1Y6ZA

Middle domain of plasmodium falciparum putative heat shock protein pf14_0417
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
258
structure length
242
Chain Sequence
PIWKQDEKSLTENDYYSFYKNTFKAYDDPLAYVHFNVEGQISFNSILYIPGSLPWELSKNMFRGIRLYVKRVFINDKFSESIPRWLTFLRGIVDSENSKMLSIINKRIVLKSISMMKGLKETGGDKWTKFLNTFGKYLKIGVVEDKENQEEIASLVEFYSINSGDKKTDLDSYIENMKEDQKCIYYISGENKKTAQNSPSLEKLKALNYDVLFSLEPIDEFCLSSLTVNKYKGYEVLDVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords heat shock protein, putative
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 78
structure length 242
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y6zA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y6zA02
3Q6MA 3Q6NA 2GQ0A 2O1VA 1HK7A 2CGEA 2O1UA 1USVA 2IOQA 2O1TA 5FWKA 2O1WA 3HJCA 1Y4UA 1USUA 1Y6ZA 2CG9A 3PRYA 1Y4SA 2IOPA
chains in the Genus database with same CATH superfamily
4HWGA 1UFVA 3P3CA 1ZA1A 2XMPA 2CBZA 4JI8B 1ZNWA 1YJ5A 5BR8E 4NS1A 5IAEA 1B1AA 2LV8A 4KVZA 3RC3A 2G1JA 4IIUA 4IZJA 2DFPA 1RRPA 3P0FA 1F4PA 4YJFA 1X38A 3STTA 2C58A 4WKNA 4URVR 4F3CA 4D4GA 1QE0A 3HHPA 1D6MA 3L4SO 3P9ZA 4DPMA 2YRXA 5KREA 1R8QA 2J5XA 2FG7C 2VFAA 3KOUA 4EI7A 3G8YA 5IUKC 4ZFNA 1WU8A 3FNQA 1M6VA 2Y67A 4LE1A 3IMKA 3HK2A 5EJ4A 4RLHA 3DEHA 2H17A 4Y2YA 5FJJA 4PGMA 1ESZA 1SPBS 4XEUA 5H82A 2K2QB 2LWIA 3GRPA 3QX8A 1J8VA 3HY6A 4U63A 3PHJA 3OCZA 5TE9A 2IWHA 4R8RA 4YCCA 3IKTA 2ZRQA 4DSNA 1AJEA 3G2KA 3P7MA 4MV3A 4AULA 1JLLB 4LX0A 1T4MA 1KRWA 2Z4RA 4O4LF 2PX3A 2JEZA 2Y3IA 2Z5EA 1O5OA 1SVNA 5EE9A 2BI8A 1ZGAA 2PX2A 4LHVA 2GCOA 1MG5A 2MR6A 3FNIA 5D5QA 3PCXA 1L5LA 2JJ1D 3ZDXB 3NC4A 5ILOA 3ZJ4A 3MTJA 5A3RA 2JEBA 3LBFA 4M55A 2R96A 3E3LA 5IKPA 3ZD8A 1FXUA 2C83A 1Y5LA 4Q4AA 1YR1A 1AA9A 1XQ6A 5DN6A 3E2MA 3O9MA 4JJGA 1UDQA 1MNQA 1NQWA 2SBTA 3ZH9B 1BFKA 4KPUA 1BW9B 1BMQA 4HLDA 2GXUA 4ERXA 1V5GA 2IEDA 2X8AA 3K9WA 4X6UA 4GXQA 4PIMA 3ETJA 2FZ5A 2XUPA 5DOVA 5JYBA 3HP4A 1GGHA 1OWNA 4ZCQA 4RPLA 3L7MA 1NI4A 3BHJA 3I9NA 2F4VB 3ZV3A 3ANXA 5EXEA 1V1RA 5DTMA 3T3EA 1YR3A 4AMBA 5DHAA 2CK3D 1V41E 2EQBA 3DB2A 4AL4A 3DTYA 3UK0A 3IVAA 5IHPA 4EDFA 5JQGF 5C7LO 2V7WA 4RJ2A 1JX6A 4R8MA 5I9NA 1XROA 2JD1A 2BUAA 3AJ8A 4K9QA 2IXGA 2PGXA 5JSZA 5AW8A 4DVGA 4K7JA 1ATZA 1LBHA 1YIOA 2P2CA 4L5AA 3IMFA 3Q3VA 1G21E 4B1FA 1BEUB 3R7BA 1W0JA 4NU5A 5B1IA 2XB2A 4H3HB 2NNWB 3NUGA 3VNVA 1EYZA 2IDKA 2VPWA 1C4WA 1DIAA 1JDZA 1Z0IA 2Y1WA 4B3HA 1XLWA 2WLSA 3PL1A 3U4DA 3FZYA 3SDZA 1Q0ZA 2H63A 3I04M 1ITZA 4PZEA 1CU1A 1N36B 1T9HA 1DWOA 5G0UA 4X97A 2QD5A 3EXHB 1E96A 5CT9A 2FMTA 1LPSA 1NJSA 3LCRA 4O59O 5ALTA 3IVMA 4BP3A 3T3DA 1EXVA 1B76A 4LY6A 3QPCA 2RBGA 1J22A 3AG5A 4G0ZA 3UOWA 1ISPA 1SY7A 5CJJA 2IV3A 1N2ZA 1ZUIA 2C2KA 2SKDA 1W5EA 4GSLA 5KSZA 1TQ4A 3KJXA 3ORHA 4OA5A 3CT4A 4OQDA 2H5EA 4PYRA 4U2EA 4WXPA 3WRYC 2EEZA 1L8QA 1CQJA 3RAGA 2BYTA 2R7KA 3BSYA 4YALA 1PNRA 3G02A 3X1XA 1F14A 4DQKA 2UXBE 1M5TA 3P9YA 5FUYA 1YJQA 5K03A 3IPLA 3KUKA 5FV4A 5BN4A 1HT3A 1Y7TA 1PHRA 2FZGA 2M1XA 4Q1CA 1M66A 4IO1A 2FJ0A 1DIRA 1L3BA 4DR3B 3BGIA 4O1IA 3PQ2A 3STXA 1A1VA 1ST3A 2XGOA 3I5AA 4J16A 2JFPA 1GAQA 2HDNB 5BWLA 1ZGZA 3JSAA 4G9EA 4P7KA 1UDCA 4LVOA 4EG4A 2GD0A 4Z7OB 5D5HA 2AJBA 2NU6B 4H0NA 2ZB4A 4Q18A 4W1RA 3QITA 1KNXA 1SXHA 3HB4X 4H35A 1UK6A 4K9SA 4XJVA 2EWMA 4UUAA 3SXJA 8MHTA 1P1RA 5LNK6 2F3UA 3MILA 2AB0A 4R9VA 1QHFA 4NV3A 1Z59A 3D43A 2GEKA 3IEKA 1NAIA 4O25A 4C89A 3GLGB 3FDZB 1GTG1 4JXKA 4GS5A 4DR4I 1KI6A 2OBBA 2ZIEA 3C87A 3ELUA 4PTZA 4R1QA 5F4ZA 2WWYA 1THMA 4C5BA 4MLDA 4MZXA 4C6TA 4ER0A 3OQMA 5AJWA 2ZUBA 3WGUA 1RYMA 1P4RA 5I4CA 4DILA 1GPLA 1KZ9A 2PT7A 4RMHA 3U0BA 1LF5A 1K2WA 1CLUA 4GR5A 2REOA 1YDEA 1UEJA 3KQQA 2J9FB 4ZT5A 3TNLA 4P4NA 1H8HA 1LV8A 2WC1A 1SHTX 2PZGA 2GBLC 3MSXA 4PZDA 1MJGA 3L43A 4L0MA 4BMDA 3MTBA 5FXMA 4N3NA 4C0SA 4FDVA 4F4JA 1W29A 2IW3A 4IOLA 1RKUA 2GGSA 3IDFA 5HF6A 4YCDA 4JT8A 2QRZA 2SCUA 1N9GA 1ZD9A 3U1TA 5IX8A 4L3VA 5CXQA 5HIAA 4MYSA 1KI9A 2OCDA 1EX9A 3U0VA 1FS5A 4CFYA 4LF5B 3REQB 4RTJA 3O3CA 4LOMA 3WIVA 4XPIA 1AC5A 4O2BB 4KN9S 2J41A 1CYEA 1UDSA 4OO1A 1SD5A 2BI4A 1Y6JA 3O2NA 3KV3O 4M0FA 4ZDJA 3L8DA 2Q5LA 4AUEA 3O92A 3TBKA 5CA1F 1CR1A 4Q9JA 1JFFB 4MYHA 3OMWA 4J76A 2GXQA 1BS2A 3GLIA 2E5LE 2BJVA 5BR1A 3A3PA 5C8YB 3D6AA 4HMOA 2AF3C 3AVYA 4DV7I 4F4FA 1FOEB 2JLZA 5JZOA 1YCHA 2Y1DA 4BMVA 4YP0A 4UOEA 4LZOA 3ESDA 2A84A 2Q45A 2X1VA 4OVKA 4F2WA 4TMFA 4M8NE 4KODA 2J6IA 3NDIA 3QRWA 3IVRA 1DCKA 4ZVLA 4MDEA 4YI3A 1A95A 3OT1B 4S3MA 2A1IA 4BNYA 4REMA 4CIVA 1UFRA 2W6ZA 1DZIA 1KEUA 1P3DA 5C34B 2FMKA 1KZYC 3OZAA 4ESEA 2NU6A 3U4MA 4UTXA 1IZ9A 4BN0A 5DM2A 3K8YA 5G53C 2WINI 1U1GA 1T9KA 2CFSA 3FDIA 3FJYA 2MINA 1XIVA 1P0FA 1CRQA 4MUIA 5FAXA 3HBAA 2O14A 1W5TA 4ICIA 1JVNA 2OGTA 1SHUX 4KYUA 3HXOA 5AK3A 1J42A 1KO5A 4IIYA 1MRSA 4QNJA 2FPRA 1K7XB 2H4XA 4IDNA 4O63O 3FDZA 1UQRA 2OVFA 1JSXA 3KSZO 2NN6B 1ORWA 3BXXA 1IEQA 5D51S 1VPTA 4FW6A 3M7ND 2ECOA 3E8MA 3FCYA 2WG1A 1ONPA 2V6MA 2FF7A 4MU3A 4UAJA 4UDYX 1Z4PX 5A0FA 3RNLA 2GO7A 3SSNA 3T54A 3ZD6A 3F9RA 3PTZA 4XVQA 2UU9E 4CM1A 4QASA 3G8CA 4DPTA 1NNEA 4E03A 1GSAA 2IVFA 3CRZA 5GOZA 3HUFA 3UJPA 4Q1VA 1K5GA 1VLVA 2VQEE 5C37A 1XO1A 1VLHA 2I6XA 4IILA 2PO1B 2CHVA 3D4NA 3HG7A 4KXYA 3VVBA 2DWQA 2D62A 5EL0A 5FPPA 4QM6A 5CIQA 1GQYA 5MDHA 1RRCA 3ZGZA 1N5KA 1GT91 1L7VC 2G72A 5DXFA 3V6MA 3ANTA 4DPWA 1G2QA 1QPGA 2EVWX 2I2BA 1MV8A 2I5PO 2P9ZA 3M2TA 4G4SP 4YJ2B 4AS3A 2B61A 2GN2A 3ZDYB 2QNRA 4MQ5A 2IS4A 2ZANA 4W5NA 3O1LA 1PGOA 1WVMA 1YFKA 3KIPA 3LUJA 4NE7A 3VUFA 1IN8A 4E30A 2FG6C 5LBIA 1E3TA 5EVJA 3LH5A 2A7QA 1JLRA 2AR9A 3MGBA 3U62A 4ARZA 5DGDA 2WMDA 1GXSB 2WSSA 1ZD3A 3CW8X 3KOMA 3BILA 1C7RA 1KO8A 3GJQA 3JV7A 3GCDA 1FYXA 3KCQA 3N58A 4BB0A 1BKSB 1P91A 1ISFA 1ZCAA 4GPD1 4N3AA 4O4HA 3W5DA 1VZ2A 2AYYA 2B1GA 2O5RA 2IHJA 3JSXA 2OE2A 3LU1A 3PKJA 2I7VA 1Q0QA 4OSPA 1OFUA 3TN7A 4GU5A 3N2ZB 4DWVA 2HD4A 4QHSA 2ZJBA 3PQ4A 2PAFA 4YACA 4YP9A 5ALRA 2DRIA 1P5RA 2VT2A 4ZI3A 4L0CA 3VTZA 2GKGA 2IEGA 5FL7A 3UT0A 4J7XA 5BN1A 1IC6A 2GRAA 4QSMA 1FNSA 4UNRA 4XPZA 4CJXA 6ADHA 4JI6I 1RZUA 3GGJA 2WFLB 4AZ3A 2Q2OA 1GPWB 3VR1A 5KJ6A 1RBZA 5EQTA 4WLUA 3HFRA 5JD3A 1IHUA 4QNKA 3TUIC 4ZCIA 5EMKA 4RSGA 1R0KA 2QXUA 3E1SA 1DUVG 1OAOC 2O50A 1P77A 2HWYA 1ZH0A 5K0BA 3IBFA 3DO8A 4UD6A 3WADA 1HY3A 1G5TA 2Q6IA 4WXEA 4ZRMA 4WW0A 3ZE2B 4LJ7A 3A04A 3T35A 4F0JA 2TMKA 2GO3A 4MQLA 4X64E 4WLNA 3A6HA 2PO1A 5GIOE 2HA2A 4CLOA 5IJZA 4R1UA 3WYNA 4IWYA 1YQTA 2CE7A 4JK3A 4MV4A 4W5OA 4S1PA 3TQFA 4I1IA 3TEMA 1KK1A 5IBCA 5EMJA 2G0NA 1R0WA 4JJ4A 4W8OA 1OI7A 4DUGD 4IXDA 2FPSA 3WRYA 2X0DA 3R7NA 3OPMA 1UJNA 3F71A 6PFKA 1N33B 4LFBE 1ZBDA 1P6UA 4WESA 1RHYA 2W6JA 2QDXA 2AT1A 3RRFA 3VJMA 1LJ8A 2HMWA 1RJFA 1TYCA 4M1QA 3RT1A 4CV2A 3EUFA 1S2IA 1Z07A 2VUIB 2X2FA 4EY7A 5BV7A 4B6PA 2G1UA 3OFVA 5AWFC 3NTRA 1YZKA 2XDQA 2WHQA 5KTPA 1YQQA 4Z7JA 4M1YA 1NLZA 4I4IA 3HL4A 4Y6GB 1GXSA 1HZZA 2Y76A 1IOWA 3D1LA 4CMEC 5ITSA 1ZU5A 3QVVA 4KQHA 1ZX1A 2CHGA 2RBKA 3ACBA 2ZS9A 3KLMX 5IDXA 3P4XA 4PO3X 3ZDEA 1EA5A 1XNGA 4Z3OA 2W5UA 2WWXA 2OFOA 3DQQA 5DHRA 3TR6A 4Z3KA 1RXCA 1R16A 4XGQA 3OJLA 2CHQA 2HU5A 1R0RE 2PL9A 2QLNA 3COYA 4HMPA 3EAGA 4PC3A 3LGAA 4JI5B 3WLRA 5F7OA 3USCS 3Q8MA 1B16A 3AONB 1GKIA 3MPUA 3MS4A 5AJYA 1VKJA 1QORA 1QJCA 3ASYA 2NO6A 4RCZA 3JAWA 5FIUA 2XR1A 5CPBA 3FYSA 3CMCO 1EUDB 3BIXA 3I4FA 3ZGYA 2ODQA 1E3QA 4I5IA 3RFXA 4ZI7A 5HKBA 1P2TA 3JQAD 3OLVA 5SICE 4XVHA 4LF8B 5B3AA 4LEIA 2OQIA 4DDTA 3JQ6A 5CCEA 2BGJA 5KNBA 3N6RA 3K30A 4Z4QA 3RRZA 4TTTS 1I7QB 1WZUA 1Q0TA 5HF9A 2GBLA 1NMYA 3HA5A 4FHDA 4DA7A 4DYHA 5MF6A 1RQNA 1XL1A 1U2TA 2LKDA 5ESXA 5HIKA 1OWPA 2PUEA 1P9RA 3TW8A 2ERYA 1O97C 1XTQA 4AMYA 2BFNA 2PBZA 3KZVA 1BWSA 1ENPA 3OLZA 2B4TO 1UC4B 1M7BA 1Q0LA 3P94A 5BSFA 3SIXA 4JZYA 1RBYA 1ODIA 1PG0A 1OIWA 2CC2A 3AMVA 2XUOA 3HP7A 3PE6A 4GQAA 1JG3A 4X7BA 1PWEA 2I22A 1F0NA 3QKSA 2OXIA 3QFSA 3ZY6A 4OFBA 1X42A 3H9JA 3N0RA 3ZWWA 3KEMA 3I6YA 2O2SA 3BEOA 1SMKA 4EUEA 2JRCA 1NJFA 2QRMA 4JU9A 2RHLA 4K6CA 4MLCA 4YT2A 1KA9H 4IF4A 4CE6A 4E5YA 4Z7CA 1EK0A 1FFXA 2GPTA 4HX2A 1NHJA 4YRCA 5BQ5A 5I48A 1G64A 1BYUA 3T1HB 1TQ2A 1G8FA 1QG0A 2WJZB 1MEOA 1W581 4G1EB 4P8RA 5JD5A 2O2DA 4KFCA 4LF9I 3QXHA 3K7EA 5JEAD 4HNAB 5TXGA 2AI3A 2PJUA 3HKBB 3PEEA 5FD8A 4UHKA 2B8NA 1FP4A 1LVGA 4M9SA 4RHXA 5EPOA 1MGOA 5THKA 1T1JA 3COVA 3SQLA 1JGTA 1TM2A 2W9XA 4WJZA 1U3FA 4EEXA 4R8LA 4ZYWA 5EIEA 4R7TA 3CZ5A 5IYZA 1DQRA 1NBHA 3F6RA 1YJAA 4HDSB 3SIPA 1I13A 3X2EA 4S04A 2ZJ2A 3CZ4A 4OLFA 1N2SA 3IIIA 5EY5B 1IWBB 4Q3EA 2XH8A 1JQKA 4N0QA 4UEKA 4B6EA 2GTPA 1AN9A 4QPPA 3O94A 2NTVA 4NR0A 3MC1A 4QATA 1RHJA 1UDOA 4Q3KA 2V3WA 3FVWA 2FQWA 3H4MA 2JGKA 5I3CA 3CX7A 5CEEA 3GYGA 4CGZA 3LGSA 2WYIA 4N5LA 2C8JA 2MWMA 2Q5JA 3G2IA 2IUUA 3ZJ5A 1P2BA 5LMNI 1BN6A 4JXXA 1KH3A 2X8WA 4Y7CA 1H2BA 2X8JA 3CS3A 4E5DA 1RRGA 3LT2A 4RPKA 1R9JA 3SE0A 1Y8QA 3L7ZA 1JHDA 3FGZA 2WNRA 1ZBQA 1Y3FE 1DQNA 2PWAA 4I4LA 2GPWA 2Z6VA 4TLEA 2PPVA 3ZLUA 3CRRA 4TYQA 1IXRC 4HS4A 4E13A 1QGZA 4YJ3F 3VOTA 3PYEA 1AQLA 4RFLA 2I2XB 1L5QA 3QMPA 5JISA 3K4QA 2PX0A 4FXPA 4FMDB 2BR5A 4B5KA 1KKHA 2DSTA 2ANCA 2Y6UA 3QKTA 3O9ZA 1V9CA 4XX0A 3CHYA 3GP5A 5ALNA 1OLOA 3H5LA 2OAGA 3ES9A 1IXKA 4QAQA 2EP8A 2VBCA 1PS9A 3Q2KA 5FPQA 1RMYA 3OEHD 2VR1A 4F71A 5HKKD 3GRUA 4QREA 1RAGA 1V8OA 4MKXA 3L6OO 2R1UA 5L6MB 1KDPA 1ZS9A 2YQZA 3O73A 3MS2A 4KYVA 2G1AA 4QQNA 2C5BA 1J99A 2ESRA 3A1DA 1ZLYA 3D0RA 1XEXA 2YFYA 3EK2A 1FBTA 1GA6A 3I1JA 4IR7A 4YVFA 1TM3E 4AZWA 4DLVA 1I01A 4Z4HA 5C8ZA 1IHPA 1AH2A 4WQMA 4DSTA 3I8OA 2ECFA 2SKEA 1L3CA 4J2HA 1NNLA 2GEDA 2PX4A 2CGEA 1R8SA 3RV4A 5EHZA 5JASA 4CNQA 3SS7X 1RQ7A 5AXCA 3LHSA 3QYFA 5L3QB 3ANSA 3H2HA 2EW2A 1FSSA 2WDPA 3BBLA 4EF4A 1NATA 2XBLA 3WOVA 3QELB 1O9HA 1NUHA 3FPGA 4HDSA 5IVKA 1NBME 1HE5A 5EJ8A 4NHEA 1H3FA 3OWOA 1N9KA 2WAXA 2FHSA 3UYKA 1LPPA 3VR5H 1CV2A 1C41A 2BMVA 3D6VA 3KV1A 4OB6A 1RWVA 3H6GA 1Z18A 2D5BA 1EK6A 4JUBA 1K4MA 1FWLA 5F73A 4U8GA 4MQEB 1PWZA 3M49A 2V7QD 4JNCA 3AM3A 4YLGA 1GHTA 4ZICA 1ZL2A 2B1RA 4RYLA 3DAHA 4PAOA 5H83A 3FVVA 4UZSA 2UXCE 1OAOA 3LQYA 2PZFA 3WVNA 1TZ2A 4LNUA 3D8BA 2A9PA 4BGVA 1O94C 2DWUA 2PGIA 4R2KA 2XAAA 1NP7A 1Z7WA 3OJXA 3UCEA 2DUWA 1WHSB 2C94A 1VE7A 1KAEA 4GMFA 4ZRDA 4LBYA 4OUDB 4A0RA 2J3IA 3ABIA 3MHPA 3AVWA 4Z8YA 4A2PA 5EMHA 1OXSC 1EVJA 1KZGB 2RGEA 5JJCA 1C3OB 1Q57A 2CMKA 1I4DD 2FRVA 1K75A 1JWBB 2FEWB 2VPPA 1WDMA 2W2NA 3GRFA 4Q24A 2QRLA 1F1BA 2QD3A 5GAJA 4A3SA 1U8ZA 1E1YA 2BN4A 3GLRA 3K53A 3MT7A 4JITA 2ADFA 2PZEA 3L7AA 5AI0A 5DU2A 5GZ3A 4Y2VA 1I7DA 4FHZA 1I94I 3EVEA 4PLVA 2H51A 5IDVA 1E1LA 1XI2A 3VHXB 1M6WA 2BHLA 1E7WA 1AGRA 4FWTA 2ZUTA 3IAS1 3ED1A 1XAHA 3U4IA 3UV7A 3ZWBA 3OHSX 1VJGA 2WD8A 1NYLA 3LXXA 2GA8A 4QO8A 1RWPA 5EE3A 1ID8A 3HDJA 3L7IA 1TFUA 4FR5A 5HIIA 4AJIA 1XNHA 3PUKA 3PXEA 1VRWA 3PUHA 1E98A 1YB4A 2CDAA 1VL1A 3B1KA 3M82A 1WY7A 2HRZA 4GKVA 5DLEA 5J5VA 3HWX1 3ABRB 1PVDA 2PXAA 3DE1X 1AKRA 3SEAA 5GIPE 4OU4A 4BQPA 5DNUA 2PGNA 1BN7A 4EHBA 5KNCH 2WHPA 3ND5A 1JDTA 3R0ZA 1AUOA 2CV2A 4I4NA 3ADBA 1W5SA 3V7YA 5PGMA 1E63A 4N7JA 4KR9A 4BFSA 4RJTA 5DNAA 3S5JA 4ZYYA 1IOVA 5EWJB 1DCMA 3IUNA 3NYWA 2W42A 1L7NA 1LQ2A 3P9SA 3IR7A 3I6ZA 1E9BA 5H7XA 1QG6A 5KQMA 4AJ1A 3VHLB 3NXSA 1JG7A 4KBYA 3BJRA 4BVLA 2WOJA 3JWIA 5LQSA 2I67A 2Q9CA 2Z2XA 4GX1A 4HDNA 1N2CB 2O6LA 5F1PA 3V1MA 1TTPB 1ZNYA 2YXLA 3ORRA 1K3FA 2RGDA 2WYWA 1DHTA 3C7KA 4XYBA 4D96A 1E6MA 4U3DA 2ZBFA 4LY9A 1OBFO 2AFHB 4B6RA 5KU7A 5LL6R 4O5AA 5HVNA 2R42A 3DR5A 3AJDA 3U80A 3UAGA 5IT0A 3L1JA 2JAWA 2G7MC 2GPNA 2MJLA 4GAEA 3FNRA 4OXRA 4F7WA 3OVMA 2J3QA 4JG4A 4KX5A 1IHOA 5JECA 3EFBA 4PGHA 1LWOA 4P80A 3STWA 2PS3A 3MS7A 2IKQA 2WP8A 5ALGA 4GT1A 4P3NA 4EHLA 4CHTA 1RWXA 3CEJA 1EGHA 5B4TA 3E5NA 5COBA 5EZYA 2WSIA 1PVVA 1ZOIA 5HFNA 3HCDA 4FYMA 1RC8A 4KO3S 2OD9A 2GJSA 1M5UA 1JBKA 4YNBA 1Z6TA 4C6RA 1U5BB 5BMOA 3HUEA 1OYWA 1U9CA 3G8BA 2HWUA 4G0QA 4UZEA 1OXMA 4GE0A 1E3EA 4UBNA 4R98A 3V1LA 3K0SA 2GMWA 3GBPA 1CJCA 3QMWA 4RIHA 5AKEA 4YTEA 2GT1A 3FUUA 4KHZA 1FJGE 3HGTA 4HH3C 2L18A 3EMKA 4PZLA 1EDZA 4XYEA 5LA6B 3S3TA 4BO4A 2H08A 2F55A 3DVRX 2DOKA 3B9QA 4YRKA 3NAZA 2HIMA 4H9GA 4EMTA 2JFVA 2CF5A 3QKUA 4LJLA 2C38B 1E2EA 2XUIA 3TPCA 2E0IA 2X7IA 1XLUA 3TAUA 3HZZA 1GFIA 4ENVA 2JC3A 1I4LD 2FSVC 3Q3CA 1FZTA 4M3NA 4IL5A 4E5VA 5GMDA 3VHQA 5EIAA 5AW4A 1U2RA 5JQGA 3PIDA 4FR2A 4D3FA 2PD6A 1DAKA 4X7MA 3WSWA 4KWHA 3WBFA 3TG2A 4OX9E 4MMYB 3AIKA 1W85A 1V5FA 4EHIA 3D6TB 4UBKA 3SJZA 3LPNA 1MH9A 4WZBB 1BZYA 4RY8A 3MMPA 4AY6A 4OKIA 1RRFA 3GH1A 2WKSA 3IT1A 4L08A 4DN6A 3S1SA 1TOAA 2CCJA 3L7KA 3N1UA 1HM5A 3ONEA 4U7HA 1VB5A 3WRXC 1F06A 3SU8A 2PA3A 3UGJA 4LFAB 2H1HA 4HLNA 5CHYA 1THTA 2RHRA 1GNSA 4PGGA 3OJCA 2PMEA 1GPYA 1D7AA 1MA3A 3LRPA 1K7FB 1DG1G 4ATNA 2A2DA 1MQ8B 2B20A 4WTOA 3F97A 3Q72A 3U4AA 1Z37A 5BSHA 2AE1A 2FX3A 3C7TA 3IUMA 7AT1A 5HK8A 3ZJUA 3B7PA 2CL6X 2FZLA 1Q3HA 2J0UA 1L2TA 3DCYA 1XELA 2DJIA 3ESZA 2EL9A 1SVMA 3OLYA 2PX6A 3ZI4A 2CMDA 2WZQA 1GKUB 3DMFA 2RSLA 1C80A 2D7JA 2YINC 1AKMA 4K6OA 1SVOA 1Z2OX 2FEXA 2OXCA 3PGA1 5ILGA 3ZDBA 3EPHA 1W30A 3ROQA 4GX5A 4KQ1A 1G2IA 5KNCD 4R5HA 4AY3A 4JV5B 1ZM4A 3F5DA 1GCOA 4OBEA 3LBYA 2BFPA 5SZJA 5TQ0A 4DV2E 1UQUA 2QPLA 2GVDC 2X1MA 2JH3A 2AXEA 2JGRA 4FDUA 2GN6A 4MGIR 2RGXA 2WB4A 4GR9A 1U5BA 1PFYA 3HVHA 3AHCA 4AC9A 1H22A 4OYHA 5A2GA 2C7PA 5I9TA 4INAA 3UQZA 1ZONA 2XUJA 3FNEA 3HB7A 1SZCA 4ER5A 3RG2A 3CUSA 2CFRA 2LE0A 3IP9A 4FK8A 4GOJA 3ROTA 2EERA 3U4HA 3UGQA 1XCMA 2VVTA 5J2TF 1FMTA 3H9BA 4HGZA 2I2DA 1U0NA 4I66A 1JIIA 3T52A 1SQ5A 1JLSA 2XA9A 2W43A 3LUFA 5EYPB 3S2EA 4LGCA 3TLCA 4ZOLF 4GM1A 4ID3A 4DZRA 3FZGA 1RADA 2I0FA 1XXEA 1UP4A 4DR6I 1XTPA 2X4LA 3K09C 1J24A 2A3RA 4HDKB 1QFJA 4K6KA 4RVOA 3RVBA 4BAGA 3WL7A 4CIYA 1F48A 3BDIA 5JQWA 1LQUA 4RXTA 1W34A 2GBPA 3O2JA 1Q0UA 5JH7B 4Z7YA 5AW9A 4II7A 3KOZA 3FB4A 1FCJA 2PGLA 2JH9A 1YZYA 4R68A 1GN9A 2ACVA 3BUSA 3TWOA 2ZBKB 2A9FA 3GJ5A 2XYVA 4F11A 4R71A 1QXSA 2QN8A 4FCTA 4KX3A 3ULKA 4X85A 3V4VB 1SBTA 2B7CA 3EYWA 4QTZA 3J80Q 5ALIA 1QFMA 4XSHA 1Z2AA 3GAFA 1SBQA 1ZC3A 4M89A 4NH4A 4LJSA 4RO0A 5T6MA 3UGKA 5FI3A 4DR7B 3CBGA 4KXVA 5ALEA 3VPDA 2AR0A 2D5CA 2H57A 2P3LA 4YHBA 5K4HA 3HLTA 5GV8A 3HSKA 3OCXA 3O03A 1YULA 4UHJA 3H11A 4E7OA 3UH1A 3OQIB 4IEEA 3R7FA 1E9RA 5JADA 3JAKB 5IMSA 1AO3A 1YKSA 4LOHA 1ICIA 1ADCA 1X77A 1XAJA 2FPGA 3L49A 3R3HA 2NTNA 3LM8A 1YC2A 3UMMA 3SZRA 5FLXC 3A9WA 1P80A 1P1IA 3OJEA 4KR0A 4BNIA 1AE1A 4C03A 5JJBA 5LXTA 1DKMA 1TYDE 3R3UA 4L5IA 1VIAA 1T9BA 2AFVA 2WWVD 1T3SA 3CWVA 4QSHA 3CLTD 3HJGA 2W4MA 2BR2B 3ILXA 4RK5A 1VYUA 1YCFA 3ASVA 3PJDA 2VP3A 1SQSA 3OZ7A 4NCIA 1B00A 4QNMA 4W1PA 4BDTA 4BNXA 5HQJA 3WLQA 1GIAA 3VH3A 4A7PA 1RKVA 4V1CI 1NRIA 1FFGA 3USZA 5J2UA 1Y6FA 5ICCA 4X1IA 4NMXB 3LV8A 3D2CA 3DOHA 2EX0A 3FPJA 4BMSA 3NRJA 3ODPA 4JL6A 3JARB 5L40A 1WMBA 3MRXA 4YY3B 4J1SA 1VJCA 1BRTA 4GZ6A 2OAP1 3Q9SA 4JGIA 3RM3A 4I50F 1PN3A 3G9QA 1EX1A 4OKSA 3F8SA 3PS9A 5F4BA 5TVKA 3W6OA 3T1NA 1FTQA 2ZYGA 3GA0A 3N9IA 3IHLA 4Z9FA 3K9LA 1TCBA 5DP2A 4EKEA 4EP1A 3Q2IA 4CMAA 4Z51A 1O9BA 3CVWA 3F49S 3AUKA 4XJXA 4RACA 1VZ3A 5JD4A 5EKSA 1FU8A 2BUBA 1IK6A 1Z3CA 1F2UA 1Z88A 4WOBA 4CEHB 4MGZR 4OM8A 2CNKA 2C8VA 3N75A 3MQFA 1Q0RA 1FS4A 3D2BA 4E7PA 3ZUPA 3KR1A 4Q93A 4KO4S 3L8HA 1EP3B 2QU8A 3MJCA 4HADA 1AKQA 3MFYA 1P7VA 4KBFA 2WV9A 4N4AA 4D9IA 5FOWA 3DEYX 4NAVA 4ZD6A 1COWD 2IYEA 3TBHA 2C96A 2VAVA 5CTAA 5JZSA 2ZM5A 4HXZA 1CEEA 3GFBA 1L7QA 4N01A 2ZBPA 1QWOA 3X1WA 1P2UA 1V4VA 3DMPA 4FOSA 3WDLA 3TRDA 4TTPA 1IEVA 1SRQA 5K36F 1EZ4A 1A4UA 1OFUX 3E70C 4HOYA 2WJWA 1NUUA 3TGLA 5F9FA 4FW9A 2IOPA 3IR5A 3WE7A 3I0NA 4MKGA 3KZCA 4IUCS 4WV3A 4D5EA 2QPAA 1WE2A 2LGJA 1D4ZA 1KIFA 4B40A 3OTIA 2AYXA 5HBRA 1FRZA 4HZGA 4MQ6A 2J09A 5IF3A 3RLIA 1ML3A 2O2HA 3A05A 4HJXA 4I6EA 5E2AA 1C8KA 2HHCA 3H5NA 4QBTA 3SF0A 4XLLA 5ARCA 3NHPA 5FWDA 3EXAA 1BCRA 3WIDA 2WV7A 4PNEA 1SEVA 1TKCA 3IUJA 4BNHA 1PBNA 5AQEA 3NW9A 5EL9A 3I5MA 3SX0A 4CYMA 5TPWB 4QUGA 1HETA 1X0XA 3MMXA 1ZOPA 3WS7A 2FSVA 1R6UA 3JQ9A 1LNSA 4RNDB 3QEMB 3EJWA 4LKOA 2IIPA 3IHKA 1YSCA 3ESQA 5DYIA 5JYCA 2R79A 1AQNA 1WEKA 4E2XA 3TTVA 4DCMA 3KKKA 4JX8A 2GCIA 5JCPA 2ZIAA 4L15A 1DIBA 5FEMA 5I7SA 3KKPA 1VG0B 4K40A 4WZAE 2O3RA 3P9KA 5DI3B 3OKFA 1JPNA 5KYXB 1WF6A 5FCDA 3Q3GE 1FW6A 1E2MA 3GA7A 1DKRA 1AU9A 4HF7A 4P84A 3IEXA 3SYMA 1FIUA 5BNZA 3EMVA 4IJMA 3KB1A 2XEXA 1L7DA 1I36A 1PK9A 4A5OA 1Y5MA 3R7WA 4WFJA 1EP2B 3EDCA 3AM5A 4QPCA 3HR8A 4TVBA 4CCYA 4CF5A 1GCAA 3QKRB 3ETDA 1RWOA 3H1BA 4KIGA 4QT0A 4V03A 3PX7A 3TLGA 3RFFA 4LA4A 4K0KB 1GGVA 4RVUA 3QFTA 4C1BA 3EXG1 3ICPA 4QM7A 1KOJA 2VK2A 3SHFA 5I8WA 5K5EA 5IH3A 4G4IA 1P9WA 1HYEA 1Q7CA 2CDNA 2E87A 4XAQA 2HK7A 2VHZA 5B58C 2O2JA 3LC2O 1AHPA 1CULC 1E1CB 1F0KA 4MWZA 5ECDA 3EGXB 1YQWA 4H7FA 1JIXA 3T7JA 3KLOA 5E4YA 3USES 4EW3A 5A1JA 3T94A 5AUPB 3EPLA 1PK8A 1QIEA 1SGWA 4DV6E 5BW5A 4PZZA 2AW3A 3IPYA 5E3HA 1HFKA 1SZDA 1A8IA 3WDKA 2Z9CA 2P7HA 2RHHA 3A70A 2Q5QA 4DR2I 4HWKA 2PNMA 1NF3A 3IVCA 2P2SA 4GXNA 2JT2A 3PITA 2O05A 4XXHA 4DV0B 3RC8A 1U0RA 4DA0A 4TT3D 3K8ZA 2CVPA 1L4HA 4OXXA 3DGFC 3SWWA 1QRRA 2WPDD 1S2DA 5L3SA 1JAZA 3KAQA 4M0CA 2J45A 2PMBA 3PDWA 1YE5A 5EI5A 3TZQA 2ZUSA 3TTSA 3O38A 5CIYA 4HGRA 2UYQA 3NEAA 3GQBB 3Q5DA 2HFSA 5D1NA 3VPBA 4XOIA 5EMMA 2N3ZA 2PLWA 2EHDA 3JYQA 2ATXA 3RKRA 3FN4A 4BRZA 3CZQA 5GVSA 2F8TA 1QIGA 1QZ3A 2C03A 2F43B 3HWRA 3O8RA 3OTWA 5F9HA 2GN1A 3K09A 4GE3A 4C0HA 4BP9A 3FWPA 2AE8A 3VPXA 2RGBA 2G7ZA 1W36C 2O8BB 5F2EA 2MMGA 3N0XA 1Q20A 2G5GX 5IK2A 1RHUA 3A2KA 2VJMB 3DF7A 1OOEA 3RH0A 3QOWA 2PXXA 3OIVA 4ESHA 1XZJA 1BVYF 2FZ4A 4DR5B 3R3XA 2HA4A 1N34I 1T2CA 2PVPA 4N12A 4EHAA 1VMEA 4TMTA 4E94A 2ZTMA 1N0IA 2B3DA 4MVJA 4AD8A 2OFPA 2FRDC 3DT9A 3F2VA 3LNCA 4HYYA 3WHKA 4XDGA 4H60A 4GNKA 2EAUA 3Q7RA 4YMSA 1XHLA 2W6OA 4X3OA 3R5HA 3IB3A 5JAIA 2X7JA 4DYDA 3MCTA 5HYVA 4GVXA 5DHSA 3TQSA 1YI1A 3CF0A 5FFNA 4HNGA 5K36E 2O5CA 3VOBA 5F1YA 3E8XA 3GCZA 4AN0A 3T9FA 1R4MB 1OTYA 1ZFNA 3N2KB 1YB7A 4PNHA 3AT1A 5KQPA 3KDSE 2AN9A 1CVRA 1NJGA 2PUHA 4GGPA 3OZTA 1ZD5A 4YQFA 5AIBA 4M7WA 1SB9A 2HMVA 1NNUA 3GPBA 4KDRA 5DGHA 1NRXA 4F6RA 2R66A 3GFSA 4ZI5A 1SCNE 3P2YA 1AQIA 1H05A 5F2KA 4EAQA 5A2QC 1AGXA 3CGGA 3PTLA 4AQYI 2WTEA 4LXUA 1K5DA 2FJUA 3OE7D 5KVQA 5EP3A 3G6KA 1D5CA 4RDXA 4KWCA 2NP7A 3B3FA 5IEBA 2DULA 3KFVA 1JQDA 5DCYA 2FUNB 4GZLA 3M83A 3RWOA 4D0RA 4EKGA 1ECJA 5JLJA 2O3TA 2JFOA 2EQAA 4DMRA 3IKVA 1IAQA 1P2GA 1OQAA 4N3OA 2IYPA 3W7AA 3PZBA 2JBWA 4B3SB 1B0UA 1IM5A 2WJGA 4E14A 1MGPA 1XCBA 3BD8A 2WW4A 3PR1A 1LTKA 5TT1A 3O4RA 4NBSA 5D84A 4PV7A 1SUDA 4U3JB 3CG4A 4RPFA 4ID9A 5FWYB 5IJ0B 1T15A 2Z2JA 3OIWA 4GLLA 1PGJA 1PAUA 1WZNA 2JKZA 4HRYA 4HEJA 1BJTA 4IMPA 3SSOA 2O54A 4NENA 1GZDA 2IHBA 2Z5LA 3B13B 3WB9A 1TF2A 4QD3A 2XQKA 4F5WA 3PBKA 1FW8A 1JR3E 2RGWA 2KYRA 3DD1A 4DRYA 2IVZA 3F3SA 3GT4A 9GPBA 1YHNA 5I4IA 4NMMA 5LMUI 5E3JA 2FOXA 2VP5A 5K6TA 2Y1EA 5JS8A 2XSZD 4KUGA 4IAOA 1X1QA 4LGVA 4B9AA 5C3UA 2OI2A 1W1WA 2ORIA 3W9SA 3C4JA 3GUVA 5DSZA 3V6LA 3JYNA 2IYSA 3QWBA 2DQYA 1W5AA 3DBRB 3V4PB 1J25A 1R5OA 1W1UA 4NYIQ 4L0QA 4B34A 2HMYB 1ZW6A 1CEQA 1EVEA 1VE6A 3AYXB 4J3JA 5CR9A 4C05A 4UE6A 3E9DA 2YDXA 4CDRA 3CH4B 1UUFA 2GS9A 3EIXA 3L7NA 3RSGA 3VPGA 1IZ8A 3EXIB 2WM2A 3CCFA 3EWAA 3FNHA 5IJ9B 3TS1A 2ZVJA 3EMBA 1XEAA 3FPFA 4G0XA 4HZUA 4RPHA 3H97A 3T99A 4HTAA 1FFEA 2ZU6A 5DYTA 5SZIA 5KSYA 1YVEI 4LYFA 4PPNA 5A4AA 3NUZA 1TUIA 1WW2A 4H1TA 1WZIA 5CT4A 1X87A 2I80A 1U80A 3NH9A 5IDYA 4DCSA 4B3ME 1BMTA 3S68A 2QSYA 4AJJA 1VJ0A 4JEUA 1VIVA 4IRXA 2G71A 3H4VA 4P08A 4CLRB 2G77B 3F5SA 2JEAA 1VSBA 3ON5A 4I1VA 1NWHA 5HA5A 2VNSA 4AZSA 1A88A 1JSZA 1XCOA 5CA1A 3A4IA 2J5BA 3DMDA 2WTXA 3DUFB 3HRKA 4JT9A 5DI9A 1KSGA 4C5AA 3NJRA 2FW0A 1NMXA 2W11A 1B15A 4LDRA 3Q87B 3RIGA 1LDBA 1CQIB 1PEYA 3R4VA 4NDNE 2GVZC 1JZTA 2D8MA 5H02A 1AS2A 3OKAA 3THYB 2R4QA 4WGFA 5FNVB 2R8XA 2B1QA 1S4QA 3MRTA 1YS4A 4LCHA 3ZE0B 1T8TA 3NHMA 4RGBA 3ZQ6A 3ZBTA 2VF3A 1IQRA 1BE6A 3LI2A 3L8ZA 2JF0A 1XU7A 2XIQA 2WG2A 4JUDX 3I8SA 2FEOA 2FW7A 3MIIA 3QVWA 5I7FA 3VKGA 3GIWA 4MARA 4XQEA 3WTCA 1WCWA 3E6AA 2ACEA 3P1JA 1PEAA 1CB7A 1OU0A 5F52A 1GSHA 2MYNA 2RARA 4IEFB 3KLNA 1FNNA 4ND2A 5JARA 4IHJA 1C1XB 4MDHA 3T3GA 1C0KA 2PSHA 1XQ1A 1DELA 1WBJB 4RPGA 5FOTA 4EHHA 4BAUA 4F5DA 1XMSA 1X70A 5ENVA 3PPIA 3BE8A 3L0OA 4OGGA 2GTHA 4QJBA 4QQRA 4TS1A 4YRSA 1IE3A 4JOQA 2WFMA 5FHRA 4WBNA 3BMQA 3V33A 4IFDC 2C7OA 4DV4E 1KNQA 4YREA 1LX6A 2GBIA 4QU0A 4MV0A 3UK2A 2QXYA 3IGFA 4KQ9A 4Q05A 2OO5C 5JNSA 1SXQA 2WFAA 4XQ0A 5GGYA 2QD1A 5FWKA 4WXYB 1RZRA 5D87A 1R10A 3R5KA 4RA6B 3MGGA 3QV2A 4X9XA 3NLLA 3RYCB 3IP1A 3ILSA 4MPDA 2ZRIA 4G25A 1PBTA 2NU7B 2JG3A 3F3YA 1UJBA 4RABA 2ZCJA 1MVLA 1Q3TA 3CISA 4N0DA 1BMFA 2C37B 1XMOI 1E18A 1JE0A 2BEKA 3LUGA 4J0DA 5LCXA 5IJ9A 3BT7A 4JOSA 3PUIA 2OL4A 3G7SA 3IT3A 2OUIA 4Y9TA 3VR6D 5KYYB 4NNOA 3SPXA 3T5AA 1P31A 3FD8A 1UP6A 1FSZA 5LYJB 4FM9A 3ENNA 2G88A 4QBIA 2E18A 3ETHA 3IAUA 2YKGA 4INJA 4ER7A 4WCVA 1L5MA 4ZOCA 5DP1A 5BN3B 3BWMA 4PS0A 5ECGC 1QVWA 1JAXA 2R47A 3AU8A 2WT8A 1M2VA 3KJZA 2JATA 3R0IA 3OURA 5D00A 2FLWA 2P6NA 1KVSA 2I7XA 2QJTA 4LXQA 1ZJJA 4ZVMA 4HD8A 2YIJA 3HJAA 3VZSA 2PLFA 3NC0C 5E9JA 1R0SA 4X1OA 4BQSA 5EXSA 2UZ1A 2EIHA 1I2ZA 1DKUA 1Q83A 2H9YA 5FBQB 5ICEA 4JH0A 3LTOA 1T9DA 1SK9A 1U0SY 2XUHA 3DTVA 3GNLA 4HK4A 5JXJA 5DSXA 1TW2A 1BE8A 3H5IA 1KSHA 5IT9C 3WQRA 1VGVA 3MYYA 2JE6B 4KR6A 3M6VA 1T3LA 4I5EA 1CY2A 1JKMA 1P3Y1 4K8RB 4IFIA 3ZWPA 4R1FA 2BUCA 3IEPA 3G5UA 5DWDA 3W8FA 4YMWA 1UDBA 2YJ6A 3L92A 4LF4E 2BHNA 1TK2A 1C4OA 2WPNA 3FYUA 5CLFA 1BSVA 5LQKA 4D56A 1OPRA 4EYEA 3F96A 1DWQA 2CNWD 3ORQA 4W4TA 3PGJA 4I55A 1FLVA 3P2EA 1OROA 3H65A 1W2GA 1ZCFA 2YIMA 1NR1A 1TEHA 1VCNA 2FRDA 3GW8A 1U2DA 1M10A 5KX5F 3CZRA 4X92A 1RTKA 4JIGA 1U11A 1UIRA 1P5FA 2HH9A 1TM7E 4DLYA 5JWOA 2AQIA 3TEFA 1JLHA 1N4AA 4RTQA 1PJZA 4QQKA 4DMHA 3OWHA 4IH4A 2BR4A 2Z83A 5D5PA 4CM8B 4YO7A 4JI7I 4O8CA 2ZK7A 1Z2NX 2PS1A 3GMIA 3RO7A 1ACLA 4GZMA 2A9QA 4BX3A 4F4HA 1UMCB 1N3IA 3DPUA 1B6GA 4YRLA 3U5ZB 3T4EA 1EVQA 4KI7A 5E2IA 2V9ZA 3BKXA 1YB2A 1J9ZA 4G8CA 3HV0A 1X8KA 4JAVC 1SXPA 2OC9A 2F6RA 4JBIA 4JJAA 4RKRA 1W88B 3TIXB 2XTMA 1X0VA 5AYVA 1GCIA 1JQ5A 1INLA 2NV0A 4TGLA 5TPZD 3TJZA 4BN4A 4L3OA 2GS8A 3G8DA 1YQXA 1X3SA 2R7AA 5L8VA 4QBKA 4QTTB 5CB0A 3CW9A 3P0JA 1WSAA 4DUYE 1BS1A 5JAOA 2J9YB 1MLDA 3IJ5A 2A0UA 4HY1A 3ISTA 3VZPA 3R0QA 4LFCE 3AI7A 2BA1G 4ITUA 2XRZA 4HDMA 3QPUA 3S2SA 3GEBA 1A9XA 1P1HA 1CDEA 1JR4A 4R6XA 2BFAA 2VATA 3ELDA 5DX8A 4D9MA 1PK7A 1ZG3A 2DM6A 1WUIS 4XVCA 4CQLB 4D9HA 3A3KA 4ZO7A 3BSSA 1QIKA 3MWJA 1QPZA 1GTL1 5IUJC 4N8SA 3PQ6A 4GI7A 2TMGA 2VP0A 2JAQA 2JL1A 3I62A 4P9NA 3CW2A 5DVZA 5CDTA 1FLNA 4Y2RA 2UUPA 3HUTA 2VC2B 3OEWA 4XWYA 5FOUA 5JANA 1D2NA 4AWAA 1P75A 2WEKA 3NOQA 2JIOA 1GG5A 3H7IA 3PFIA 2A0XA 1P19A 1V25A 2H85A 3BGVA 1HX7A 2HXSA 3ICCA 3OMXA 1H9AA 1E2DA 3C6XA 4G86A 4N1AA 4IDEA 5DMHA 3BWBA 4UNNA 3R3YA 3L5KA 1FSGA 3AW8A 2ZP1A 1DKOA 2C1ZA 4IYJA 4KLZA 4KSCA 3E9ZA 3VNUA 4IFDB 1ML4A 1FYEA 1VDMA 2KMLA 2WU0A 3AHDA 4DJAA 1ULHA 1J8FA 3NBFA 4WERA 2Q21A 4AUNA 3MUNA 1NLMA 4P4SA 2HRQA 1YBAA 2X22A 2W2OA 3VZRA 5DXAA 1RYNA 3V55A 4DG9A 3UFXB 4MGYR 1FRVA 4FFLA 4LE0A 3RK1A 4KKVA 1XNJA 4XYMA 3TZ6A 1SKUA 2P4HX 5F51A 1RJWA 4QXQA 1MEJA 4GR4A 3PGXA 1UMCA 4CL2A 4L02A 1E1KA 2HKJA 4IZKA 3ZK9A 1A97A 1B93A 1DDGA 2D7CA 1Q1NA 1ICEA 2VNJA 3FY4A 1NVVQ 2WD7B 3MG9A 5DNWA 2OCLA 3FJOA 4UBOA 2NXCA 2OXEA 1V11A 1WVIA 2UYGA 2NZWA 4YV0A 3HCRA 1A5ZA 4I4TA 4BEWA 1EJ0A 4JP2A 1DB3A 3U44B 3L4JA 3I1YA 4FC6A 4UU0A 5CVUA 2DQSA 1W4BA 2ZIXA 1RM0A 4S12A 2J8ZA 4QVKA 1PL0A 4LSZA 4UCQA 5EJ5A 3KRNA 4II3A 3E9NA 2IQ5A 1Z75A 3JQBC 5FUVA 1GA4A 2KJQA 4DLRA 3R9XA 4Q1EA 2XD9A 4Q4CA 2R8ZA 2K5UA 2BL4A 3OD1A 2O5VA 1OD6A 4Q4HB 1JMVA 1ADFA 1ZUNB 4ALIA 2CYAA 2OOKA 4JJFA 1UJ6A 3FX2A 3KJEA 1UEXC 3L77A 4NXME 1H0HA 2BFCA 4RMJA 2PUJA 4TRNA 2OYCA 2OGUA 4Q9HA 2Z0MA 3TW0A 4CI9A 3DLIA 4AF8A 2JZCA 2IHVA 3CLUD 1C8LA 4XM1A 4L3WA 4CM4B 2HN9A 2QK4A 3DLAA 1E7SA 5BVGB 4JLMA 2IHUA 4P36A 1H2AS 4YRIA 4CKBB 4RTNA 2OHJA 1D9XA 3CH7A 3GLHE 3N2YA 2PUDA 1SU7A 3E9RA 2GJKA 1GNRA 4MI9A 3OFSA 3OPVA 4MQUA 2GX6A 2XCUA 3DVAA 4A6DA 3WG9A 1WB9A 4GLBA 3PC8C 1HDEA 3V1YA 5K05A 1DAOA 1HNXI 1GGNA 2G4LA 2ERXA 1IN5A 3CNEA 3ZDZB 1GPJA 3KX2A 4ZHQB 3AL0C 4IFDA 2BWJA 5KOHB 1RXWA 1SIOA 4X71A 4D99A 3EZLA 4QG7A 4DW8A 1J23A 4Q01A 2OO5A 3BAZA 4P5EA 4KIFA 2FUCA 4FW5A 1D07A 2JGIA 1YRWA 3L1KA 3FGNA 1VP9A 3OO1A 1UBMS 2AG6A 3E9YA 5DBFA 4QOFA 3T5BA 4JOCA 4CLEA 1OH6A 2Y92A 1WSDA 4LXIA 4DR4B 2B4AA 3RSFA 3KQWA 5CXUA 5F2NA 5BR4A 3MCAA 4HFJA 4WN9B 4CR6A 1T1RA 1ZM3A 4FGKA 4GEKA 3WZLA 1XWWA 1QR6A 1F60A 3T4PA 3AETB 2ZAGA 4IJUA 5ECYA 1JNXX 2QTFA 4N03A 3O0TA 2HRRA 2NSLA 3RTGA 2P27A 2F3SA 2Y77A 1R66A 1GILA 1R18A 1I1NA 2ONYA 4LCBA 2CSUA 2N1BA 5DHUA 4C4TA 5J4VA 1OLXB 4DV3E 4L6CA 2O4CA 2R7MA 1PKXA 4HAXA 1RLIA 4M36A 2O7NA 3TIVA 3IOEA 2I4MA 3FLBA 1G0NA 4DMCA 2D6FA 2C7VA 2PWZA 1RXIA 1WW3A 1MJGM 2JGEA 2PH3A 1OJLA 4LJRA 1V3UA 4GZ3A 2Z5GA 4NK4A 1NW6A 2NUBA 1Q0PA 1TDJA 5TQ2A 4LK2A 5AVUA 1TX4B 5IT9A 1BFDA 1WXIA 2Y8EA 4R8VA 2Z43A 1OMOA 1LRKA 3IVXA 3SZLA 1DI0A 4Z4IA 1MPTA 2CXQA 4QJ4A 3R75A 5CG1A 1V96A 4AJKA 1GKKA 1CDZA 2VHWA 3TZKA 4OHYA 3OM9A 3INNA 4ZEWA 3WKBA 1GTJ1 4N0EA 1XKQA 1AGNA 2IXEA 3NAQA 2RH9B 2OZVA 2GDZA 2COEA 1Q21A 2R11A 3FMGA 1HLFA 3LXUX 4CKCA 3L6BA 1W76A 3NVMB 3ORFA 2ABWA 2WUWE 4D8WA 4G1FA 1E60A 3B7GA 4XGKA 4EW2A 1U7ZA 4AMGA 2D00A 1H8HD 4RMNA 2QX9A 1Y33E 4DBLE 5JAUA 1EFKA 4BRSA 5KI6A 1I6MA 3BHMA 1WUYA 1HEYA 1GUBA 1YIDA 2IF2A 2R87A 4JX9A 4RJLA 4U9UA 5LLSA 3TLZA 2XXAA 3CNQS 3BXEA 3TGWA 2HCFA 4HO1X 4EF6A 1Y34E 4DJFC 1YL5A 4MU1A 2IUFA 5ALXA 4DDKA 1L0BA 2IK8A 3U1YA 1E0KA 1OYRA 1GPDG 2EKBA 3OIUA 1MU5A 3RTDA 1A5SB 5B7NA 3W3AA 3D3JA 4L1KA 1AK2A 1KH1A 3F6YA 4PXYA 2O3ZA 1DCFA 2P9FA 4TUYA 1T2VA 3BOSA 4EG8A 5BRAA 2W48A 4B4VA 1PJ8A 4EENA 3F5MA 2HNKA 3TL3A 1AMOA 2QSJA 3M33A 5JOQA 4LRUA 1UMBA 3RYFA 3MHTA 4RX1A 2ECKA 2JA2A 2WWHA 2NSHA 1LW7A 1KXZA 2PZJA 2XYQA 4OL0A 5DLDA 5IARA 4YPOA 1LEHA 4IPTA 4DT1A 3L02A 1YZTA 1BX3A 3ANNA 4DV5B 3C7CB 4IJKA 4HDRB 3R23A 2XLCA 1QYDA 4XSVA 4OHPA 5G41A 4FCCA 2IL1A 3PS1A 3T3PB 1OLXA 5CVTA 1ESEA 3M1LA 4CQMB 1UPAA 2I1LA 1Z16A 1M1YE 2IXTA 3DBIA 3L0ZA 2ZI9A 3F7TA 3ZQKA 1NLYA 2F90A 3HR7A 4HX9A 4G0YA 3M4NA 1J09A 2ODTX 3FFBA 4P53A 4QRIA 4BB9A 3MMSA 2DE0X 3U26A 3HVRA 2R1VB 4GMGA 4JWKA 3U7HB 2ATEA 2GBFA 3L7OA 2VJLA 4F96A 3NATA 5DYWA 3WHPA 3ADCA 2JAUA 4TMWA 4BO7A 1LGYA 2D13A 4W9NC 4WUBA 3TUZC 2DKNA 4ZVSA 4Z7QB 4JLOA 2V2ZA 4BGIA 2NXJA 4C6SA 3BD7A 1GPH1 3FUWA 3RVMA 5IANA 4IIJF 4TQGA 3HVKA 4A8HA 3AV3A 3BMNB 2QN3A 1BXRB 1C8BA 3T1YE 1E3WB 1NUSA 2AEMA 2RC5A 3B85A 3CX4A 3MJSA 3PXAA 4HDOB 5CNIA 5EJ9A 3JWEA 1BNCA 1NVKA 4KH1A 3S44A 3NP9A 1Y5IA 2NPOA 2VYNA 3I30X 4NHOA 1K3UB 4KJZA 4PHHA 4B43A 4DF3A 3C7DB 3Q6IA 3CVUA 1FFSA 4PYJA 1KF0A 2XTJA 3GPIA 3P19A 4NBRA 1EBUA 4QPNA 5F3RA 4QGHA 4D5GA 1FLDA 3RS5A 1JEEA 4RLQA 1E99A 4U4AA 3ROFA 1SRRA 1XBTA 2OHHA 3UYLA 4JI6B 4PU0A 1MIOA 1N5LA 1XTKA 2NVBA 3R7LA 1OZFA 3TB4A 4YIKA 4RTKA 1GR0A 4L9SA 3D9QX 2VDUE 3KM0A 5AI5A 1XNQI 2VRNA 2XBMA 1GO2A 3OTHA 4Q3NA 1QAMA 3A1NA 3RYIB 2JI6A 5SY6A 3WGKA 4B80A 5K0ZA 3L4EA 4YWJA 1H7SA 1M8PA 2Q4RA 3N8KA 4H0CA 3MPOA 4IDDA 4DIUA 1OVMA 2VTBB 1IXYA 1G8PA 1D2RA 2VHEA 3EFOB 4BLWA 1WEHA 3V4OA 3ZV5A 1UZNA 5I7UA 4PHFA 3DOFA 1UKVY 1QSGA 2HBRA 3F7OA 4YIHA 3ABSB 1E1RD 2YBEA 4RZ2A 1X1RA 4U2BA 1JU9A 3CRNA 3RIYA 3F1LA 1UMDB 3GG2A 1GFZA 1E5DA 2XDWA 3ETCA 2O2IA 3MQ2A 4KIUA 4NYMQ 3WU5A 5LYYA 5KHLB 3RFVA 4F21A 2VS1A 3UBTA 2A1UA 3GMEA 4LHEA 3G0BA 1KH2A 5JEAE 2YWGA 4HH0A 2WHYA 1YO6A 3HXQA 1I10A 2GAOA 2R7LA 3HBLA 3MF4A 1W4CA 2ICAA 2QMUA 4M22A 1JEYA 1DCTA 4X65B 3ZZUA 4ECEA 5CX4A 1JZSA 1LTQA 5EHNA 2QW1A 3M9LA 2FP4B 3VSAA 2VCHA 2Q3BA 4A6EA 1OFTA 5JMPA 1G3RA 2Y71A 1Z2CA 5K20A 3JR7A 4N6GA 3JD0A 2HLNA 3N74A 1K6IA 4IM7A 2O52A 2WNIA 1QYCA 2CVFA 5B1HA 5KHOC 5KWEA 4A2CA 4BGDA 4ZQHA 2WVHA 3ZCUA 1J1ZA 3DVSX 1BDMA 2GM9A 4QLAA 1KHTA 5BNWA 1WX1A 3MWKA 2NN6D 2B3TA 3IUYA 4FKMA 1IJBA 5K0NA 2BJWA 1NMZA 3FFTA 2QZPA 3GX1A 3LGXA 4MA0A 3VR4D 4PRYA 3VTAA 2I87A 1B4DA 2FW6A 821PA 3FGPA 4M0MA 1GL3A 3K1TA 4F6LA 2V0GA 1QYRA 3GDGA 4BASA 2W0SA 4OFZA 3T7SA 4PC2A 5JBNA 1CNEA 4Z0TA 4B6FA 2PLAA 3I2YX 5KTRA 1KVKA 3OCVA 1HK7A 1VLLA 2BA0G 3A9SA 4H2DA 5FEUA 1IY9A 3UKDA 1HGXA 1UBCA 1WDTA 1UXGA 3RSSA 5JJKA 4LQ4A 4PWYA 1JKFA 4U7TB 3KL4A 1CSEE 4S0ZA 1LBSA 4CT5A 2OESA 2W6JD 2JNWA 1IBLI 1AY0A 2XJ9A 2CXRA 3K1ZA 3Q11A 2QN1A 4PZ9A 1FS6A 2JLBA 4QUJA 2Q7OE 5AVYA 2BRUC 4F60A 1FFAA 2G8LA 4Q16A 4EG6A 4XUEA 1NQAO 4JEMA 3PFNA 3EASA 3RIEA 2AJTA 3TRHA 4CODB 1KRXA 1DUSA 1X7ZB 2BDEA 3FPAA 1AK9A 4NXNB 2VBGA 2DB3A 2HFUA 1FC0A 1GZ4A 1Z15A 4WKBA 3RKUA 3IUQA 3TO5A 2P0AA 4MKFA 1RWWA 1O95A 2NO1A 4NJMB 2JI4A 3TI7A 4CUKA 4EO7A 4M1WA 3UUEA 4RTPA 1LK5A 3NI2A 2P78A 2VSYA 3KXKA 2BFWA 3IXMA 2ZIGA 1Y4DE 4FT4A 4J9UE 4QU9A 3S1AA 5CA0F 5C0OE 4M86A 2ZJAA 3IHWA 1MIHA 4WKPA 2BH2A 4MKRA 3R3ZA 5JJLA 3P2IA 2Z98A 2XNHA 4PQFA 4PX5A 2PUAA 2NO7A 2R8BA 5D7NA 1ZZGA 1C0PA 4UJ5A 1CY6A 3AI2A 4LECA 1KU0A 5B6JA 5FWXB 1DLIA 3EEQA 4FYXA 5AKHA 3WLFA 4WZAA 2UXDI 2B25A 4KQCA 1U0GA 3FRJA 4IOJA 1HA3A 1MXHA 3JWHA 5EKDA 5KVAA 2Q6TA 4DZZA 1NBOA 4LIPD 4A0FA 3PB3A 2UVQA 2V2VA 1CRZA 1TMGE 3ENZA 3KL2A 1KK3A 3LD9A 1CWUA 3O6VA 1D2MA 3P0EA 4LYEA 4FZ3A 1FKAE 3OTOB 3CO0S 1L1FA 4CEJA 5TMEA 3D02A 1RJ9B 1H73A 4JYAB 3R6DA 3QU9A 4OQMA 1XUOA 3BBPA 4TLMB 5FFFA 1X92A 1E1QD 2JLSA 4JNKA 5IC5A 4LJ6A 2BE9A 2REBA 2WYVA 2CFTA 1WULS 4ENWA 5E9AA 4GH5A 3KZXA 1EFPB 4R5MA 3EPJA 1W5BA 3PIRA 3S99A 3ZHYA 4F85A 4XWGA 5E6UB 4FXOA 3UK7A 1SXJE 1XXLA 3NP7A 4ACBA 5LMNB 4ZVPA 4NMWA 4HQKA 3S2YA 4DLZA 2IS6A 5BWCA 1E9AA 3TSYA 3WL8A 1ZK2A 3HO6A 1NHHA 2BGMA 2AX4A 3II6X 2YXDA 4TSKA 4WZZA 2CJWA 1XL0A 3DT8A 3MOSA 5EP1A 2YZGA 3GHHA 3ZDFA 2ZT8A 1L4UA 2J5QA 3KUDA 3TX6A 1TAGA 1A04A 1QGUA 2VTVA 4B4KA 1XR3A 1U28C 1J07A 4BNJA 1L4FA 4HQOA 2AH5A 1EX6A 1I3OA 4NJOA 4EPRA 1ZM9A 1PG5A 3GUCA 5MGNA 2H1RA 1SQGA 1XRSB 2FRXA 1AXRA 1SKYE 3ANYB 4B84A 5FHQA 4UOQA 4ZQFA 4HXFB 1PHPA 1T1EA 1ZJ5A 2XKBA 3BMOB 1A4XA 1BE1A 2TRSB 2H2WA 4KLAA 1K0UA 2YMPA 2FDRA 3RBAA 3S28A 3QFRA 5GVRA 3V3KA 1VPWA 5ED0A 1YAHA 1OB2A 2DUMA 2IIVA 5T3UA 2FR0A 1V8DA 4IIEA 5A6SA 5EIHA 3ZDQA 3HU1A 4BP1A 1MQSA 1FWKA 2QM8A 5BQPA 5A5VA 5ERYA 1J9GA 2VJKA 1RVV1 4QXRA 4BXOB 1C7EA 1SOMA 1OFGA 4GG1A 5JYDA 1CUYA 4OHWA 4QIHA 1FA9A 3ST7A 3TJRA 1GDHA 4GYJA 1VHWA 5BMVF 2O2XA 3F90A 1UBHS 5DN9A 4OLAA 1UWLA 1NJ6A 2GESA 2AFRA 2HXYA 1GDDA 3NETA 3NHAA 2HM7A 4FFNA 2WDZA 3TSCA 4DPKA 1D6TA 3DJFA 2V7VA 4KQKA 5KDDA 2J3KA 4HDAA 5CLGA 2W6IA 4DR1E 3GOQA 5DCUA 3V7UA 4YV1A 1K92A 3LHKA 2BIFA 2V7TA 2GXSA 1RJ9A 4KH0A 4FD3A 3EPRA 4Q9AA 3AY7A 1H0SA 4F2HA 4XB2A 3RS2A 2O2ZA 5K3FA 4DV1E 2W0MA 3TNFA 3A9CA 3CXUA 3GEPA 3WGZA 1AS3A 5G4KB 3KO8A 2YHBA 1R8YA 2BLNA 4XLZA 3NHUA 4BHTA 2UKDA 1VI5A 3M6UA 4YAKA 1IMJA 5FJIA 3RREA 2JD2A 3A37A 3GT7A 1GAEO 2HV9A 3FMFA 4MZDA 4B6SA 2IYTA 2DBZA 4D3DA 2HREA 1E3SA 2NPIA 2X19A 3O4JA 5LKAA 5CB8A 4KL8S 1F2TA 2PS9A 3PQ7A 4FWGA 2M6LA 4ZPXA 3F74A 4CMGA 1FU7A 4G1BA 3D4BA 3IT2A 3PSAA 4KTTE 4Q1BA 1PQ4A 2Y27A 4MQFB 3LZCA 2M6KA 2UUBI 4JHLA 4R1OA 4WY2A 5L6LB 3RTAA 3FNGA 1FUUA 4I99A 4MEBA 3PDHA 5KSOA 2BZ0A 3EOBI 2O8CA 3OEED 1MBZA 4WECA 5IXYA 2FGJA 2HHHI 2ORWA 2X4GA 3LRXA 3VRHA 2PX5A 2YRWA 1L8LA 4EB8A 3DL2A 2CXSA 4FTWA 3CH5A 4IGAA 4KNVA 5AM5A 1RCUA 5JAHA 3SC2A 4HLQB 3LPLA 5GMEA 1YOVA 1PQWA 4KKXB 1QE5A 3SM9A 1WPQA 3HDTA 2BD0A 4WN3A 1CUDA 4EJ2A 3KT0A 3L8CA 1GUYA 1ZJ6A 3AEUB 2HI0A 4MUAA 3IQFA 1VSTA 1SVSA 5IF9A 5A9SA 3ROPA 5JBIA 2NVUB 3HL0A 5ISMA 3U56A 2RKWA 3ZKWB 5I9IA 3KT3A 4IXMA 5F3DA 2GVNA 3HO8A 1T9GS 3F1KA 3L3BA 3LBHA 3N2NA 3NNDA 2AJ8A 3UWDA 1BX1A 1XVAA 1UIMA 2COUA 2WSYB 1QS0A 3T6KA 2M1ZA 4ENSA 2C3MA 1Y1QA 4U0JA 4W5TA 4YHHI 1JR3A 1AURA 4L9WA 3T0GA 5KOJB 3ECSA 1FDSA 4XIYA 3H0EA 5FADA 3FKJA 2QUZA 2H3HA 4E5MA 4KO2S 3GUHA 1X7WA 3A10A 1ZU4A 3HKDA 4FCVA 3R5FA 1FDRA 2GOYA 4P33A 5DTIA 5TEVA 3ZI0A 1KEKA 2NP6A 1RC1A 1TO1E 1VKZA 4LY3A 4RHCA 2QVZX 3BSWA 3PSHA 1SVUA 5DYYA 2ASVA 1P44A 1DBIA 4C7OA 3CF4G 2XZOA 1UINA 3I1FA 4O33A 2ZXFA 4LMBA 4LQDA 3S29A 4FILA 2DKFA 3TQRA 4ZTUB 4X20B 3UKOA 1USUA 1M1ZA 1Z5PA 3ANMA 3R0VA 5D86A 4RADA 1UZLA 1Z0WA 1IH8A 2Q9BA 4M98A 3R7SA 5DW0A 1FVOA 5B6PA 4USMA 1L7RA 1X1SA 2I34A 3WWYA 2W71A 1CLEA 2BF4A 1DU4A 5HFAA 1VJDA 3LDHA 3QG1A 1C7QA 2BRUA 1Q11A 2JLWA 1TCCA 4HUQA 1KFBB 1QGAA 1XFDA 3TSZA 3B4TA 3ID6C 3PPXA 5A4KA 4LBZA 4BQFA 2F3TA 4XR9A 4B75A 4NJEA 3D6MA 4I36A 5BPFA 4R1TA 3JD4A 1ZWKA 2HDHA 3O8QB 3W06A 3LCCA 3BRWD 3CUKA 3AQ4A 3LXMA 1L5WA 5FOVA 1RR6A 4BBJA 4UTPA 3KZ1E 2OFWA 2HK2A 4N65A 2B9EA 4GBED 4X66E 1B8OA 4CFSA 1GFWA 1F7UA 4DU7A 3TCNA 1DBSA 4KN8A 3OT5A 1PZEA 4M0LA 4B4DA 3IE2A 4E0BA 4PINA 3WL3A 3ZJTA 1I7LA 2AOTB 3RC7A 1T13A 1PR4A 4FEEA 4IXWA 5B30A 5DMXA 3IBGA 3B6EA 1EUZA 4DJEC 1YA6A 3ONFA 3HEBA 3AEUA 3K1YA 3MLBA 1K7EB 1ORDA 1UR5A 4R0VA 1JQ3A 2X2PA 4WY5A 1TO2E 3SXPA 3UMVA 4H1WA 3WGJA 1LSUA 2H1FA 3A3OA 4BJHB 3KJIA 2CN1A 5KZMB 3OUTA 1H42A 4IVPA 1JEQA 4KZPA 3GLUA 1ZSVA 2E9SA 2X7XA 1MAAA 4F12A 1DMRA 2CXOA 4MS1A 4G9GA 4BLTA 3OZVA 2WVAA 1K97A 2P4EA 3T5TA 2XOEA 2XUZA 2DR3A 3S2GA 2VNIA 2V6IA 2P8SA 1O97D 2ZVDA 2BKUA 3WK9A 4A5SA 3P9RA 4TS4A 2A9RA 4XD7A 2Y05A 4BATA 4OIFA 5JNTA 4UNSA 4OKGA 1HG1A 2OD2A 3RAPR 2B21A 1CUCA 4EO4A 3C43A 1ZXLA 3SLGA 4XWKA 2EW1A 4GOMD 1ZK3A 1UDNA 1NW3A 3VBEA 3S2IA 4HZIA 2JKYA 3CR3C 3EWSA 1IJKA 4CM6A 4BU1A 1EWRA 1EDOA 4B6QA 1KO1A 4U00A 4Z54A 2I3GA 4FBGA 1XHKA 2OK7A 5ER6A 1LQTA 1TIKA 4IINA 1AG9A 1X9GA 2AN5A 2QROA 5HJEA 3SFZA 5GONB 2Z8ZA 4JQZA 4P7GA 4W99A 3ENQA 1O57A 1QVVA 1S8OA 3ZDDA 2HHJA 5DNXA 1W4ZA 4R2XA 3SYNA 3RAEC 2XV1A 1U28A 3AF4A 4Q6WA 1XWFA 4TYMA 4KMMA 3NZEA 1Z5UA 2YOHA 4H6PA 3UQYS 5HQ3B 3QBJA 4NMHA 4JUAA 3THSA 4RTSA 4BNLA 3AJRA 1CZOA 1VHTA 3O8QA 4UPDA 5CU7A 1WQ1R 2I65A 4DY4A 2JJ1A 2X86A 1POWA 3NX4A 2IBTA 1RYFA 1TVMA 4ZVNA 3HYCA 2IYNA 2QI9F 4Z4FA 2VA8A 3L4KA 4PE5B 3FSGD 3QNMA 3PVSA 2R6GA 3P9XA 3AGPA 4R9SA 2A67A 1ISHA 1MAHA 3G59A 3HFJA 4ZN6A 1MB9A 3GEHA 4JI8I 2OQVA 2QVYX 3HCEA 1XVTA 3G82C 1NVXQ 3OSUA 7ADHA 1M2FA 2F1KA 1N5OX 3H5WA 1T0PA 2CD9A 2XI4A 3PXDA 4WHMA 2UZ0A 4KQIA 2WI8A 4QO7A 2A5YB 2Z2IA 3D7RA 4YB8A 4EUHA 2F4VI 4Z6KA 1KKMA 3KB6A 1EXNA 4M46A 4A27A 4BQIA 3V2IA 5T41A 4A73A 3A2LA 4DJDC 5H9VA 3QQ5A 4WA7A 3ER6A 1L5OA 2CK3A 1S9HA 3DBOB 4FJ0A 2CLOB 1IRXA 4AQDA 1XK6A 4DR6B 4Y3UA 2D1FA 1NLFA 5CGQB 4Q02A 3HKMA 2OA0A 3QLJA 4JSYA 4YRRA 3ZU2A 4UOZA 3SHVA 2I29A 1FMLA 1LI4A 1NE2A 2H3EA 2NZ2A 3N3AC 1OZ0A 1IRIA 4XQGA 3TLJA 5HP4A 1GZHB 4ZXPA 3FLMA 5HTKA 1E2KA 4GI1A 3ROKA 2HBYA 4I6GA 4DBLC 3L8YA 4G36A 5K0FA 3G13A 4DAOA 3C6QA 1XTJA 1KEPA 3CSSA 3JQ8B 3PHBE 4KO8A 5CJPA 4BZXA 2B8EA 1YQDA 2VZLA 4AMZA 1V5EA 4FSDA 1GRVA 2QMYA 1MO3A 1KI7A 1P60A 1VL8A 2HYIC 1HKUA 4HTFB 1YR6A 1N7HA 4PVCA 3PFBA 1D3AA 3VYTB 4LTDA 4K2AA 1DIOB 4D4JA 3IC5A 3O8NA 2Z5VA 2Z57A 3AILA 3NWPA 3CUWA 2NTEA 4HEA6 4Z0PA 5I47A 4QTYA 4YMTA 2YYSA 1AUVA 2H1WA 4GWLA 1XNRE 3PWZA 1CZUA 1IJEA 1G21B 1OX4B 2W90A 2ZJOA 4WEQA 4RZHA 1YZGA 3J7AC 3AL3A 1SHZA 2V65A 2EKLA 4GKAA 1II8A 1ZR2A 1EQUA 3MD0A 4XCVA 4ZKEA 1NONA 3TOCA 2O0JA 3IH5A 4UXHA 4V0MA 3WDSA 4DSZA 3BDAA 1Z8HA 2Z5CA 3TE6A 4A03A 3U3JA 3WYFA 5CLQA 2UUCI 1DMSA 1KQOA 1G291 3C5CA 4MDYA 1G7RA 4LDPA 3ZHVA 4DMFA 3ETNA 3RPEA 2AN3A 2BM1A 5B6IA 3BTSA 1GR1A 2EQ5A 2OV4A 4DNXA 3AR3A 2Z6QA 2QE7D 1EG2A 1S8AA 2QLLA 1N6LA 3GVXA 2I3DA 3P0HA 4DTCA 5JMOA 3VA7A 3IPRA 3FOWA 1HYBA 2C39B 2RI1A 4MCAA 1D2CA 1V6SA 2H7XA 3UMBA 2PE5A 1FTNA 4TZ0A 1QHNA 1XZCA 3P3EA 5A62A 3GFGA 2OCXA 1UJ4A 2I99A 1YQEA 2QYSA 5BOSB 1W5FA 1O94D 4ME6A 3VPFA 5IRCD 1TQHA 4IBOA 4OQ4A 2J65A 2HJWA 4YRQA 3ZXIA 3KZKA 4DWJA 3AVTA 4CT0A 3HXPA 1NVBA 2UXBB 2ALJA 4AS2A 3LTNC 2WRZA 2V97A 3CXRA 3UT6A 2XMZA 4WLFA 3DMTC 4J3NA 3BE4A 1C7ZA 1KDVA 3KWMA 1T34A 2GHRA 4XM0A 1HQCA 3VU8A 4AB1A 4CG3A 2RIRA 2QT1A 4V0SA 1K89A 1JG4A 4W6QA 4NOJA 1KSFX 4EB6A 1LS6A 2RGGA 4QXMA 3U4CA 4JI3I 3CA8A 3H5TA 2OMEA 4DA6A 4DIEA 5KJEA 3GPDG 1GNQA 2OPBA 3ZZNA 1MP0A 3TOVA 4X7PA 2XLBA 3VDNB 5A6VA 2O3QA 2O8FA 3FUTA 1YACA 4R1NA 2XMQA 2AD1A 2OUKA 3CM0A 4G3XA 2VHYA 5LMCA 5DJ5A 5JFTA 3L01A 4HNVA 1JTFA 2UUAI 3HYRA 1NTOA 3F47A 4M1KA 2IDZA 3B20A 5HJ2A 4KXLA 1YZNA 3TCKA 3LKBA 3LCJA 4FWDA 1BCSB 3FWNA 4MW0A 3QWAA 1LLQA 1X7XA 3DNFA 1X80B 3DT6A 4HATA 4J6FA 4PHGA 5K0EA 4YCNA 1UMKA 1R15A 2YJZA 1ULSA 1PJLA 1WD5A 3O3OB 3OM8A 4NFSA 4EJSA 2XA1A 4PZPA 3ZDCA 3GDFA 4LF7E 1T5TA 3B6MA 3SJCA 4Z53A 1LBEA 2ZYWX 5AJVB 1JHRA 5DE3A 1KYVA 3HV2A 4N5NA 4ND6A 1Z8NA 1AKNA 2BSXA 3CX8A 5HDBB 1OLSB 2QRPA 4O4LB 3ESCA 4X1KB 3DFIA 1V3TA 5COQA 2O8DA 1EFVB 2YYZA 2FN8A 4RE6A 2DPGA 3B3GA 4HV4A 2EJTA 3ONVA 4V1CA 2ODPA 1DC4A 4UVGA 4UU8A 4Q9KA 1YE3A 4NKRA 3VZQA 3JW8A 5JV5A 3KSAC 4AXBA 3F98A 4TTQA 4DLLA 5KX5A 4XVUA 4X84A 2VUHB 2XUDA 3PS2A 1JPVA 2CV1A 3PC2A 3D4IA 3PGMA 4CKXA 1NPTO 3AXTA 5KUTA 1DVRA 1KJJA 2AFIE 5AW3A 3COPA 2GD6A 1SBNE 4RJKA 2GETA 1I14A 3E4CA 4LTNA 3JS5A 4JLSA 3N86A 5F35A 4OTZA 3KYCB 3W5HA 1TW3A 1TTHA 1RP7A 3ZU6A 4JXJA 3P0IA 1Z3IX 1QFSA 3IERA 3OZEA 4OH1A 1GLNA 4LF5I 2RD2A 3T3NA 2ZRNA 1ENYA 4GI2A 4Y6QA 1V16A 2YWJA 5TV2A 5LLDA 2ZRBA 3MAGA 1Z4OA 2QQ5A 3H2IA 3T7CA 5IDQA 4QECA 4E88A 4R8SA 2G06A 1E9FA 1S1MA 2I6UA 3N8HA 5CB4F 1RSZA 5IM4A 3SQOA 3KYDB 3GG9A 1JDPA 4LBVA 3VR0A 3E81A 1CETA 1DQPA 2ZWAA 3VR3D 3A06A 1UDXA 4GECA 3GZJA 4C5CA 1NT4A 3V4RA 1NIPA 5A03A 5DCWA 1HORA 2Q1YA 3VSBA 1NN3A 5J3JA 4GPTA 4JP3A 3AGQA 3CNHA 5B1EA 4BZQA 1E9EA 4DHWA 3GEIA 3EUWA 3ADKA 4OM7A 4NZZA 1G20B 3K70B 3CZMA 4DEYA 4ZO6A 3W0LB 1FX1A 4EABA 4DR2B 4H1UA 2PUTA 2AK2A 3RUFA 2X2EA 3B1JA 4YAFA 5EXPA 3FBGA 1VJTA 2EKZA 3EULA 3E5RA 3LBIA 2P5TB 3LX8A 4GI3A 3OESA 4QYSA 5ICSA 2VQEB 3C24A 2FN4A 1GPKA 1TM1E 1W44A 2P41A 9LDTA 1W6UA 1Z12A 3EAQA 3QOFA 1B14A 4PGAA 1G6Q1 1A2KC 4EKNB 3ESBA 1XQYA 4BNFA 4A2QA 1U99A 2QS9A 4TKMA 4B3RI 4D41A 4GM4A 5CHEA 4AY2A 2EJUA 2Z8XA 4RGYA 4V2IA 5D1HA 1Y4AE 3WWOA 1CNMA 2W8ZA 1EFVA 4OQXA 4B48A 2O7RA 4MQYA 1EKXA 2PG3A 3KVNA 4KQWA 3UV3A 1Z9BA 2FPLA 3LY8A 4GOND 2GYVA 2RAPA 1GY8A 2QY9A 1ZGBA 3M4JA 2VQFE 1EK2A 3UGTA 4DDMA 4I5DA 3ADPA 3FVTA 5ALDA 3OOYA 1N57A 2BMDA 3MJ4A 2FUG6 1JAYA 2ZR9A 1YCGA 5AM3A 1LDGA 1ACJA 1UFOA 1W0CA 2GF2A 1TUBA 1BKDR 3BZUA 3RJTA 3UCXA 5IWAI 1T0JB 2R00C 4AIIA 1BVUA 1S0UA 2NUAA 2QUBA 3HRHA 1HLPA 3IMCA 3GT3A 3IEMA 1N34B 2JFQA 3NOVA 1XXHE 2J3MA 1T9ZA 2I2CA 1KMHA 3ABQB 1RKXA 4HFNA 3ZYZA 3TRJA 2CWDA 4KE6A 3K0FB 1EFDN 3EGCA 1U0LA 2WJPA 2CB9A 2R6R1 3AEQA 3OTQA 3G7UA 3FPCA 4PFQA 1BXGB 2HMAA 2WICA 4F2DA 5IWCA 2HWWA 4DCVA 1TEZA 2QX4A 5DBIA 3L18A 4ISCA 4KLCA 3E9MA 4MVJM 5K0JA 1JL3A 1ZH8A 1RP1A 2BE7A 2RHTA 2NAPA 2J7PD 2NVWA 4HSEA 1NSFA 1O96A 1Y5RA 3MAAC 1ODKA 2IRWA 1T4DA 1ILEA 3ZU5A 1P9LA 3ZCQA 1JPUA 4I1UA 2FWIA 3EXEB 3CYFA 1M7HA 1QHHA 3GJ8A 4BPBA 3E3MA 1UKAA 3R74A 1RBMA 4IVRA 4OCZA 1A6FA 5G0VA 4DUGA 5EWLA 1S7GA 3W4JA 4EK9A 4AQYB 1LC3A 2UYCA 4CKWB 4PG7A 4B3TE 1UADA 3HBMA 4LZNA 1CTQA 1DX4A 4JFAA 4BFVA 3DYBA 3LW8A 4HQNA 2WJHA 3GXBA 4WX2B 1XRQA 3C97A 1GPBA 4HYMA 1GNVA 5H9WA 1UBTS 4KREA 3BULA 3E84A 3G88A 4Y67A 5C1IA 5T8KC 5TIIA 1OVGA 4D25A 2HF7A 1W73A 4WK4B 1GNLA 1KBOA 2HSJA 4IX9A 1VLQA 1WW8A 4FGSA 5C7YA 2VBFA 3V4FA 1JJIA 4X64B 4DC0A 2H0QA 5C0XC 4MVJD 2VZ9A 1XJQA 2EWVA 4ZJPA 1D6JA 1A72A 1WY5A 2COKA 1F8XA 5LLTA 4FOOA 4HWSA 2ID4A 3A7DA 2C31A 4OAPA 3VC1A 4H16A 1XPUA 4TMKA 3C7AA 4Q48A 4TVKA 2D2XA 1FE8A 1QQ6A 3UXYA 1ZHFA 4LFBB 4DB4A 3RVQA 4G24A 4KPEC 3E2IA 4LDNA 4OQYA 4OSEA 1QGYA 1MX0A 5GZ1A 4UU7A 1KYTA 2PIAA 3DF9A 4JBGA 4JLNA 4KO1S 2JFBA 3X2FA 5CCXA 3LA6A 2AA3A 2PRJA 3TF5A 1ADYA 2NU8B 4EITA 2M98A 2FQXA 3Q7TA 5G02A 5CH3A 1QAQA 2HJ9A 1TKRA 3JQAA 4RAQA 4BLQA 3VOSA 2PRSA 1N33I 2O2YA 3CO5A 2OP0A 1NT2A 1WCXA 4FS3A 5ARBA 1C29B 5K9ZA 2PLRA 3O8BA 3VMMA 1GTZA 6NULA 1R6TA 2LD4A 4MRMA 3W1EA 3Q5GA 4QPZA 1XX6A 1DBRA 2GAAA 1THZA 5AOCA 4BEVA 5JAPA 2OXRA 1UPUA 1YR2A 2EATA 4M37A 5L3VA 2FA9A 4ROTA 3OE4A 4YPVA 4CM5A 4ZREA 2F1IA 2JIMA 1RYYA 4DRZA 3CSUA 4C4OA 1Z5ZA 5FWNA 2XQVA 4PYIA 4YJKA 1Q91A 3AFMA 2XIJA 3HR4A 4CKYA 3GN1A 5IKOA 4GO1A 2P2NA 2WIJA 3WMRA 5GP1A 1SD2A 1V47A 1GUZA 1DAEA 2DTEA 3IP8A 3EXEA 2ORVA 2X9QA 3DXZA 1XTRA 3OOSA 1EQ2A 1HDYA 1YZHA 4UW9A 2ATVA 2J46A 2Z6UA 5B36A 5IG2A 1YR7A 4JI5I 5BSGA 5JJ5A 4Q6BA 1SVIA 3HFSA 4I46A 4LYGA 3ICQB 2H2IA 3CZPA 3S2FA 4PNZA 3ZZ1A 1R6MA 4J0IA 2FX5A 4CEIB 4MDTA 4TL7A 4EFNA 5JEAA 2FSSA 4TVSA 3EH2A 5HUJA 4KQ6A 3UXMA 4CL3A 1RAEA 1T1IA 1Y8RB 2ZTSA 2WWWA 3GVPA 2FX2A 4G01B 5EIOA 4ZEMA 4QGBA 2K4MA 4BFXA 1EXMA 4LF8I 3C14C 1LBTA 4E4TA 2BEUB 1Q16A 2AG5A 1SHLA 2XOKA 3I9MA 4EPTA 1GRCA 3LIPA 4DARA 2LVBA 5A02A 1LRLA 1XQWA 3BA6A 3KPUA 3I2IA 2E55A 4NEHB 2P77A 2X7HA 1TF5A 3UMRA 4NSNA 1ABBA 2EHJA 1KYWA 4ZYTA 4O3FA 4YUAA 3MMZA 2Q28A 1UFKA 2PKQO 1G8KA 2W83A 4J7AA 1NURA 1S2OA 3AKDA 3N8GA 4PLHA 4XIFA 1LC0A 1SVKA 4BKUA 5B7QA 2X9NA 4EQZA 1QCCA 1E7MA 1VKRA 3KPWA 4IDPA 5A5DA 1Q1ZA 2QTTA 2XODA 1EXWA 4UEOA 1CUXA 4FD2A 4C14A 2ZT5A 2JGDB 4BJ6A 1WL8A 2IBSA 3ORYA 3AR4A 4PLFA 3IJRA 5CK4A 3OZWA 4IIBA 3SQDA 4R2MA 4F2GA 1HDIA 5JG7A 3W5IA 4B45A 2ISSD 2JGJA 5A05A 3UY4A 4DL9A 2VYFA 3FETA 3JZIA 3WWPA 4NCNA 2VT3A 2Z5BB 3AY6A 3R9KA 3WX0A 1SK8A 2Y0DA 5DT2A 4EX6A 4YPFA 2PO0A 1Y3IA 4GW3A 4IOMA 3A4VA 1T3GA 2F62A 3K8QA 2B92A 3QVGB 1H2RS 1D8AA 1OWMA 2FSGA 1SB8A 3FCCA 4AJLA 1FX0A 1Q1AA 2BW0A 3QPVA 1QTQA 3SZOA 3G85A 4YRGA 2B1IA 2NO9A 4QICA 1XQ9A 3CY6A 3WYAA 3U39A 1YRQA 4B2IA 2NYVA 3OEHA 4P38A 5DWVA 3H5VA 4NBWA 4UARA 5E7JA 3GJTA 4Z1MD 1GSIA 3C74A 4K1LA 1E6LA 3QU4A 2XYRA 2F4NA 1XZ8A 2WHXA 3O8OA 4HQ0A 2QBYA 2ZUEA 3QT6A 2JA1A 2R8YA 4BVJA 5C0XB 1S3GA 3P2JA 4YGYA 1IPEA 4YRAA 2V74B 3KSUA 1J7KA 4IIJA 5BYKA 1XV5A 3MXTA 3RJZA 1Y6GA 4YAGA 4WFQA 3IQEA 5IU6A 2WHEA