2UUCE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uucE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uucE02
1Z0CA 4URLA 1XNRI 1NZ0A 4MYUA 4X66E 1O0WA 2EZ6A 1HNZE 2LJHA 3C4BA 3H4LA 2HKJA 1RQ0A 4LFAE 4LF8E 1YZ9A 1EKZA 4LF4E 2A2DA 2NUEA 1WUUA 3LTOA 4DV1I 5LL6R 1I94E 1H7SA 2UU9I 2UUCI 4JI4E 5BR8I 3WU5A 2A2CA 1BKNA 1YYOA 1IBLE 4LFBE 1FJGE 5CFFE 4DUYE 4FW9A 5IWAE 3LLHA 2R42A 4JI6E 5IT9Q 4X64E 4NXME 2V34A 3C4TA 4NXNI 1N32I 4USMA 4DR3I 2VQEE 1B62A 5FLXQ 3OTOE 5L3JA 2LUPB 2L2KB 4FN5A 1ZM9A 4Z7YA 2ZM6E 4DV0I 1VISA 4X65I 4Z7CA 4JV5E 3P1XA 1UILA 2E5LE 3GONA 4UTGA 4R1FA 3Q1QA 4DV6I 1NHIA 2VQFE 4DUZI 2UXBI 2LBSB 1N33E 3PYGA 3B78A 1WHQA 4DR7I 1MU5A 2AJ4A 2B3TB 2E1RA 1YYWA 1FI4A 1ZXNA 1DI2A 4LFCE 2LUQA 3ADJA 4DV4I 4DV2E 1N0VC 4JYAI 1KKHA 1J5EE 3T1HI 4YHHE 1XNQI 1NHJA 5IT9C 3LNUA 4JI0E 3K17A 4YY3I 1ZM3A 4B3RI 3M6AA 2HFSA 3VYYA 5FLXC 1KVKA 3PYEA 5LMUI 2UXDI 2DEIA 4FWGA 4AQYI 1S4EA 2DIXA 1HNXE 4DV3I 3J81Q 1D6TA 2UUBI 1OJ4A 4DR1E 4DV7I 4KQVA 2GS8A 1XNRE 4DV5I 1K47A 1N36I 5GMEA 1Z0EA 1RREA 2X7IA 4WUCA 2UXCI 2HK2A 1EI1A 4X8WA 2RSMA 2HK3A 4DV1E 2RTXA 1RC7A 2UU9E 2UUCE 4DR4I 2L3JA 2EFGA 2NPFA 4USKA 2VF3A 3J80Q 3HULA 4HYMA 1Z0BA 2CPNA 4WYQB 3LPSA 3JAMQ 4KHPI 2HFUA 3J7AG 1FNMA 1IBKI 1STUA 3CWVA 1U2RA 1J26A 2WW4A 2UUAI 2F4VI 4LFAI 4NXNE 1N32E 3J81C 4DR3E 1I94I 2HHHI 4LF7I 1NHHA 1N34I 1XMQI 4JI2I 4B3ME 2NUFA 4LF5I 4DV0E 4X65E 5A2QQ 2ZBKB 4DU7A 4WUBA 4DV6E 4JI3I 4DR2I 3B82A 3WU4A 4RPFA 2UXBE 3PYDA 2LTRA 4NXMI 4OX9E 1GQEA 2RS7A 3K1JA 4EMDA 2JY9A 1T4NA 2V2ZA 3J80C 3ZKDA 4DV4E 4PRXA 2ZM6I 1T4LB 4JYAE 1Z5CA 3JAMC 2BV3A 4LF9E 4WFTA 4OOGC 2B7VA 2DMYA 4DR6I 3ZZ0A 4M2ZA 3T1HE 2V2QA 1XNQE 4B3SI 2LRSA 3VYXA 1H7UA 4YY3E 2RS6A 2KHXA 3D4JA 1UEKA 2XEXA 4P7AA 1XMOI 4GKKI 1HNWI 4X62I 1WHNA 2UXDE 4HACA 4K0KE 4DU8A 4AQYE 3V5RA 5LMNI 4DKKA 4JI7I 5A2QC 4DV3E 4DR5I 3ZZUA 1ELOA 1H73A 1ZXMA 3QT7A 1PIEA 4JI8I 4HXZA 4DV7E 1QZRA 1YYKA 4DV5E 2L33A 2IHR1 2ZITA 1N36E 2N3GA 4B3TI 4GKJI 1KTVA 5GMDA 4LF6I 2NA2A 1FWKA 2UXCE 2L3CA 4XTJA 3T1YI 1IBMI 4JI1I 2YT4A 2J7KA 1PVGA 4UT4A 1HNXI 4JI5I 4DR4E 2BM0A 4PRVA 3V2UC 1X49A 2V8PA 1ZBTA 1N0UA 5BR8E 1XHKA 4WUDA 1HR0I 1KIJA 4PU9A 1X47A 4KHPE 4M1KA 1FWLA 1IBKE 2DB2A 4DXLA 1B63A 4X66I 2UUAE 2F4VE 1HNZI 4M30A 4LF8I 4LF4I 2DEJA 2HHHE 4LF7E 3QT6A 3QT5A 4DPYA 3PYFA 3WU3A 1N34E 1XMQE 4JI2E 4LF5E 1FKAE 4JI4I 4P52A 1IBLI 4LFBI 2LTSA 1FJGI 4MYTA 2L2MA 4JI3E 4DR2E 4DUYI 5IWAI 2CZ9A 2BM1A 2JVAA 1Z0WA 2HKEA 4DPUA 3ZM7A 4DUZE 4JI6I 1H74A 3F0NA 4X64I 1ZM4A 4DPTA 4DR7E 4DPWA 2VQEI 3OTOI 4B3MI 2NUGA 1Z0TA 2LJPA 1DARA 4DR6E 4FWDA 2V2VA 3ZKBA 2N3HA 1Z5AA 1H72C 4B3SE 4DPXA 3ADIA 4JV5I 1MX0A 2E5LI 4ZVIA 2VQFI 4OX9I 1ZM2A 1N33I 2X36A 3J7AM 4B3RE 2R3VA 1T4OA 1XMOE 4GKKE 1HNWE 4X62E 1QU6A 3ADGA 5LMNE 1MG7A 5LMUE 4JI7E 4FWHA 4JG4A 4ED4A 4DR5E 2Q2EB 1Z0GA 4LFCI 1Z59A 2UUBE 4LF9I 4JI8E 1A6FA 1EA6A 4DV2I 2L2NA 1J5EI 2B7TA 4YHHI 4B3TE 4GKJE 1S16A 4JI0I 4LF6E 3QT8A 3B8HA 1X48A 4I3HA 1Z0VA 3T1YE 3WU6A 1IBME 1UHZA 4K0KI 4JI1E 4HACB 4JI5E 3HTXA 3ZZTA 1PKPA 2MDRA 1Z5BA 3ADLA 2OI2A 3J7Yp 4HY1A 4DR1I 1HR0E 1RR9A
chains in the Genus database with same CATH superfamily
1Z0CA 4MQYA 4IS9A 4URLA 4R2AA 1XNRI 1MEYC 1NZ0A 4MYUA 4O5GA 2WNRA 4U3DA 4X66E 2YTGA 5JEAF 1BBOA 1O0WA 2EZ6A 1ZBQA 1HNZE 2B9DA 2V87A 2LJHA 4FW6A 3C4BA 3H4LA 2EQ1A 5T6JA 1MGTA 1Y60A 1RQ0A 2GPIA 2HKJA 4LFAE 4LF8E 1YZ9A 4LU9A 1EKZA 4LF4E 2NN6E 1Y4UA 4IZKA 2A2DA 2WBUA 2YRHA 2NUEA 1WUUA 3LTOA 5JEAB 4FW3A 4DV1I 5LL6R 1I94E 4NHRA 1H7SA 1RHYA 1T39A 2UU9I 2UUCI 4JI4E 2GO4A 2WP8B 5AC5A 2JPAA 2YRKA 5BR8I 4WX9A 2ENAA 4O43A 3WU5A 2A2CA 1BKNA 2YRMA 4OKGA 4NZVA 1YYOA 2BB8A 2JYAA 1IBLE 1EH8A 4LFBE 1FJGE 1VI7A 5C0XD 5CFFE 4TUGA 3IWDA 4DUYE 1A1GA 4FW9A 5IWAE 4HTGA 5DNYA 3LLHA 2EPXA 4MDTA 2EOEA 2R42A 2YPNA 2WZOA 4OO1F 2YTJA 2EPNA 2ADRA 4JI6E 4WSGA 4BHCA 5IT9Q 2EMZA 4X64E 4NXME 4FW7A 2V88A 1JK2A 2C39B 2V34A 4QNJA 3C4TA 3CDIA 4F2JC 2BA0D 2MC5A 2F1DA 4BMJA 4NXNI 1N32I 4USMA 4DR3I 2VQEE 3HXLA 2JXPA 4OO1B 2MC6A 1B62A 2GLIA 2CT1A 5FLXQ 3OTOE 2EPMX 5L3JA 5AASA 2PO2A 2LUPB 2L2KB 1A1IA 1PJQA 1G2FC 2AE8A 1OYSA 1JK1A 4U3BA 4FN5A 3HPZA 1L4SA 1ZM9A 1DQ3A 3KZYA 2EOSA 4Z7YA 2YSOA 3THNA 2ZM6E 4DV0I 4J8ZA 1VISA 4X65I 2NN6B 4Z7CA 4F54A 1AAYA 4ISAA 2KONA 2H36X 4JV5E 3P1XA 1UILA 2E5LE 1USVA 3GONA 4R1FA 2EMXA 4UTGA 2WCC3 4DV6I 3Q1QA 2NABA 1R6MA 4Q28A 2IESA 1NHIA 2LCEA 1AH5A 2EL5A 3GMEA 5K36D 2JE6A 5ADZA 2EL6A 2VQFE 1YFHA 4DUZI 2UXBI 2LBSB 1N33E 3PYGA 2EOZA 3B78A 1WHQA 5AE3A 2CGEA 3EPHA 3GCMA 4DR7I 5KL3A 1MU5A 2AJ4A 3MHSC 2YTOA 2B3TB 2E1RA 4RHBB 2O1WA 4DMIA 2EMYA 1YYWA 2EMBA 4F9CB 1FI4A 2GHFA 1DI2A 1ZXNA 1PJTA 4MYTA 4KZSA 4LFCE 1PJSA 2LUQA 4IFDF 1ZU1A 3ADJA 4F6NA 2EOYA 4DV4I 1E3HA 2RSIA 4DV2E 1N0VC 4JYAI 2LO3A 1BB8A 1GTKA 1UDSA 2VRDA 1KKHA 4LOMA 2PO1A 4R2EA 1J5EE 5AE1A 2Z5CB 2V85A 1UDQA 4YHHE 3T1HI 1XNQI 2JEAA 4BA2B 2C37B 3HKMA 1NHJA 4IFDB 5IT9C 2ENHA 2M9AA 3IWCA 3LNUA 4JI0E 4FW4A 2BR2B 2EOMA 3K17A 4YY3I 3EQ1A 3LMLA 1YHCA 1ZM3A 1BBGA 2I13A 4B3RI 1A1KA 2PNLA 2EQ0A 2KOUA 3M6AA 2HFSA 3VYYA 5C0XA 5FLXC 1KVKA 2EM0A 2EWLA 3PYEA 2RPCA 2FTXB 5LMUI 2D9HA 3U1KA 4I8OA 2UXDI 2DEIA 2EP3A 4FWGA 1X3CA 3P3GA 4AQYI 2EM4A 4O4KA 4ZYDA 1S4EA 2DIXA 1HNXE 4DV3I 4L5NC 3J81Q 2UUBI 1D6TA 3UK3C 2JOXA 4LCGA 2CG9A 1OJ4A 4DR1E 4L8NA 1LLMC 2YSPA 2BA1G 4WSPA 4DV7I 4KQVA 5DNLA 2GS8A 1XNRE 2EOQA 2C38A 4DV5I 4GZNC 2O1UA 3MSWA 1YPNA 1K47A 1N36I 4LPFA 1B69A 5LLQA 5GMEA 2YWQA 1Z0EA 2EPUA 2FGGA 4F9AB 3HJCA 1HK7A 2YTDA 1RREA 2X7IA 4WUCA 1IQSA 4AIDA 2UXCI 2HK2A 1EI1A 4X8WA 2R1FA 5JEAA 2RSMA 4WXCA 2HK3A 2L6MA 4M0VA 2K7IA 1KYQA 3F6GA 4DV1E 1NCSA 2VE7C 5IV8B 5A6KA 3Q6NA 4OO1C 4IZJD 2RTXA 2WP8A 5K36A 1YH8A 2JT2A 1RC7A 2UU9E 2UUCE 2O3ZA 3P76A 1X6FA 2EM9A 2L3JA 2LT7A 2PNMA 5EL9A 2EFGA 4DR4I 2YU5A 2PO0A 2V86A 2DSYA 4ZYEA 4LCHA 4BA1A 4QNKA 2NPFA 3THOB 4USKA 2JEBB 1GZ6A 4R2QA 2NN6C 2VF3A 5DRQA 3J80Q 3HULA 4HEIA 2EM5A 1UDOA 1Z0BA 4HYMA 4MU4A 2CPNA 5DNXA 4WYQB 3HPSA 4F6MA 2YTPA 3LPSA 1R6LA 3JAMQ 2PNZB 2HFUA 4KHPI 3J7AG 2WNRB 3PS3A 1FNMA 1IBKI 4MU1A 1STUA 3CWVA 4P7DA 1U2RA 2DLKA 5KL2A 1J26A 2EMFA 2C39A 2LV2A 2WW4A 2UUAI 2EE8A 4F9BB 2F4VI 4LFAI 1QNTA 3JTZA 2EM2A 2BA1D 2LVHA 1YUIA 4OO1A 4NXNE 1N32E 3J81C 4IZKB 4DR3E 1I94I 2EN6A 5EKWA 1RMDA 2ELZA 2HHHI 4LF7I 1NHHA 2NN6F 5KL6A 1Z1BA 1N34I 1XMQI 2WBSA 4JI2I 4B3ME 2NUFA 4LF5I 4DV0E 2E72A 2EN4A 4X65E 5A2QQ 3EPLA 3DF6A 2ZBKB 4R8OA 4BCAA 1UN6B 2RQLA 4DU7A 4WUBA 1X5WA 2K4VA 4DV6E 5DRPA 4IFDC 2Z5BB 5JEAD 4JI3I 4DR2I 2YTNA 4ZYGA 4BS9A 3B82A 5DROA 3WU4A 2J65A 4RPFA 2UXBE 2WBTA 3PYDA 2LTRA 4NXMI 4AIMA 4OX9E 2A25A 3FIGA 3P3EA 1GQEA 2RS7A 3DJWA 3VK6A 3K1JA 3K6QA 4EMDA 2JY9A 2Z5EA 1T4NA 5A6BA 5F3WA 4N4RB 2EPZA 2V2ZA 3CDJA 3J80C 3ZKDA 3BGHA 2EMAA 1Y4SA 2N8XA 4DV4E 4PRXA 2ZM6I 1T4LB 4JYAE 1Z5CA 1X6EA 4LTYA 3JAMC 2BV3A 4TUIA 4LF9E 1TF6A 2Z5CA 4WFTA 4OOGC 2B7VA 2DMYA 4BA2A 3ZZ0A 4DR6I 4M2ZA 5C0XE 3T1HE 2V2QA 4IZJA 1XNQE 4WXDA 4B3SI 3BBGA 2L8TA 2BR2A 2LRSA 3VYXA 2CSHA 1H7UA 4OO1D 4YY3E 2EPRA 2VF1A 3EPKA 2RS6A 2KHXA 3D4JA 1USUA 1UEKA 2XEXA 3KWRA 4P7AA 5K36F 2HGHA 1XMOI 4GKKI 3M85G 2NN6D 1HNWI 2M1SA 4X62I 1WHNA 2UXDE 4HACA 2EOIA 4K0KE 4DU8A 4AQYE 3V5RA 4N3OA 2EM3A 5LMNI 4DKKA 1XXEA 4JI7I 5A2QC 4J3DA 4DV3E 3C6KA 4DR5I 2V83A 3IWBA 1ELOA 1H73A 1ZXMA 3ZZUA 2LE2A 3QT7A 1PIEA 4JI8I 4HXZA 3L7ZA 4DV7E 1QZRA 1YYKA 2IOPA 4GQUA 4DV5E 2L33A 5JEAE 2O1TA 2IHR1 3B4TA 3NZKA 2ZITA 2JEAB 1N36E 3EPJA 2N3GA 4B3TI 1PDAA 2MKNA 2EPCA 5A6AA 4WPYA 5K36E 4GKJI 1KTVA 3L00A 3RMPA 3AUZA 1P42A 5A6BD 5GMDA 4LF6I 2NA2A 1FWKA 3BIDA 2UXCE 1UDNA 2L3CA 4R2PA 4XTJA 4Q35B 1ZAAC 5C0XB 3T1YI 2ODRC 4AM3A 1IBMI 4JI1I 2EORA 2YT4A 4ZYHA 4FW5A 2J7KA 1PVGA 4UT4A 1HNXI 4IFDD 4JI5I 4DR4E 2BM0A 4OZEA 4PRVA 4X9JA 3V2UC 1YSAC 1X49A 1NEIA 1Y6ZA 2V8PA 3P3CA 1ZBTA 4P78A 2GQ0A 2EPAA 1P47A 4IS1C 1N0UA 5BR8E 2EN8A 3OMLA 1XHKA 4WUDA 1A1HA 3M85D 1KIJA 2O1VA 4PU9A 2PNZA 3M99B 1HR0I 3MHHC 4OO1E 2YZTA 2C38B 1X47A 4KHPE 4M1KA 5ELWA 2G7HA 1IBKE 1FWLA 2EPPA 5KL5A 4LCFA 3ECRA 1Y5YA 2DB2A 4DXLA 2EM8A 1B63A 4X66I 2UUAE 2EPOA 2F4VE 2V89A 1E3PA 1HNZI 4M30A 3JU0A 2CVEA 2EL4A 4LF8I 4LF4I 2DEJA 4BC9A 2V8QB 2HHHE 4LF7E 3QT6A 1EH6A 3QT5A 4DPYA 3U1YA 3PYFA 2EN3A 2BA0G 1N3GA 1IQOA 2EN7A 3WU3A 5K36B 2LMZA 2YU8A 1N34E 1XMQE 4JI2E 4LF5E 1FKAE 1OYRA 4JI4I 2PO0B 4BA1B 2IOQA 2JP9A 4GEQB 3M7NG 2NN6A 2YTIA 4P52A 1OYPA 3AV0A 2Z5BA 1IBLI 4KWYA 2LTSA 4LFBI 2CTDA 1FJGI 2EOJA 1ZR9A 2EM6A 2LJUA 1WJPA 2L2MA 1YUJA 2M4IA 4DR2E 4JI3E 4DUYI 4MU3A 5IWAI 1SR9A 2EMCA 2CZ9A 2BM1A 5DRRA 2EMGA 3F6HA 1A1FA 2JVAA 2R76A 3HQ1A 1Z0WA 2HKEA 4DPUA 3ZM7A 4DUZE 4JI6I 1SFEA 1H74A 3F0NA 2M7QA 3TQMA 4X64I 1ZM4A 2HJJA 4DPTA 4MLQA 4IFDE 4DR7E 1DGCA 4DPWA 2IERA 2VQEI 2F8BA 4O24A 2JR1A 3OTOI 1EH7A 4B3MI 2NUGA 4BBYA 5A69A 1Z0TA 5KL7A 1A1LA 2DGCA 3Q6MA 2YTEA 2DLQA 3KZZA 2PO2B 4NBQA 2LJPA 3BF2A 5FWKA 1DARA 4DR6E 3GLLA 4MU0A 1IMUA 4FWDA 2EN1A 4IJDA 3ZOQB 2V2VA 3ZKBA 2N3HA 1Z5AA 3PS2A 2EOFA 1H72C 4B3SE 4DPXA 1F2IG 3ADIA 3PS1A 4JV5I 2L92A 1MX0A 2E5LI 2C37A 5TSEA 2ODRD 4R2RA 4ZVIA 4IFDA 5AC4A 1WRJA 1T38A 2E1MA 3QG5C 2EMKA 2PRTA 3C6MA 2VQFI 4OX9I 2EMIA 1ZM2A 2MKDA 2X36A 3J7AM 4B3RE 2JE6B 2EOHA 3M7ND 2R3VA 1N33I 1T4OA 1XMOE 4GKKE 2GO3A 3UHMA 1HNWE 2EN2A 4R2DA 1TN9A 4RH8A 4X62E 5C0XC 2EMHA 1QU6A 2DMIA 2FV4B 3ADGA 4FK5C 2YTQA 2ELYA 1WXRA 5LMNE 5LMUE 4JI7E 1MG7A 4FWHA 2ENCA 5AE2A 4JG4A 4ED4A 3VHTB 4DR5E 2Q2EB 2EPKX 1Z0GA 4LFCI 1Z59A 2Q8UA 2J7JA 2UUBE 4LF9I 2JOBA 1UBDC 4JI8E 2MDGA 1A6FA 1EA6A 3K85A 2I9IA 4DV2I 1G2DC 2EOXA 2L2NA 2EM7A 4IZJB 4M9VC 4MLVA 1J5EI 2B7TA 2HC5A 4YHHI 2PO1B 4B3TE 2EMLA 4GKJE 2EMWA 5C0XF 1S16A 4JI0I 4LF6E 3QT8A 2EJ4A 3B8HA 1X48A 2YTFA 4R2CA 4R2SA 3DD6A 2BBGA 4I3HA 1Z0VA 5JEAC 3T1YE 3H09A 3PRYA 3WU6A 4R03A 1IBME 1UHZA 4K0KI 4JI1E 2DRPA 4HACB 5IXMB 2EOOA 4JI5E 2EQ3A 3HTXA 5K36C 1A1JA 2VESA 3ZZTA 2EPLX 1PKPA 3H1CA 4BC7A 2MDRA 1TF3A 1Z5BA 3KRNA 3ADLA 5A6JA 2OI2A 3J7Yp 2JEBA 2JWOA 4HY1A 4DR1I 1KJKA 1HR0E 1RR9A 3L7ZB 5KL4A 1X6HA 3P06A 4BHBA
chains in the Genus database with same CATH topology
1Z0CA 4URLA 1XNRI 1NZ0A 4MYUA 4X66E 1O0WA 2EZ6A 1ZBQA 1HNZE 2B9DA 2V87A 2LJHA 3C4BA 3H4LA 5T6JA 2HKJA 1RQ0A 4LFAE 4LF8E 1YZ9A 4LU9A 1EKZA 4LF4E 1Y4UA 4IZKA 2A2DA 2NUEA 1WUUA 3LTOA 4DV1I 5LL6R 1I94E 1H7SA 2UU9I 2UUCI 4JI4E 5BR8I 3WU5A 2A2CA 1BKNA 1YYOA 1IBLE 4LFBE 1FJGE 5CFFE 4TUGA 3IWDA 4DUYE 4FW9A 5IWAE 5DNYA 3LLHA 2R42A 2WZOA 4JI6E 5IT9Q 4X64E 4NXME 2V88A 2V34A 3C4TA 2MC5A 4NXNI 4BMJA 1N32I 4USMA 4DR3I 2VQEE 3HXLA 2MC6A 1B62A 5FLXQ 3OTOE 5L3JA 5AASA 2LUPB 2L2KB 4FN5A 3HPZA 1ZM9A 1DQ3A 4Z7YA 2ZM6E 4DV0I 4J8ZA 1VISA 4X65I 4Z7CA 4F54A 2KONA 2H36X 4JV5E 3P1XA 1UILA 2E5LE 1USVA 3GONA 4R1FA 4UTGA 3Q1QA 4DV6I 4Q28A 1NHIA 5ADZA 2VQFE 4DUZI 2UXBI 2LBSB 1N33E 3PYGA 3B78A 1WHQA 5AE3A 2CGEA 4DR7I 1MU5A 2AJ4A 2O1WA 2B3TB 2E1RA 4DMIA 1YYWA 1FI4A 4F9CB 1ZXNA 1DI2A 4KZSA 4LFCE 2LUQA 3ADJA 4DV4I 4DV2E 1N0VC 4JYAI 1KKHA 1J5EE 5AE1A 2Z5CB 2V85A 3T1HI 4YHHE 1XNQI 1NHJA 5IT9C 3IWCA 3LNUA 4JI0E 3K17A 4YY3I 3LMLA 1ZM3A 4B3RI 2PNLA 2KOUA 3M6AA 2HFSA 3VYYA 5FLXC 1KVKA 2EWLA 3PYEA 2FTXB 5LMUI 4I8OA 2UXDI 2DEIA 4FWGA 4AQYI 1S4EA 2DIXA 1HNXE 4DV3I 4L5NC 3J81Q 2UUBI 1D6TA 2JOXA 2CG9A 1OJ4A 4DR1E 4L8NA 4WSPA 4DV7I 4KQVA 2GS8A 1XNRE 4DV5I 2O1UA 3MSWA 1K47A 1N36I 5GMEA 1Z0EA 2FGGA 4F9AB 3HJCA 1HK7A 1RREA 2X7IA 4WUCA 2UXCI 2HK2A 1EI1A 4X8WA 2RSMA 2HK3A 2L6MA 4M0VA 3F6GA 4DV1E 2VE7C 3Q6NA 4IZJD 2RTXA 1RC7A 2UU9E 2UUCE 4DR4I 2PNMA 2L3JA 2EFGA 2V86A 2DSYA 2NPFA 4USKA 1GZ6A 2VF3A 3J80Q 3HULA 4HYMA 1Z0BA 2CPNA 4WYQB 3HPSA 3LPSA 3JAMQ 4KHPI 2HFUA 3J7AG 1FNMA 1IBKI 1STUA 3CWVA 4P7DA 1U2RA 1J26A 2WW4A 2UUAI 4F9BB 2F4VI 4LFAI 3JTZA 4NXNE 1N32E 3J81C 4IZKB 4DR3E 1I94I 2HHHI 4LF7I 1NHHA 1N34I 1XMQI 4JI2I 4B3ME 2NUFA 4LF5I 4DV0E 4X65E 5A2QQ 3DF6A 2ZBKB 4R8OA 4BCAA 4DU7A 4WUBA 4DV6E 2K4VA 2Z5BB 4JI3I 4DR2I 4BS9A 3B82A 3WU4A 4RPFA 2UXBE 3PYDA 2LTRA 4NXMI 4OX9E 3FIGA 1GQEA 2RS7A 3VK6A 3DJWA 3K1JA 3K6QA 4EMDA 2JY9A 2Z5EA 1T4NA 5F3WA 2V2ZA 3J80C 3ZKDA 1Y4SA 4DV4E 4PRXA 2ZM6I 1T4LB 4JYAE 1Z5CA 4LTYA 3JAMC 2BV3A 4TUIA 4LF9E 2Z5CA 4WFTA 4OOGC 2B7VA 2DMYA 4DR6I 3ZZ0A 4M2ZA 3T1HE 2V2QA 4IZJA 1XNQE 4B3SI 2L8TA 2LRSA 3VYXA 1H7UA 4YY3E 2VF1A 2RS6A 2KHXA 3D4JA 1USUA 1UEKA 2XEXA 3KWRA 4P7AA 1XMOI 4GKKI 1HNWI 2M1SA 4X62I 1WHNA 2UXDE 4HACA 4K0KE 4DU8A 4AQYE 3V5RA 4N3OA 5LMNI 4DKKA 4JI7I 5A2QC 4DV3E 4DR5I 2V83A 3IWBA 1ELOA 1H73A 1ZXMA 3ZZUA 2LE2A 3QT7A 1PIEA 4JI8I 4HXZA 4DV7E 1QZRA 1YYKA 2IOPA 4DV5E 2L33A 2O1TA 2IHR1 2ZITA 1N36E 2N3GA 4B3TI 4WPYA 4GKJI 1KTVA 3RMPA 3AUZA 5GMDA 4LF6I 2NA2A 1FWKA 2UXCE 2L3CA 4XTJA 3T1YI 2ODRC 1IBMI 4JI1I 2YT4A 2J7KA 1PVGA 4UT4A 1HNXI 4JI5I 4DR4E 2BM0A 4PRVA 3V2UC 1X49A 1Y6ZA 2V8PA 1ZBTA 4P78A 2GQ0A 1N0UA 5BR8E 3OMLA 1XHKA 4WUDA 1HR0I 1KIJA 2O1VA 4PU9A 2YZTA 1X47A 4KHPE 4M1KA 2G7HA 1IBKE 1FWLA 2DB2A 4DXLA 1B63A 4X66I 2UUAE 2F4VE 2V89A 1HNZI 4M30A 3JU0A 4LF8I 4LF4I 2DEJA 4BC9A 2V8QB 2HHHE 4LF7E 3QT6A 3QT5A 4DPYA 3PYFA 3WU3A 2LMZA 1N34E 1XMQE 4JI2E 4LF5E 1FKAE 4JI4I 2IOQA 4GEQB 4P52A 3AV0A 2Z5BA 1IBLI 4LFBI 2LTSA 1FJGI 4MYTA 2L2MA 4JI3E 2M4IA 4DR2E 4DUYI 5IWAI 1SR9A 2CZ9A 2BM1A 3F6HA 2JVAA 3HQ1A 1Z0WA 2HKEA 4DPUA 3ZM7A 4DUZE 4JI6I 1H74A 3F0NA 2M7QA 4X64I 1ZM4A 4DPTA 4DR7E 4DPWA 2VQEI 2F8BA 2JR1A 3OTOI 4B3MI 2NUGA 4BBYA 1Z0TA 3Q6MA 2LJPA 5FWKA 1DARA 4DR6E 4FWDA 3ZOQB 2V2VA 3ZKBA 2N3HA 1Z5AA 1H72C 4B3SE 4DPXA 3ADIA 4JV5I 2L92A 1MX0A 2E5LI 2ODRD 4ZVIA 2E1MA 2VQFI 4OX9I 1ZM2A 1N33I 2X36A 3J7AM 4B3RE 2R3VA 1T4OA 1XMOE 4GKKE 1HNWE 4X62E 1QU6A 2FV4B 3ADGA 1WXRA 5LMNE 5LMUE 1MG7A 4JI7E 4FWHA 5AE2A 4JG4A 4ED4A 4DR5E 2Q2EB 1Z0GA 4LFCI 1Z59A 2UUBE 4LF9I 2JOBA 4JI8E 1A6FA 1EA6A 4DV2I 3K85A 2L2NA 4IZJB 1J5EI 2B7TA 4YHHI 4B3TE 4GKJE 1S16A 4JI0I 4LF6E 3QT8A 3B8HA 1X48A 4I3HA 1Z0VA 3T1YE 3H09A 3PRYA 3WU6A 4R03A 1IBME 1UHZA 4K0KI 4JI1E 4HACB 4JI5E 3HTXA 3ZZTA 1PKPA 4BC7A 2MDRA 1Z5BA 3ADLA 2OI2A 3J7Yp 2JWOA 4HY1A 4DR1I 1HR0E 1RR9A 3P06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0C A;  4URL A;  1XNR I;  1NZ0 A;  4MYU A;  4X66 E;  1O0W A;  2EZ6 A;  1HNZ E;  2LJH A;  3C4B A;  3H4L A;  2HKJ A;  1RQ0 A;  4LFA E;  4LF8 E;  1YZ9 A;  1EKZ A;  4LF4 E;  2A2D A;  2NUE A;  1WUU A;  3LTO A;  4DV1 I;  5LL6 R;  1I94 E;  1H7S A;  2UU9 I;  2UUC I;  4JI4 E;  5BR8 I;  3WU5 A;  2A2C A;  1BKN A;  1YYO A;  1IBL E;  4LFB E;  1FJG E;  5CFF E;  4DUY E;  4FW9 A;  5IWA E;  3LLH A;  2R42 A;  4JI6 E;  5IT9 Q;  4X64 E;  4NXM E;  2V34 A;  3C4T A;  4NXN I;  1N32 I;  4USM A;  4DR3 I;  2VQE E;  1B62 A;  5FLX Q;  3OTO E;  5L3J A;  2LUP B;  2L2K B;  4FN5 A;  1ZM9 A;  4Z7Y A;  2ZM6 E;  4DV0 I;  1VIS A;  4X65 I;  4Z7C A;  4JV5 E;  3P1X A;  1UIL A;  2E5L E;  3GON A;  4UTG A;  4R1F A;  3Q1Q A;  4DV6 I;  1NHI A;  2VQF E;  4DUZ I;  2UXB I;  2LBS B;  1N33 E;  3PYG A;  3B78 A;  1WHQ A;  4DR7 I;  1MU5 A;  2AJ4 A;  2B3T B;  2E1R A;  1YYW A;  1FI4 A;  1ZXN A;  1DI2 A;  4LFC E;  2LUQ A;  3ADJ A;  4DV4 I;  4DV2 E;  1N0V C;  4JYA I;  1KKH A;  1J5E E;  3T1H I;  4YHH E;  1XNQ I;  1NHJ A;  5IT9 C;  3LNU A;  4JI0 E;  3K17 A;  4YY3 I;  1ZM3 A;  4B3R I;  3M6A A;  2HFS A;  3VYY A;  5FLX C;  1KVK A;  3PYE A;  5LMU I;  2UXD I;  2DEI A;  4FWG A;  4AQY I;  1S4E A;  2DIX A;  1HNX E;  4DV3 I;  3J81 Q;  1D6T A;  2UUB I;  1OJ4 A;  4DR1 E;  4DV7 I;  4KQV A;  2GS8 A;  1XNR E;  4DV5 I;  1K47 A;  1N36 I;  5GME A;  1Z0E A;  1RRE A;  2X7I A;  4WUC A;  2UXC I;  2HK2 A;  1EI1 A;  4X8W A;  2RSM A;  2HK3 A;  4DV1 E;  2RTX A;  1RC7 A;  2UU9 E;  2UUC E;  4DR4 I;  2L3J A;  2EFG A;  2NPF A;  4USK A;  2VF3 A;  3J80 Q;  3HUL A;  4HYM A;  1Z0B A;  2CPN A;  4WYQ B;  3LPS A;  3JAM Q;  4KHP I;  2HFU A;  3J7A G;  1FNM A;  1IBK I;  1STU A;  3CWV A;  1U2R A;  1J26 A;  2WW4 A;  2UUA I;  2F4V I;  4LFA I;  4NXN E;  1N32 E;  3J81 C;  4DR3 E;  1I94 I;  2HHH I;  4LF7 I;  1NHH A;  1N34 I;  1XMQ I;  4JI2 I;  4B3M E;  2NUF A;  4LF5 I;  4DV0 E;  4X65 E;  5A2Q Q;  2ZBK B;  4DU7 A;  4WUB A;  4DV6 E;  4JI3 I;  4DR2 I;  3B82 A;  3WU4 A;  4RPF A;  2UXB E;  3PYD A;  2LTR A;  4NXM I;  4OX9 E;  1GQE A;  2RS7 A;  3K1J A;  4EMD A;  2JY9 A;  1T4N A;  2V2Z A;  3J80 C;  3ZKD A;  4DV4 E;  4PRX A;  2ZM6 I;  1T4L B;  4JYA E;  1Z5C A;  3JAM C;  2BV3 A;  4LF9 E;  4WFT A;  4OOG C;  2B7V A;  2DMY A;  4DR6 I;  3ZZ0 A;  4M2Z A;  3T1H E;  2V2Q A;  1XNQ E;  4B3S I;  2LRS A;  3VYX A;  1H7U A;  4YY3 E;  2RS6 A;  2KHX A;  3D4J A;  1UEK A;  2XEX A;  4P7A A;  1XMO I;  4GKK I;  1HNW I;  4X62 I;  1WHN A;  2UXD E;  4HAC A;  4K0K E;  4DU8 A;  4AQY E;  3V5R A;  5LMN I;  4DKK A;  4JI7 I;  5A2Q C;  4DV3 E;  4DR5 I;  3ZZU A;  1ELO A;  1H73 A;  1ZXM A;  3QT7 A;  1PIE A;  4JI8 I;  4HXZ A;  4DV7 E;  1QZR A;  1YYK A;  4DV5 E;  2L33 A;  2IHR 1;  2ZIT A;  1N36 E;  2N3G A;  4B3T I;  4GKJ I;  1KTV A;  5GMD A;  4LF6 I;  2NA2 A;  1FWK A;  2UXC E;  2L3C A;  4XTJ A;  3T1Y I;  1IBM I;  4JI1 I;  2YT4 A;  2J7K A;  1PVG A;  4UT4 A;  1HNX I;  4JI5 I;  4DR4 E;  2BM0 A;  4PRV A;  3V2U C;  1X49 A;  2V8P A;  1ZBT A;  1N0U A;  5BR8 E;  1XHK A;  4WUD A;  1HR0 I;  1KIJ A;  4PU9 A;  1X47 A;  4KHP E;  4M1K A;  1FWL A;  1IBK E;  2DB2 A;  4DXL A;  1B63 A;  4X66 I;  2UUA E;  2F4V E;  1HNZ I;  4M30 A;  4LF8 I;  4LF4 I;  2DEJ A;  2HHH E;  4LF7 E;  3QT6 A;  3QT5 A;  4DPY A;  3PYF A;  3WU3 A;  1N34 E;  1XMQ E;  4JI2 E;  4LF5 E;  1FKA E;  4JI4 I;  4P52 A;  1IBL I;  4LFB I;  2LTS A;  1FJG I;  4MYT A;  2L2M A;  4JI3 E;  4DR2 E;  4DUY I;  5IWA I;  2CZ9 A;  2BM1 A;  2JVA A;  1Z0W A;  2HKE A;  4DPU A;  3ZM7 A;  4DUZ E;  4JI6 I;  1H74 A;  3F0N A;  4X64 I;  1ZM4 A;  4DPT A;  4DR7 E;  4DPW A;  2VQE I;  3OTO I;  4B3M I;  2NUG A;  1Z0T A;  2LJP A;  1DAR A;  4DR6 E;  4FWD A;  2V2V A;  3ZKB A;  2N3H A;  1Z5A A;  1H72 C;  4B3S E;  4DPX A;  3ADI A;  4JV5 I;  1MX0 A;  2E5L I;  4ZVI A;  2VQF I;  4OX9 I;  1ZM2 A;  1N33 I;  2X36 A;  3J7A M;  4B3R E;  2R3V A;  1T4O A;  1XMO E;  4GKK E;  1HNW E;  4X62 E;  1QU6 A;  3ADG A;  5LMN E;  1MG7 A;  5LMU E;  4JI7 E;  4FWH A;  4JG4 A;  4ED4 A;  4DR5 E;  2Q2E B;  1Z0G A;  4LFC I;  1Z59 A;  2UUB E;  4LF9 I;  4JI8 E;  1A6F A;  1EA6 A;  4DV2 I;  2L2N A;  1J5E I;  2B7T A;  4YHH I;  4B3T E;  4GKJ E;  1S16 A;  4JI0 I;  4LF6 E;  3QT8 A;  3B8H A;  1X48 A;  4I3H A;  1Z0V A;  3T1Y E;  3WU6 A;  1IBM E;  1UHZ A;  4K0K I;  4JI1 E;  4HAC B;  4JI5 E;  3HTX A;  3ZZT A;  1PKP A;  2MDR A;  1Z5B A;  3ADL A;  2OI2 A;  3J7Y p;  4HY1 A;  4DR1 I;  1HR0 E;  1RR9 A; 
#chains in the Genus database with same CATH topology
 1Z0C A;  4MQY A;  4IS9 A;  4URL A;  4R2A A;  1XNR I;  1MEY C;  1NZ0 A;  4MYU A;  4O5G A;  2WNR A;  4U3D A;  4X66 E;  2YTG A;  5JEA F;  1BBO A;  1O0W A;  2EZ6 A;  1ZBQ A;  1HNZ E;  2B9D A;  2V87 A;  2LJH A;  4FW6 A;  3C4B A;  3H4L A;  2EQ1 A;  5T6J A;  1MGT A;  1Y60 A;  1RQ0 A;  2GPI A;  2HKJ A;  4LFA E;  4LF8 E;  1YZ9 A;  4LU9 A;  1EKZ A;  4LF4 E;  2NN6 E;  1Y4U A;  4IZK A;  2A2D A;  2WBU A;  2YRH A;  2NUE A;  1WUU A;  3LTO A;  5JEA B;  4FW3 A;  4DV1 I;  5LL6 R;  1I94 E;  4NHR A;  1H7S A;  1RHY A;  1T39 A;  2UU9 I;  2UUC I;  4JI4 E;  2GO4 A;  2WP8 B;  5AC5 A;  2JPA A;  2YRK A;  5BR8 I;  4WX9 A;  2ENA A;  4O43 A;  3WU5 A;  2A2C A;  1BKN A;  2YRM A;  4OKG A;  4NZV A;  1YYO A;  2BB8 A;  2JYA A;  1IBL E;  1EH8 A;  4LFB E;  1FJG E;  1VI7 A;  5C0X D;  5CFF E;  4TUG A;  3IWD A;  4DUY E;  1A1G A;  4FW9 A;  5IWA E;  4HTG A;  5DNY A;  3LLH A;  2EPX A;  4MDT A;  2EOE A;  2R42 A;  2YPN A;  2WZO A;  4OO1 F;  2YTJ A;  2EPN A;  2ADR A;  4JI6 E;  4WSG A;  4BHC A;  5IT9 Q;  2EMZ A;  4X64 E;  4NXM E;  4FW7 A;  2V88 A;  1JK2 A;  2C39 B;  2V34 A;  4QNJ A;  3C4T A;  3CDI A;  4F2J C;  2BA0 D;  2MC5 A;  2F1D A;  4BMJ A;  4NXN I;  1N32 I;  4USM A;  4DR3 I;  2VQE E;  3HXL A;  2JXP A;  4OO1 B;  2MC6 A;  1B62 A;  2GLI A;  2CT1 A;  5FLX Q;  3OTO E;  2EPM X;  5L3J A;  5AAS A;  2PO2 A;  2LUP B;  2L2K B;  1A1I A;  1PJQ A;  1G2F C;  2AE8 A;  1OYS A;  1JK1 A;  4U3B A;  4FN5 A;  3HPZ A;  1L4S A;  1ZM9 A;  1DQ3 A;  3KZY A;  2EOS A;  4Z7Y A;  2YSO A;  3THN A;  2ZM6 E;  4DV0 I;  4J8Z A;  1VIS A;  4X65 I;  2NN6 B;  4Z7C A;  4F54 A;  1AAY A;  4ISA A;  2KON A;  2H36 X;  4JV5 E;  3P1X A;  1UIL A;  2E5L E;  1USV A;  3GON A;  4R1F A;  2EMX A;  4UTG A;  2WCC 3;  4DV6 I;  3Q1Q A;  2NAB A;  1R6M A;  4Q28 A;  2IES A;  1NHI A;  2LCE A;  1AH5 A;  2EL5 A;  3GME A;  5K36 D;  2JE6 A;  5ADZ A;  2EL6 A;  2VQF E;  1YFH A;  4DUZ I;  2UXB I;  2LBS B;  1N33 E;  3PYG A;  2EOZ A;  3B78 A;  1WHQ A;  5AE3 A;  2CGE A;  3EPH A;  3GCM A;  4DR7 I;  5KL3 A;  1MU5 A;  2AJ4 A;  3MHS C;  2YTO A;  2B3T B;  2E1R A;  4RHB B;  2O1W A;  4DMI A;  2EMY A;  1YYW A;  2EMB A;  4F9C B;  1FI4 A;  2GHF A;  1DI2 A;  1ZXN A;  1PJT A;  4MYT A;  4KZS A;  4LFC E;  1PJS A;  2LUQ A;  4IFD F;  1ZU1 A;  3ADJ A;  4F6N A;  2EOY A;  4DV4 I;  1E3H A;  2RSI A;  4DV2 E;  1N0V C;  4JYA I;  2LO3 A;  1BB8 A;  1GTK A;  1UDS A;  2VRD A;  1KKH A;  4LOM A;  2PO1 A;  4R2E A;  1J5E E;  5AE1 A;  2Z5C B;  2V85 A;  1UDQ A;  4YHH E;  3T1H I;  1XNQ I;  2JEA A;  4BA2 B;  2C37 B;  3HKM A;  1NHJ A;  4IFD B;  5IT9 C;  2ENH A;  2M9A A;  3IWC A;  3LNU A;  4JI0 E;  4FW4 A;  2BR2 B;  2EOM A;  3K17 A;  4YY3 I;  3EQ1 A;  3LML A;  1YHC A;  1ZM3 A;  1BBG A;  2I13 A;  4B3R I;  1A1K A;  2PNL A;  2EQ0 A;  2KOU A;  3M6A A;  2HFS A;  3VYY A;  5C0X A;  5FLX C;  1KVK A;  2EM0 A;  2EWL A;  3PYE A;  2RPC A;  2FTX B;  5LMU I;  2D9H A;  3U1K A;  4I8O A;  2UXD I;  2DEI A;  2EP3 A;  4FWG A;  1X3C A;  3P3G A;  4AQY I;  2EM4 A;  4O4K A;  4ZYD A;  1S4E A;  2DIX A;  1HNX E;  4DV3 I;  4L5N C;  3J81 Q;  2UUB I;  1D6T A;  3UK3 C;  2JOX A;  4LCG A;  2CG9 A;  1OJ4 A;  4DR1 E;  4L8N A;  1LLM C;  2YSP A;  2BA1 G;  4WSP A;  4DV7 I;  4KQV A;  5DNL A;  2GS8 A;  1XNR E;  2EOQ A;  2C38 A;  4DV5 I;  4GZN C;  2O1U A;  3MSW A;  1YPN A;  1K47 A;  1N36 I;  4LPF A;  1B69 A;  5LLQ A;  5GME A;  2YWQ A;  1Z0E A;  2EPU A;  2FGG A;  4F9A B;  3HJC A;  1HK7 A;  2YTD A;  1RRE A;  2X7I A;  4WUC A;  1IQS A;  4AID A;  2UXC I;  2HK2 A;  1EI1 A;  4X8W A;  2R1F A;  5JEA A;  2RSM A;  4WXC A;  2HK3 A;  2L6M A;  4M0V A;  2K7I A;  1KYQ A;  3F6G A;  4DV1 E;  1NCS A;  2VE7 C;  5IV8 B;  5A6K A;  3Q6N A;  4OO1 C;  4IZJ D;  2RTX A;  2WP8 A;  5K36 A;  1YH8 A;  2JT2 A;  1RC7 A;  2UU9 E;  2UUC E;  2O3Z A;  3P76 A;  1X6F A;  2EM9 A;  2L3J A;  2LT7 A;  2PNM A;  5EL9 A;  2EFG A;  4DR4 I;  2YU5 A;  2PO0 A;  2V86 A;  2DSY A;  4ZYE A;  4LCH A;  4BA1 A;  4QNK A;  2NPF A;  3THO B;  4USK A;  2JEB B;  1GZ6 A;  4R2Q A;  2NN6 C;  2VF3 A;  5DRQ A;  3J80 Q;  3HUL A;  4HEI A;  2EM5 A;  1UDO A;  1Z0B A;  4HYM A;  4MU4 A;  2CPN A;  5DNX A;  4WYQ B;  3HPS A;  4F6M A;  2YTP A;  3LPS A;  1R6L A;  3JAM Q;  2PNZ B;  2HFU A;  4KHP I;  3J7A G;  2WNR B;  3PS3 A;  1FNM A;  1IBK I;  4MU1 A;  1STU A;  3CWV A;  4P7D A;  1U2R A;  2DLK A;  5KL2 A;  1J26 A;  2EMF A;  2C39 A;  2LV2 A;  2WW4 A;  2UUA I;  2EE8 A;  4F9B B;  2F4V I;  4LFA I;  1QNT A;  3JTZ A;  2EM2 A;  2BA1 D;  2LVH A;  1YUI A;  4OO1 A;  4NXN E;  1N32 E;  3J81 C;  4IZK B;  4DR3 E;  1I94 I;  2EN6 A;  5EKW A;  1RMD A;  2ELZ A;  2HHH I;  4LF7 I;  1NHH A;  2NN6 F;  5KL6 A;  1Z1B A;  1N34 I;  1XMQ I;  2WBS A;  4JI2 I;  4B3M E;  2NUF A;  4LF5 I;  4DV0 E;  2E72 A;  2EN4 A;  4X65 E;  5A2Q Q;  3EPL A;  3DF6 A;  2ZBK B;  4R8O A;  4BCA A;  1UN6 B;  2RQL A;  4DU7 A;  4WUB A;  1X5W A;  2K4V A;  4DV6 E;  5DRP A;  4IFD C;  2Z5B B;  5JEA D;  4JI3 I;  4DR2 I;  2YTN A;  4ZYG A;  4BS9 A;  3B82 A;  5DRO A;  3WU4 A;  2J65 A;  4RPF A;  2UXB E;  2WBT A;  3PYD A;  2LTR A;  4NXM I;  4AIM A;  4OX9 E;  2A25 A;  3FIG A;  3P3E A;  1GQE A;  2RS7 A;  3DJW A;  3VK6 A;  3K1J A;  3K6Q A;  4EMD A;  2JY9 A;  2Z5E A;  1T4N A;  5A6B A;  5F3W A;  4N4R B;  2EPZ A;  2V2Z A;  3CDJ A;  3J80 C;  3ZKD A;  3BGH A;  2EMA A;  1Y4S A;  2N8X A;  4DV4 E;  4PRX A;  2ZM6 I;  1T4L B;  4JYA E;  1Z5C A;  1X6E A;  4LTY A;  3JAM C;  2BV3 A;  4TUI A;  4LF9 E;  1TF6 A;  2Z5C A;  4WFT A;  4OOG C;  2B7V A;  2DMY A;  4BA2 A;  3ZZ0 A;  4DR6 I;  4M2Z A;  5C0X E;  3T1H E;  2V2Q A;  4IZJ A;  1XNQ E;  4WXD A;  4B3S I;  3BBG A;  2L8T A;  2BR2 A;  2LRS A;  3VYX A;  2CSH A;  1H7U A;  4OO1 D;  4YY3 E;  2EPR A;  2VF1 A;  3EPK A;  2RS6 A;  2KHX A;  3D4J A;  1USU A;  1UEK A;  2XEX A;  3KWR A;  4P7A A;  5K36 F;  2HGH A;  1XMO I;  4GKK I;  3M85 G;  2NN6 D;  1HNW I;  2M1S A;  4X62 I;  1WHN A;  2UXD E;  4HAC A;  2EOI A;  4K0K E;  4DU8 A;  4AQY E;  3V5R A;  4N3O A;  2EM3 A;  5LMN I;  4DKK A;  1XXE A;  4JI7 I;  5A2Q C;  4J3D A;  4DV3 E;  3C6K A;  4DR5 I;  2V83 A;  3IWB A;  1ELO A;  1H73 A;  1ZXM A;  3ZZU A;  2LE2 A;  3QT7 A;  1PIE A;  4JI8 I;  4HXZ A;  3L7Z A;  4DV7 E;  1QZR A;  1YYK A;  2IOP A;  4GQU A;  4DV5 E;  2L33 A;  5JEA E;  2O1T A;  2IHR 1;  3B4T A;  3NZK A;  2ZIT A;  2JEA B;  1N36 E;  3EPJ A;  2N3G A;  4B3T I;  1PDA A;  2MKN A;  2EPC A;  5A6A A;  4WPY A;  5K36 E;  4GKJ I;  1KTV A;  3L00 A;  3RMP A;  3AUZ A;  1P42 A;  5A6B D;  5GMD A;  4LF6 I;  2NA2 A;  1FWK A;  3BID A;  2UXC E;  1UDN A;  2L3C A;  4R2P A;  4XTJ A;  4Q35 B;  1ZAA C;  5C0X B;  3T1Y I;  2ODR C;  4AM3 A;  1IBM I;  4JI1 I;  2EOR A;  2YT4 A;  4ZYH A;  4FW5 A;  2J7K A;  1PVG A;  4UT4 A;  1HNX I;  4IFD D;  4JI5 I;  4DR4 E;  2BM0 A;  4OZE A;  4PRV A;  4X9J A;  3V2U C;  1YSA C;  1X49 A;  1NEI A;  1Y6Z A;  2V8P A;  3P3C A;  1ZBT A;  4P78 A;  2GQ0 A;  2EPA A;  1P47 A;  4IS1 C;  1N0U A;  5BR8 E;  2EN8 A;  3OML A;  1XHK A;  4WUD A;  1A1H A;  3M85 D;  1KIJ A;  2O1V A;  4PU9 A;  2PNZ A;  3M99 B;  1HR0 I;  3MHH C;  4OO1 E;  2YZT A;  2C38 B;  1X47 A;  4KHP E;  4M1K A;  5ELW A;  2G7H A;  1IBK E;  1FWL A;  2EPP A;  5KL5 A;  4LCF A;  3ECR A;  1Y5Y A;  2DB2 A;  4DXL A;  2EM8 A;  1B63 A;  4X66 I;  2UUA E;  2EPO A;  2F4V E;  2V89 A;  1E3P A;  1HNZ I;  4M30 A;  3JU0 A;  2CVE A;  2EL4 A;  4LF8 I;  4LF4 I;  2DEJ A;  4BC9 A;  2V8Q B;  2HHH E;  4LF7 E;  3QT6 A;  1EH6 A;  3QT5 A;  4DPY A;  3U1Y A;  3PYF A;  2EN3 A;  2BA0 G;  1N3G A;  1IQO A;  2EN7 A;  3WU3 A;  5K36 B;  2LMZ A;  2YU8 A;  1N34 E;  1XMQ E;  4JI2 E;  4LF5 E;  1FKA E;  1OYR A;  4JI4 I;  2PO0 B;  4BA1 B;  2IOQ A;  2JP9 A;  4GEQ B;  3M7N G;  2NN6 A;  2YTI A;  4P52 A;  1OYP A;  3AV0 A;  2Z5B A;  1IBL I;  4KWY A;  2LTS A;  4LFB I;  2CTD A;  1FJG I;  2EOJ A;  1ZR9 A;  2EM6 A;  2LJU A;  1WJP A;  2L2M A;  1YUJ A;  2M4I A;  4DR2 E;  4JI3 E;  4DUY I;  4MU3 A;  5IWA I;  1SR9 A;  2EMC A;  2CZ9 A;  2BM1 A;  5DRR A;  2EMG A;  3F6H A;  1A1F A;  2JVA A;  2R76 A;  3HQ1 A;  1Z0W A;  2HKE A;  4DPU A;  3ZM7 A;  4DUZ E;  4JI6 I;  1SFE A;  1H74 A;  3F0N A;  2M7Q A;  3TQM A;  4X64 I;  1ZM4 A;  2HJJ A;  4DPT A;  4MLQ A;  4IFD E;  4DR7 E;  1DGC A;  4DPW A;  2IER A;  2VQE I;  2F8B A;  4O24 A;  2JR1 A;  3OTO I;  1EH7 A;  4B3M I;  2NUG A;  4BBY A;  5A69 A;  1Z0T A;  5KL7 A;  1A1L A;  2DGC A;  3Q6M A;  2YTE A;  2DLQ A;  3KZZ A;  2PO2 B;  4NBQ A;  2LJP A;  3BF2 A;  5FWK A;  1DAR A;  4DR6 E;  3GLL A;  4MU0 A;  1IMU A;  4FWD A;  2EN1 A;  4IJD A;  3ZOQ B;  2V2V A;  3ZKB A;  2N3H A;  1Z5A A;  3PS2 A;  2EOF A;  1H72 C;  4B3S E;  4DPX A;  1F2I G;  3ADI A;  3PS1 A;  4JV5 I;  2L92 A;  1MX0 A;  2E5L I;  2C37 A;  5TSE A;  2ODR D;  4R2R A;  4ZVI A;  4IFD A;  5AC4 A;  1WRJ A;  1T38 A;  2E1M A;  3QG5 C;  2EMK A;  2PRT A;  3C6M A;  2VQF I;  4OX9 I;  2EMI A;  1ZM2 A;  2MKD A;  2X36 A;  3J7A M;  4B3R E;  2JE6 B;  2EOH A;  3M7N D;  2R3V A;  1N33 I;  1T4O A;  1XMO E;  4GKK E;  2GO3 A;  3UHM A;  1HNW E;  2EN2 A;  4R2D A;  1TN9 A;  4RH8 A;  4X62 E;  5C0X C;  2EMH A;  1QU6 A;  2DMI A;  2FV4 B;  3ADG A;  4FK5 C;  2YTQ A;  2ELY A;  1WXR A;  5LMN E;  5LMU E;  4JI7 E;  1MG7 A;  4FWH A;  2ENC A;  5AE2 A;  4JG4 A;  4ED4 A;  3VHT B;  4DR5 E;  2Q2E B;  2EPK X;  1Z0G A;  4LFC I;  1Z59 A;  2Q8U A;  2J7J A;  2UUB E;  4LF9 I;  2JOB A;  1UBD C;  4JI8 E;  2MDG A;  1A6F A;  1EA6 A;  3K85 A;  2I9I A;  4DV2 I;  1G2D C;  2EOX A;  2L2N A;  2EM7 A;  4IZJ B;  4M9V C;  4MLV A;  1J5E I;  2B7T A;  2HC5 A;  4YHH I;  2PO1 B;  4B3T E;  2EML A;  4GKJ E;  2EMW A;  5C0X F;  1S16 A;  4JI0 I;  4LF6 E;  3QT8 A;  2EJ4 A;  3B8H A;  1X48 A;  2YTF A;  4R2C A;  4R2S A;  3DD6 A;  2BBG A;  4I3H A;  1Z0V A;  5JEA C;  3T1Y E;  3H09 A;  3PRY A;  3WU6 A;  4R03 A;  1IBM E;  1UHZ A;  4K0K I;  4JI1 E;  2DRP A;  4HAC B;  5IXM B;  2EOO A;  4JI5 E;  2EQ3 A;  3HTX A;  5K36 C;  1A1J A;  2VES A;  3ZZT A;  2EPL X;  1PKP A;  3H1C A;  4BC7 A;  2MDR A;  1TF3 A;  1Z5B A;  3KRN A;  3ADL A;  5A6J A;  2OI2 A;  3J7Y p;  2JEB A;  2JWO A;  4HY1 A;  4DR1 I;  1KJK A;  1HR0 E;  1RR9 A;  3L7Z B;  5KL4 A;  1X6H A;  3P06 A;  4BHB A; 
#chains in the Genus database with same CATH homology
 1Z0C A;  4URL A;  1XNR I;  1NZ0 A;  4MYU A;  4X66 E;  1O0W A;  2EZ6 A;  1ZBQ A;  1HNZ E;  2B9D A;  2V87 A;  2LJH A;  3C4B A;  3H4L A;  5T6J A;  2HKJ A;  1RQ0 A;  4LFA E;  4LF8 E;  1YZ9 A;  4LU9 A;  1EKZ A;  4LF4 E;  1Y4U A;  4IZK A;  2A2D A;  2NUE A;  1WUU A;  3LTO A;  4DV1 I;  5LL6 R;  1I94 E;  1H7S A;  2UU9 I;  2UUC I;  4JI4 E;  5BR8 I;  3WU5 A;  2A2C A;  1BKN A;  1YYO A;  1IBL E;  4LFB E;  1FJG E;  5CFF E;  4TUG A;  3IWD A;  4DUY E;  4FW9 A;  5IWA E;  5DNY A;  3LLH A;  2R42 A;  2WZO A;  4JI6 E;  5IT9 Q;  4X64 E;  4NXM E;  2V88 A;  2V34 A;  3C4T A;  2MC5 A;  4NXN I;  4BMJ A;  1N32 I;  4USM A;  4DR3 I;  2VQE E;  3HXL A;  2MC6 A;  1B62 A;  5FLX Q;  3OTO E;  5L3J A;  5AAS A;  2LUP B;  2L2K B;  4FN5 A;  3HPZ A;  1ZM9 A;  1DQ3 A;  4Z7Y A;  2ZM6 E;  4DV0 I;  4J8Z A;  1VIS A;  4X65 I;  4Z7C A;  4F54 A;  2KON A;  2H36 X;  4JV5 E;  3P1X A;  1UIL A;  2E5L E;  1USV A;  3GON A;  4R1F A;  4UTG A;  3Q1Q A;  4DV6 I;  4Q28 A;  1NHI A;  5ADZ A;  2VQF E;  4DUZ I;  2UXB I;  2LBS B;  1N33 E;  3PYG A;  3B78 A;  1WHQ A;  5AE3 A;  2CGE A;  4DR7 I;  1MU5 A;  2AJ4 A;  2O1W A;  2B3T B;  2E1R A;  4DMI A;  1YYW A;  1FI4 A;  4F9C B;  1ZXN A;  1DI2 A;  4KZS A;  4LFC E;  2LUQ A;  3ADJ A;  4DV4 I;  4DV2 E;  1N0V C;  4JYA I;  1KKH A;  1J5E E;  5AE1 A;  2Z5C B;  2V85 A;  3T1H I;  4YHH E;  1XNQ I;  1NHJ A;  5IT9 C;  3IWC A;  3LNU A;  4JI0 E;  3K17 A;  4YY3 I;  3LML A;  1ZM3 A;  4B3R I;  2PNL A;  2KOU A;  3M6A A;  2HFS A;  3VYY A;  5FLX C;  1KVK A;  2EWL A;  3PYE A;  2FTX B;  5LMU I;  4I8O A;  2UXD I;  2DEI A;  4FWG A;  4AQY I;  1S4E A;  2DIX A;  1HNX E;  4DV3 I;  4L5N C;  3J81 Q;  2UUB I;  1D6T A;  2JOX A;  2CG9 A;  1OJ4 A;  4DR1 E;  4L8N A;  4WSP A;  4DV7 I;  4KQV A;  2GS8 A;  1XNR E;  4DV5 I;  2O1U A;  3MSW A;  1K47 A;  1N36 I;  5GME A;  1Z0E A;  2FGG A;  4F9A B;  3HJC A;  1HK7 A;  1RRE A;  2X7I A;  4WUC A;  2UXC I;  2HK2 A;  1EI1 A;  4X8W A;  2RSM A;  2HK3 A;  2L6M A;  4M0V A;  3F6G A;  4DV1 E;  2VE7 C;  3Q6N A;  4IZJ D;  2RTX A;  1RC7 A;  2UU9 E;  2UUC E;  4DR4 I;  2PNM A;  2L3J A;  2EFG A;  2V86 A;  2DSY A;  2NPF A;  4USK A;  1GZ6 A;  2VF3 A;  3J80 Q;  3HUL A;  4HYM A;  1Z0B A;  2CPN A;  4WYQ B;  3HPS A;  3LPS A;  3JAM Q;  4KHP I;  2HFU A;  3J7A G;  1FNM A;  1IBK I;  1STU A;  3CWV A;  4P7D A;  1U2R A;  1J26 A;  2WW4 A;  2UUA I;  4F9B B;  2F4V I;  4LFA I;  3JTZ A;  4NXN E;  1N32 E;  3J81 C;  4IZK B;  4DR3 E;  1I94 I;  2HHH I;  4LF7 I;  1NHH A;  1N34 I;  1XMQ I;  4JI2 I;  4B3M E;  2NUF A;  4LF5 I;  4DV0 E;  4X65 E;  5A2Q Q;  3DF6 A;  2ZBK B;  4R8O A;  4BCA A;  4DU7 A;  4WUB A;  4DV6 E;  2K4V A;  2Z5B B;  4JI3 I;  4DR2 I;  4BS9 A;  3B82 A;  3WU4 A;  4RPF A;  2UXB E;  3PYD A;  2LTR A;  4NXM I;  4OX9 E;  3FIG A;  1GQE A;  2RS7 A;  3VK6 A;  3DJW A;  3K1J A;  3K6Q A;  4EMD A;  2JY9 A;  2Z5E A;  1T4N A;  5F3W A;  2V2Z A;  3J80 C;  3ZKD A;  1Y4S A;  4DV4 E;  4PRX A;  2ZM6 I;  1T4L B;  4JYA E;  1Z5C A;  4LTY A;  3JAM C;  2BV3 A;  4TUI A;  4LF9 E;  2Z5C A;  4WFT A;  4OOG C;  2B7V A;  2DMY A;  4DR6 I;  3ZZ0 A;  4M2Z A;  3T1H E;  2V2Q A;  4IZJ A;  1XNQ E;  4B3S I;  2L8T A;  2LRS A;  3VYX A;  1H7U A;  4YY3 E;  2VF1 A;  2RS6 A;  2KHX A;  3D4J A;  1USU A;  1UEK A;  2XEX A;  3KWR A;  4P7A A;  1XMO I;  4GKK I;  1HNW I;  2M1S A;  4X62 I;  1WHN A;  2UXD E;  4HAC A;  4K0K E;  4DU8 A;  4AQY E;  3V5R A;  4N3O A;  5LMN I;  4DKK A;  4JI7 I;  5A2Q C;  4DV3 E;  4DR5 I;  2V83 A;  3IWB A;  1ELO A;  1H73 A;  1ZXM A;  3ZZU A;  2LE2 A;  3QT7 A;  1PIE A;  4JI8 I;  4HXZ A;  4DV7 E;  1QZR A;  1YYK A;  2IOP A;  4DV5 E;  2L33 A;  2O1T A;  2IHR 1;  2ZIT A;  1N36 E;  2N3G A;  4B3T I;  4WPY A;  4GKJ I;  1KTV A;  3RMP A;  3AUZ A;  5GMD A;  4LF6 I;  2NA2 A;  1FWK A;  2UXC E;  2L3C A;  4XTJ A;  3T1Y I;  2ODR C;  1IBM I;  4JI1 I;  2YT4 A;  2J7K A;  1PVG A;  4UT4 A;  1HNX I;  4JI5 I;  4DR4 E;  2BM0 A;  4PRV A;  3V2U C;  1X49 A;  1Y6Z A;  2V8P A;  1ZBT A;  4P78 A;  2GQ0 A;  1N0U A;  5BR8 E;  3OML A;  1XHK A;  4WUD A;  1HR0 I;  1KIJ A;  2O1V A;  4PU9 A;  2YZT A;  1X47 A;  4KHP E;  4M1K A;  2G7H A;  1IBK E;  1FWL A;  2DB2 A;  4DXL A;  1B63 A;  4X66 I;  2UUA E;  2F4V E;  2V89 A;  1HNZ I;  4M30 A;  3JU0 A;  4LF8 I;  4LF4 I;  2DEJ A;  4BC9 A;  2V8Q B;  2HHH E;  4LF7 E;  3QT6 A;  3QT5 A;  4DPY A;  3PYF A;  3WU3 A;  2LMZ A;  1N34 E;  1XMQ E;  4JI2 E;  4LF5 E;  1FKA E;  4JI4 I;  2IOQ A;  4GEQ B;  4P52 A;  3AV0 A;  2Z5B A;  1IBL I;  4LFB I;  2LTS A;  1FJG I;  4MYT A;  2L2M A;  4JI3 E;  2M4I A;  4DR2 E;  4DUY I;  5IWA I;  1SR9 A;  2CZ9 A;  2BM1 A;  3F6H A;  2JVA A;  3HQ1 A;  1Z0W A;  2HKE A;  4DPU A;  3ZM7 A;  4DUZ E;  4JI6 I;  1H74 A;  3F0N A;  2M7Q A;  4X64 I;  1ZM4 A;  4DPT A;  4DR7 E;  4DPW A;  2VQE I;  2F8B A;  2JR1 A;  3OTO I;  4B3M I;  2NUG A;  4BBY A;  1Z0T A;  3Q6M A;  2LJP A;  5FWK A;  1DAR A;  4DR6 E;  4FWD A;  3ZOQ B;  2V2V A;  3ZKB A;  2N3H A;  1Z5A A;  1H72 C;  4B3S E;  4DPX A;  3ADI A;  4JV5 I;  2L92 A;  1MX0 A;  2E5L I;  2ODR D;  4ZVI A;  2E1M A;  2VQF I;  4OX9 I;  1ZM2 A;  1N33 I;  2X36 A;  3J7A M;  4B3R E;  2R3V A;  1T4O A;  1XMO E;  4GKK E;  1HNW E;  4X62 E;  1QU6 A;  2FV4 B;  3ADG A;  1WXR A;  5LMN E;  5LMU E;  1MG7 A;  4JI7 E;  4FWH A;  5AE2 A;  4JG4 A;  4ED4 A;  4DR5 E;  2Q2E B;  1Z0G A;  4LFC I;  1Z59 A;  2UUB E;  4LF9 I;  2JOB A;  4JI8 E;  1A6F A;  1EA6 A;  4DV2 I;  3K85 A;  2L2N A;  4IZJ B;  1J5E I;  2B7T A;  4YHH I;  4B3T E;  4GKJ E;  1S16 A;  4JI0 I;  4LF6 E;  3QT8 A;  3B8H A;  1X48 A;  4I3H A;  1Z0V A;  3T1Y E;  3H09 A;  3PRY A;  3WU6 A;  4R03 A;  1IBM E;  1UHZ A;  4K0K I;  4JI1 E;  4HAC B;  4JI5 E;  3HTX A;  3ZZT A;  1PKP A;  4BC7 A;  2MDR A;  1Z5B A;  3ADL A;  2OI2 A;  3J7Y p;  2JWO A;  4HY1 A;  4DR1 I;  1HR0 E;  1RR9 A;  3P06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...