIDA 2CVPA 2C3UA 3C8UA 3NALA 3HCNA 2XQFA 3CEHA 3UMYA 1P8JA 2DHCA 2QD3A 1US8A 5LCXA 1E3QA 4NYJQ 2W9XA 3QYJA 3WIBA 4C4YA 2RHDA 1XA3A 4EI9A 5L7TA 2FWAA 1XQYA 1JG3A 3RU2A 2WDZA 3BTVA 3VH2A 2C39B 3QV1A 5I8ZA 1PCXA 4B7AA 4EG8A 3T5GA 1M74A 1NQAO 3SJAA 3G82C 3BEOA 2MHCA 5CVEA 1WSBA 4GDMA 4M0EA 2BFWA 4R9UC 2DLNA 2QJRA 1RXWA 3BIWA 1ZGZA 3ZV4A 5I45A 5CIQA 4KAFA 3ORRA 4F8YA 4QG7A 1OJLA 4AMBA 3FCXA 1C2YA 4MRRA 1LNQA 4YN3A 3GWZA 5F78A 3SBXA 2BSAA 4GSYA 4EPVA 1M1ZA 3EMKA 3ZJTA 4G0VA 3EJ6A 2KM1A 2QTHA 3NVMB 4MTCA 3X3HA 5JH7B 1U0RA 4LMPA 4A36A 4JV5E 4QUEA 2BGNA 4MGKR 2GARA 4ZQIA 5JXIA 3F4BA 4Z8YA 2HHLA 4DNQA 4ZI3A 1MZPA 2EKZA 4KE6A 3F1KA 4M60A 2GAOA 1LDEA 2OCYC 3H2GA 5DOVA 3GBSA 4LYYA 4PE5B 1YKGA 1WA5A 3N0VA 3THYA 2B1RA 3QK7A 3STTA 1MKYA 4PZPA 2A1UA 4BFTA 1XGKA 4AF8A 1GQYA 2G07A 1IHPA 1NWCA 1EXNA 4TXMA 4XIGS 5F7ZA 5FXMA 2L82A 3OQHA 3ZLJA 1GKYA 3QBDA 5DYTA 3GUVA 1RJDA 2IP2A 2X1HA 2Y0BA 2Z2IA 4H6VA 1GFWA 1U0EA 4RIGA 2Z8ZA 2P9CA 1LX6A 2IEGA 2BYTA 4JFAA 3ZZTA 4TWBA 1O96B 1J70A 2FSFA 3G9QA 5T6BA 5C5DA 4H1UA 1XEFA 3QVLA 4Z49A 3HULA 2CFRA 3H11B 3IAUA 2CYBA 4P0QB 3EC7A 4WZBA 3S3TA 3TQTA 3PNLA 5A6SB 3THSA 1JHZA 4WKPA 1IXYA 2FETA 1GD1O 2DOKA 1WB6A 1N9ZA 3JVIA 3NOXA 1UJ5A 3AXSA 3G0CA 4GVPA 1SCAA 4FNGA 1GGKA 1Y7LA 2PHZA 1Q6ZA 4ODIA 2QMZA 3PC4A 5IAJA 3T7JA 3C8ZA 3DVRX 3ENNA 2IGBA 1BE0A 1OBCA 4M89A 1R4MB 3TW8B 3N28A 3I9FA 1C9YA 5JWRA 1E1QD 3P7MA 5EMKA 4B3MB 1J9ZA 2JFQA 1YRWA 4Z0NA 5L4SA 3GQBB 3TGWA 3PD0A 2C1XA 5IBCA 3SWWA 2I7TA 1P2UA 2QW1A 2MJLA 4FLFA 1CUEA 3ZWXA 5HQTA 4P4SB 4DR1B 5DBFA 5SY4A 3SFTA 4DSZA 5TMEA 3TEJA 1XJCA 2ZTHA 5EZ6B 2VP5A 3WZ2A 1RLOA 4LBWA 4V3CA 4PFQA 5DBGA 5H1YA 3LQ1A 4P98A 1XR3A 3GGJA 3GOQA 1RYHA 2HHAA 3ETEA 3KKEA 5BMVB 2FUNB 1IAQA 5KS2A 2ZWOA 2VJLA 4YMUA 4K88A 4N01A 2QF7A 2G1KA 3SDBA 3QOFA 1MU0A 2MOKA 3Q9NA 3QE2A 3U61B 4DDUA 2NMVA 2E5FA 3OZBA 5F7JA 2W0SA 1K3FA 4RJIA 3VVBA 4MU1A 2NZ2A 4JGIA 3EQ9A 3AFMA 2C2HA 1V3TA 2GTIA 4XQCA 1A95A 1HT0A 3PV0A 3RTCA 2JJ8A 2XKAA 4U00A 2RHGB 3UXEA 3CEPB 2G80A 1CLUA 2IYUA 1HFWA 3Q88A 3GCGA 1NNLA 2M6KA 4B43A 4ZK6A 1OZ0A 3FFXA 1GO2A 2XCUA 3EGCA 3RUFA 3V1LA 4DM4A 4DC9A 4TTIA 2QLBA 3D8HA 4D9IA 1E5TA 1QP0A 3ZHTA 3CEMA 1XXLA 4HQRA 4IXTA 2JFNA 2PVCA 3CURA 2R7NA 4JP2A 3F6SA 4OB6A 5CNJA 1B93A 5EQFA 5BN5B 5L3VA 4Y7CA 1XOIA 3TKAA 5BSEA 1N3YA 1SKUA 3GRZA 2REOA 4IOKA 1CRQA 4P7GA 4UNPA 3DTVA 3GPIA 2HFJA 2ERCA 2CNDA 1UAAA 3AVTA 4AKIA 3OJXA 1UWKA 3ADPA 4JQCA 1V8PA 3WK9A 2PL9A 2O3QA 3EBLA 5H80A 1MAHA 5J5CA 5CAEB 4N3AA 3JRXA 2ZYWX 1T1RA 2QG9A 5JCZA 1IN6A 3AXTA 2D5IA 1K68A 3K53A 4FZVA 4UQLA 1UOQA 2C9YA 2O9JA 3ENWA 4JVLA 4CFZA 3GJ0A 2YVUA 5JVDA 1ORHA 3VPXA 1BQ3A 4JI2I 1PK8A 2GNPA 2WQZA 3EEIA 3L6UA 1TYCA 4H7KA 4M0UA 5CB6A 4XTCS 1HRKA 1ZHHA 5MGBA 3RTEA 1JILA 2ZS7A 1L7OA 2IYFA 3OF5A 5AVWA 4IDEA 2GPTA 2HQBA 2ONYA 2D1QA 3AETA 5HZMA 5CDGA 1GPAA 1QFSA 1M1YB 2NLOA 4A82A 5B2FA 2XUIA 2YJ6A 4BE7B 4JI4I 5EA2A 1P7PA 1V5WA 1P5JA 2WF6A 4OAQA 4GE3A 3WGLA 5IYZB 3JYQA 4BATA 3PVZA 3A32A 3TIFA 1E7WA 1TO1E 4IH4A 1NQVA 1EP1B 5HJ5A 1R6BX 1QIHA 3K9GA 1CSEE 3L6OO 2ZJ5A 4NK4A 4N3NA 1U4SA 2J0VA 2OORA 4U7DA 1E6WA 2HT1A 1DKLA 1RTKA 2R1VA 2RGGA 3ZPXA 1BA3A 3BEDA 3MWEB 1FSGA 4GI3A 2QRVA 4WY2A 3DC2A 3G79A 4RNDB 4J76A 1Q0SA 2D59A 1ZJZA 5LP6B 4QOEA 4REQB 5EJ9A 3UM9A 1N5RA 1VJRA 3LYUA 2FEAA 1FFXB 3O26A 1BVHA 4CG3A 4E11A 1F2UB 3A05A 2AEJA 3G8AA 3NYWA 4MVYA 2QM8A 3GH1A 3I5UA 1NLMA 3B7PA 4JQZA 5DXJA 2DUJA 3U44B 2PK3A 2RG1A 5DNLA 3KXIA 3C6YA 1PLJA 4CM8A 4A2CA 1DKPA 3GYGA 4XRRA 4EJSC 1N1EA 1ODSA 4PZLA 4HN9A 4DCTA 1YQQA 1MVNA 2R85A 3AJ9A 4NTZA 2FDXA 3P9ZA 3V3KA 1ONBA 1ENOA 1QZTA 1WUHS 2VK8A 2GS8A 3EIOA 5B1EA 5BY2A 1VJCA 4Z1OA 2ARKA 3V8VA 1CR4A 4YJGB 1B43A 4DY4A 5JARA 1H5QA 2JFHA 4B2LA 3CLSC 1FUIA 4IV8A 4GLLA 4CIBA 1B00A 1IMJA 4MLZA 3R0JA 3CF0A 4Q48A 3WMFA 1G8MA 4GI5A 2OYCA 4J0GA 1DC7A 2R44A 1OIWA 3ICEA 1ITZA 4Y2UA 1AQ6A 5A7FA 4QUGA 2C2GA 2W2VA 1BWSA 4KHPB 4IV5A 2I33A 4KX5A 4QEZA 3TLGA 3VR4A 4WK4B 3HEMA 4G1VA 3EPHA 4HDNB 2RIPA 3F6BX 4DCNA 1N33E 1ZITA 2VRCD 3CVOA 2FOLA 4OK3A 2ZE7A 3MOSA 1PGPA 1YMQA 1Q0UA 3OF3A 2BGGA 1WCV1 5IHPA 5C1BA 3CSDA 4ZC1A 2ATEA 2GX6A 3CCBA 4OQMA 2XKKA 3F8SA 2YOFA 2ZIZA 4DZTA 2Q5FA 3I9V1 3V1KA 1QKKA 3DPSA 1AQUA 4K26A 4PPYA 4WXHA 1KAMA 1A5AB 3W7VA 3JAMA 1CF9A 4R3UC 5JJCA 1AKWA 1BN7A 1HFKA 3L46A 3ZDRA 3QE0A 5ALXA 2BMEA 3L82B 3O3NB 3QFRA 4W5JA 4JYMA 4YV7A 2ZVPX 3FROA 1B26A 3PHIA 1NN5A 1IWOA 3IESA 1X38A 3RFUA 1N2ZA 1M2GA 3EVDA 1HQYE 4DR6E 3G0DA 3GY0A 5EIFA 4JYPA 2JHAA 3RFVA 4BZQA 2EEZA 4ZK2A 2AEFA 5L8VA 4TV8B 2CLDX 3AI3A 2ZM6I 1JLRA 1MZVA 3K2EA 4MIEA 4EUEA 1JHAA 5LL6R 4RE5A 4ESVA 1FS5A 3A70A 3J80A 1RXUA 2PAAA 4W5NA 3UENA 4EJMA 1F8FA 4LIPD 2IYEA 1UFKA 3WGYA 1PR2A 3AF5A 4QXAA 3BGIA 3E9EA 3ADCA 1OF1A 2UUAE 3EAGA 2QV0A 3I5AA 3DLBA 4HNGA 3PG5A 4E5YA 2NXJA 1MJ5A 4XI9A 3BULA 1L8QA 2OGWA 3D6UA 4HS4A 2Q5OA 2G3YA 1XD8A 4YACA 2XB2A 5A3SA 1G60A 3N53A 4LOLA 4W9NA 2GBPA 2WIGA 4K87A 4RWZA 3RUCA 3T5CA 4E2XA 3UT5B 5BSKA 3K31A 3ZQKA 1YGPA 3JD3A 4IPTA 1U2EA 5FUWA 5U4QA 5D51S 4CLXA 3A0UA 1QYXA 4EEZA 1O57A 3A1EA 1TCBA 3R75A 3WDLA 1OAOA 2FGJA 1WXDA 2HLPA 3I5YA 4P22A 3UAVA 2WFLA 4G5HA 2BA1D 1JFFB 4XIJA 4XSHA 4U2FA 2AUTA 1WSAA 4G3XA 2PNLA 4QVGA 5J1TB 4OIFA 1GPJA 2QAGC 4L8LA 4WADA 2OZLB 2GEFA 4Y2QA 4PHHA 4PZZA 3I53A 1ISJA 3RT1A 1U6JA 2WOOA 4I8DA 1XKLA 5G2OA 4YJ2A 1DEOA 2DQSA 3FLEA 2OVFA 3JD4A 3IR5A 4O4IA 5GVRA 1AOXA 3TSWA 5H3CA 4BFCA 2J4FA 1V11A 4GXQA 3CW9A 2IIVA 4BV3A 1VIAA 1ZEJA 1CY2A 1GGNA 1OWPA 1G3RA 1GPLA 4D45A 1BDIA 4XB1A 4HEHA 4RACA 2PUEA 2XXAB 1PFVA 2ZITA 5E8RA 2HJRA 3A6HA 2ZBEA 3KTDA 3KU1A 1NPYA 3A3KA 3O1HB 4OU5A 3WLNA 1PJ8A 3MTBA 3RTAA 3TH5A 4M1KA 2NAFA 5J63A 4CHGA 4FM9A 4F6LA 2HMYB 2ATIA 1RBQA 4MUJA 4X7BA 3I45A 3C70A 4PBSA 4Z7JA 2O8CA 3GCXA 4UUNA 1N2HA 4Y2JA 3DV0A 5DNEA 4MQMA 5DRTA 4OI1A 3LNUA 1J2EA 4G5YA 2FJ0A 5KDLA 3RIEA 2Q6OA 2XDQA 2X22A 1MFPA 1X1SA 3L1JA 3WI7A 1RQ2A 2E6KA 1NVEA 2FEXA 1RZUA 2YV3A 1ZIPA 2Q3EA 5LZ8A 3ZWNA 3WGTA 3K2BA 1P4HA 3ZE6A 5FTJA 1M2HA 4C3UA 2QR3A 3SVLA 4O63O 5GPBA 1OU0A 2GM4A 5LWQA 4TSFD 1C1DB 2UUOA 5DBEX 3S8MA 3ZWYA 1NVFA 1VPWA 1JIJA 1SRRA 1Z35A 2NUTB 5SY9A 1Z6YA 2IV7A 3L8YA 5J58A 3PDWA 3B85A 4CW7A 2OXEA 1YBHA 1YRAA 1A5TA 2X4LA 3O4JA 4OYRA 4URWR 4K1LA 2W2TA 3X0DA 4ZALA 1EUZA 3D81A 3KZNA 3NHMA 1AQLA 2PL5A 5LVAA 4YHHB 4QOIA 1D7AA 5IWCA 1MH9A 3GRRA 4MDFA 1KMMA 3A4MA 2C96A 2VXOA 3D54D 1XROA 4ILKA 3TFQA 3W04A 5IWAB 2LIPA 2V0NA 3C6BA 2XEXA 2HCFA 2V6GA 4DMGA 3S2EA 2Y68A 3ZW9A 2FFHA 3DEZA 2GD6A 4II2A 5M7EA 4FJ0A 4IUBS 4DV3B 3QFHA 3G88A 1FX0A 3V7YA 3PP8A 1NHJA 2FR0A 3JRNA 4JYAI 2D8MA 1ETUA 3H2ZA 4FUQA 3RU9A 3ZV5A 3QXCA 2PMBA 4RX1A 4BC0A 4DUGD 1HNWI 1IUOA 2Y66A 5KYWA 1I4TD 1Y5YA 2AQHA 2VP0A 3MMZA 4M8KA 5LQDA 4DPYA 3TUJC 3BXFA 1YZQA 1JZQA 2G67A 4DLWA 4QNKA 4WAUA 5EXDA 4BB0A 5H82A 4KQCA 4X71A 4CL8A 2VC2B 3SHTA 2PX8A 2C38B 3FFBA 3ELBA 1Z0GA 3K8OE 4MUGA 3NDJA 4Y0VA 3AR3A 2Q2VA 2BFDA 2K7ZA 4PX3A 3BF7A 5CA0B 2XQKA 5DM1A 2BM1A 4PSKA 1JEEA 1S7GA 4G36A 4K6GA 5K03A 2I4RA 3SQDA 1GCOA 3QUAA 3ASUA 4LRQA 5J43A 3ZDCA 4AS2A 3NZEA 5D7BA 1L5VA 4KRYA 4OBBA 4JLNA 1H2AS 1JWAB 1K7FB 1P1KA 4FKZA 2PO5A 1K47A 5K0ZA 1EWYA 3LY8A 2YUIA 1IIRA 1H2ZA 4TKUA 1AKMA 4F2DA 5EJ5A 1R50A 3T5BA 2JVKA 1U0HC 1RIFA 2HFUA 1RHRA 4LGCA 3BIXA 1DOAA 4WKBA 1RHQA 4I9FA 5HUJA 2QUJA 2C39A 3JQ9C 2A35A 1HDXA 1Z4LA 1ZD5A 2JHGA 3QVWA 3AEZA 2GPYA 4EY6A 1KMNA 4H77A 5AVOA 3KQQA 4N5DA 5DKFA 5C8DA 3EN0A 3CKLA 3MGCA 2JE6A 3OFSA 2HJHA 4OL9A 4EYGA 4B9EA 4HO1X 2B0CA 4MYSA 5IDXA 2QMUA 5LP6A 1AIPA 2FEKA 4JP1A 1WBDA 2JEBA 1OPRA 1YVEI 3I23A 3ODPA 821PA 1PZHA 1P5HA 3PRHA 2K7FA 1ESZA 2A3RA 3K1YA 4MGZR 3WWOA 3A1DA 5TEWA 4E13A 4GOLD 4OGLA 4M21A 3LUCA 1FA9A 1LRJA 3UHMA 4Y0AA 2W7TA 1O8BA 5EE1A 1Z62A 4KWHA 4XGNA 1XCBA 3VRHA 3WOVA 4YCSA 1OGIA 4L8VA 1HRDA 4IOJA 1QTIA 2B8WA 1J9EA 1SXJB 1HOXA 2YHIB 3Q2IA 1V3UA 5FYDA 3RIHA 1JDVA 3QGMA 1EZZA 3KUUA 3D3KA 5L3RA 1MJGA 2WJGA 4DLZA 4BMSA 1FQWA 2QTCA 2XE7A 4R1OA 3WNVA 4J90A 1E3WB 3T0IA 5KQLA 3PQ2A 2B34A 2IH5A 3KVNA 2PWAA 5TGTA 4LXXA 5IAOA 4KHPE 3E5RA 4DV4I 3BMNB 3FPEA 4JWKA 4D6YA 3Q7QA 5FX2A 5AUPB 3NASA 5C9ZA 3R4VA 4KR3A 4MWDA 3S2UA 4NATA 4ND8A 4I5DA 3UB3A 4IYRA 3HJGA 2NM0A 1UBMS 2QA5A 3M82A 4EJSB 3DMGA 1RI2A 3EC2A 3K4HA 4LXIA 1TO6A 4RMIA 3TRFA 4DLAA 5IT5A 3IKMB 3IAS6 1ZKDA 3DPUA 3O82A 3SE7A 4P0PB 3ZJ4A 3DJFA 2EJVA 2ZB8A 3ZGVA 3W5DA 1M0WA 1HBJA 1Z37A 3OLZA 3PQFA 5DHQA 4TWRA 3ZHXA 3J81C 1GPH1 1W30A 4U7FA 1ABEA 2OAGA 4GLBA 1CJVC 4F8JA 4TYMA 4HXGA 3U19A 4CTMA 2EGHA 3R3VA 2IYZA 4JLJA 5LP6C 3E2PA 4YFVA 4BO5A 3AVOA 3GFBA 4P2BA 2ZJZA 3MAGA 2A4MA 4WOJA 1D4FA 1GP2A 2ZE5A 1EIZA 2RHOA 4JBHA 3EK2A 1HNZB 3I39X 2FF5A 3LPAA 2B94A 3NWBA 2DXIA 4GS5A 3BH7A 4PLPA 4L5AA 2PBLA 2D2FA 2X7HA 1ZJWA 1QLHA 4DWOA 3MS2A 2QQGA 4HUTA 2VK2A 1RAEA 1XDBA 4YASA 3ERCA 3EEQA 4I3GA 1K8QA 2OHXA 3WLJA 3Q7SA 1S4QA 4IIGA 2G08A 3ILXA 1BMFD 3R20A 1PLLA 5E4YA 1VG8A 5NULA 1YAHA 3FDFA 4GD3Q 2W48A 1KJNA 3WB2A 3ZQUA 4N48A 1IBLE 1DLIA 1Q11A 2GVDC 3PXAA 4NKRA 4AMYA 1G7SA 1VP9A 3ZXIA 1KDZA 3I2IA 3PX7A 4BFVA 2PU7A 4WOBA 3TCKA 3T7TA 4BFSA 5FORA 4AB1A 2ZBPA 1JGTA 1MPTA 3B6IA 5A71A 1L6RA 3WGGA 2WHEA 4QQ8A 5EQDA 3GT7A 3W5IA 2VQFI 5ADVA 1TW2A 3I9MA 3KYCB 4ZIRB 4DCUA 1R6TA 1WMFA 1YGYA 1UWVA 3CWZA 3OQBA 3EZYA 1F0KA 1SCJA 4WJLA 1DAPA 1M34B 2RBEA 1NKSA 3HA3A 3SM3A 1Z07A 1W34A 3QVXA 1PS0A 1JTVA 1M5UA 2EXXA 2A0XA 2P9GA 4HAWA 4JLOA 4Z7CA 4LOKA 4GMXA 5CUQA 3P96A 4ZXPA 5KC8A 4YCCA 1TLTA 3CE9A 2OP1A 1EFHA 1V39A 3NBKA 5EINA 5JLJA 3BL5A 1F48A 2YXPX 3CRQA 3DVQX 5B53A 7REQA 5JV5A 3OUTA 1M0TA 2WJ6A 1RP7A 1R6AA 1E2BA 4Q3KA 3LA6A 3LC7O 1S4EA 3BL6A 3EMBA 3N75A 3BIOA 4MB0A 3DAFA 3DL2A 1SWVA 3WYCA 1VISA 1HDEA 1DL5A 1L5KA 2Z5GA 1FXSA 2AYXA 2JF0A 3DPIA 4CI0B 1G66A 5EIWA 1CF4A 4F86A 1T8TA 3RTBA 1I3MA 2E5WA 2C2XA 3JPYA 3DQQA 2WTMA 5SY6A 3ZY2A 1UKBA 4HXFB 3OLXA 5JI2E 5CIWA 3TDMA 3HRKA 4NCHA 3PQCA 5H83A 1N5JA 2Y67A 3F96A 1NRJB 4PWZA 2R6ZA 1GPBA 3IUMA 3M70A 1FQOA 1R6UA 1T3SA 1JXMA 4KXUA 2Z5BA 3WHKA 2XMCA 3CCCA 1F4LA 1CIPA 2XDAA 1C4OA 3OCXA 4IEIA 3U4DA 2ZXFA 5CIYA 3PF8A 5G4KB 1JR6A 2KYRA 4HDKA 4U7HA 3ROQA 3TVYA 4CF3A 4K0RA 3U3DA 1O97D 2OBFA 3R3JA 3UGKA 5IFKA 5I7AA 1GNPA 3SHFA 2C83A 3DD6A 3L7NA 4HEQA 4BV9A 1RJWA 4P6VF 3WDMA 3P06A 3TJMA 2E1RA 4Y2VA 3OEYA 3GPDG 1HQCA 1P39A 4B4WA 1O5OA 1ZI9A 2PS9A 2O1UA 1XZDA 3DBLB 1OXTA 3JQ8A 4NVRA 5I47A 2DCMA 4GQUA 5K0NA 3NDIA 1RM0A 3VKWA 3EGDA 4E5NA 4I4CA 5IS2A 1T3GA 4X6YA 3QEOA 1PTKA 1YCFA 2PKYX 3IIJA 4IZ6A 1MA0A 2E0IA 3Q7EA 3WJ1A 3ROFA 4BPBA 2XDWA 2F4VB 2CDCA 3U9LA 3AI1A 1ZU4A 1V43A 3Q3HA 3MQ4A 4PYLA 3RSCA 4JN6B 4FGLA 1IBLB 3U44A 1RNLA 1XD2B 2H1FA 5JXWA 1JFLA 2XIQA 3BMOB 2JAXA 3ZS8A 3OBBA 3OCWA 4X62B 5T5QA 5DTEA 2N42A 3CPHA 1J22A 1K5GA 1JZTA 1XBTA 1JJVA 4DR5E 1RE1A 5JW6A 1VB5A 3OHSX 1UT5A 2CE7A 2ECOA 2EYQA 4LF6I 1SOUA 2XV1A 2AN3A 3QOYA 2ZRMA 4GUDA 5F5LA 4CM1A 1V5GA 3MSCA 4BNLA 2JFPA 3GEGA 4KQFA 4F5ZA 5BNZA 3NNDA 3FAKA 1T5IA 4X1IB 1GU7A 4YK7A 3NLLA 5JAQA 4I6JA 1I6MA 3RIGA 2J9XB 3RRZA 4M1SA 3M6AA 1YB4A 4C87A 5T3UA 1EVKA 2PGAA 3OJ0A 5ER9A 2IPXA 3O38A 3TUIC 13PKA 3WKDA 2X5NA 1TIBA 2O8VA 1EFKA 4RPLA 1OV4A 5B3KA 2A94A 1JDZA 1SG9A 4Y2TA 3WZLA 2FXIA 4KH1A 5C7IO 3PXCX 4YRDA 5C0XB 3NKLA 4UEJA 1R1DA 1Z6QA 2BFDB 2NYUA 3HI6A 3IB6A 4GP7A 2P9FA 5LU9A 3O2JA 4QYSA 2WB2A 5ALPA 1GUYA 1DTEA 1ECPA 1MT0A 1UMBA 2GBLA 1IHXA 3EDMA 1L4EA 4K03A 4EDFA 1P29A 5IDVA 2OCAA 4YDSA 3K0AA 3R9IA 2BR5A 1RLJA 5GTDA 4YXWA 2ZUUA 4HNQA 3ES9A 2R4UA 3BRWD 4F4UA 4US2R 2D7DA 2ACVA 4MO2A 1E9FA 1KY3A 4N1AA 2ASVA 3B60A 2G7MC 3K94A 4NHEA 3IKJA 3RSGA 3HN2A 1FPQA 3B3GA 3DZKA 3NKVA 2YWXA 3NC4A 4GX1A 4O3MA 2V4MA 3CZ9A 4UDNA 4YAFA 5AHXA 3P32A 5HCIA 3VGJA 4JI8B 4A6XA 4O0MA 3VR5D 2QY9A 1ZVMA 3SOZA 1BU8A 4USKA 1AN0A 5K36A 3H3JA 5CFQA 2XODA 1PAUA 5DTJA 2YCBA 2HL6A 4LSGA 1XMOB 3DVSX 4HAVA 1VCNA 4KKXB 5ESWA 1GN8A 3DKPA 4WECA 4Q9HA 3LOQA 1OTHA 3RYTC 5KIAA 2QN6A 5EE0A 3EH2A 4QPJC 3TNFA 4QLBA 4H1WA 3KEMA 1QHEA 1DJMA 1HE1C 3KVRA 4OOFA 1EX9A 1Z0IA 5K3BA 3RD5A 4I4IA 5BUZA 2H5LA 1RPAA 1GZ6A 1A4UA 2GUGA 2QZJA 4LS3A 2G06A 2G63A 1RI1A 1XB2A 1PR5A 3MJCA 4R41A 3THOA 4EGAA 3CVVA 1EDDA 4JBYA 2CXPA 2XMRA 3FNQA 4HGRA 3OZ7A 4EGQA 3JZMA 3KPWA 1D0VA 1LBSA 1PJAA 5G3ZA 4I5FA 3CKYA 4F71A 4I4NA 1EFPA 2FN7A 4YI3A 1CT9A 1GA6A 2DUWA 5JAOA 4TT3D 4ZVUA 3NHRA 4CTOA 5IAAA 4NENB 1R5BA 3GZNA 1NA5A 2VYNA 4IIUA 2JJ1A 5ALJA 5NLLA 3ZDQA 1KEPA 5KNBA 3DTVD 1ZH8A 1C4KA 1QH8A 2P6PA 2Z6VA 4GEGA 1RRFA 4PPQA 3D4NA 3WB1A 1YIOA 3K0SA 4MV1A 4BLWA 3OZWA 1I3LA 3GJZA 1AUXA 2VKQA 1D03A 2W4QA 4FYVA 3OETA 2AKAB 2AW3A 4JOBA 2P65A 3FKSD 4R1TA 5EXXA 1GAQA 3RIXA 3U6BA 2HSDA 4B76A 1PZMA 2PO0A 1KY2A 1G5QA 1FF9A 2IZ6A 2R1TA 2RBKA 4B2PA 5E2IA 4UMDA 1GAWA 3L1KA 5J2TB 2G9VA 1HSZA 4M49A 2FK8A 1EFVB 5DHAA 3ZWVA 4ID9A 3ZNQA 1C8KA 3VPDA 2UZAA 4BNDB 4DQKA 1KAOA 1R4NA 3BGSA 3U4HA 1ZSNA 1EGQA 2Z5EA 2ADMA 2DWPA 5D2CA 4ALLA 1QZXA 3SBDA 4BIMA 1XHLA 3CUSA 5KJFA 3G13A 1BE6A 1RZRA 4K6HA 1E0SA 4AIDA 2VP4A 4AMGA 1NSFA 3V00A 4EA6A 1VHWA 4NBTA 4NJOA 3IIIA 4TPKA 4KXNA 1W0JD 1SFRA 4B85A 2WWXA 3UMBA 2GN1A 5KNCH 2P1DA 3FBWA 2Y1KA 3Q11A 4Q3CA 3A9CA 2YXLA 2I1VB 1FB5A 3GG9A 5T8KA 3F9IA 4N49A 4O4IB 3T99A 2YKGA 3WGNA 5E7MA 2IEIA 5BVGB 2CHFA 1SUIA 3R3WA 3R44A 1MABB 1U9ZA 3FMOB 4WKOA 3B1WA 3FRIA 5K0LA 1X3SA 4LF5I 3FVRA 4RVSA 2BGLA 4ZICA 2P9QA 2ZR7A 3K73O 4NPHA 4X85A 5CM8B 2C37A 1HDIA 2FUG1 3CKMA 4H31A 4WY8A 3SC3A 5LQJA 4GPZA 2Q21A 3RFXA 4ZEXA 2EX1A 1CE8A 3SKXA 3V42A 1VQ1A 2ETXA 2FE1A 4R1MA 3STUA 1PDWA 4YJHA 4ASUD 5KOHA 3HJAA 1U8XX 4JI3B 4DR7B 5I9BA 1YBMA 1EM8B 1NJ8A 4KWEA 2H7YA 1CYEA 4HATA 3KQKA 3WMXA 4B6OA 1KI3A 3G23A 4V0KA 4ESHA 4G81A 4DYHA 3WLRA 2WE8A 5M29A 3FZYA 1ZZEA 3LPMA 3BG5A 4BO9A 4UKDA 4ITRC 3CVWA 2ZUFA 2G5PA 4B9AA 4OQYA 4E09A 3JPWA 2Z0MA 1UDXA 1OD6A 4R8RA 4M46A 4C1NA 3NHFA 1PTJA 4C14A 5CVTA 1Y6RA 2V1XA 3E6AA 3VBEA 2GWRA 4KK3A 4LGYA 4E33A 4WUBA 1PV2A 4Y18A 3WIUA 1I51A 5DIFA 4ZYXA 1CIVA 4ETNA 1L5OA 1Z33A 2GN0A 5TB5A 3U3XA 2J3DA 4RTPA 2XZLA 2IOPA 3V7NA 3QPAA 5DMXA 1FP7A 2O6HA 3KX2A 2B7LA 4U9HS 3IQEA 3PUVA 3D2AA 2P90A 2HCBA 2WP8J 5JCJD 3T5PA 3UAZA 2H0QA 3W5HA 1NVBA 5BWNA 5H9WA 3G5AA 1FP2A 2QJOA 1UK9A 1LDGA 1MTZA 2QOEA 3ACBA 4CF5A 1FX1A 1DKMA 2HM7A 2I34A 1G3MA 4N5MA 2QNRA 3I2KA 4P2GA 2GF9A 4PU9A 4ZTBA 1SIBE 3BD6A 1TC1A 3FPLA 4MR8A 5KYVA 3UUFA 4DAOA 4MQYA 1PF7E 4XJSA 3AK4A 1R64A 1GR0A 1K89A 5JPCA 2H2WA 2C2ZA 3V8EA 5CVDA 2QRUA 2XRMA 4DDHA 4CEIA 2FCAA 1EGHA 5FA8A 1ISMA 2HY7A 2V3VA 3R0ZA 4DLKA 4IDDA 1LK0A 2C3PA 5JEDA 4M8LA 4Y1RA 3S8EA 4D25A 5LYJA 3I6QA 3FJOA 2NX2A 2H08A 4WLEA 3A9VA 5FI5A 5J5VA 3KT0A 3UWMA 4H7FA 1RYFA 2JEAA 3DAPA 1OUMA 2HMUA 2JG3A 4BPRA 1C9NA 4PC1A 1YIDA 2K6GA 3W2IA 5EYPB 1C7IA 2NN6A 1TKAA 5EIOA 1J8VA 1B0ZA 2P62A 5DHRA 3V9AA 2GBFA 2CXXA 2FN8A 2L2QA 1L8LA 3LI2A 3MHPA 2ANCA 1E2NA 3OEWA 3TTWA 2OZKA 3SC4A 1MEEA 1DC8A 4NEHB 1PFYA 5ALQA 3Q9SA 3AIMA 4BX3A 4X66B 1N33B 3AI2A 4A0SA 4GKJB 1LJLA 1QGDA 2MYTA 1AKVA 3B52X 2PMFA 1IUPA 2QP9X 1A04A 2DTXA 3AV0B 4FLMA 2C7GA 4LCJA 4TTQA 3T9FA 2QI9F 3LPDA 3UIEA 5C32A 2BGJA 4RETA 5E9AA 1XELA 3O2NA 4OJNA 1QPBA 3HKEB 3MYRA 2AVDA 3G5MA 3EDQA 4ISAA 4Q18A 4TLMB 4ZEOA 3FMVA 2FWRA 4UZSA 1EDBA 1W4AA 3UBMA 3VVMA 4XEHA 3I9JA 2HYDA 5FBZA 5BSFA 1ML4A 1E5XA 4KO2S 3F3KA 2LKCA 3B2NA 1P81A 2CDRA 4ZO6A 2Y1CA 2CJXA 4JX8A 3UW3A 3ZNNA 2YFYA 4ZYWA 2FWNA 3A9WA 1N75A 2DZDA 1H6BA 3E7FA 4S1WA 4Y0NA 1MENA 1PHPA 2LZ0A 3A06A 1OFHA 5FUBA 4AU1A 1UJMA 2BUCA 2ZJ7A 2WMOB 4ZJPA 5KDDA 5JY6A 1QZ3A 4F5YA 3LWBA 4YMLA 1QRTA 2R3VA 3T15A 2B92A 5JMOA 2AF3C 3GFQA 1RTTA 2OO5A 4EPRA 2DPMA 3MGKA 4J7XA 1E7SA 1I10A 2YC4C 1W52X 4NQZA 4Q7JB 4ZAXA 3TO5A 3H18A 3I8SA 1X8LA 1HG0A 1N2XA 4DV2B 2MTBA 3F7MA 3OIWA 3R3ZA 4PZYA 3VH3A 1ATIA 1JYEA 2A0KA 1QX4A 1WD5A 3LC0A 4C01A 3GXOA 5BWLA 1K7CA 4XSGA 4BTEA 3K72B 4W8OA 4ZGWA 1KK1A 1XTZA 2Y0DA 2CHQA 2EF1A 3FI9A 2LJPA 3LQ2A 5FULA 2RGEA 2W90A 3H1CA 5H16A 2JGDA 5JRZA 1E79D 3D1VA 4WNAA 1M5TA 4CKEA 5C3MA 2PS1A 1HYEA 1RDFA 3ANXA 1RPJA 2AFHA 4J16C 5KAPA 4O33A 1RCFA 3VR6A 3T41A 1Z5AA 3THXB 1XMIA 3VPSA 3WYDA 2TYSB 3RO7A 1JEDA 4R40A 1IBMI 4RH3A 2JATA 4B1FA 2PSDA 2IERA 1A2QA 3HG7A 4L6AA 1A72A 1GA1A 2BBWA 2Y2VA 4W63A 2D1RA 2BISA 3HNOA 2GAIA 3WGJA 4CXMA 1J1ZA 2GNAA 4J0HA 1C4XA 2C3MA 3ZLUA 1XG5A 2IYYA 4GUAA 1OJ7A 1UKEA 2Q1YA 3DB1A 3PEFA 4G37A 1NXWA 4LFAI 1GL7A 2OG2A 1V1MB 3NT5A 4HEJA 2ZIAA 1R9JA 3DT8A 3F3YA 1N32B 1KMCA 5H3HA 2DE0X 2WAXA 4MW5A 3AF3A 3GT0A 3KD2A 4PW0A 4ENPA 2CL0X 1WXQA 3H5RA 4B5LA 3AZOA 5HM8A 1D2MA 2PKXA 2UZ3A 3LBIA 3PLAE 3S2ZA 3UWKA 4CM5A 2CDNA 3EDYA 4AKEA 1NVDA 4JENA 4UE3S 4AY5A 4EBBA 1N77A 1GM5A 1QX3A 1IQ0A 3KKLA 1ZHFA 1B3RA 1SGWA 4X7MA 3ZGZA 1NR7A 4MKFA 4RJTA 1JVBA 4XOUA 1EWQA 4QG3A 2NUAA 3GWGA 3HCRA 1VJ1A 1T91A 3AEXA 1I3OA 2WSYB 3D4JA 3ZU2A 3Q6MA 1X1AA 1K6EA 2DU8A 3ZU6A 3P52A 1RR6A 1UMKA 5JQGB 1RWKA 3QUCA 2POCA 5EJ4A 5CLFA 3IHLA 3H0EA 1DTWA 4GC5A 4OHFA 3BMQA 3JATB 2H2FA 1RPZA 4BQOA 2EDCA 1T4GA 2E89A 2H5EA 2OFWA 2EWMA 2VDVE 3L8DA 4L4ZA 2YZNA 3VOSA 3VPGA 1DS6A 2AT1A 3A2NA 4B74A 1RD4A 3N9IA 1OXKB 3SQOA 2ZBDA 4PIVA 3MFQA 1OIXA 1W0JA 3N2EA 4MS1A 1ZMOA 3M6UA 1TM4E 1E3TA 3GLIA 4A0FA 3HBJA 4DNFA 2FMXA 2HMSA 1POWA 4BLPA 3C3AA 4ZARA 3RSOA 4QHTA 5CBKA 4ENQA 1TQ2A 1N7HA 2JLBA 2V65A 3CHYA 3GZJA 3IAM6 2L0XA 3GK3A 4DKXA 4C7KA 1RWQA 4FFSA 1D1QA 4MQ4A 5AI4A 2GA9A 2LNDA 3NIBA 2NXNA 2PTHA 4ZU3A 4QOGA 2OO7A 1Z5OA 1NT2A 1YI1A 4JB3A 9ATCA 5AW5A 2AJBA 4WXPA 3ZD6A 4DCCA 2NG1A 3FNFA 5JSHA 2OY0A 3N6VA 4WUDA 4A16A 3CX8A 4J0FA 1POXA 4GAEA 1X7HA 3CLSD 3K9BA 4O2BF 1QIJA 4EI2A 2BRUA 3MB5A 4DSOA 4ZV4A 5LQAA 1Z3CA 1JI3A 1MF7A 2C98A 4RKYA 2YHAA 1X70A 1GKIA 1RQRA 4GEKA 1QQTA 1HSOA 1OWOA 1JIUA 3DHNA 4QU5A 4UULA 1TXGA 3CDJA 2ZYHA 4QHSA 1KP9A 5IC5A 3AX6A 3SM9A 1DAMA 3EGXB 4A9AA 4ESEA 1UODA 2R5WA 2XUHA 1K5DA 4PLGA 5F9HA 3D3WB 2VHCA 1XTTA 2BHRA 4IG4A 4UAJA 2Y1XA 3WWPA 5LSAA 2XD9A 1P4GA 3E82A 1T36A 4KIWA 1FSPA 4H16A 4JDPA 3OY7A 2Q50A 1COWD 2CJYA 3E3NA 3VR3D 1LA2A 4FFLA 4A23A 5B4VA 2I1LA 3L7JA 2QGZA 4M0LA 4NXME 3ENZA 4J94A 4QJ3A 1DCTA 2H1RA 1GFIA 5EQTA 1AM4D 5CITA 1IN4A 1Z4NA 1K63A 1N7JA 1S89A 3DOUA 3UATA 1MB9A 3I04A 4ZU1X 2AK2A 2JNWA 3C97A 2E3JA 3EA0A 3A11A 3IEXA 1VHDA 3A27A 1NONA 3DOIA 4WE3A 1WQ1R 4NBWA 3DKVA 3PGXA 4I66A 5IJXA 3NCTA 4PVCA 4C88A 4U4AA 3HB0A 3AVWA 1P60A 1QGUB 2BEUA 4YT2A 1XUOA 5AHOA 1JEYA 2DLCX 1XF1A 3JWHA 5EY5B 2QTMA 5K8CA 1JU4A 4L9RA 1E4YA 4OMUA 2DWUA 3C5HA 2IVZA 5BWBA 1E94E 2PUWA 1L5MA 4K9OA 2BRUC 2OESA 1YUMA 4NZOA 3SC2A 4EB6B 1VKOA 1XHEA 4A6EA 4MWEA 1UH5A 1E77A 4RM3A 3MNFA 3PS1A 1TCVA 1SA0B 4BMDA 1EUDB 3OQJA 4KVGA 2B3TA 1P9OA 4KREA 3WRVA 1RBZA 1A50B 1YJ8A 3C48A 3EVTA 6ADHA 5HRUA 3A3YA 4QULA 4EX6A 4YRZA 5KQGA 1RHKA 2G1PA 3L8CA 2F1OA 5KNCD 5FOWA 2A7XA 1D2CA 2P4HX 3UK2A 5DM60 2V1UA 2MSNA 3VHRA 1U3DA 1Z5NA 2VF8A 5BYAA 3HABA 1IEWA 2V7QD 5AVVA 2H2IA 4R68A 3LHIA 3SLRA 3R3UA 1OLSA 2E5LE 3BH6A 4R8SA 4TLBA 4WZ6A 2IDJA 1O96A 2PX2A 4FDUA 1C3JA 3JQFC 5A4MS 2H00A 1TKRA 1O7JA 2PR2A 3R6DA 3GD5A 4Z0PA 2XGJA 4U39A 2R6CA 3NQ41 1I0IA 2K5UA 4PTYA 5DFAA 5G0SA 5HJ2A 1YIAA 5K36B 1CVRA 1S4MA 3AV3A 1ZJ5A 1D8TA 1JKJB 3LRTA 4QFCA 4P92A 4FN5A 1GXSA 4W8GA 3KP1A 3T95A 3A1VA 4BMXA 3L7YA 2ZB4A 2CHGA 3K32A 2P2LA 1QTQA 5JAIA 3X1XA 2QTRA 4DDKA 2ZSAA 3KYDB 1MO2A 1CF2O 3OIFA 4NZZA 1IZZA 3D4PA 4WINA 3NIGB 4DU8A 4KIJA 1ZO8A 5FI1B 3T7SA 2PV0A 2XB8A 1TAQA 5LZ7A 4DQLA 4F96A 3Q12A 3HKEA 3PHCA 3DFMA 1JQAA 4UDYX 1DKUA 1QM5A 2DETA 2I2BA 3VI3B 2D5LA 2YWDA 1V9CA 1OKKD 2FFRA 3JSXA 2HTFA 4PCVA 4EGCB 1BEEA 1M3SA 3E15A 3ZLTA 2GYUA 1T3TA 2WHXA 3I72A 3LCCA 4OLJA 3AUJB 4TKZA 4XWOA 2Y1DA 3HYRA 3AONB 4IXNA 3RVLA 3UAOA 3U7RA 2ORIA 3VR3A 2C9DA 2ZSFA 1AK9A 8GPBA 1OJ4A 2ONKA 5AI6A 3FSGD 1MOQA 2ZE6A 4NNPA 5HQJA 1I0LA 3FCOA 4P53A 3PENA 1CS4C 1AHHA 2B4AA 2Z1DA 2HKEA 3LV8A 4FHEA 4PGGA 4R9RA 3ZZ1A 1BMDA 2H1WA 4FBGA 2O5EA 1FLVA 5AP9A 3L8MA 2VJMA 4OO1A 1QO0A 4C0LA 4CWAA 1GAEO 4OOEA 3W5UA 4BEJA 1F0NA 2OGUA 1DC6A 1KFJB 3A7EA 4LC9A 4ECAA 3CGWA 4J0KA 1IZ9A 2WLTA 2C7BA 3BKWA 2XT9A 1R6MA 4UAUA 1UFQA 5AOVA 4GOOD 3IAXA 3WFIA 2PH5A 2JC3A 4RZSA 2WSLA 2H07A 3MJTA 4M76B 3B1JA 3UKOA 1A4IA 3MRXA 2PGDA 4QDXA 1C7QA 5KYGA 1MRSA 2ZQYA 1OVGA 1X80B 2JI7A 5FWXB 2OPHA 2NUTA 4WBSA 1E3IA 1UPXA 1W5SA 2FPLA 1C0KA 5K2OA 4AQYB 1LRLA 2I9PA 5GIOE 1QPGA 3ANLA 3TMKA 4KZKA 3JQAA 4BY9E 3NHZA 4C7VA 4FYYA 3SG0A 2PUAA 3RS0A 1M2WA 3HWRA 1EK6A 1B16A 1RRPA 4KGVA 5HJEA 1JIKA 1EKXA 2AMFA 4JUCA 4LYEA 3PPVA 2RMKA 2ZJAA 3A4NA 3F2IA 4JLAA 3SYRA 3UWDA 1CJSA 1JG1A 4MUXA 5B3JC 3F5FA 5K0SA 2AD5A 4N8EA 4UM8B 3HI4A 2GFQA 2IH4A 4RTOA 2P6MA 1FDUA 1O94C 2O2XA 3DJYA 1H8HD 4OXRA 4MVWA 4Q6WA 4X45A 1P7ZA 3E35A 3LBNA 1JP7A 4EZEA 4WLUA 4FWBA 3NPMA 4UDOA 4YAIA 1CBUA 4JASB 4XQEA 3NBQA 4BX0A 4HOYA 2VJOA 2PKEA 3WV5A 5KVSA 4F12A 1X1EA 1DDIA 5IULC 3MFYA 4MAMA 4B7ZA 4FE4A 1K1EA 1KI7A 1YKSA 4RQUA 1QVVA 3VU8A 1B8OA 2MYPA 3GMIA 3ZH2A 3ANTA 1KQGA 4LZOA 2D0IA 3ZHOA 2D1SA 1G8KA 2HAEA 2RGDA 1D4AA 4KE7A 1BXKA 2NQTA 4M0MA 3EXEB 3R7WB 3KVVA 1RWXA 3GT4A 4R16A 4RF5A 5FB3A 1BOFA 5FWDA 5TEVA 2ID4A 4H3HB 4CPDA 2QE7A 2ZJBA 2R1ZA 4DQUA 4KO3S 4J0QA 5D01A 4HDCA 3F97A 5EUBA 3UYLA 3RYCA 3AKDA 3LDFA 3UY4A 1T4MA 1UQTA 2QU7A 4XAQA 1NLUA 1VTKA 3O8DA 4EZBA 3OU2A 2IYQA 4R7TA 4LXUA 2OAEA 4XX0A 4ZT3A 2XLBA 5FBWB 4I4LA 1SBHA 5LLSA 1F4VA 3U3OA 2J6BA 4F3NA 2VYFA 2FB9A 4REOA 4FYXA 3SD7A 4DUYB 5B6IA 3KHUA 1EBFA 3B7WA 5EKSA 1XZPA 2RCYA 4L0CA 3OH8A 4CTJA 4FK8A 3AILA 3SLKA 1J0CA 2BJVA 4RF2A 1N9GB 2PNFA 1FLDA 1I7PA 4A8JA 3BK2A 1JR3E 1Z83A 2YOGA 4TS4A 4H7JA 5ARCA 5BRNA 5JD5A 2IYNA 2FPXA 4GR9A 2I1QA 2NWQA 3CJRA 1PN3A 1SXJE 5DISB 2IUEA 3EC1A 4K9KA 1LJ8A 5TARA 1UZNA 1XDSA 1NSYA 3HB7A 3REQB 4J3DA 4N65A 3UC9A 3U5ZB 2PRSA 4X54A 4MYTA 1L9KA 3KT8A 5A0TA 4O5AA 3IP1A 4CUJA 3GFSA 1L7NA 3ROGA 1GPYA 2CFCA 5DWVA 4PIMA 3UYKA 4IKEA 2ZSKA 4UJ5A 1QPZA 4KGXA 1E4EA 4UW9A 1TB4A 4UOQA 3TSAA 2COKA 1TE2A 3NANA 4JYZA 1N2CA 2Z5CA 3KEGA 1K27A 1LLFA 3QBVA 4BLUA 1TVMA 3R1IA 5I51A 4JYAE 4J29A 2VP9A 2VTDA 4XR9A 2QGFA 4JKYA 4AZSA 3A6PC 3NTVA 2VYCA 4W99A 3K92A 3BQNB 1TCAA 5BWCA 3N07A 2ZTLA 4YI5A 4NJMB 3BCRA 3AY3A 4U8HA 3S6JA 5TQ2A 4LDPA 4GPBA 4P82A 4MTLA 3SFZA 3R24A 4DRZA 4F6RB 2C2YA 3IPRA 3IJRA 2AWNA 4U2BA 3WGZA 3VZRA 1F5SA 1QG6A 2P5YA 4Z3KA 5HPYB 3O3OB 3ODGA 1HLDA 3HGQA 5I5GA 2SBTA 3LK6A 4Q7EA 2F3RA 2ID9A 4ZO4A 2ODPA 2P9JA 3IAAA 1LDMA 5HTOA 3O75A 1T2FA 1U7TA 4IV0A 3K0AB 1YOVA 2A0WA 4GLOA 3VYWA 3G02A 3HN6A 4W5OA 3W78A 3B36A 3DWFA 3NH6A 5C4IA 3G7UA 4JI8E 1M76A 2Y9PB 1U2PA 1ZH6A 4HWOA 4NAUA 4IIJB 1UMCA 3UCEA 3DS8A 3UQZA 4AKTA 3HCFA 1GQRA 1PVVA 4P7FA 3PC2A 1LSOA 3TXYA 4IINA 2VQFB 3HZHA 1KFEB 2F8TA 5DF1A 1NF9A 1RR9A 1VG0B 4PR0A 1BDMA 1Z7EA 4KWCA 1F6BA 2GEDA 1BC5A 1BGWA 1LKZA 3TEMA 3VU9B 1SJ9A 5HWSA 2A30A 1VBKA 4HD8A 5LPNA 4NXMB 1Z36A 5JBNA 1QGUA 1T25A 4UZEA 3ZHCA 3BHMA 1KPHA 4QRIA 3BE6A 1MHPA 3IAEA 1W85A 4P3YA 4BWVA 5ICCA 4L5BA 4RTRA 2C1EA 3AUXA 5EJMA 5FPPA 3K09A 3JR7A 4WNCA 1SKYE 4RHTA 1PE0A 1Z0ZA 1T2DA 1UJCA 3ZX4A 1J1IA 1VOTA 3AEUB 4HR7A 2ZK7A 3D6AA 4WVFA 5GV7A 1JB9A 1Z0WA 1I3NA 2ZCUA 1P33A 1JLKA 1ZK3A 4LZLA 3CNHA 1LLCA 4R2MA 1EIWA 2IF2A 4ITUA 2V3CC 1SBNE 3D3EA 3IVXA 2CCGA 1OXSC 3IILA 2ZRIA 2VWGA 1J06A 1RI5A 5G1NA 1ND6A 1ZMTA 4EJ0A 2JAUA 2PA0A 2PH3A 1ECCA 3GUUA 4X1KB 3COVA 1GL9B 3L06A 3ZGYA 3QFSA 4F91B 4KLCA 1RXSA 4DUZB 1ZRSA 1MB0A 3UG6A 1KIAA 3M0EA 3SX0A 1X39A 1YVDA 2CYAA 1O97C 3UBTA 3MGGA 2VPWA 3O8BA 3DV9A 1GZDA 5K3SA 4LJRA 1PFUA 3VAYA 3T4UA 2PANA 2PUCA 5ULLA 1IJEA 5LQNA 1W5AA 2GSWA 3LCUA 1VB3A 3LUHA 3RQSA 3U31A 1MC4A 4EFMA 3M9LA 3KAPA 2EJUA 4OEHA 3HKDA 4NHOA 1I0ZA 2E87A 1TA0A 4DY6A 4LPSA 4DR7E 4GZMA 5BN3A 4O5OA 3HV2A 1R6DA 1GZSA 2HGSA 2JCXA 1N5IA 1W88B 2BEWB 5JATA 5IPFA 4DMHA 2RJOA 5DB4A 2DH5A 2VWHA 3G1WA 2QY6A 1HOTA 1C1YA 4PNHA 4TRNA 4LI0A 1P0QA 5TY0A 5KJ1A 3JWIA 2QM0A 1PT8A 4WZBE 1Q21A 1Y4DE 2GMWA 4I9UA 4BNMA 3LUGA 5I4IA 1NW8A 1AO3A 4Z3OA 2IV3A 1GZVA 1UM9A 5TPZD 3LXXA 1I9CA 3DZGA 3KYBA 1KI6A 1AK1A 2X9LA 2XB4A 5TQJA 3PFCA 3SKYA 3KZOA 3R7SA 1QFZA 2QU8A 3ZK9A 1XYYA 4DBLC 3EPKA 1H0RA 2TSYB 3FN4A 3CN7A 1XFDA 2HLDA 3Q7RA 6GPBA 4QX6A 4F46A 3HBMA 3AQIA 4M0DA 1P0FA 3J81A 3A4VA 5JBIA 5JR3A 3GLTA 1JEYB 2CV1A 3MT8A 4RTKA 4GBGA 1RFLA 1WM1A 2WWYA 4Q3AA 4S3MA 4D9NA 5G4KA 4QUKA 3IDZA 1R27A 1UXIA 2ZYIA 1KFBB 2REBA 4N54A 5BQPA 1H7UA 1FP1D 2J33A 4LN1A 4BNTA 3MTIA 2FMIA 3ELYA 3LYHA 4K7JA 4R1QA 4ALIA 4TS9A 3VR5H 3PUWA 3OTOE 4GI1A 4OM8A 3VISA 1LCIA 3HQ4O 1AXGA 4IOLA 3NAMA 3H3FA 4REQA 2E37A 1JHQA 1QS0B 1R0CA 3JQFA 2ZIUB 3MJEA 4HB2A 3UMSA 2IHKA 3IP3A 4K6KA 2GEUA 2UZ4A 1J23A 3EWIA 2Z2KA 1D5CA 4K3UA 4YMWA 4JB2A 4NG4A 1EHIA 3H2YA 5BO5A 2KX7A 4JJIA 3FSRA 5K8IA 2VJQA 3DYIA 1ZJ4A 1REQB 4PYRA 3NJ8A 5SZKB 4DA7A 4NFLA 3T1OA 1MRNA 3O95A 1FYEA 3KSAC 4CCSA 2CCKA 2PFSA 4MV4A 4YT5A 5C0OE 4FMDB 1SC1A 2HRZA 5B7GA 5K8VA 2Q6TA 1A6FA 4B4DA 4YXWD 1CZHA 1K88A 1EFUA 1A8SA 2ILVA 3GV0A 3LP5A 4FPXA 4P4UA 2IEZA 5CM2Z 3UWPA 2Y8EA 1UXOA 3STXA 1TZBA 4URXR 1G55A 2BKLA 1JAXA 1M0EA 3CPJB 3DDUA 4GKJE 3EFHA 4FR0A 4MW7A 1DC5A 1MOSA 4M8SA 4BP8A 3HYLA 2ZIXB 4CEHB 2HA6A 2RI1A 3G6WA 4UVEA 3R6GA 4DPLA 2V7UA 2HUPA 4IWYA 4MV3A 5JZOA 4K46A 2PMEA 1FE8A 4NBNA 2QN3A 1X92A 4V03A 2PD3A 1TJ3A 4AQYE 1K06A 4OG2A 3T1HI 3PYDA 2OMEA 4PS1A 4Z9BA 4HH3C 1ODIA 1IBKE 1FBNA 3BCSA 5JNSA 5DM70 1RW4A 4QBTA 5COQA