2UUCE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uucE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uucE02
4X64I 1ZM2A 1IBKE 2DB2A 4FN5A 3WU3A 4JI7E 4DV4I 1Z0TA 1WUUA 4DUYI 4WUCA 1ZM3A 4JI8E 4ED4A 3LNUA 2J7KA 4R1FA 2L33A 1D6TA 4DR2E 1NZ0A 3ADGA 4DV7E 1IBLE 3VYXA 1NHIA 3V5RA 4M1KA 4JI2I 2YT4A 1PKPA 3PYDA 1J5EI 4LFAE 4JI5I 2B7TA 4LFCI 1YYOA 1YYWA 3ADIA 4LF5I 2BM0A 4DR4I 2BM1A 1I94I 4GKKE 2HKEA 4WUDA 2DEIA 4B3SE 2LRSA 3K17A 2HHHI 4Z7CA 1H7SA 1N33E 2BV3A 2VQEI 1U2RA 1ZBTA 1NHJA 3QT8A 1FJGE 1XMQI 4GKKI 1XNRI 3T1YI 4USMA 2HHHE 2B3TB 1Z0GA 2NA2A 2RS6A 1N34E 1YYKA 4X65I 1N33I 3ZM7A 2F4VE 4HYMA 2HK2A 2E1RA 2NUFA 4B3RI 1XMQE 4LFAI 4X66I 1UILA 3WU4A 4FWDA 4FW9A 4LFCE 4DPWA 3VYYA 1O0WA 4DV3I 4LF4I 5LMNE 4LFBE 2DMYA 1MG7A 3QT7A 1BKNA 1PIEA 1FKAE 1Z59A 1H74A 1RREA 2RSMA 1H72C 4K0KI 4JI0E 3OTOE 4XTJA 1KTVA 4DR5E 2UXDE 2DIXA 2L3JA 1KVKA 4X8WA 3J81Q 2LJHA 1FJGI 4JI0I 3Q1QA 3PYGA 2ZM6E 3J7AM 3F0NA 3HTXA 4B3TE 4DV5E 3K1JA 2UXBI 4B3RE 5IT9Q 5LMUE 4LF7E 2VQEE 4DR2I 2XEXA 2WW4A 3PYEA 2L2KB 4OX9I 5IT9C 5GMDA 1VISA 4NXNE 4M2ZA 1HNZI 3ZZ0A 1N36I 3QT5A 4JI1E 1ELOA 4KHPI 4JV5I 4OX9E 3GONA 5A2QQ 4JI4I 4DR6I 4YY3E 1N36E 1Z5AA 4FWGA 4WUBA 4DPXA 4DV1I 4UTGA 1S16A 4KHPE 2X7IA 4DUYE 1RC7A 3T1HE 4DR7I 2VQFI 1XNQE 4X62I 1OJ4A 1GQEA 2L2NA 2V34A 1X47A 4LF7I 1DARA 3M6AA 2LTSA 2UXBE 2HFUA 4JI5E 1STUA 2JY9A 4KQVA 3JAMQ 4B3ME 2L3CA 4X62E 1HNZE 5CFFE 1KKHA 2GS8A 4LF6E 1T4NA 1HR0E 4DUZI 1EKZA 2V2VA 5FLXQ 1I94E 1Z0VA 4B3MI 1H73A 1Z5BA 4DXLA 4HY1A 3LTOA 4JV5E 2R42A 4OOGC 1XHKA 1J5EE 4RPFA 1HNXI 3C4BA 2VQFE 4DR5I 2UXDI 3J80Q 2V8PA 2F4VI 3LLHA 2LUPB 4LF8I 1A6FA 3P1XA 1N32I 1XNQI 3HULA 4JG4A 4PRXA 4PU9A 4B3TI 2V2QA 1UEKA 4LFBI 4DPYA 4LF9E 1Z5CA 2UUBE 4Z7YA 1N32E 2Q2EB 3ZKBA 2A2CA 4DV2E 1WHQA 3B82A 2E5LI 2N3HA 4MYUA 4AQYI 3J80C 1HNXE 3WU6A 1MX0A 1B63A 2ZBKB 4DV6E 4DKKA 4NXME 4ZVIA 2RTXA 4AQYE 2RS7A 1ZXNA 4YY3I 4JYAI 4P7AA 1XNRE 4B3SI 3B78A 4LF6I 2DEJA 2EFGA 1PVGA 1Z0EA 5BR8E 1UHZA 2UU9E 3B8HA 2NUGA 3D4JA 2V2ZA 5LMUI 4X66E 3T1YE 3ZZTA 4HACA 4HACB 3J81C 1RQ0A 1Z0CA 2UUCE 5IWAE 2OI2A 2UUBI 3H4LA 2ZM6I 2VF3A 4DV2I 1FWKA 1XMOI 4JI3I 4LF4E 1HR0I 5LMNI 3JAMC 3QT6A 3LPSA 4DPUA 4DV0E 2CPNA 4NXMI 1XMOE 4JI3E 2LUQA 2LBSB 3J7Yp 4DR7E 1S4EA 4NXNI 1T4OA 1ZXMA 4DR3E 2LTRA 4P52A 4I3HA 2X36A 2MDRA 2EZ6A 4DV5I 5L3JA 1IBME 1Z0WA 1X48A 2E5LE 2ZITA 1ZM4A 5GMEA 4DU7A 1EA6A 4DV6I 2HK3A 1RR9A 3PYFA 4DU8A 4K0KE 4X65E 1N34I 1J26A 4YHHE 4JI6E 2NUEA 3T1HI 4PRVA 2B7VA 4MYTA 1YZ9A 3ADLA 2CZ9A 1FNMA 3CWVA 4DV3E 4DV4E 4DR4E 4GKJI 5FLXC 2UU9I 1NHHA 4DR1E 2UUAE 3WU5A 4DR3I 4DUZE 2JVAA 1HNWI 4JI2E 3ADJA 1QU6A 3OTOI 1N0UA 4X64E 2KHXA 2UUAI 2UXCI 4JYAE 2AJ4A 4UT4A 4DV1E 2LJPA 1MU5A 4M30A 3ZKDA 1QZRA 1DI2A 1FI4A 1H7UA 2NPFA 1IBKI 4JI8I 2UXCE 4HXZA 4JI1I 4EMDA 4URLA 4JI7I 1WHNA 4YHHI 1IBLI 4JI6I 4GKJE 2UUCI 1KIJA 2A2DA 2HFSA 5IWAI 4LF8E 4JI4E 1FWLA 4DR6E 5A2QC 1K47A 1X49A 4DR1I 5LL6R 1EI1A 4DV7I 1ZM9A 3ZZUA 4DPTA 1IBMI 1HNWE 4LF9I 2L2MA 4USKA 2IHR1 1Z0BA 3V2UC 4DV0I 2R3VA 1T4LB 3C4TA 4LF5E 4WYQB 1B62A 4WFTA 5BR8I 2N3GA 3J7AG 1N0VC 4FWHA 2HKJA
chains in the Genus database with same CATH superfamily
4X64I 3NZKA 1ZM2A 2EOQA 2DB2A 1IBKE 4FN5A 4FW6A 3WU3A 5DRRA 2EM4A 2EOIA 1UDNA 3HPSA 5C0XB 5C0XA 4JI7E 4I8OA 1Z0TA 4DV4I 1WUUA 4LOMA 5LLQA 5DNXA 2DSYA 4WUCA 4DUYI 1ZM3A 4OO1D 1OYRA 2F8BA 4JI8E 4ED4A 3LNUA 2WCC3 1NCSA 2YTFA 5K36E 3P3EA 2PNZA 2PNZB 2J7KA 4R1FA 2CTDA 2L33A 1D6TA 4P7DA 3HXLA 4DR2E 1NZ0A 5JEAE 4U3BA 3ADGA 4O4KA 4DV7E 3HQ1A 4RHBB 1IBLE 3VYXA 1NHIA 3V5RA 4M1KA 4JI2I 2YT4A 1PKPA 3DJWA 3PYDA 4IFDA 4IFDB 1J5EI 4LFAE 4JI5I 3Q6NA 1P47A 2Q8UA 2B7TA 4LFCI 2VE7C 4GQUA 1YYOA 2BB8A 2ELZA 2WNRB 1YYWA 2WNRA 3ADIA 4LF5I 1SR9A 1P42A 2BM0A 2LCEA 4DR4I 4IZJB 4IZJA 4R2CA 2BM1A 1I94I 4GEQB 4Q35B 4GKKE 3HJCA 2YTIA 2EOXA 4X9JA 2HKEA 4WUDA 2EM7A 2CG9A 2M9AA 1MEYC 4R8OA 2DEIA 4IZJD 4DMIA 4B3SE 2VF1A 2LRSA 3IWDA 3K17A 1USVA 4Z7CA 3MSWA 1N33E 1H7SA 2BV3A 3BIDA 2VQEI 2BR2A 2BR2B 2EL4A 2V88A 5AE2A 1U2RA 4BS9A 1BBOA 2HJJA 1ZBTA 5KL5A 2O1WA 2YTQA 2EOHA 1NHJA 3THNA 1FJGE 2EN8A 3GLLA 3QT8A 1XMQI 3OMLA 4GKKI 2GQ0A 2Z5BB 2EMZA 2HC5A 2Z5BA 1PJTA 1XNRI 1EH6A 3T1YI 2LVHA 4USMA 2NABA 2V85A 2HHHE 2B3TB 1T38A 2NA2A 2RS6A 4ZYHA 1N34E 1YYKA 1X3CA 1N0VC 1Z0GA 4U3DA 4X65I 3M7NG 1Y4SA 2JYAA 3HPZA 3AUZA 2F4VE 2CVEA 2HK2A 2R76A 2E1RA 3CDJA 4HYMA 3ZM7A 2NUFA 4B3RI 1XMQE 4LFAI 4WSGA 4X66I 1UILA 2EM2A 4NBQA 2ENHA 2NN6B 2NN6A 2EQ3A 3DF6A 3WU4A 5JEAD 2NN6F 4O5GA 5ELWA 4FW9A 4FWDA 2RSIA 4LFCE 2IOQA 4DPWA 3VYYA 1O0WA 4F9BB 4DV3I 4KWYA 4LF4I 5LMNE 2RQLA 3IWBA 4LFBE 2DMYA 1MG7A 3QT7A 1GTKA 2JT2A 3EPLA 2EMHA 1BKNA 1PIEA 1USUA 3BGHA 2O1UA 1FKAE 1A1GA 4OO1A 4OO1B 1KYQA 1Z59A 2GO4A 1H74A 4QNJA 1WXRA 1DQ3A 4LCGA 1RREA 2RSMA 1H72C 4K0KI 1R6LA 2LMZA 3UK3C 2J7JA 3H1CA 1X5WA 2YTGA 4JI0E 3M99B 2K7IA 3OTOE 5K36A 5K36B 4WPYA 4XTJA 1DGCA 4LU9A 1OYPA 1KTVA 4DR5E 2UXDE 2Z5CB 2Z5CA 2DIXA 2L3JA 2EPNA 1KVKA 2JOXA 4X8WA 4J3DA 3J81Q 2YSPA 3LMLA 5DROA 4HEIA 2LJHA 1FJGI 3THOB 4JI0I 3Q1QA 3PS2A 3PYGA 1ZAAC 5TSEA 1R6MA 2M1SA 5IV8B 2ZM6E 1EH7A 3J7AM 3CWVA 5C0XE 5A6AA 3F0NA 5A6BA 1YSAC 2EOMA 3HTXA 4GKJI 4B3TE 4DV5E 3K1JA 1N3GA 2FTXB 4OKGA 2UXBI 4MLVA 4RH8A 4B3RE 1T39A 2LO3A 1UDQA 5IT9Q 5LMUE 4MQYA 3P06A 2EMAA 4LF7E 4FW4A 2I9IA 1QNTA 4TUGA 1ZR9A 2M7QA 3GMEA 2VQEE 2DLQA 3P76A 4DR2I 2XEXA 2EPUA 3EPJA 1Y5YA 5A6KA 2WW4A 2I13A 3DD6A 3PYEA 2L2KB 2EMFA 5IT9C 4OX9I 5GMDA 2R1FA 1E3PA 1VISA 4NXNE 2O3ZA 3C6MA 4M2ZA 1HNZI 3ZZ0A 3AV0A 1N36I 2EL5A 3QT5A 4IJDA 4JI1E 2EMBA 2NN6D 1HK7A 3KRNA 4F9CB 5AC4A 1AH5A 1ELOA 4KHPI 4F6NA 2ADRA 3JU0A 4JV5I 5AE1A 2H36X 4OX9E 3GONA 2EPRA 2IOPA 5A2QQ 4JI4I 2PO0A 4R2PA 2PO0B 4DR6I 1UDSA 4YY3E 5K36D 2JWOA 1N36E 1Z5AA 2KOUA 4FWGA 4WUBA 4DPXA 3K6QA 2WBUA 4DV1I 4FW7A 4UTGA 5ADZA 4OO1E 4BA1B 3MHSC 2YU5A 4KHPE 1S16A 2X7IA 4BA1A 4DUYE 1RC7A 4ZYDA 3T1HE 4DR7I 2EMWA 5JEAC 4R03A 1XNQE 2VQFI 4X62I 2EN2A 1GQEA 1OJ4A 2L2NA 2V34A 1X47A 2C39B 2C39A 4LF7I 2YPNA 1TF6A 2CGEA 1DARA 5DNLA 4N3OA 3M6AA 2YTDA 2LTSA 4F9AB 2UXBE 2HFUA 2EOYA 4JI5E 1STUA 2BA0D 2K4VA 2E1MA 2JY9A 4R2DA 4ISAA 4KQVA 3JAMQ 3EQ1A 4B3ME 1Y6ZA 5C0XC 2L3CA 4X62E 4MU0A 1HNZE 2EN1A 5CFFE 3VK6A 5AASA 1KKHA 3BF2A 4LF6E 1RMDA 1T4NA 2YTOA 1HR0E 2GS8A 4DUZI 1GZ6A 1EKZA 2JPAA 1Y4UA 2V2VA 1PJSA 2EPPA 2YZTA 1I94E 5FLXQ 5C0XF 4R2QA 4BHCA 5KL7A 4BBYA 2IERA 1OYSA 3EPHA 2DMIA 4BMJA 2PRTA 1Z0VA 2LV2A 4B3MI 2GLIA 4O24A 1H73A 2DGCA 1Z5BA 2NN6C 3L7ZA 3L7ZB 4IZKB 4IZKA 4DXLA 2M4IA 4HY1A 3TQMA 3LTOA 2D9HA 4JV5E 1BB8A 2R42A 4OOGC 1XHKA 1J5EE 2RPCA 2WP8A 2EMCA 2WP8B 4RPFA 5EKWA 1HNXI 3C4BA 3U1YA 2ELYA 2VQFE 1Y60A 4DR5I 2UXDI 2ODRC 3J80Q 2V8PA 5F3WA 2EOZA 2V86A 2MKDA 2F4VI 3LLHA 2EPCA 2LUPB 4LF8I 1A6FA 3P1XA 3QG5C 2Z5EA 1N32I 1XNQI 4J8ZA 2V8QB 3HULA 2JXPA 2JEAB 4JG4A 2EN3A 2KONA 4PRXA 2JEAA 4IFDE 4BHBA 4PU9A 2FV4B 4B3TI 2V2QA 1Z1BA 1UEKA 2EM8A 4LFBI 4DPYA 4LF9E 1UBDC 3F6GA 1Z5CA 2EMLA 2UUBE 1IQSA 4Z7YA 1N32E 2Q2EB 3ZKBA 1E3HA 2A2CA 4DV2E 1ZBQA 4F6MA 5K36C 1WHQA 2EN7A 2YRHA 3B82A 2E5LI 4BA2B 4BA2A 2N3HA 3C6KA 1LLMC 4MYUA 4AQYI 2JE6B 2JE6A 4AIMA 3J80C 4ZYGA 2WZOA 1HNXE 2EWLA 3WU6A 4BC7A 1B63A 1MX0A 2ZBKB 4DV6E 4IS1C 5A6BD 4DKKA 4NXME 3PRYA 5KL3A 4ZVIA 1WJPA 2NN6E 5KL4A 1A1IA 3EPKA 3PS1A 2F1DA 2EN6A 2RTXA 5K36F 4MU1A 1A1HA 1TN9A 4AQYE 4BCAA 2RS7A 4ZYEA 1ZXNA 2PO2B 2PO2A 4YY3I 4JYAI 2FGGA 1XNRE 4P7AA 2GHFA 1PJQA 2EOFA 4B3SI 3B78A 3M85G 4LF6I 5DRPA 3UHMA 2DEJA 2EFGA 1PVGA 1Z0EA 5BR8E 4WXCA 1UHZA 2L8TA 2UU9E 2NUGA 2GO3A 3B8HA 2V2ZA 3D4JA 5LMUI 4IS9A 4NHRA 4X66E 1X6EA 3T1YE 3ZZTA 4HACA 4HACB 2L6MA 3J81C 2WBTA 1WRJA 1SFEA 2J65A 3K85A 1RQ0A 1F2IG 3PS3A 4MU4A 1JK2A 2EPKX 2GPIA 2MC5A 1Z0CA 2UUCE 2A25A 5IWAE 2OI2A 2UUBI 3H4LA 2ZM6I 2EQ1A 4O43A 2DRPA 5AC5A 2E72A 2VF3A 4DV2I 1FWKA 2B9DA 4AIDA 1XMOI 3IWCA 4JI3I 4GZNC 2EQ0A 5A69A 4LF4E 1HR0I 2LJUA 5LMNI 3JAMC 2JOBA 2JEBB 2JEBA 3QT6A 2YSOA 5T6JA 4M9VC 3LPSA 4F2JC 4LCFA 1N33I 2EORA 4TUIA 2EOSA 4DV0E 2CT1A 1L4SA 4DPUA 2CPNA 2YRKA 1VI7A 4NXMI 2EM6A 1XMOE 4JI3E 1G2FC 2LUQA 2LBSB 3J7Yp 5DRQA 2YTPA 1YUIA 4DR7E 2MC6A 2YU8A 5EL9A 1S4EA 4NXNI 1T4OA 2YWQA 2V87A 1ZXMA 2EOEA 3FIGA 4DR3E 2YTJA 1EH8A 2LTRA 2VRDA 4P52A 4I3HA 1PDAA 2EMKA 2X36A 3GCMA 2MDRA 2EZ6A 4DV5I 4L5NC 4L8NA 1IBME 1Z0WA 4FW5A 5L3JA 4IFDC 1MGTA 1X48A 1YFHA 2E5LE 3CDIA 2ZITA 2JR1A 3M85D 1ZM4A 5GMEA 1B69A 4DU7A 3KWRA 1EA6A 1YH8A 4DV6I 1JK1A 2HK3A 1RR9A 3PYFA 4R2EA 4DU8A 2EM3A 4K0KE 4R2SA 2C37B 4X65E 2EPMX 2C37A 2O1TA 2L92A 2O1VA 1N34I 1J26A 2EOOA 2EP3A 3M7ND 4YHHE 4FK5C 2BA1D 4JI6E 2NUEA 2V89A 3T1HI 2EMIA 4PRVA 2YTNA 2EJ4A 4N4RB 2B7VA 1YUJA 4MYTA 2EPAA 3H09A 3MHHC 1YZ9A 3L00A 1BBGA 5FWKA 4LTYA 3ADLA 2CZ9A 3ZOQB 1FNMA 4DV3E 3JTZA 4DV4E 4DR4E 5KL2A 1X6FA 2LE2A 2C38B 2C38A 4OZEA 5FLXC 1A1LA 1ZU1A 3VHTB 3HKMA 5IXMB 2V83A 2UU9I 2MDGA 5AE3A 1NHHA 4DR1E 2BA0G 3RMPA 5KL6A 2UUAE 5JEAB 5JEAA 3Q6MA 5A6JA 3WU5A 2EN4A 2MKNA 2ENCA 4WSPA 4DR3I 3KZZA 4MU3A 4DUZE 2JVAA 4AM3A 2EL6A 2IESA 4P78A 1A1KA 4JI2E 3ADJA 1XXEA 1YPNA 2EM9A 1HNWI 1RHYA 1QU6A 5JEAF 4KZSA 4HTGA 4WX9A 3OTOI 2HHHI 1NEIA 1N0UA 2KHXA 4X64E 2UUAI 2UXCI 2YRMA 4JYAE 2G7HA 1UN6B 2AJ4A 4UT4A 4DV1E 2AE8A 4IFDD 2CSHA 2LJPA 1IQOA 1MU5A 4M30A 2JP9A 3ZKDA 4R2RA 4Q28A 1QZRA 1DI2A 1FI4A 1H7UA 2N8XA 5DNYA 2NPFA 2EPXA 4BC9A 3P3CA 3KZYA 1IBKI 4JI8I 1TF3A 2PNLA 2UXCE 2PO1A 2PO1B 4HXZA 2EMXA 4LCHA 2YTEA 2WBSA 4F54A 4NZVA 4LPFA 2EPLX 4JI1I 4EMDA 4URLA 2BA1G 4JI7I 1A1JA 1WHNA 4YHHI 1IBLI 2ODRD 1A1FA 2EM5A 4GKJE 2UUCI 1KIJA 4JI6I 2A2DA 2HFSA 5IWAI 4LF8E 4JI4E 2HGHA 2EM0A 1AAYA 2LT7A 2EOJA 3ECRA 4DR6E 1IMUA 2DLKA 1KJKA 1FWLA 1YHCA 5A2QC 1K47A 1X49A 4DR1I 4OO1F 1X6HA 5LL6R 3U1KA 2EMGA 4FW3A 1EI1A 2PNMA 4DV7I 4WXDA 4M0VA 1ZM9A 3P3GA 3ZZUA 3B4TA 1UDOA 4DPTA 1HNWE 4MDTA 1IBMI 4IFDF 2EE8A 2EMYA 4LF9I 2L2MA 2VESA 4USKA 2IHR1 1Z0BA 2BBGA 3V2UC 4DV0I 2R3VA 1T4LB 4QNKA 3C4TA 4LF5E 4WYQB 1B62A 3F6HA 2ENAA 4R2AA 4WFTA 5BR8I 4OO1C 2N3GA 2EPZA 4MLQA 5C0XD 1G2DC 3J7AG 2EPOA 4FWHA 2HKJA 3BBGA
chains in the Genus database with same CATH topology
4X64I 1ZM2A 1IBKE 2DB2A 4FN5A 3WU3A 3HPSA 4JI7E 4I8OA 1Z0TA 4DV4I 1WUUA 4DUYI 2DSYA 4WUCA 1ZM3A 2F8BA 4JI8E 4ED4A 3LNUA 2J7KA 4R1FA 2L33A 1D6TA 4P7DA 3HXLA 4DR2E 1NZ0A 3ADGA 4DV7E 3HQ1A 1IBLE 3VYXA 1NHIA 3V5RA 4M1KA 4JI2I 2YT4A 1PKPA 3DJWA 3PYDA 1J5EI 4LFAE 4JI5I 3Q6NA 2B7TA 4LFCI 2VE7C 1YYOA 1YYWA 3ADIA 4LF5I 1SR9A 2BM0A 4DR4I 4IZJB 4IZJA 2BM1A 1I94I 4GEQB 3HJCA 4GKKE 2HKEA 4WUDA 2CG9A 4R8OA 2DEIA 4IZJD 4DMIA 4B3SE 2VF1A 2LRSA 3IWDA 3K17A 1USVA 4Z7CA 3MSWA 1N33E 1H7SA 2BV3A 2VQEI 2V88A 5AE2A 1U2RA 4BS9A 1ZBTA 2O1WA 1NHJA 3QT8A 1FJGE 1XMQI 3OMLA 4GKKI 2GQ0A 2Z5BB 2Z5BA 1XNRI 3T1YI 4USMA 2V85A 2HHHE 2B3TB 2NA2A 2RS6A 1Z0GA 1N34E 1YYKA 4X65I 1N33I 1Y4SA 3HPZA 3ZM7A 3AUZA 2F4VE 4HYMA 2HK2A 2E1RA 2NUFA 4B3RI 1XMQE 4LFAI 4X66I 1UILA 3DF6A 3WU4A 4FW9A 4FWDA 4LFCE 2IOQA 4DPWA 3VYYA 1O0WA 4F9BB 4DV3I 4LF4I 5LMNE 3IWBA 4LFBE 2DMYA 1MG7A 3QT7A 1USUA 1BKNA 1PIEA 2O1UA 1FKAE 1Z59A 1H74A 1WXRA 1DQ3A 1RREA 2RSMA 1H72C 4K0KI 2LMZA 4JI0E 3OTOE 4WPYA 4XTJA 4LU9A 1KTVA 4DR5E 2UXDE 2Z5CB 2Z5CA 2DIXA 2L3JA 1KVKA 2JOXA 4X8WA 3J81Q 3LMLA 2LJHA 1FJGI 4JI0I 3Q1QA 3PYGA 2M1SA 2ZM6E 3J7AM 3F0NA 3HTXA 4B3TE 4DV5E 3K1JA 2FTXB 2UXBI 4B3RE 5IT9Q 5LMUE 3P06A 4LF7E 4TUGA 2M7QA 2VQEE 4DR2I 2XEXA 2WW4A 3PYEA 2L2KB 4OX9I 5IT9C 5GMDA 1VISA 4NXNE 4M2ZA 1HNZI 3ZZ0A 3AV0A 1N36I 3QT5A 4JI1E 1HK7A 4F9CB 1ELOA 4KHPI 4JV5I 3JU0A 5AE1A 2H36X 4OX9E 3GONA 2IOPA 5A2QQ 4JI4I 4DR6I 4YY3E 2JWOA 1N36E 1Z5AA 2KOUA 4FWGA 4WUBA 4DPXA 3K6QA 4DV1I 4UTGA 5ADZA 1S16A 4KHPE 2X7IA 4DUYE 1RC7A 3T1HE 4DR7I 4R03A 1XNQE 2VQFI 4X62I 1OJ4A 1GQEA 2L2NA 2V34A 1X47A 4LF7I 2CGEA 1DARA 4N3OA 3M6AA 2LTSA 4F9AB 2UXBE 2HFUA 4JI5E 1STUA 2K4VA 2E1MA 2JY9A 4KQVA 3JAMQ 4B3ME 1Y6ZA 2L3CA 4X62E 1HNZE 5CFFE 3VK6A 1KKHA 5AASA 2GS8A 4LF6E 1T4NA 1HR0E 4DUZI 1GZ6A 1Y4UA 1EKZA 2V2VA 5FLXQ 2YZTA 1I94E 4BBYA 4BMJA 1Z0VA 4B3MI 1H73A 1Z5BA 4IZKB 4IZKA 4DXLA 2M4IA 4HY1A 3LTOA 4JV5E 2R42A 4OOGC 1XHKA 1J5EE 4RPFA 1HNXI 3C4BA 2VQFE 4DR5I 2UXDI 2ODRC 3J80Q 2V8PA 5F3WA 2V86A 2F4VI 3LLHA 2LUPB 4LF8I 1A6FA 3P1XA 2Z5EA 1N32I 1XNQI 4J8ZA 2V8QB 3HULA 4JG4A 4PRXA 2KONA 4PU9A 2FV4B 4B3TI 2V2QA 1UEKA 4LFBI 4DPYA 4LF9E 3F6GA 1Z5CA 2UUBE 4Z7YA 1N32E 2Q2EB 3ZKBA 2A2CA 4DV2E 1ZBQA 1WHQA 3B82A 2E5LI 2N3HA 4MYUA 4AQYI 3J80C 1HNXE 2WZOA 2EWLA 3WU6A 4BC7A 1B63A 1MX0A 2ZBKB 4DV6E 4DKKA 4NXME 3PRYA 4ZVIA 2RTXA 4AQYE 4BCAA 2RS7A 1ZXNA 4YY3I 4JYAI 2FGGA 1XNRE 4P7AA 4B3SI 3B78A 4LF6I 2DEJA 2EFGA 1PVGA 1Z0EA 5BR8E 1UHZA 2L8TA 2UU9E 2NUGA 3B8HA 2V2ZA 3D4JA 5LMUI 4X66E 3T1YE 3ZZTA 4HACA 4HACB 2L6MA 3J81C 3K85A 1RQ0A 2MC5A 1Z0CA 2UUCE 5IWAE 2OI2A 2UUBI 3H4LA 2ZM6I 2VF3A 4DV2I 1FWKA 2B9DA 1XMOI 4JI3I 3IWCA 4LF4E 1HR0I 5LMNI 3JAMC 2JOBA 3QT6A 5T6JA 3LPSA 4DPUA 4TUIA 4DV0E 2CPNA 4NXMI 1XMOE 4JI3E 2LUQA 2LBSB 3J7Yp 4DR7E 2MC6A 1S4EA 4NXNI 1T4OA 2V87A 1ZXMA 4DR3E 3FIGA 2LTRA 4P52A 4I3HA 2X36A 2MDRA 2EZ6A 4DV5I 4L5NC 4L8NA 1IBME 1Z0WA 5L3JA 1X48A 2E5LE 2ZITA 2JR1A 1ZM4A 5GMEA 4DU7A 3KWRA 1EA6A 4DV6I 2HK3A 1RR9A 3PYFA 4DU8A 4K0KE 2O1TA 4X65E 1N34I 2L92A 2O1VA 1J26A 4YHHE 4JI6E 2NUEA 2V89A 3T1HI 4PRVA 2B7VA 4MYTA 3H09A 1YZ9A 5FWKA 4LTYA 3ADLA 2CZ9A 3ZOQB 1FNMA 4DV3E 3JTZA 4DV4E 4DR4E 3CWVA 4GKJI 2LE2A 5FLXC 2UU9I 2V83A 5AE3A 1NHHA 4DR1E 3RMPA 2UUAE 3Q6MA 3WU5A 4WSPA 4DR3I 4DUZE 2JVAA 1HNWI 4P78A 4JI2E 3ADJA 1QU6A 4KZSA 3OTOI 2HHHI 1N0UA 2KHXA 4X64E 2UUAI 2UXCI 4JYAE 2G7HA 2AJ4A 4UT4A 4DV1E 2LJPA 1MU5A 4M30A 3ZKDA 4Q28A 1QZRA 1DI2A 1FI4A 1H7UA 5DNYA 2NPFA 4BC9A 1IBKI 4JI8I 2PNLA 2UXCE 4HXZA 4JI1I 4F54A 4EMDA 4URLA 4JI7I 1WHNA 4YHHI 1IBLI 2ODRD 4JI6I 4GKJE 2UUCI 1KIJA 2A2DA 2HFSA 5IWAI 4LF8E 4JI4E 1FWLA 4DR6E 5A2QC 1K47A 1X49A 4DR1I 5LL6R 1EI1A 2PNMA 4DV7I 4M0VA 1ZM9A 3ZZUA 4DPTA 1IBMI 1HNWE 4LF9I 2L2MA 4USKA 2IHR1 1Z0BA 3V2UC 4DV0I 2R3VA 1T4LB 3C4TA 4LF5E 4WYQB 1B62A 3F6HA 4WFTA 5BR8I 2N3GA 3J7AG 1N0VC 4FWHA 2HKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 I;  1ZM2 A;  1IBK E;  2DB2 A;  4FN5 A;  3WU3 A;  4JI7 E;  4DV4 I;  1Z0T A;  1WUU A;  4DUY I;  4WUC A;  1ZM3 A;  4JI8 E;  4ED4 A;  3LNU A;  2J7K A;  4R1F A;  2L33 A;  1D6T A;  4DR2 E;  1NZ0 A;  3ADG A;  4DV7 E;  1IBL E;  3VYX A;  1NHI A;  3V5R A;  4M1K A;  4JI2 I;  2YT4 A;  1PKP A;  3PYD A;  1J5E I;  4LFA E;  4JI5 I;  2B7T A;  4LFC I;  1YYO A;  1YYW A;  3ADI A;  4LF5 I;  2BM0 A;  4DR4 I;  2BM1 A;  1I94 I;  4GKK E;  2HKE A;  4WUD A;  2DEI A;  4B3S E;  2LRS A;  3K17 A;  2HHH I;  4Z7C A;  1H7S A;  1N33 E;  2BV3 A;  2VQE I;  1U2R A;  1ZBT A;  1NHJ A;  3QT8 A;  1FJG E;  1XMQ I;  4GKK I;  1XNR I;  3T1Y I;  4USM A;  2HHH E;  2B3T B;  1Z0G A;  2NA2 A;  2RS6 A;  1N34 E;  1YYK A;  4X65 I;  1N33 I;  3ZM7 A;  2F4V E;  4HYM A;  2HK2 A;  2E1R A;  2NUF A;  4B3R I;  1XMQ E;  4LFA I;  4X66 I;  1UIL A;  3WU4 A;  4FWD A;  4FW9 A;  4LFC E;  4DPW A;  3VYY A;  1O0W A;  4DV3 I;  4LF4 I;  5LMN E;  4LFB E;  2DMY A;  1MG7 A;  3QT7 A;  1BKN A;  1PIE A;  1FKA E;  1Z59 A;  1H74 A;  1RRE A;  2RSM A;  1H72 C;  4K0K I;  4JI0 E;  3OTO E;  4XTJ A;  1KTV A;  4DR5 E;  2UXD E;  2DIX A;  2L3J A;  1KVK A;  4X8W A;  3J81 Q;  2LJH A;  1FJG I;  4JI0 I;  3Q1Q A;  3PYG A;  2ZM6 E;  3J7A M;  3F0N A;  3HTX A;  4B3T E;  4DV5 E;  3K1J A;  2UXB I;  4B3R E;  5IT9 Q;  5LMU E;  4LF7 E;  2VQE E;  4DR2 I;  2XEX A;  2WW4 A;  3PYE A;  2L2K B;  4OX9 I;  5IT9 C;  5GMD A;  1VIS A;  4NXN E;  4M2Z A;  1HNZ I;  3ZZ0 A;  1N36 I;  3QT5 A;  4JI1 E;  1ELO A;  4KHP I;  4JV5 I;  4OX9 E;  3GON A;  5A2Q Q;  4JI4 I;  4DR6 I;  4YY3 E;  1N36 E;  1Z5A A;  4FWG A;  4WUB A;  4DPX A;  4DV1 I;  4UTG A;  1S16 A;  4KHP E;  2X7I A;  4DUY E;  1RC7 A;  3T1H E;  4DR7 I;  2VQF I;  1XNQ E;  4X62 I;  1OJ4 A;  1GQE A;  2L2N A;  2V34 A;  1X47 A;  4LF7 I;  1DAR A;  3M6A A;  2LTS A;  2UXB E;  2HFU A;  4JI5 E;  1STU A;  2JY9 A;  4KQV A;  3JAM Q;  4B3M E;  2L3C A;  4X62 E;  1HNZ E;  5CFF E;  1KKH A;  2GS8 A;  4LF6 E;  1T4N A;  1HR0 E;  4DUZ I;  1EKZ A;  2V2V A;  5FLX Q;  1I94 E;  1Z0V A;  4B3M I;  1H73 A;  1Z5B A;  4DXL A;  4HY1 A;  3LTO A;  4JV5 E;  2R42 A;  4OOG C;  1XHK A;  1J5E E;  4RPF A;  1HNX I;  3C4B A;  2VQF E;  4DR5 I;  2UXD I;  3J80 Q;  2V8P A;  2F4V I;  3LLH A;  2LUP B;  4LF8 I;  1A6F A;  3P1X A;  1N32 I;  1XNQ I;  3HUL A;  4JG4 A;  4PRX A;  4PU9 A;  4B3T I;  2V2Q A;  1UEK A;  4LFB I;  4DPY A;  4LF9 E;  1Z5C A;  2UUB E;  4Z7Y A;  1N32 E;  2Q2E B;  3ZKB A;  2A2C A;  4DV2 E;  1WHQ A;  3B82 A;  2E5L I;  2N3H A;  4MYU A;  4AQY I;  3J80 C;  1HNX E;  3WU6 A;  1MX0 A;  1B63 A;  2ZBK B;  4DV6 E;  4DKK A;  4NXM E;  4ZVI A;  2RTX A;  4AQY E;  2RS7 A;  1ZXN A;  4YY3 I;  4JYA I;  4P7A A;  1XNR E;  4B3S I;  3B78 A;  4LF6 I;  2DEJ A;  2EFG A;  1PVG A;  1Z0E A;  5BR8 E;  1UHZ A;  2UU9 E;  3B8H A;  2NUG A;  3D4J A;  2V2Z A;  5LMU I;  4X66 E;  3T1Y E;  3ZZT A;  4HAC A;  4HAC B;  3J81 C;  1RQ0 A;  1Z0C A;  2UUC E;  5IWA E;  2OI2 A;  2UUB I;  3H4L A;  2ZM6 I;  2VF3 A;  4DV2 I;  1FWK A;  1XMO I;  4JI3 I;  4LF4 E;  1HR0 I;  5LMN I;  3JAM C;  3QT6 A;  3LPS A;  4DPU A;  4DV0 E;  2CPN A;  4NXM I;  1XMO E;  4JI3 E;  2LUQ A;  2LBS B;  3J7Y p;  4DR7 E;  1S4E A;  4NXN I;  1T4O A;  1ZXM A;  4DR3 E;  2LTR A;  4P52 A;  4I3H A;  2X36 A;  2MDR A;  2EZ6 A;  4DV5 I;  5L3J A;  1IBM E;  1Z0W A;  1X48 A;  2E5L E;  2ZIT A;  1ZM4 A;  5GME A;  4DU7 A;  1EA6 A;  4DV6 I;  2HK3 A;  1RR9 A;  3PYF A;  4DU8 A;  4K0K E;  4X65 E;  1N34 I;  1J26 A;  4YHH E;  4JI6 E;  2NUE A;  3T1H I;  4PRV A;  2B7V A;  4MYT A;  1YZ9 A;  3ADL A;  2CZ9 A;  1FNM A;  3CWV A;  4DV3 E;  4DV4 E;  4DR4 E;  4GKJ I;  5FLX C;  2UU9 I;  1NHH A;  4DR1 E;  2UUA E;  3WU5 A;  4DR3 I;  4DUZ E;  2JVA A;  1HNW I;  4JI2 E;  3ADJ A;  1QU6 A;  3OTO I;  1N0U A;  4X64 E;  2KHX A;  2UUA I;  2UXC I;  4JYA E;  2AJ4 A;  4UT4 A;  4DV1 E;  2LJP A;  1MU5 A;  4M30 A;  3ZKD A;  1QZR A;  1DI2 A;  1FI4 A;  1H7U A;  2NPF A;  1IBK I;  4JI8 I;  2UXC E;  4HXZ A;  4JI1 I;  4EMD A;  4URL A;  4JI7 I;  1WHN A;  4YHH I;  1IBL I;  4JI6 I;  4GKJ E;  2UUC I;  1KIJ A;  2A2D A;  2HFS A;  5IWA I;  4LF8 E;  4JI4 E;  1FWL A;  4DR6 E;  5A2Q C;  1K47 A;  1X49 A;  4DR1 I;  5LL6 R;  1EI1 A;  4DV7 I;  1ZM9 A;  3ZZU A;  4DPT A;  1IBM I;  1HNW E;  4LF9 I;  2L2M A;  4USK A;  2IHR 1;  1Z0B A;  3V2U C;  4DV0 I;  2R3V A;  1T4L B;  3C4T A;  4LF5 E;  4WYQ B;  1B62 A;  4WFT A;  5BR8 I;  2N3G A;  3J7A G;  1N0V C;  4FWH A;  2HKJ A; 
#chains in the Genus database with same CATH topology
 4X64 I;  3NZK A;  1ZM2 A;  2EOQ A;  2DB2 A;  1IBK E;  4FN5 A;  4FW6 A;  3WU3 A;  5DRR A;  2EM4 A;  2EOI A;  1UDN A;  3HPS A;  5C0X B;  5C0X A;  4JI7 E;  4I8O A;  1Z0T A;  4DV4 I;  1WUU A;  4LOM A;  5LLQ A;  5DNX A;  2DSY A;  4WUC A;  4DUY I;  1ZM3 A;  4OO1 D;  1OYR A;  2F8B A;  4JI8 E;  4ED4 A;  3LNU A;  2WCC 3;  1NCS A;  2YTF A;  5K36 E;  3P3E A;  2PNZ A;  2PNZ B;  2J7K A;  4R1F A;  2CTD A;  2L33 A;  1D6T A;  4P7D A;  3HXL A;  4DR2 E;  1NZ0 A;  5JEA E;  4U3B A;  3ADG A;  4O4K A;  4DV7 E;  3HQ1 A;  4RHB B;  1IBL E;  3VYX A;  1NHI A;  3V5R A;  4M1K A;  4JI2 I;  2YT4 A;  1PKP A;  3DJW A;  3PYD A;  4IFD A;  4IFD B;  1J5E I;  4LFA E;  4JI5 I;  3Q6N A;  1P47 A;  2Q8U A;  2B7T A;  4LFC I;  2VE7 C;  4GQU A;  1YYO A;  2BB8 A;  2ELZ A;  2WNR B;  1YYW A;  2WNR A;  3ADI A;  4LF5 I;  1SR9 A;  1P42 A;  2BM0 A;  2LCE A;  4DR4 I;  4IZJ B;  4IZJ A;  4R2C A;  2BM1 A;  1I94 I;  4GEQ B;  4Q35 B;  4GKK E;  3HJC A;  2YTI A;  2EOX A;  4X9J A;  2HKE A;  4WUD A;  2EM7 A;  2CG9 A;  2M9A A;  1MEY C;  4R8O A;  2DEI A;  4IZJ D;  4DMI A;  4B3S E;  2VF1 A;  2LRS A;  3IWD A;  3K17 A;  1USV A;  4Z7C A;  3MSW A;  1N33 E;  1H7S A;  2BV3 A;  3BID A;  2VQE I;  2BR2 A;  2BR2 B;  2EL4 A;  2V88 A;  5AE2 A;  1U2R A;  4BS9 A;  1BBO A;  2HJJ A;  1ZBT A;  5KL5 A;  2O1W A;  2YTQ A;  2EOH A;  1NHJ A;  3THN A;  1FJG E;  2EN8 A;  3GLL A;  3QT8 A;  1XMQ I;  3OML A;  4GKK I;  2GQ0 A;  2Z5B B;  2EMZ A;  2HC5 A;  2Z5B A;  1PJT A;  1XNR I;  1EH6 A;  3T1Y I;  2LVH A;  4USM A;  2NAB A;  2V85 A;  2HHH E;  2B3T B;  1T38 A;  2NA2 A;  2RS6 A;  4ZYH A;  1N34 E;  1YYK A;  1X3C A;  1N0V C;  1Z0G A;  4U3D A;  4X65 I;  3M7N G;  1Y4S A;  2JYA A;  3HPZ A;  3AUZ A;  2F4V E;  2CVE A;  2HK2 A;  2R76 A;  2E1R A;  3CDJ A;  4HYM A;  3ZM7 A;  2NUF A;  4B3R I;  1XMQ E;  4LFA I;  4WSG A;  4X66 I;  1UIL A;  2EM2 A;  4NBQ A;  2ENH A;  2NN6 B;  2NN6 A;  2EQ3 A;  3DF6 A;  3WU4 A;  5JEA D;  2NN6 F;  4O5G A;  5ELW A;  4FW9 A;  4FWD A;  2RSI A;  4LFC E;  2IOQ A;  4DPW A;  3VYY A;  1O0W A;  4F9B B;  4DV3 I;  4KWY A;  4LF4 I;  5LMN E;  2RQL A;  3IWB A;  4LFB E;  2DMY A;  1MG7 A;  3QT7 A;  1GTK A;  2JT2 A;  3EPL A;  2EMH A;  1BKN A;  1PIE A;  1USU A;  3BGH A;  2O1U A;  1FKA E;  1A1G A;  4OO1 A;  4OO1 B;  1KYQ A;  1Z59 A;  2GO4 A;  1H74 A;  4QNJ A;  1WXR A;  1DQ3 A;  4LCG A;  1RRE A;  2RSM A;  1H72 C;  4K0K I;  1R6L A;  2LMZ A;  3UK3 C;  2J7J A;  3H1C A;  1X5W A;  2YTG A;  4JI0 E;  3M99 B;  2K7I A;  3OTO E;  5K36 A;  5K36 B;  4WPY A;  4XTJ A;  1DGC A;  4LU9 A;  1OYP A;  1KTV A;  4DR5 E;  2UXD E;  2Z5C B;  2Z5C A;  2DIX A;  2L3J A;  2EPN A;  1KVK A;  2JOX A;  4X8W A;  4J3D A;  3J81 Q;  2YSP A;  3LML A;  5DRO A;  4HEI A;  2LJH A;  1FJG I;  3THO B;  4JI0 I;  3Q1Q A;  3PS2 A;  3PYG A;  1ZAA C;  5TSE A;  1R6M A;  2M1S A;  5IV8 B;  2ZM6 E;  1EH7 A;  3J7A M;  3CWV A;  5C0X E;  5A6A A;  3F0N A;  5A6B A;  1YSA C;  2EOM A;  3HTX A;  4GKJ I;  4B3T E;  4DV5 E;  3K1J A;  1N3G A;  2FTX B;  4OKG A;  2UXB I;  4MLV A;  4RH8 A;  4B3R E;  1T39 A;  2LO3 A;  1UDQ A;  5IT9 Q;  5LMU E;  4MQY A;  3P06 A;  2EMA A;  4LF7 E;  4FW4 A;  2I9I A;  1QNT A;  4TUG A;  1ZR9 A;  2M7Q A;  3GME A;  2VQE E;  2DLQ A;  3P76 A;  4DR2 I;  2XEX A;  2EPU A;  3EPJ A;  1Y5Y A;  5A6K A;  2WW4 A;  2I13 A;  3DD6 A;  3PYE A;  2L2K B;  2EMF A;  5IT9 C;  4OX9 I;  5GMD A;  2R1F A;  1E3P A;  1VIS A;  4NXN E;  2O3Z A;  3C6M A;  4M2Z A;  1HNZ I;  3ZZ0 A;  3AV0 A;  1N36 I;  2EL5 A;  3QT5 A;  4IJD A;  4JI1 E;  2EMB A;  2NN6 D;  1HK7 A;  3KRN A;  4F9C B;  5AC4 A;  1AH5 A;  1ELO A;  4KHP I;  4F6N A;  2ADR A;  3JU0 A;  4JV5 I;  5AE1 A;  2H36 X;  4OX9 E;  3GON A;  2EPR A;  2IOP A;  5A2Q Q;  4JI4 I;  2PO0 A;  4R2P A;  2PO0 B;  4DR6 I;  1UDS A;  4YY3 E;  5K36 D;  2JWO A;  1N36 E;  1Z5A A;  2KOU A;  4FWG A;  4WUB A;  4DPX A;  3K6Q A;  2WBU A;  4DV1 I;  4FW7 A;  4UTG A;  5ADZ A;  4OO1 E;  4BA1 B;  3MHS C;  2YU5 A;  4KHP E;  1S16 A;  2X7I A;  4BA1 A;  4DUY E;  1RC7 A;  4ZYD A;  3T1H E;  4DR7 I;  2EMW A;  5JEA C;  4R03 A;  1XNQ E;  2VQF I;  4X62 I;  2EN2 A;  1GQE A;  1OJ4 A;  2L2N A;  2V34 A;  1X47 A;  2C39 B;  2C39 A;  4LF7 I;  2YPN A;  1TF6 A;  2CGE A;  1DAR A;  5DNL A;  4N3O A;  3M6A A;  2YTD A;  2LTS A;  4F9A B;  2UXB E;  2HFU A;  2EOY A;  4JI5 E;  1STU A;  2BA0 D;  2K4V A;  2E1M A;  2JY9 A;  4R2D A;  4ISA A;  4KQV A;  3JAM Q;  3EQ1 A;  4B3M E;  1Y6Z A;  5C0X C;  2L3C A;  4X62 E;  4MU0 A;  1HNZ E;  2EN1 A;  5CFF E;  3VK6 A;  5AAS A;  1KKH A;  3BF2 A;  4LF6 E;  1RMD A;  1T4N A;  2YTO A;  1HR0 E;  2GS8 A;  4DUZ I;  1GZ6 A;  1EKZ A;  2JPA A;  1Y4U A;  2V2V A;  1PJS A;  2EPP A;  2YZT A;  1I94 E;  5FLX Q;  5C0X F;  4R2Q A;  4BHC A;  5KL7 A;  4BBY A;  2IER A;  1OYS A;  3EPH A;  2DMI A;  4BMJ A;  2PRT A;  1Z0V A;  2LV2 A;  4B3M I;  2GLI A;  4O24 A;  1H73 A;  2DGC A;  1Z5B A;  2NN6 C;  3L7Z A;  3L7Z B;  4IZK B;  4IZK A;  4DXL A;  2M4I A;  4HY1 A;  3TQM A;  3LTO A;  2D9H A;  4JV5 E;  1BB8 A;  2R42 A;  4OOG C;  1XHK A;  1J5E E;  2RPC A;  2WP8 A;  2EMC A;  2WP8 B;  4RPF A;  5EKW A;  1HNX I;  3C4B A;  3U1Y A;  2ELY A;  2VQF E;  1Y60 A;  4DR5 I;  2UXD I;  2ODR C;  3J80 Q;  2V8P A;  5F3W A;  2EOZ A;  2V86 A;  2MKD A;  2F4V I;  3LLH A;  2EPC A;  2LUP B;  4LF8 I;  1A6F A;  3P1X A;  3QG5 C;  2Z5E A;  1N32 I;  1XNQ I;  4J8Z A;  2V8Q B;  3HUL A;  2JXP A;  2JEA B;  4JG4 A;  2EN3 A;  2KON A;  4PRX A;  2JEA A;  4IFD E;  4BHB A;  4PU9 A;  2FV4 B;  4B3T I;  2V2Q A;  1Z1B A;  1UEK A;  2EM8 A;  4LFB I;  4DPY A;  4LF9 E;  1UBD C;  3F6G A;  1Z5C A;  2EML A;  2UUB E;  1IQS A;  4Z7Y A;  1N32 E;  2Q2E B;  3ZKB A;  1E3H A;  2A2C A;  4DV2 E;  1ZBQ A;  4F6M A;  5K36 C;  1WHQ A;  2EN7 A;  2YRH A;  3B82 A;  2E5L I;  4BA2 B;  4BA2 A;  2N3H A;  3C6K A;  1LLM C;  4MYU A;  4AQY I;  2JE6 B;  2JE6 A;  4AIM A;  3J80 C;  4ZYG A;  2WZO A;  1HNX E;  2EWL A;  3WU6 A;  4BC7 A;  1B63 A;  1MX0 A;  2ZBK B;  4DV6 E;  4IS1 C;  5A6B D;  4DKK A;  4NXM E;  3PRY A;  5KL3 A;  4ZVI A;  1WJP A;  2NN6 E;  5KL4 A;  1A1I A;  3EPK A;  3PS1 A;  2F1D A;  2EN6 A;  2RTX A;  5K36 F;  4MU1 A;  1A1H A;  1TN9 A;  4AQY E;  4BCA A;  2RS7 A;  4ZYE A;  1ZXN A;  2PO2 B;  2PO2 A;  4YY3 I;  4JYA I;  2FGG A;  1XNR E;  4P7A A;  2GHF A;  1PJQ A;  2EOF A;  4B3S I;  3B78 A;  3M85 G;  4LF6 I;  5DRP A;  3UHM A;  2DEJ A;  2EFG A;  1PVG A;  1Z0E A;  5BR8 E;  4WXC A;  1UHZ A;  2L8T A;  2UU9 E;  2NUG A;  2GO3 A;  3B8H A;  2V2Z A;  3D4J A;  5LMU I;  4IS9 A;  4NHR A;  4X66 E;  1X6E A;  3T1Y E;  3ZZT A;  4HAC A;  4HAC B;  2L6M A;  3J81 C;  2WBT A;  1WRJ A;  1SFE A;  2J65 A;  3K85 A;  1RQ0 A;  1F2I G;  3PS3 A;  4MU4 A;  1JK2 A;  2EPK X;  2GPI A;  2MC5 A;  1Z0C A;  2UUC E;  2A25 A;  5IWA E;  2OI2 A;  2UUB I;  3H4L A;  2ZM6 I;  2EQ1 A;  4O43 A;  2DRP A;  5AC5 A;  2E72 A;  2VF3 A;  4DV2 I;  1FWK A;  2B9D A;  4AID A;  1XMO I;  3IWC A;  4JI3 I;  4GZN C;  2EQ0 A;  5A69 A;  4LF4 E;  1HR0 I;  2LJU A;  5LMN I;  3JAM C;  2JOB A;  2JEB B;  2JEB A;  3QT6 A;  2YSO A;  5T6J A;  4M9V C;  3LPS A;  4F2J C;  4LCF A;  1N33 I;  2EOR A;  4TUI A;  2EOS A;  4DV0 E;  2CT1 A;  1L4S A;  4DPU A;  2CPN A;  2YRK A;  1VI7 A;  4NXM I;  2EM6 A;  1XMO E;  4JI3 E;  1G2F C;  2LUQ A;  2LBS B;  3J7Y p;  5DRQ A;  2YTP A;  1YUI A;  4DR7 E;  2MC6 A;  2YU8 A;  5EL9 A;  1S4E A;  4NXN I;  1T4O A;  2YWQ A;  2V87 A;  1ZXM A;  2EOE A;  3FIG A;  4DR3 E;  2YTJ A;  1EH8 A;  2LTR A;  2VRD A;  4P52 A;  4I3H A;  1PDA A;  2EMK A;  2X36 A;  3GCM A;  2MDR A;  2EZ6 A;  4DV5 I;  4L5N C;  4L8N A;  1IBM E;  1Z0W A;  4FW5 A;  5L3J A;  4IFD C;  1MGT A;  1X48 A;  1YFH A;  2E5L E;  3CDI A;  2ZIT A;  2JR1 A;  3M85 D;  1ZM4 A;  5GME A;  1B69 A;  4DU7 A;  3KWR A;  1EA6 A;  1YH8 A;  4DV6 I;  1JK1 A;  2HK3 A;  1RR9 A;  3PYF A;  4R2E A;  4DU8 A;  2EM3 A;  4K0K E;  4R2S A;  2C37 B;  4X65 E;  2EPM X;  2C37 A;  2O1T A;  2L92 A;  2O1V A;  1N34 I;  1J26 A;  2EOO A;  2EP3 A;  3M7N D;  4YHH E;  4FK5 C;  2BA1 D;  4JI6 E;  2NUE A;  2V89 A;  3T1H I;  2EMI A;  4PRV A;  2YTN A;  2EJ4 A;  4N4R B;  2B7V A;  1YUJ A;  4MYT A;  2EPA A;  3H09 A;  3MHH C;  1YZ9 A;  3L00 A;  1BBG A;  5FWK A;  4LTY A;  3ADL A;  2CZ9 A;  3ZOQ B;  1FNM A;  4DV3 E;  3JTZ A;  4DV4 E;  4DR4 E;  5KL2 A;  1X6F A;  2LE2 A;  2C38 B;  2C38 A;  4OZE A;  5FLX C;  1A1L A;  1ZU1 A;  3VHT B;  3HKM A;  5IXM B;  2V83 A;  2UU9 I;  2MDG A;  5AE3 A;  1NHH A;  4DR1 E;  2BA0 G;  3RMP A;  5KL6 A;  2UUA E;  5JEA B;  5JEA A;  3Q6M A;  5A6J A;  3WU5 A;  2EN4 A;  2MKN A;  2ENC A;  4WSP A;  4DR3 I;  3KZZ A;  4MU3 A;  4DUZ E;  2JVA A;  4AM3 A;  2EL6 A;  2IES A;  4P78 A;  1A1K A;  4JI2 E;  3ADJ A;  1XXE A;  1YPN A;  2EM9 A;  1HNW I;  1RHY A;  1QU6 A;  5JEA F;  4KZS A;  4HTG A;  4WX9 A;  3OTO I;  2HHH I;  1NEI A;  1N0U A;  2KHX A;  4X64 E;  2UUA I;  2UXC I;  2YRM A;  4JYA E;  2G7H A;  1UN6 B;  2AJ4 A;  4UT4 A;  4DV1 E;  2AE8 A;  4IFD D;  2CSH A;  2LJP A;  1IQO A;  1MU5 A;  4M30 A;  2JP9 A;  3ZKD A;  4R2R A;  4Q28 A;  1QZR A;  1DI2 A;  1FI4 A;  1H7U A;  2N8X A;  5DNY A;  2NPF A;  2EPX A;  4BC9 A;  3P3C A;  3KZY A;  1IBK I;  4JI8 I;  1TF3 A;  2PNL A;  2UXC E;  2PO1 A;  2PO1 B;  4HXZ A;  2EMX A;  4LCH A;  2YTE A;  2WBS A;  4F54 A;  4NZV A;  4LPF A;  2EPL X;  4JI1 I;  4EMD A;  4URL A;  2BA1 G;  4JI7 I;  1A1J A;  1WHN A;  4YHH I;  1IBL I;  2ODR D;  1A1F A;  2EM5 A;  4GKJ E;  2UUC I;  1KIJ A;  4JI6 I;  2A2D A;  2HFS A;  5IWA I;  4LF8 E;  4JI4 E;  2HGH A;  2EM0 A;  1AAY A;  2LT7 A;  2EOJ A;  3ECR A;  4DR6 E;  1IMU A;  2DLK A;  1KJK A;  1FWL A;  1YHC A;  5A2Q C;  1K47 A;  1X49 A;  4DR1 I;  4OO1 F;  1X6H A;  5LL6 R;  3U1K A;  2EMG A;  4FW3 A;  1EI1 A;  2PNM A;  4DV7 I;  4WXD A;  4M0V A;  1ZM9 A;  3P3G A;  3ZZU A;  3B4T A;  1UDO A;  4DPT A;  1HNW E;  4MDT A;  1IBM I;  4IFD F;  2EE8 A;  2EMY A;  4LF9 I;  2L2M A;  2VES A;  4USK A;  2IHR 1;  1Z0B A;  2BBG A;  3V2U C;  4DV0 I;  2R3V A;  1T4L B;  4QNK A;  3C4T A;  4LF5 E;  4WYQ B;  1B62 A;  3F6H A;  2ENA A;  4R2A A;  4WFT A;  5BR8 I;  4OO1 C;  2N3G A;  2EPZ A;  4MLQ A;  5C0X D;  1G2D C;  3J7A G;  2EPO A;  4FWH A;  2HKJ A;  3BBG A; 
#chains in the Genus database with same CATH homology
 4X64 I;  1ZM2 A;  1IBK E;  2DB2 A;  4FN5 A;  3WU3 A;  3HPS A;  4JI7 E;  4I8O A;  1Z0T A;  4DV4 I;  1WUU A;  4DUY I;  2DSY A;  4WUC A;  1ZM3 A;  2F8B A;  4JI8 E;  4ED4 A;  3LNU A;  2J7K A;  4R1F A;  2L33 A;  1D6T A;  4P7D A;  3HXL A;  4DR2 E;  1NZ0 A;  3ADG A;  4DV7 E;  3HQ1 A;  1IBL E;  3VYX A;  1NHI A;  3V5R A;  4M1K A;  4JI2 I;  2YT4 A;  1PKP A;  3DJW A;  3PYD A;  1J5E I;  4LFA E;  4JI5 I;  3Q6N A;  2B7T A;  4LFC I;  2VE7 C;  1YYO A;  1YYW A;  3ADI A;  4LF5 I;  1SR9 A;  2BM0 A;  4DR4 I;  4IZJ B;  4IZJ A;  2BM1 A;  1I94 I;  4GEQ B;  3HJC A;  4GKK E;  2HKE A;  4WUD A;  2CG9 A;  4R8O A;  2DEI A;  4IZJ D;  4DMI A;  4B3S E;  2VF1 A;  2LRS A;  3IWD A;  3K17 A;  1USV A;  4Z7C A;  3MSW A;  1N33 E;  1H7S A;  2BV3 A;  2VQE I;  2V88 A;  5AE2 A;  1U2R A;  4BS9 A;  1ZBT A;  2O1W A;  1NHJ A;  3QT8 A;  1FJG E;  1XMQ I;  3OML A;  4GKK I;  2GQ0 A;  2Z5B B;  2Z5B A;  1XNR I;  3T1Y I;  4USM A;  2V85 A;  2HHH E;  2B3T B;  2NA2 A;  2RS6 A;  1Z0G A;  1N34 E;  1YYK A;  4X65 I;  1N33 I;  1Y4S A;  3HPZ A;  3ZM7 A;  3AUZ A;  2F4V E;  4HYM A;  2HK2 A;  2E1R A;  2NUF A;  4B3R I;  1XMQ E;  4LFA I;  4X66 I;  1UIL A;  3DF6 A;  3WU4 A;  4FW9 A;  4FWD A;  4LFC E;  2IOQ A;  4DPW A;  3VYY A;  1O0W A;  4F9B B;  4DV3 I;  4LF4 I;  5LMN E;  3IWB A;  4LFB E;  2DMY A;  1MG7 A;  3QT7 A;  1USU A;  1BKN A;  1PIE A;  2O1U A;  1FKA E;  1Z59 A;  1H74 A;  1WXR A;  1DQ3 A;  1RRE A;  2RSM A;  1H72 C;  4K0K I;  2LMZ A;  4JI0 E;  3OTO E;  4WPY A;  4XTJ A;  4LU9 A;  1KTV A;  4DR5 E;  2UXD E;  2Z5C B;  2Z5C A;  2DIX A;  2L3J A;  1KVK A;  2JOX A;  4X8W A;  3J81 Q;  3LML A;  2LJH A;  1FJG I;  4JI0 I;  3Q1Q A;  3PYG A;  2M1S A;  2ZM6 E;  3J7A M;  3F0N A;  3HTX A;  4B3T E;  4DV5 E;  3K1J A;  2FTX B;  2UXB I;  4B3R E;  5IT9 Q;  5LMU E;  3P06 A;  4LF7 E;  4TUG A;  2M7Q A;  2VQE E;  4DR2 I;  2XEX A;  2WW4 A;  3PYE A;  2L2K B;  4OX9 I;  5IT9 C;  5GMD A;  1VIS A;  4NXN E;  4M2Z A;  1HNZ I;  3ZZ0 A;  3AV0 A;  1N36 I;  3QT5 A;  4JI1 E;  1HK7 A;  4F9C B;  1ELO A;  4KHP I;  4JV5 I;  3JU0 A;  5AE1 A;  2H36 X;  4OX9 E;  3GON A;  2IOP A;  5A2Q Q;  4JI4 I;  4DR6 I;  4YY3 E;  2JWO A;  1N36 E;  1Z5A A;  2KOU A;  4FWG A;  4WUB A;  4DPX A;  3K6Q A;  4DV1 I;  4UTG A;  5ADZ A;  1S16 A;  4KHP E;  2X7I A;  4DUY E;  1RC7 A;  3T1H E;  4DR7 I;  4R03 A;  1XNQ E;  2VQF I;  4X62 I;  1OJ4 A;  1GQE A;  2L2N A;  2V34 A;  1X47 A;  4LF7 I;  2CGE A;  1DAR A;  4N3O A;  3M6A A;  2LTS A;  4F9A B;  2UXB E;  2HFU A;  4JI5 E;  1STU A;  2K4V A;  2E1M A;  2JY9 A;  4KQV A;  3JAM Q;  4B3M E;  1Y6Z A;  2L3C A;  4X62 E;  1HNZ E;  5CFF E;  3VK6 A;  1KKH A;  5AAS A;  2GS8 A;  4LF6 E;  1T4N A;  1HR0 E;  4DUZ I;  1GZ6 A;  1Y4U A;  1EKZ A;  2V2V A;  5FLX Q;  2YZT A;  1I94 E;  4BBY A;  4BMJ A;  1Z0V A;  4B3M I;  1H73 A;  1Z5B A;  4IZK B;  4IZK A;  4DXL A;  2M4I A;  4HY1 A;  3LTO A;  4JV5 E;  2R42 A;  4OOG C;  1XHK A;  1J5E E;  4RPF A;  1HNX I;  3C4B A;  2VQF E;  4DR5 I;  2UXD I;  2ODR C;  3J80 Q;  2V8P A;  5F3W A;  2V86 A;  2F4V I;  3LLH A;  2LUP B;  4LF8 I;  1A6F A;  3P1X A;  2Z5E A;  1N32 I;  1XNQ I;  4J8Z A;  2V8Q B;  3HUL A;  4JG4 A;  4PRX A;  2KON A;  4PU9 A;  2FV4 B;  4B3T I;  2V2Q A;  1UEK A;  4LFB I;  4DPY A;  4LF9 E;  3F6G A;  1Z5C A;  2UUB E;  4Z7Y A;  1N32 E;  2Q2E B;  3ZKB A;  2A2C A;  4DV2 E;  1ZBQ A;  1WHQ A;  3B82 A;  2E5L I;  2N3H A;  4MYU A;  4AQY I;  3J80 C;  1HNX E;  2WZO A;  2EWL A;  3WU6 A;  4BC7 A;  1B63 A;  1MX0 A;  2ZBK B;  4DV6 E;  4DKK A;  4NXM E;  3PRY A;  4ZVI A;  2RTX A;  4AQY E;  4BCA A;  2RS7 A;  1ZXN A;  4YY3 I;  4JYA I;  2FGG A;  1XNR E;  4P7A A;  4B3S I;  3B78 A;  4LF6 I;  2DEJ A;  2EFG A;  1PVG A;  1Z0E A;  5BR8 E;  1UHZ A;  2L8T A;  2UU9 E;  2NUG A;  3B8H A;  2V2Z A;  3D4J A;  5LMU I;  4X66 E;  3T1Y E;  3ZZT A;  4HAC A;  4HAC B;  2L6M A;  3J81 C;  3K85 A;  1RQ0 A;  2MC5 A;  1Z0C A;  2UUC E;  5IWA E;  2OI2 A;  2UUB I;  3H4L A;  2ZM6 I;  2VF3 A;  4DV2 I;  1FWK A;  2B9D A;  1XMO I;  4JI3 I;  3IWC A;  4LF4 E;  1HR0 I;  5LMN I;  3JAM C;  2JOB A;  3QT6 A;  5T6J A;  3LPS A;  4DPU A;  4TUI A;  4DV0 E;  2CPN A;  4NXM I;  1XMO E;  4JI3 E;  2LUQ A;  2LBS B;  3J7Y p;  4DR7 E;  2MC6 A;  1S4E A;  4NXN I;  1T4O A;  2V87 A;  1ZXM A;  4DR3 E;  3FIG A;  2LTR A;  4P52 A;  4I3H A;  2X36 A;  2MDR A;  2EZ6 A;  4DV5 I;  4L5N C;  4L8N A;  1IBM E;  1Z0W A;  5L3J A;  1X48 A;  2E5L E;  2ZIT A;  2JR1 A;  1ZM4 A;  5GME A;  4DU7 A;  3KWR A;  1EA6 A;  4DV6 I;  2HK3 A;  1RR9 A;  3PYF A;  4DU8 A;  4K0K E;  2O1T A;  4X65 E;  1N34 I;  2L92 A;  2O1V A;  1J26 A;  4YHH E;  4JI6 E;  2NUE A;  2V89 A;  3T1H I;  4PRV A;  2B7V A;  4MYT A;  3H09 A;  1YZ9 A;  5FWK A;  4LTY A;  3ADL A;  2CZ9 A;  3ZOQ B;  1FNM A;  4DV3 E;  3JTZ A;  4DV4 E;  4DR4 E;  3CWV A;  4GKJ I;  2LE2 A;  5FLX C;  2UU9 I;  2V83 A;  5AE3 A;  1NHH A;  4DR1 E;  3RMP A;  2UUA E;  3Q6M A;  3WU5 A;  4WSP A;  4DR3 I;  4DUZ E;  2JVA A;  1HNW I;  4P78 A;  4JI2 E;  3ADJ A;  1QU6 A;  4KZS A;  3OTO I;  2HHH I;  1N0U A;  2KHX A;  4X64 E;  2UUA I;  2UXC I;  4JYA E;  2G7H A;  2AJ4 A;  4UT4 A;  4DV1 E;  2LJP A;  1MU5 A;  4M30 A;  3ZKD A;  4Q28 A;  1QZR A;  1DI2 A;  1FI4 A;  1H7U A;  5DNY A;  2NPF A;  4BC9 A;  1IBK I;  4JI8 I;  2PNL A;  2UXC E;  4HXZ A;  4JI1 I;  4F54 A;  4EMD A;  4URL A;  4JI7 I;  1WHN A;  4YHH I;  1IBL I;  2ODR D;  4JI6 I;  4GKJ E;  2UUC I;  1KIJ A;  2A2D A;  2HFS A;  5IWA I;  4LF8 E;  4JI4 E;  1FWL A;  4DR6 E;  5A2Q C;  1K47 A;  1X49 A;  4DR1 I;  5LL6 R;  1EI1 A;  2PNM A;  4DV7 I;  4M0V A;  1ZM9 A;  3ZZU A;  4DPT A;  1IBM I;  1HNW E;  4LF9 I;  2L2M A;  4USK A;  2IHR 1;  1Z0B A;  3V2U C;  4DV0 I;  2R3V A;  1T4L B;  3C4T A;  4LF5 E;  4WYQ B;  1B62 A;  3F6H A;  4WFT A;  5BR8 I;  2N3G A;  3J7A G;  1N0V C;  4FWH A;  2HKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...