2UUCE

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2uucE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2uucE02
4B3TI 2L3JA 4LF5E 4JI2E 2A2CA 4JI8E 3CWVA 2HK2A 3PYDA 4KQVA 5FLXQ 3PYEA 2N3GA 2HKEA 2UU9E 2EZ6A 4R1FA 1QZRA 4MYTA 1B62A 1HNXI 1FWKA 1XMOE 4LFCI 5CFFE 4HXZA 4Z7CA 4LF8E 4DR1E 4YHHE 4DR3I 3ADJA 3PYGA 4K0KI 1PVGA 4LF7E 1FNMA 4B3ME 1IBKE 3J81Q 1YYOA 2BM1A 2NUGA 2LJHA 1FKAE 2X7IA 4DV0E 2F4VI 3Q1QA 1I94I 3D4JA 5IWAE 3VYXA 3T1HI 4LFAE 1N34I 1IBLI 3B82A 4JI5I 2HHHI 4DR7E 2JVAA 1Z0WA 1H73A 3WU4A 4DUYI 2VQFI 1ZM4A 4I3HA 4X65E 1XMQE 3OTOE 1FJGI 4DUZI 1ELOA 4ZVIA 1ZM2A 1XNQI 2CZ9A 4B3SE 2BV3A 1KIJA 4JI6I 1T4OA 4OX9E 2L2KB 3T1YE 1NHJA 2OI2A 3VYYA 4DV7E 3ADIA 2LJPA 4B3TE 4FW9A 4DV5I 4GKJE 1A6FA 4LF4I 4JG4A 2DEIA 4X62E 4PU9A 3ZKDA 3J7AM 4AQYI 5GMDA 3LTOA 1HNXE 1RQ0A 1N32I 4JI4I 4GKKI 2R3VA 5L3JA 4LFCE 1VISA 4MYUA 2LTSA 1Z5CA 4DV4E 1XHKA 4LF9I 1X48A 2RSMA 3WU3A 5A2QQ 1N36I 4DR6I 4DXLA 3J81C 1N0VC 4K0KE 1ZXMA 2ZM6I 3M6AA 2RS6A 3LPSA 1J5EE 3WU5A 4LF6I 1I94E 1S16A 2E5LI 3K1JA 2HFUA 2RTXA 3T1HE 4OOGC 1Z0BA 4DR4I 1HNWI 1IBLE 1YZ9A 4JI5E 1UHZA 4DPXA 2HHHE 4DV2I 1WUUA 1O0WA 2XEXA 2VQFE 1WHNA 1DARA 1HNZI 5BR8I 4KHPI 3ZKBA 4FWGA 3ZM7A 1X47A 4JI7E 4DUZE 2LTRA 3J7AG 1QU6A 4P52A 4JI0E 4JI6E 3ZZ0A 4JI1E 3H4LA 3QT7A 2LUPB 2ZBKB 1Z0EA 4URLA 2BM0A 4HY1A 1T4NA 2A2DA 2UXCI 4DV5E 1STUA 1EKZA 5LMNI 4NXNE 3ZZUA 1FI4A 2LBSB 2UXDI 4JYAE 2B7VA 4P7AA 3QT8A 4AQYE 1NZ0A 1IBMI 1H7UA 3J7Yp 1U2RA 1N32E 1Z0VA 4JI4E 4GKKE 4JI2I 1RR9A 1Z59A 4NXMI 5A2QC 4LF9E 2B3TB 2UXBI 2DEJA 4ED4A 4YY3E 1HR0I 2UU9I 4X8WA 2UUBE 1H7SA 2NA2A 5LMUI 2AJ4A 4WUCA 3V5RA 2R42A 4DV6I 2ZM6E 1YYKA 3ZZTA 1N33I 1KKHA 2ZITA 3ADLA 4DR2I 5IT9Q 4EMDA 2E5LE 4USMA 4LF7I 2VQEI 4B3MI 4DPWA 2L33A 3ADGA 4B3RI 2B7TA 4DR4E 1HNWE 4DR5I 4DPUA 3LLHA 1ZXNA 3C4BA 4JI3I 2V8PA 5IWAI 4DV1I 2L2MA 3C4TA 3V2UC 1HNZE 4DR3E 1S4EA 4DU8A 4HACB 2KHXA 1Z5BA 2J7KA 3K17A 1T4LB 1ZM3A 2DMYA 3WU6A 1XNRI 4WUDA 1OJ4A 1UILA 2JY9A 1XMQI 2F4VE 4DV3I 3QT6A 1N34E 2UXCE 5LMNE 4OX9I 4X64I 2EFGA 3HTXA 5LL6R 2V2QA 1DI2A 3B8HA 1IBME 4DUYE 1NHHA 4X66I 4GKJI 4NXME 4X62I 2DIXA 4DKKA 1FJGE 2UXBE 1XNQE 4USKA 1HR0E 2LRSA 2UUAI 1H74A 4FWDA 2L3CA 5LMUE 2HKJA 2V2VA 2UUCI 2NUEA 4DV6E 4DV4I 4LFBI 1GQEA 1N33E 5IT9C 1MU5A 4DR2E 1YYWA 1ZBTA 4LF4E 2VQEE 3B78A 5GMEA 4B3RE 3J80Q 1UEKA 4JV5I 4DR5E 2VF3A 1J5EI 4PRVA 1KVKA 4LF5I 4JI3E 3JAMQ 1EI1A 4JI8I 4DV1E 4M30A 1Z5AA 1KTVA 2E1RA 1N36E 4DR6E 2N3HA 3GONA 1XMOI 2RS7A 2IHR1 1N0UA 2NUFA 1XNRE 4LF8I 3HULA 4DR1I 4DU7A 4YHHI 4FWHA 4WYQB 4JI7I 4LF6E 1FWLA 1PIEA 4PRXA 2YT4A 4DV3E 2LUQA 4WUBA 1IBKI 1WHQA 4HYMA 1EA6A 1ZM9A 4JI0I 4DPTA 4X64E 1RC7A 4DV0I 4JI1I 1NHIA 2DB2A 2L2NA 1J26A 4DV2E 3P1XA 4LFAI 4X66E 4KHPE 3QT5A 5BR8E 3LNUA 5FLXC 1D6TA 4NXNI 1K47A 1PKPA 4DR7I 1Z0GA 4JYAI 1B63A 2HK3A 4UT4A 2UUAE 2HFSA 4Z7YA 3PYFA 4X65I 2UUCE 1MX0A 3OTOI 2V34A 3F0NA 4LFBE 1MG7A 4M1KA 4YY3I 4FN5A 4B3SI 4HACA 4M2ZA 4RPFA 2UUBI 3J80C 4DPYA 1Z0TA 2WW4A 4WFTA 1X49A 2NPFA 3T1YI 1Z0CA 1BKNA 2CPNA 4JV5E 4UTGA 2V2ZA 2UXDE 2MDRA 1H72C 2Q2EB 4XTJA 2GS8A 2X36A 4DV7I 3JAMC 1RREA
chains in the Genus database with same CATH superfamily
4HEIA 2L3JA 4B3TI 4LF5E 2R1FA 2CT1A 1UBDC 2DRPA 4JI2E 2A2CA 2D9HA 2EL6A 2YTDA 4BA2B 5DNYA 5C0XB 1SFEA 4JI8E 3QG5C 3CWVA 3PS3A 2HK2A 2EPNA 3PYDA 4KQVA 2IOPA 4J8ZA 3DD6A 5KL4A 5FLXQ 2C38A 2N3GA 4BMJA 2HKEA 3PYEA 3HKMA 2UU9E 2EZ6A 1T38A 4R1FA 1QZRA 2IOQA 3BGHA 4MYTA 1B62A 2CGEA 4I8OA 3EPLA 3K85A 1FWKA 3PS2A 3BBGA 2EOSA 1XMOE 1HNXI 4LCFA 3BF2A 4LFCI 5CFFE 5FWKA 2EM4A 2R76A 4L5NC 2ADRA 3HQ1A 4Q35B 1USVA 4HXZA 2BA1D 3H1CA 4Z7CA 4LF8E 4DR1E 5A6KA 5KL2A 4YHHE 5DROA 1A1FA 2O1WA 4DR3I 2VRDA 3IWBA 2WP8B 3ADJA 3PYGA 1PJTA 3GCMA 4Q28A 4P7DA 2ENHA 4L8NA 4K0KI 1PVGA 1Y4SA 1IQOA 3F6HA 2NN6B 3GLLA 2PRTA 2EOHA 2ENCA 4LF7E 1FNMA 3Q6NA 1X6FA 2KONA 4B3ME 1X6EA 5IV8B 1IBKE 2YZTA 5DRQA 3J81Q 1YYOA 2WBTA 2BM1A 2NUGA 2LVHA 2LJHA 2EWLA 5JEAA 4OO1B 4IZKB 5AE1A 2JOXA 1FKAE 2X7IA 2EPOA 2O1UA 4DV0E 3CDJA 2F4VI 5K36A 2C39B 3Q1QA 1I94I 5KL6A 3HPZA 3D4JA 4M0VA 4U3BA 5IWAE 3VYXA 4MU3A 2EMGA 3T1HI 2EMZA 4LFAE 1N34I 1IBLI 2N8XA 5A69A 4NZVA 3B82A 4JI5I 4F9AB 2E1MA 5AE3A 1DGCA 2EL4A 2HHHI 4DR7E 2CVEA 2JVAA 2EPZA 2EPXA 1JK2A 1Z0WA 2IESA 3P3GA 4MU4A 1H73A 3WU4A 5C0XC 4DUYI 4R2AA 2VQFI 1BBGA 1XXEA 4LCGA 1ZM4A 4I3HA 2DMIA 4OO1D 3VHTB 1ZBQA 4X65E 4QNJA 2H36X 1KYQA 4ZYEA 1XMQE 3OTOE 4AIMA 4R8OA 5C0XF 4DUZI 1ELOA 1FJGI 4ZVIA 2EOJA 1ZM2A 5DNXA 2VE7C 1XNQI 2CZ9A 2F8BA 4B3SE 4MDTA 4LCHA 2K4VA 2RQLA 2BV3A 4QNKA 1KIJA 5KL7A 4JI6I 2ODRD 3L7ZB 1T4OA 4OX9E 2FGGA 2L2KB 4LTYA 3T1YE 1NHJA 2BR2B 1T39A 2OI2A 2PO2A 2EN4A 2EMAA 3VYYA 2EM7A 2NN6C 2CG9A 4DV7E 4BS9A 3ADIA 2LJPA 2K7IA 2JEAA 4B3TE 1P47A 4FW9A 4DV5I 4GKJE 1A6FA 4OO1C 4NBQA 5T6JA 4IFDA 4LF4I 2NN6F 4JG4A 3KZYA 1TF3A 2DEIA 2M4IA 4X62E 5JEAE 4PU9A 3ZKDA 1YSAC 3U1KA 3UK3C 3J7AM 2EQ3A 2EPMX 2EQ1A 4FK5C 4AQYI 2M7QA 4OO1F 1E3PA 5K36E 2YSPA 5GMDA 3LTOA 1RQ0A 1HNXE 1N32I 1G2DC 1DQ3A 2Z5CB 5A6BD 2O1TA 4JI4I 4GKKI 2R3VA 5F3WA 5L3JA 1A1JA 4LFCE 1VISA 2JE6A 4MYUA 2LE2A 2LTSA 2V85A 1Z5CA 2M1SA 4DV4E 1XHKA 5DRRA 4LF9I 2YSOA 1X48A 2RSMA 1A1IA 3WU3A 5DNLA 5A2QQ 1EH8A 1Y5YA 3UHMA 2PO0A 1A1KA 1N36I 3M85D 4DR6I 1GZ6A 2EN6A 3JTZA 4DXLA 2V89A 3J81C 2HC5A 1G2FC 4K0KE 1N0VC 1ZXMA 4MLVA 2RPCA 2V88A 2EJ4A 2MC6A 2JWOA 1F2IG 2YU8A 4F6MA 2YTIA 1UDNA 2DLKA 2ZM6I 5AC5A 1NEIA 2PNMA 2BA0D 2Z5BA 3M6AA 2RS6A 1R6MA 3LPSA 1J5EE 3WU5A 4O4KA 3Q6MA 2EORA 4LF6I 3MHHC 2EM8A 1I94E 1MEYC 2JXPA 1S16A 2E5LI 1ZR9A 5A6BA 3K1JA 2HFUA 5JEAD 2RTXA 3T1HE 4OOGC 5KL3A 1Z0BA 4DR4I 1HNWI 1IBLE 2PNZB 1QNTA 1YZ9A 4IJDA 5K36D 4JI5E 4FW6A 4FW3A 1UHZA 4DPXA 4BC9A 2LT7A 2HHHE 4AIDA 2EN8A 1AH5A 1KJKA 1Y6ZA 4N4RB 3AUZA 4DV2I 2YRMA 3DF6A 1WUUA 4GQUA 1O0WA 2XEXA 4N3OA 2IERA 2VQFE 1WHNA 4IFDE 1DARA 1HNZI 4FW5A 5BR8I 4KHPI 2EOQA 4BA2A 3ZKBA 1IQSA 4FWGA 3ZM7A 2EOFA 1X47A 2YTGA 2YTPA 4JI7E 2EPCA 2MKDA 2WBUA 4DUZE 2LTRA 4ZYHA 4MU0A 2BA0G 2CSHA 3J7AG 1QU6A 2GPIA 2I13A 4KZSA 4P52A 3HPSA 2EN2A 2GLIA 2WZOA 4MU1A 4JI0E 5JEAB 4R2RA 1EH6A 4JI6E 5LLQA 2YTQA 2CTDA 3ZZ0A 2VF1A 1YFHA 1TF6A 4JI1E 3H4LA 3QT7A 5K36B 2LUPB 3EPKA 2ZBKB 1Z0EA 4URLA 2L6MA 2BM0A 2EMKA 4R2QA 2YU5A 2WP8A 2YTFA 4BC7A 2DGCA 1Y4UA 1T4NA 4HY1A 4GZNC 2JR1A 2A2DA 2UXCI 1SR9A 4DV5E 1STUA 4RHBB 2NN6A 5ELWA 1EKZA 5LMNI 1A1HA 4NXNE 3ZZUA 1FI4A 2LBSB 1A1LA 3RMPA 4FW7A 5EL9A 4OO1A 2UXDI 4JYAE 2BA1G 2B7VA 4P7AA 3QT8A 5DRPA 4AQYE 1NZ0A 2GO4A 1H7UA 1IBMI 5KL5A 3J7Yp 1U2RA 4OKGA 1N32E 4IFDD 2DLQA 1Z0VA 4JI4E 4GKKE 5A6AA 1RR9A 4JI2I 1Z59A 2EMWA 4NXMI 5A2QC 2EPRA 2EMXA 2EPLX 1X5WA 2ENAA 4LF9E 4BA1A 2MC5A 2B3TB 1UDOA 3HJCA 2UXBI 2EP3A 2DEJA 2G7HA 4ED4A 2WNRA 4YY3E 1HR0I 2UU9I 4X8WA 2MKNA 1OYRA 3P06A 2UUBE 4R2EA 4R03A 1H7SA 2NA2A 1PJSA 3MHSC 2LO3A 2VESA 5LMUI 2AJ4A 4WUCA 3V5RA 1E3HA 2R42A 1JK1A 4DV6I 2ZM6E 1YYKA 3ZZTA 1VI7A 1N33I 1YPNA 2JP9A 2EM2A 2JOBA 2EPPA 1KKHA 2ZITA 3ADLA 2HJJA 4DR2I 2JEAB 5IT9Q 4EMDA 2I9IA 2GHFA 2E5LE 2ELYA 2HGHA 4USMA 5JEAC 4LF7I 1UN6B 2L8TA 4R2PA 2VQEI 4DPWA 1WXRA 4B3MI 2L33A 2PO1A 3ADGA 4B3RI 4IFDB 2B7TA 5AASA 2EMYA 4X9JA 4TUIA 4DR4E 1HNWE 4DR5I 5K36C 1YUJA 1OYSA 4DPUA 3LLHA 1ZXNA 5JEAF 1PDAA 5IXMB 2LMZA 3LMLA 2EOZA 3C4BA 3EPJA 4JI3I 4IZJA 2V8PA 4WXCA 5K36F 3KZZA 5IWAI 2EPUA 4DV1I 2NN6E 2L2MA 1WRJA 3C4TA 2KOUA 1HNZE 3GMEA 4DR3E 4IS9A 1S4EA 3V2UC 4DU8A 4HACB 2KHXA 1Z5BA 4OO1E 3ECRA 3MSWA 2J7KA 3K17A 1LLMC 4ISAA 5AE2A 3L00A 1T4LB 1ZM3A 4F2JC 2DMYA 1YH8A 4BBYA 4LPFA 3WU6A 4WUDA 1XNRI 2YTNA 2Z5BB 1Z1BA 1OJ4A 3F6GA 4O43A 2M9AA 3JU0A 1UILA 1A1GA 2JY9A 4MQYA 4GEQB 4BCAA 3M7ND 1XMQI 2F4VE 2JYAA 2Q8UA 3VK6A 1BBOA 2YTJA 2EMLA 1USUA 4DV3I 3IWCA 3QT6A 4HTGA 2YTEA 2JEBA 1N34E 2UXCE 3B4TA 3THOB 2DSYA 1R6LA 2C38B 2EMHA 2EOOA 5LMNE 2FTXB 4TUGA 3C6MA 4X64I 4OX9I 2EFGA 4WSPA 3HTXA 2F1DA 3IWDA 3DJWA 5LL6R 1WJPA 4F54A 2V2QA 3TQMA 1DI2A 3B8HA 3NZKA 1IBME 2EM6A 4R2CA 4IFDC 4DUYE 2C37A 2NN6D 3M85G 1NHHA 1UDSA 4X66I 3HXLA 4GKJI 2WCC3 4NXME 5C0XA 2A25A 2EOIA 4NHRA 4LOMA 4X62I 2DIXA 4DKKA 1ZU1A 1FJGE 2UXBE 4IFDF 2BBGA 2PNZA 1XNQE 2YTOA 4USKA 2EN3A 2LRSA 4R2SA 1HR0E 1MGTA 2UUAI 1UDQA 1H74A 4FWDA 5ADZA 2ODRC 3K6QA 1GTKA 2L3CA 4ZYGA 4M9VC 2EN1A 3M7NG 5LMUE 2HKJA 2V2VA 2UUCI 2NUEA 4DV6E 4DV4I 4LFBI 1GQEA 1N33E 2O1VA 5IT9C 2GQ0A 3BIDA 2WBSA 1MU5A 2PNLA 4DR2E 1YYWA 3ZOQB 1ZAAC 1ZBTA 4LF4E 2YWQA 3KWRA 2VQEE 3B78A 3PRYA 5GMEA 2EM3A 3P3EA 4B3RE 3KRNA 3J80Q 1UEKA 2YPNA 1AAYA 4JV5I 4DR5E 4IZKA 2VF3A 3U1YA 4AM3A 3H09A 2V8QB 1J5EI 4PRVA 1PJQA 4KWYA 1B69A 2C39A 1KVKA 4LF5I 3P3CA 4JI3E 2LJUA 3EQ1A 3OMLA 4WXDA 1X3CA 5TSEA 1EI1A 3JAMQ 4JI8I 2L92A 4DV1E 1TN9A 4U3DA 2J7JA 2YRKA 3THNA 4M30A 4LU9A 2Z5EA 1Z5AA 4BA1B 1KTVA 4WX9A 4R2DA 2E1RA 1N36E 2WNRB 4DR6E 2N3HA 3P76A 2EOEA 3GONA 2V86A 4IZJD 1XMOI 3M99B 2RS7A 3CDIA 2IHR1 4MLQA 2EMBA 4O24A 1N0UA 2NUFA 1XNRE 2PO2B 2EE8A 4LF8I 3HULA 4DR1I 4F9CB 5AC4A 4DU7A 5C0XE 4YHHI 4O5GA 2E72A 4FWHA 2BB8A 1YHCA 2EM0A 4WYQB 4JI7I 4LF6E 1FWLA 2EM5A 1RMDA 1PIEA 4PRXA 1OYPA 2FV4B 2YT4A 2V83A 2LUQA 4DV3E 4WUBA 1IBKI 2PO1B 1WHQA 1Y60A 1NCSA 4HYMA 1EA6A 2NABA 2O3ZA 1ZM9A 4JI0I 3L7ZA 3EPHA 4FW4A 1L4SA 4DPTA 2LCEA 4X64E 1RC7A 2BR2A 4BHCA 4DV0I 4JI1I 1NHIA 2DB2A 2EN7A 2L2NA 4IZJB 3FIGA 3PS1A 1J26A 4DV2E 2JE6B 2EMFA 3P1XA 2EPKX 4OZEA 4LFAI 4X66E 4KHPE 3QT5A 5BR8E 2B9DA 3LNUA 2PO0B 5FLXC 1D6TA 2J65A 4NXNI 2AE8A 2EOYA 2EPAA 1K47A 1PKPA 4WSGA 4DR7I 4WPYA 1EH7A 1Z0GA 4JYAI 1B63A 2HK3A 4DMIA 2RSIA 2YRHA 5EKWA 4UT4A 2ELZA 1X6HA 2LV2A 2UUAE 2HFSA 4Z7YA 2EL5A 1YUIA 2EMIA 1HK7A 2Z5CA 3PYFA 4BHBA 5C0XD 2JT2A 2EOXA 2EOMA 4X65I 2UUCE 4J3DA 1N3GA 1MX0A 2EM9A 3OTOI 3AV0A 2V34A 3F0NA 2JPAA 5A6JA 4LFBE 2EQ0A 4IS1C 1P42A 2GO3A 1MG7A 4M1KA 4YY3I 4FN5A 4B3SI 4HACA 4M2ZA 4RPFA 4ZYDA 4F9BB 2UUBI 1IMUA 2JEBB 1RHYA 3J80C 4RH8A 4DPYA 1Z0TA 2WW4A 4WFTA 1X49A 2NPFA 4F6NA 3T1YI 1Z0CA 2V87A 1BKNA 2CPNA 4JV5E 4UTGA 1BB8A 2V2ZA 2UXDE 2MDRA 2MDGA 1H72C 2Q2EB 4XTJA 2GS8A 3C6KA 2EMCA 2X36A 4DV7I 3JAMC 2C37B 1RREA 4P78A
chains in the Genus database with same CATH topology
4B3TI 2L3JA 4LF5E 4JI2E 2A2CA 5DNYA 4JI8E 3CWVA 2HK2A 3PYDA 4KQVA 2IOPA 4J8ZA 5FLXQ 3PYEA 2N3GA 4BMJA 2HKEA 2UU9E 2EZ6A 4R1FA 1QZRA 2IOQA 4MYTA 1B62A 2CGEA 4I8OA 3K85A 1HNXI 1FWKA 1XMOE 4LFCI 5CFFE 5FWKA 4L5NC 3HQ1A 1USVA 4HXZA 4Z7CA 4LF8E 4DR1E 4YHHE 2O1WA 4DR3I 3IWBA 3ADJA 3PYGA 4Q28A 4P7DA 4L8NA 4K0KI 1PVGA 1Y4SA 3F6HA 4LF7E 1FNMA 3Q6NA 2KONA 4B3ME 1IBKE 2YZTA 3J81Q 1YYOA 2BM1A 2NUGA 2LJHA 2EWLA 4IZKB 5AE1A 2JOXA 1FKAE 2X7IA 2O1UA 4DV0E 2F4VI 3Q1QA 1I94I 3HPZA 3D4JA 4M0VA 5IWAE 3VYXA 3T1HI 4LFAE 1N34I 1IBLI 3B82A 4JI5I 4F9AB 2E1MA 5AE3A 2HHHI 4DR7E 2JVAA 1Z0WA 1H73A 3WU4A 4DUYI 2VQFI 1ZM4A 4I3HA 1ZBQA 4X65E 2H36X 1XMQE 3OTOE 4R8OA 1FJGI 4DUZI 1ELOA 4ZVIA 1ZM2A 2VE7C 1XNQI 2CZ9A 2F8BA 4B3SE 2K4VA 2BV3A 1KIJA 4JI6I 2ODRD 1T4OA 4OX9E 2FGGA 2L2KB 4LTYA 3T1YE 1NHJA 2OI2A 3VYYA 2CG9A 4DV7E 4BS9A 3ADIA 2LJPA 4B3TE 4FW9A 4DV5I 4GKJE 1A6FA 5T6JA 4LF4I 4JG4A 2DEIA 2M4IA 4X62E 4PU9A 3ZKDA 3J7AM 4AQYI 2M7QA 5GMDA 3LTOA 1HNXE 1RQ0A 1N32I 1DQ3A 2Z5CB 2O1TA 4JI4I 4GKKI 2R3VA 5F3WA 5L3JA 4LFCE 1VISA 4MYUA 2LE2A 2LTSA 2V85A 1Z5CA 2M1SA 4DV4E 1XHKA 4LF9I 1X48A 2RSMA 3WU3A 5A2QQ 1N36I 4DR6I 1GZ6A 3JTZA 4DXLA 2V89A 3J81C 1N0VC 4K0KE 1ZXMA 2V88A 2MC6A 2JWOA 2ZM6I 2PNMA 2Z5BA 3M6AA 2RS6A 3LPSA 1J5EE 3WU5A 3Q6MA 4LF6I 1I94E 1S16A 2E5LI 3K1JA 2HFUA 2RTXA 3T1HE 4OOGC 1Z0BA 4DR4I 1HNWI 1IBLE 1YZ9A 4JI5E 1UHZA 4DPXA 4BC9A 2HHHE 1Y6ZA 3AUZA 4DV2I 3DF6A 1WUUA 1O0WA 2XEXA 4N3OA 2VQFE 1WHNA 1DARA 1HNZI 5BR8I 4KHPI 3ZKBA 4FWGA 3ZM7A 1X47A 4JI7E 4DUZE 2LTRA 3J7AG 1QU6A 4P52A 4KZSA 3HPSA 2WZOA 4JI0E 4JI6E 3ZZ0A 2VF1A 4JI1E 3H4LA 3QT7A 2LUPB 2ZBKB 1Z0EA 4URLA 2L6MA 2BM0A 4BC7A 1Y4UA 4HY1A 1T4NA 2JR1A 2A2DA 2UXCI 1SR9A 4DV5E 1STUA 1EKZA 5LMNI 4NXNE 3ZZUA 1FI4A 2LBSB 3RMPA 2UXDI 4JYAE 2B7VA 4P7AA 3QT8A 4AQYE 1NZ0A 1IBMI 1H7UA 3J7Yp 1U2RA 1N32E 1Z0VA 4JI4E 4GKKE 4JI2I 1RR9A 1Z59A 4NXMI 5A2QC 4LF9E 2MC5A 2B3TB 2UXBI 3HJCA 2DEJA 2G7HA 4ED4A 4YY3E 1HR0I 2UU9I 4X8WA 3P06A 2UUBE 4R03A 1H7SA 2NA2A 5LMUI 2AJ4A 4WUCA 3V5RA 2R42A 4DV6I 2ZM6E 1YYKA 3ZZTA 1N33I 2JOBA 1KKHA 2ZITA 3ADLA 4DR2I 5IT9Q 4EMDA 2E5LE 4USMA 4LF7I 2L8TA 2VQEI 4B3MI 4DPWA 1WXRA 2L33A 3ADGA 4B3RI 2B7TA 5AASA 4TUIA 4DR4E 1HNWE 4DR5I 4DPUA 3LLHA 1ZXNA 2LMZA 3LMLA 3C4BA 4JI3I 4IZJA 2V8PA 5IWAI 4DV1I 2L2MA 3C4TA 3V2UC 2KOUA 1HNZE 4DR3E 1S4EA 4DU8A 4HACB 2KHXA 1Z5BA 3MSWA 2J7KA 3K17A 5AE2A 1T4LB 1ZM3A 2DMYA 4BBYA 3WU6A 1XNRI 4WUDA 2Z5BB 1OJ4A 3F6GA 3JU0A 1UILA 2JY9A 4GEQB 4BCAA 1XMQI 2F4VE 3VK6A 1USUA 4DV3I 3IWCA 3QT6A 1N34E 2UXCE 2DSYA 5LMNE 2FTXB 4TUGA 4X64I 4OX9I 2EFGA 4WSPA 3HTXA 3IWDA 3DJWA 5LL6R 4F54A 2V2QA 1DI2A 3B8HA 1IBME 4DUYE 1NHHA 4X66I 3HXLA 4GKJI 4NXME 4X62I 2DIXA 4DKKA 1FJGE 2UXBE 1XNQE 4USKA 1HR0E 2LRSA 2UUAI 1H74A 4FWDA 5ADZA 2ODRC 3K6QA 2L3CA 5LMUE 2HKJA 2V2VA 2UUCI 2NUEA 4DV6E 4DV4I 4LFBI 1GQEA 1N33E 2O1VA 5IT9C 2GQ0A 1MU5A 2PNLA 4DR2E 1YYWA 3ZOQB 1ZBTA 4LF4E 3KWRA 2VQEE 3B78A 3PRYA 5GMEA 4B3RE 3J80Q 1UEKA 4JV5I 4DR5E 4IZKA 2VF3A 3H09A 2V8QB 1J5EI 4PRVA 1KVKA 4LF5I 4JI3E 3OMLA 3JAMQ 1EI1A 4JI8I 2L92A 4DV1E 2Z5EA 4M30A 4LU9A 1Z5AA 1KTVA 2E1RA 1N36E 4DR6E 2N3HA 3GONA 2V86A 4IZJD 1XMOI 2RS7A 2IHR1 1N0UA 2NUFA 1XNRE 4LF8I 3HULA 4DR1I 4F9CB 4DU7A 4YHHI 4FWHA 4WYQB 4JI7I 4LF6E 1FWLA 1PIEA 4PRXA 2FV4B 2YT4A 2V83A 2LUQA 4DV3E 4WUBA 1IBKI 1WHQA 4HYMA 1EA6A 1ZM9A 4JI0I 4DPTA 4X64E 1RC7A 4DV0I 4JI1I 1NHIA 2DB2A 2L2NA 4IZJB 3FIGA 1J26A 4DV2E 3P1XA 4LFAI 4X66E 4KHPE 3QT5A 5BR8E 2B9DA 3LNUA 5FLXC 1D6TA 4NXNI 1K47A 1PKPA 4DR7I 4WPYA 1Z0GA 4JYAI 1B63A 2HK3A 4DMIA 4UT4A 2UUAE 2HFSA 4Z7YA 2Z5CA 1HK7A 3PYFA 4X65I 2UUCE 1MX0A 3OTOI 3AV0A 2V34A 3F0NA 4LFBE 1MG7A 4M1KA 4YY3I 4FN5A 4B3SI 4HACA 4M2ZA 4RPFA 4F9BB 2UUBI 3J80C 4DPYA 1Z0TA 2WW4A 4WFTA 1X49A 2NPFA 3T1YI 1Z0CA 2V87A 1BKNA 2CPNA 4JV5E 4UTGA 2V2ZA 2UXDE 2MDRA 1H72C 2Q2EB 4XTJA 2GS8A 2X36A 4DV7I 3JAMC 1RREA 4P78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T I;  2L3J A;  4LF5 E;  4JI2 E;  2A2C A;  4JI8 E;  3CWV A;  2HK2 A;  3PYD A;  4KQV A;  5FLX Q;  3PYE A;  2N3G A;  2HKE A;  2UU9 E;  2EZ6 A;  4R1F A;  1QZR A;  4MYT A;  1B62 A;  1HNX I;  1FWK A;  1XMO E;  4LFC I;  5CFF E;  4HXZ A;  4Z7C A;  4LF8 E;  4DR1 E;  4YHH E;  4DR3 I;  3ADJ A;  3PYG A;  4K0K I;  1PVG A;  4LF7 E;  1FNM A;  4B3M E;  1IBK E;  3J81 Q;  1YYO A;  2BM1 A;  2NUG A;  2LJH A;  1FKA E;  2X7I A;  4DV0 E;  2F4V I;  3Q1Q A;  1I94 I;  3D4J A;  5IWA E;  3VYX A;  3T1H I;  4LFA E;  1N34 I;  1IBL I;  3B82 A;  4JI5 I;  2HHH I;  4DR7 E;  2JVA A;  1Z0W A;  1H73 A;  3WU4 A;  4DUY I;  2VQF I;  1ZM4 A;  4I3H A;  4X65 E;  1XMQ E;  3OTO E;  1FJG I;  4DUZ I;  1ELO A;  4ZVI A;  1ZM2 A;  1XNQ I;  2CZ9 A;  4B3S E;  2BV3 A;  1KIJ A;  4JI6 I;  1T4O A;  4OX9 E;  2L2K B;  3T1Y E;  1NHJ A;  2OI2 A;  3VYY A;  4DV7 E;  3ADI A;  2LJP A;  4B3T E;  4FW9 A;  4DV5 I;  4GKJ E;  1A6F A;  4LF4 I;  4JG4 A;  2DEI A;  4X62 E;  4PU9 A;  3ZKD A;  3J7A M;  4AQY I;  5GMD A;  3LTO A;  1HNX E;  1RQ0 A;  1N32 I;  4JI4 I;  4GKK I;  2R3V A;  5L3J A;  4LFC E;  1VIS A;  4MYU A;  2LTS A;  1Z5C A;  4DV4 E;  1XHK A;  4LF9 I;  1X48 A;  2RSM A;  3WU3 A;  5A2Q Q;  1N36 I;  4DR6 I;  4DXL A;  3J81 C;  1N0V C;  4K0K E;  1ZXM A;  2ZM6 I;  3M6A A;  2RS6 A;  3LPS A;  1J5E E;  3WU5 A;  4LF6 I;  1I94 E;  1S16 A;  2E5L I;  3K1J A;  2HFU A;  2RTX A;  3T1H E;  4OOG C;  1Z0B A;  4DR4 I;  1HNW I;  1IBL E;  1YZ9 A;  4JI5 E;  1UHZ A;  4DPX A;  2HHH E;  4DV2 I;  1WUU A;  1O0W A;  2XEX A;  2VQF E;  1WHN A;  1DAR A;  1HNZ I;  5BR8 I;  4KHP I;  3ZKB A;  4FWG A;  3ZM7 A;  1X47 A;  4JI7 E;  4DUZ E;  2LTR A;  3J7A G;  1QU6 A;  4P52 A;  4JI0 E;  4JI6 E;  3ZZ0 A;  4JI1 E;  3H4L A;  3QT7 A;  2LUP B;  2ZBK B;  1Z0E A;  4URL A;  2BM0 A;  4HY1 A;  1T4N A;  2A2D A;  2UXC I;  4DV5 E;  1STU A;  1EKZ A;  5LMN I;  4NXN E;  3ZZU A;  1FI4 A;  2LBS B;  2UXD I;  4JYA E;  2B7V A;  4P7A A;  3QT8 A;  4AQY E;  1NZ0 A;  1IBM I;  1H7U A;  3J7Y p;  1U2R A;  1N32 E;  1Z0V A;  4JI4 E;  4GKK E;  4JI2 I;  1RR9 A;  1Z59 A;  4NXM I;  5A2Q C;  4LF9 E;  2B3T B;  2UXB I;  2DEJ A;  4ED4 A;  4YY3 E;  1HR0 I;  2UU9 I;  4X8W A;  2UUB E;  1H7S A;  2NA2 A;  5LMU I;  2AJ4 A;  4WUC A;  3V5R A;  2R42 A;  4DV6 I;  2ZM6 E;  1YYK A;  3ZZT A;  1N33 I;  1KKH A;  2ZIT A;  3ADL A;  4DR2 I;  5IT9 Q;  4EMD A;  2E5L E;  4USM A;  4LF7 I;  2VQE I;  4B3M I;  4DPW A;  2L33 A;  3ADG A;  4B3R I;  2B7T A;  4DR4 E;  1HNW E;  4DR5 I;  4DPU A;  3LLH A;  1ZXN A;  3C4B A;  4JI3 I;  2V8P A;  5IWA I;  4DV1 I;  2L2M A;  3C4T A;  3V2U C;  1HNZ E;  4DR3 E;  1S4E A;  4DU8 A;  4HAC B;  2KHX A;  1Z5B A;  2J7K A;  3K17 A;  1T4L B;  1ZM3 A;  2DMY A;  3WU6 A;  1XNR I;  4WUD A;  1OJ4 A;  1UIL A;  2JY9 A;  1XMQ I;  2F4V E;  4DV3 I;  3QT6 A;  1N34 E;  2UXC E;  5LMN E;  4OX9 I;  4X64 I;  2EFG A;  3HTX A;  5LL6 R;  2V2Q A;  1DI2 A;  3B8H A;  1IBM E;  4DUY E;  1NHH A;  4X66 I;  4GKJ I;  4NXM E;  4X62 I;  2DIX A;  4DKK A;  1FJG E;  2UXB E;  1XNQ E;  4USK A;  1HR0 E;  2LRS A;  2UUA I;  1H74 A;  4FWD A;  2L3C A;  5LMU E;  2HKJ A;  2V2V A;  2UUC I;  2NUE A;  4DV6 E;  4DV4 I;  4LFB I;  1GQE A;  1N33 E;  5IT9 C;  1MU5 A;  4DR2 E;  1YYW A;  1ZBT A;  4LF4 E;  2VQE E;  3B78 A;  5GME A;  4B3R E;  3J80 Q;  1UEK A;  4JV5 I;  4DR5 E;  2VF3 A;  1J5E I;  4PRV A;  1KVK A;  4LF5 I;  4JI3 E;  3JAM Q;  1EI1 A;  4JI8 I;  4DV1 E;  4M30 A;  1Z5A A;  1KTV A;  2E1R A;  1N36 E;  4DR6 E;  2N3H A;  3GON A;  1XMO I;  2RS7 A;  2IHR 1;  1N0U A;  2NUF A;  1XNR E;  4LF8 I;  3HUL A;  4DR1 I;  4DU7 A;  4YHH I;  4FWH A;  4WYQ B;  4JI7 I;  4LF6 E;  1FWL A;  1PIE A;  4PRX A;  2YT4 A;  4DV3 E;  2LUQ A;  4WUB A;  1IBK I;  1WHQ A;  4HYM A;  1EA6 A;  1ZM9 A;  4JI0 I;  4DPT A;  4X64 E;  1RC7 A;  4DV0 I;  4JI1 I;  1NHI A;  2DB2 A;  2L2N A;  1J26 A;  4DV2 E;  3P1X A;  4LFA I;  4X66 E;  4KHP E;  3QT5 A;  5BR8 E;  3LNU A;  5FLX C;  1D6T A;  4NXN I;  1K47 A;  1PKP A;  4DR7 I;  1Z0G A;  4JYA I;  1B63 A;  2HK3 A;  4UT4 A;  2UUA E;  2HFS A;  4Z7Y A;  3PYF A;  4X65 I;  2UUC E;  1MX0 A;  3OTO I;  2V34 A;  3F0N A;  4LFB E;  1MG7 A;  4M1K A;  4YY3 I;  4FN5 A;  4B3S I;  4HAC A;  4M2Z A;  4RPF A;  2UUB I;  3J80 C;  4DPY A;  1Z0T A;  2WW4 A;  4WFT A;  1X49 A;  2NPF A;  3T1Y I;  1Z0C A;  1BKN A;  2CPN A;  4JV5 E;  4UTG A;  2V2Z A;  2UXD E;  2MDR A;  1H72 C;  2Q2E B;  4XTJ A;  2GS8 A;  2X36 A;  4DV7 I;  3JAM C;  1RRE A; 
#chains in the Genus database with same CATH topology
 4HEI A;  2L3J A;  4B3T I;  4LF5 E;  2R1F A;  2CT1 A;  1UBD C;  2DRP A;  4JI2 E;  2A2C A;  2D9H A;  2EL6 A;  2YTD A;  4BA2 B;  5DNY A;  5C0X B;  1SFE A;  4JI8 E;  3QG5 C;  3CWV A;  3PS3 A;  2HK2 A;  2EPN A;  3PYD A;  4KQV A;  2IOP A;  4J8Z A;  3DD6 A;  5KL4 A;  5FLX Q;  2C38 A;  2N3G A;  4BMJ A;  2HKE A;  3PYE A;  3HKM A;  2UU9 E;  2EZ6 A;  1T38 A;  4R1F A;  1QZR A;  2IOQ A;  3BGH A;  4MYT A;  1B62 A;  2CGE A;  4I8O A;  3EPL A;  3K85 A;  1FWK A;  3PS2 A;  3BBG A;  2EOS A;  1XMO E;  1HNX I;  4LCF A;  3BF2 A;  4LFC I;  5CFF E;  5FWK A;  2EM4 A;  2R76 A;  4L5N C;  2ADR A;  3HQ1 A;  4Q35 B;  1USV A;  4HXZ A;  2BA1 D;  3H1C A;  4Z7C A;  4LF8 E;  4DR1 E;  5A6K A;  5KL2 A;  4YHH E;  5DRO A;  1A1F A;  2O1W A;  4DR3 I;  2VRD A;  3IWB A;  2WP8 B;  3ADJ A;  3PYG A;  1PJT A;  3GCM A;  4Q28 A;  4P7D A;  2ENH A;  4L8N A;  4K0K I;  1PVG A;  1Y4S A;  1IQO A;  3F6H A;  2NN6 B;  3GLL A;  2PRT A;  2EOH A;  2ENC A;  4LF7 E;  1FNM A;  3Q6N A;  1X6F A;  2KON A;  4B3M E;  1X6E A;  5IV8 B;  1IBK E;  2YZT A;  5DRQ A;  3J81 Q;  1YYO A;  2WBT A;  2BM1 A;  2NUG A;  2LVH A;  2LJH A;  2EWL A;  5JEA A;  4OO1 B;  4IZK B;  5AE1 A;  2JOX A;  1FKA E;  2X7I A;  2EPO A;  2O1U A;  4DV0 E;  3CDJ A;  2F4V I;  5K36 A;  2C39 B;  3Q1Q A;  1I94 I;  5KL6 A;  3HPZ A;  3D4J A;  4M0V A;  4U3B A;  5IWA E;  3VYX A;  4MU3 A;  2EMG A;  3T1H I;  2EMZ A;  4LFA E;  1N34 I;  1IBL I;  2N8X A;  5A69 A;  4NZV A;  3B82 A;  4JI5 I;  4F9A B;  2E1M A;  5AE3 A;  1DGC A;  2EL4 A;  2HHH I;  4DR7 E;  2CVE A;  2JVA A;  2EPZ A;  2EPX A;  1JK2 A;  1Z0W A;  2IES A;  3P3G A;  4MU4 A;  1H73 A;  3WU4 A;  5C0X C;  4DUY I;  4R2A A;  2VQF I;  1BBG A;  1XXE A;  4LCG A;  1ZM4 A;  4I3H A;  2DMI A;  4OO1 D;  3VHT B;  1ZBQ A;  4X65 E;  4QNJ A;  2H36 X;  1KYQ A;  4ZYE A;  1XMQ E;  3OTO E;  4AIM A;  4R8O A;  5C0X F;  4DUZ I;  1ELO A;  1FJG I;  4ZVI A;  2EOJ A;  1ZM2 A;  5DNX A;  2VE7 C;  1XNQ I;  2CZ9 A;  2F8B A;  4B3S E;  4MDT A;  4LCH A;  2K4V A;  2RQL A;  2BV3 A;  4QNK A;  1KIJ A;  5KL7 A;  4JI6 I;  2ODR D;  3L7Z B;  1T4O A;  4OX9 E;  2FGG A;  2L2K B;  4LTY A;  3T1Y E;  1NHJ A;  2BR2 B;  1T39 A;  2OI2 A;  2PO2 A;  2EN4 A;  2EMA A;  3VYY A;  2EM7 A;  2NN6 C;  2CG9 A;  4DV7 E;  4BS9 A;  3ADI A;  2LJP A;  2K7I A;  2JEA A;  4B3T E;  1P47 A;  4FW9 A;  4DV5 I;  4GKJ E;  1A6F A;  4OO1 C;  4NBQ A;  5T6J A;  4IFD A;  4LF4 I;  2NN6 F;  4JG4 A;  3KZY A;  1TF3 A;  2DEI A;  2M4I A;  4X62 E;  5JEA E;  4PU9 A;  3ZKD A;  1YSA C;  3U1K A;  3UK3 C;  3J7A M;  2EQ3 A;  2EPM X;  2EQ1 A;  4FK5 C;  4AQY I;  2M7Q A;  4OO1 F;  1E3P A;  5K36 E;  2YSP A;  5GMD A;  3LTO A;  1RQ0 A;  1HNX E;  1N32 I;  1G2D C;  1DQ3 A;  2Z5C B;  5A6B D;  2O1T A;  4JI4 I;  4GKK I;  2R3V A;  5F3W A;  5L3J A;  1A1J A;  4LFC E;  1VIS A;  2JE6 A;  4MYU A;  2LE2 A;  2LTS A;  2V85 A;  1Z5C A;  2M1S A;  4DV4 E;  1XHK A;  5DRR A;  4LF9 I;  2YSO A;  1X48 A;  2RSM A;  1A1I A;  3WU3 A;  5DNL A;  5A2Q Q;  1EH8 A;  1Y5Y A;  3UHM A;  2PO0 A;  1A1K A;  1N36 I;  3M85 D;  4DR6 I;  1GZ6 A;  2EN6 A;  3JTZ A;  4DXL A;  2V89 A;  3J81 C;  2HC5 A;  1G2F C;  4K0K E;  1N0V C;  1ZXM A;  4MLV A;  2RPC A;  2V88 A;  2EJ4 A;  2MC6 A;  2JWO A;  1F2I G;  2YU8 A;  4F6M A;  2YTI A;  1UDN A;  2DLK A;  2ZM6 I;  5AC5 A;  1NEI A;  2PNM A;  2BA0 D;  2Z5B A;  3M6A A;  2RS6 A;  1R6M A;  3LPS A;  1J5E E;  3WU5 A;  4O4K A;  3Q6M A;  2EOR A;  4LF6 I;  3MHH C;  2EM8 A;  1I94 E;  1MEY C;  2JXP A;  1S16 A;  2E5L I;  1ZR9 A;  5A6B A;  3K1J A;  2HFU A;  5JEA D;  2RTX A;  3T1H E;  4OOG C;  5KL3 A;  1Z0B A;  4DR4 I;  1HNW I;  1IBL E;  2PNZ B;  1QNT A;  1YZ9 A;  4IJD A;  5K36 D;  4JI5 E;  4FW6 A;  4FW3 A;  1UHZ A;  4DPX A;  4BC9 A;  2LT7 A;  2HHH E;  4AID A;  2EN8 A;  1AH5 A;  1KJK A;  1Y6Z A;  4N4R B;  3AUZ A;  4DV2 I;  2YRM A;  3DF6 A;  1WUU A;  4GQU A;  1O0W A;  2XEX A;  4N3O A;  2IER A;  2VQF E;  1WHN A;  4IFD E;  1DAR A;  1HNZ I;  4FW5 A;  5BR8 I;  4KHP I;  2EOQ A;  4BA2 A;  3ZKB A;  1IQS A;  4FWG A;  3ZM7 A;  2EOF A;  1X47 A;  2YTG A;  2YTP A;  4JI7 E;  2EPC A;  2MKD A;  2WBU A;  4DUZ E;  2LTR A;  4ZYH A;  4MU0 A;  2BA0 G;  2CSH A;  3J7A G;  1QU6 A;  2GPI A;  2I13 A;  4KZS A;  4P52 A;  3HPS A;  2EN2 A;  2GLI A;  2WZO A;  4MU1 A;  4JI0 E;  5JEA B;  4R2R A;  1EH6 A;  4JI6 E;  5LLQ A;  2YTQ A;  2CTD A;  3ZZ0 A;  2VF1 A;  1YFH A;  1TF6 A;  4JI1 E;  3H4L A;  3QT7 A;  5K36 B;  2LUP B;  3EPK A;  2ZBK B;  1Z0E A;  4URL A;  2L6M A;  2BM0 A;  2EMK A;  4R2Q A;  2YU5 A;  2WP8 A;  2YTF A;  4BC7 A;  2DGC A;  1Y4U A;  1T4N A;  4HY1 A;  4GZN C;  2JR1 A;  2A2D A;  2UXC I;  1SR9 A;  4DV5 E;  1STU A;  4RHB B;  2NN6 A;  5ELW A;  1EKZ A;  5LMN I;  1A1H A;  4NXN E;  3ZZU A;  1FI4 A;  2LBS B;  1A1L A;  3RMP A;  4FW7 A;  5EL9 A;  4OO1 A;  2UXD I;  4JYA E;  2BA1 G;  2B7V A;  4P7A A;  3QT8 A;  5DRP A;  4AQY E;  1NZ0 A;  2GO4 A;  1H7U A;  1IBM I;  5KL5 A;  3J7Y p;  1U2R A;  4OKG A;  1N32 E;  4IFD D;  2DLQ A;  1Z0V A;  4JI4 E;  4GKK E;  5A6A A;  1RR9 A;  4JI2 I;  1Z59 A;  2EMW A;  4NXM I;  5A2Q C;  2EPR A;  2EMX A;  2EPL X;  1X5W A;  2ENA A;  4LF9 E;  4BA1 A;  2MC5 A;  2B3T B;  1UDO A;  3HJC A;  2UXB I;  2EP3 A;  2DEJ A;  2G7H A;  4ED4 A;  2WNR A;  4YY3 E;  1HR0 I;  2UU9 I;  4X8W A;  2MKN A;  1OYR A;  3P06 A;  2UUB E;  4R2E A;  4R03 A;  1H7S A;  2NA2 A;  1PJS A;  3MHS C;  2LO3 A;  2VES A;  5LMU I;  2AJ4 A;  4WUC A;  3V5R A;  1E3H A;  2R42 A;  1JK1 A;  4DV6 I;  2ZM6 E;  1YYK A;  3ZZT A;  1VI7 A;  1N33 I;  1YPN A;  2JP9 A;  2EM2 A;  2JOB A;  2EPP A;  1KKH A;  2ZIT A;  3ADL A;  2HJJ A;  4DR2 I;  2JEA B;  5IT9 Q;  4EMD A;  2I9I A;  2GHF A;  2E5L E;  2ELY A;  2HGH A;  4USM A;  5JEA C;  4LF7 I;  1UN6 B;  2L8T A;  4R2P A;  2VQE I;  4DPW A;  1WXR A;  4B3M I;  2L33 A;  2PO1 A;  3ADG A;  4B3R I;  4IFD B;  2B7T A;  5AAS A;  2EMY A;  4X9J A;  4TUI A;  4DR4 E;  1HNW E;  4DR5 I;  5K36 C;  1YUJ A;  1OYS A;  4DPU A;  3LLH A;  1ZXN A;  5JEA F;  1PDA A;  5IXM B;  2LMZ A;  3LML A;  2EOZ A;  3C4B A;  3EPJ A;  4JI3 I;  4IZJ A;  2V8P A;  4WXC A;  5K36 F;  3KZZ A;  5IWA I;  2EPU A;  4DV1 I;  2NN6 E;  2L2M A;  1WRJ A;  3C4T A;  2KOU A;  1HNZ E;  3GME A;  4DR3 E;  4IS9 A;  1S4E A;  3V2U C;  4DU8 A;  4HAC B;  2KHX A;  1Z5B A;  4OO1 E;  3ECR A;  3MSW A;  2J7K A;  3K17 A;  1LLM C;  4ISA A;  5AE2 A;  3L00 A;  1T4L B;  1ZM3 A;  4F2J C;  2DMY A;  1YH8 A;  4BBY A;  4LPF A;  3WU6 A;  4WUD A;  1XNR I;  2YTN A;  2Z5B B;  1Z1B A;  1OJ4 A;  3F6G A;  4O43 A;  2M9A A;  3JU0 A;  1UIL A;  1A1G A;  2JY9 A;  4MQY A;  4GEQ B;  4BCA A;  3M7N D;  1XMQ I;  2F4V E;  2JYA A;  2Q8U A;  3VK6 A;  1BBO A;  2YTJ A;  2EML A;  1USU A;  4DV3 I;  3IWC A;  3QT6 A;  4HTG A;  2YTE A;  2JEB A;  1N34 E;  2UXC E;  3B4T A;  3THO B;  2DSY A;  1R6L A;  2C38 B;  2EMH A;  2EOO A;  5LMN E;  2FTX B;  4TUG A;  3C6M A;  4X64 I;  4OX9 I;  2EFG A;  4WSP A;  3HTX A;  2F1D A;  3IWD A;  3DJW A;  5LL6 R;  1WJP A;  4F54 A;  2V2Q A;  3TQM A;  1DI2 A;  3B8H A;  3NZK A;  1IBM E;  2EM6 A;  4R2C A;  4IFD C;  4DUY E;  2C37 A;  2NN6 D;  3M85 G;  1NHH A;  1UDS A;  4X66 I;  3HXL A;  4GKJ I;  2WCC 3;  4NXM E;  5C0X A;  2A25 A;  2EOI A;  4NHR A;  4LOM A;  4X62 I;  2DIX A;  4DKK A;  1ZU1 A;  1FJG E;  2UXB E;  4IFD F;  2BBG A;  2PNZ A;  1XNQ E;  2YTO A;  4USK A;  2EN3 A;  2LRS A;  4R2S A;  1HR0 E;  1MGT A;  2UUA I;  1UDQ A;  1H74 A;  4FWD A;  5ADZ A;  2ODR C;  3K6Q A;  1GTK A;  2L3C A;  4ZYG A;  4M9V C;  2EN1 A;  3M7N G;  5LMU E;  2HKJ A;  2V2V A;  2UUC I;  2NUE A;  4DV6 E;  4DV4 I;  4LFB I;  1GQE A;  1N33 E;  2O1V A;  5IT9 C;  2GQ0 A;  3BID A;  2WBS A;  1MU5 A;  2PNL A;  4DR2 E;  1YYW A;  3ZOQ B;  1ZAA C;  1ZBT A;  4LF4 E;  2YWQ A;  3KWR A;  2VQE E;  3B78 A;  3PRY A;  5GME A;  2EM3 A;  3P3E A;  4B3R E;  3KRN A;  3J80 Q;  1UEK A;  2YPN A;  1AAY A;  4JV5 I;  4DR5 E;  4IZK A;  2VF3 A;  3U1Y A;  4AM3 A;  3H09 A;  2V8Q B;  1J5E I;  4PRV A;  1PJQ A;  4KWY A;  1B69 A;  2C39 A;  1KVK A;  4LF5 I;  3P3C A;  4JI3 E;  2LJU A;  3EQ1 A;  3OML A;  4WXD A;  1X3C A;  5TSE A;  1EI1 A;  3JAM Q;  4JI8 I;  2L92 A;  4DV1 E;  1TN9 A;  4U3D A;  2J7J A;  2YRK A;  3THN A;  4M30 A;  4LU9 A;  2Z5E A;  1Z5A A;  4BA1 B;  1KTV A;  4WX9 A;  4R2D A;  2E1R A;  1N36 E;  2WNR B;  4DR6 E;  2N3H A;  3P76 A;  2EOE A;  3GON A;  2V86 A;  4IZJ D;  1XMO I;  3M99 B;  2RS7 A;  3CDI A;  2IHR 1;  4MLQ A;  2EMB A;  4O24 A;  1N0U A;  2NUF A;  1XNR E;  2PO2 B;  2EE8 A;  4LF8 I;  3HUL A;  4DR1 I;  4F9C B;  5AC4 A;  4DU7 A;  5C0X E;  4YHH I;  4O5G A;  2E72 A;  4FWH A;  2BB8 A;  1YHC A;  2EM0 A;  4WYQ B;  4JI7 I;  4LF6 E;  1FWL A;  2EM5 A;  1RMD A;  1PIE A;  4PRX A;  1OYP A;  2FV4 B;  2YT4 A;  2V83 A;  2LUQ A;  4DV3 E;  4WUB A;  1IBK I;  2PO1 B;  1WHQ A;  1Y60 A;  1NCS A;  4HYM A;  1EA6 A;  2NAB A;  2O3Z A;  1ZM9 A;  4JI0 I;  3L7Z A;  3EPH A;  4FW4 A;  1L4S A;  4DPT A;  2LCE A;  4X64 E;  1RC7 A;  2BR2 A;  4BHC A;  4DV0 I;  4JI1 I;  1NHI A;  2DB2 A;  2EN7 A;  2L2N A;  4IZJ B;  3FIG A;  3PS1 A;  1J26 A;  4DV2 E;  2JE6 B;  2EMF A;  3P1X A;  2EPK X;  4OZE A;  4LFA I;  4X66 E;  4KHP E;  3QT5 A;  5BR8 E;  2B9D A;  3LNU A;  2PO0 B;  5FLX C;  1D6T A;  2J65 A;  4NXN I;  2AE8 A;  2EOY A;  2EPA A;  1K47 A;  1PKP A;  4WSG A;  4DR7 I;  4WPY A;  1EH7 A;  1Z0G A;  4JYA I;  1B63 A;  2HK3 A;  4DMI A;  2RSI A;  2YRH A;  5EKW A;  4UT4 A;  2ELZ A;  1X6H A;  2LV2 A;  2UUA E;  2HFS A;  4Z7Y A;  2EL5 A;  1YUI A;  2EMI A;  1HK7 A;  2Z5C A;  3PYF A;  4BHB A;  5C0X D;  2JT2 A;  2EOX A;  2EOM A;  4X65 I;  2UUC E;  4J3D A;  1N3G A;  1MX0 A;  2EM9 A;  3OTO I;  3AV0 A;  2V34 A;  3F0N A;  2JPA A;  5A6J A;  4LFB E;  2EQ0 A;  4IS1 C;  1P42 A;  2GO3 A;  1MG7 A;  4M1K A;  4YY3 I;  4FN5 A;  4B3S I;  4HAC A;  4M2Z A;  4RPF A;  4ZYD A;  4F9B B;  2UUB I;  1IMU A;  2JEB B;  1RHY A;  3J80 C;  4RH8 A;  4DPY A;  1Z0T A;  2WW4 A;  4WFT A;  1X49 A;  2NPF A;  4F6N A;  3T1Y I;  1Z0C A;  2V87 A;  1BKN A;  2CPN A;  4JV5 E;  4UTG A;  1BB8 A;  2V2Z A;  2UXD E;  2MDR A;  2MDG A;  1H72 C;  2Q2E B;  4XTJ A;  2GS8 A;  3C6K A;  2EMC A;  2X36 A;  4DV7 I;  3JAM C;  2C37 B;  1RRE A;  4P78 A; 
#chains in the Genus database with same CATH homology
 4B3T I;  2L3J A;  4LF5 E;  4JI2 E;  2A2C A;  5DNY A;  4JI8 E;  3CWV A;  2HK2 A;  3PYD A;  4KQV A;  2IOP A;  4J8Z A;  5FLX Q;  3PYE A;  2N3G A;  4BMJ A;  2HKE A;  2UU9 E;  2EZ6 A;  4R1F A;  1QZR A;  2IOQ A;  4MYT A;  1B62 A;  2CGE A;  4I8O A;  3K85 A;  1HNX I;  1FWK A;  1XMO E;  4LFC I;  5CFF E;  5FWK A;  4L5N C;  3HQ1 A;  1USV A;  4HXZ A;  4Z7C A;  4LF8 E;  4DR1 E;  4YHH E;  2O1W A;  4DR3 I;  3IWB A;  3ADJ A;  3PYG A;  4Q28 A;  4P7D A;  4L8N A;  4K0K I;  1PVG A;  1Y4S A;  3F6H A;  4LF7 E;  1FNM A;  3Q6N A;  2KON A;  4B3M E;  1IBK E;  2YZT A;  3J81 Q;  1YYO A;  2BM1 A;  2NUG A;  2LJH A;  2EWL A;  4IZK B;  5AE1 A;  2JOX A;  1FKA E;  2X7I A;  2O1U A;  4DV0 E;  2F4V I;  3Q1Q A;  1I94 I;  3HPZ A;  3D4J A;  4M0V A;  5IWA E;  3VYX A;  3T1H I;  4LFA E;  1N34 I;  1IBL I;  3B82 A;  4JI5 I;  4F9A B;  2E1M A;  5AE3 A;  2HHH I;  4DR7 E;  2JVA A;  1Z0W A;  1H73 A;  3WU4 A;  4DUY I;  2VQF I;  1ZM4 A;  4I3H A;  1ZBQ A;  4X65 E;  2H36 X;  1XMQ E;  3OTO E;  4R8O A;  1FJG I;  4DUZ I;  1ELO A;  4ZVI A;  1ZM2 A;  2VE7 C;  1XNQ I;  2CZ9 A;  2F8B A;  4B3S E;  2K4V A;  2BV3 A;  1KIJ A;  4JI6 I;  2ODR D;  1T4O A;  4OX9 E;  2FGG A;  2L2K B;  4LTY A;  3T1Y E;  1NHJ A;  2OI2 A;  3VYY A;  2CG9 A;  4DV7 E;  4BS9 A;  3ADI A;  2LJP A;  4B3T E;  4FW9 A;  4DV5 I;  4GKJ E;  1A6F A;  5T6J A;  4LF4 I;  4JG4 A;  2DEI A;  2M4I A;  4X62 E;  4PU9 A;  3ZKD A;  3J7A M;  4AQY I;  2M7Q A;  5GMD A;  3LTO A;  1HNX E;  1RQ0 A;  1N32 I;  1DQ3 A;  2Z5C B;  2O1T A;  4JI4 I;  4GKK I;  2R3V A;  5F3W A;  5L3J A;  4LFC E;  1VIS A;  4MYU A;  2LE2 A;  2LTS A;  2V85 A;  1Z5C A;  2M1S A;  4DV4 E;  1XHK A;  4LF9 I;  1X48 A;  2RSM A;  3WU3 A;  5A2Q Q;  1N36 I;  4DR6 I;  1GZ6 A;  3JTZ A;  4DXL A;  2V89 A;  3J81 C;  1N0V C;  4K0K E;  1ZXM A;  2V88 A;  2MC6 A;  2JWO A;  2ZM6 I;  2PNM A;  2Z5B A;  3M6A A;  2RS6 A;  3LPS A;  1J5E E;  3WU5 A;  3Q6M A;  4LF6 I;  1I94 E;  1S16 A;  2E5L I;  3K1J A;  2HFU A;  2RTX A;  3T1H E;  4OOG C;  1Z0B A;  4DR4 I;  1HNW I;  1IBL E;  1YZ9 A;  4JI5 E;  1UHZ A;  4DPX A;  4BC9 A;  2HHH E;  1Y6Z A;  3AUZ A;  4DV2 I;  3DF6 A;  1WUU A;  1O0W A;  2XEX A;  4N3O A;  2VQF E;  1WHN A;  1DAR A;  1HNZ I;  5BR8 I;  4KHP I;  3ZKB A;  4FWG A;  3ZM7 A;  1X47 A;  4JI7 E;  4DUZ E;  2LTR A;  3J7A G;  1QU6 A;  4P52 A;  4KZS A;  3HPS A;  2WZO A;  4JI0 E;  4JI6 E;  3ZZ0 A;  2VF1 A;  4JI1 E;  3H4L A;  3QT7 A;  2LUP B;  2ZBK B;  1Z0E A;  4URL A;  2L6M A;  2BM0 A;  4BC7 A;  1Y4U A;  4HY1 A;  1T4N A;  2JR1 A;  2A2D A;  2UXC I;  1SR9 A;  4DV5 E;  1STU A;  1EKZ A;  5LMN I;  4NXN E;  3ZZU A;  1FI4 A;  2LBS B;  3RMP A;  2UXD I;  4JYA E;  2B7V A;  4P7A A;  3QT8 A;  4AQY E;  1NZ0 A;  1IBM I;  1H7U A;  3J7Y p;  1U2R A;  1N32 E;  1Z0V A;  4JI4 E;  4GKK E;  4JI2 I;  1RR9 A;  1Z59 A;  4NXM I;  5A2Q C;  4LF9 E;  2MC5 A;  2B3T B;  2UXB I;  3HJC A;  2DEJ A;  2G7H A;  4ED4 A;  4YY3 E;  1HR0 I;  2UU9 I;  4X8W A;  3P06 A;  2UUB E;  4R03 A;  1H7S A;  2NA2 A;  5LMU I;  2AJ4 A;  4WUC A;  3V5R A;  2R42 A;  4DV6 I;  2ZM6 E;  1YYK A;  3ZZT A;  1N33 I;  2JOB A;  1KKH A;  2ZIT A;  3ADL A;  4DR2 I;  5IT9 Q;  4EMD A;  2E5L E;  4USM A;  4LF7 I;  2L8T A;  2VQE I;  4B3M I;  4DPW A;  1WXR A;  2L33 A;  3ADG A;  4B3R I;  2B7T A;  5AAS A;  4TUI A;  4DR4 E;  1HNW E;  4DR5 I;  4DPU A;  3LLH A;  1ZXN A;  2LMZ A;  3LML A;  3C4B A;  4JI3 I;  4IZJ A;  2V8P A;  5IWA I;  4DV1 I;  2L2M A;  3C4T A;  3V2U C;  2KOU A;  1HNZ E;  4DR3 E;  1S4E A;  4DU8 A;  4HAC B;  2KHX A;  1Z5B A;  3MSW A;  2J7K A;  3K17 A;  5AE2 A;  1T4L B;  1ZM3 A;  2DMY A;  4BBY A;  3WU6 A;  1XNR I;  4WUD A;  2Z5B B;  1OJ4 A;  3F6G A;  3JU0 A;  1UIL A;  2JY9 A;  4GEQ B;  4BCA A;  1XMQ I;  2F4V E;  3VK6 A;  1USU A;  4DV3 I;  3IWC A;  3QT6 A;  1N34 E;  2UXC E;  2DSY A;  5LMN E;  2FTX B;  4TUG A;  4X64 I;  4OX9 I;  2EFG A;  4WSP A;  3HTX A;  3IWD A;  3DJW A;  5LL6 R;  4F54 A;  2V2Q A;  1DI2 A;  3B8H A;  1IBM E;  4DUY E;  1NHH A;  4X66 I;  3HXL A;  4GKJ I;  4NXM E;  4X62 I;  2DIX A;  4DKK A;  1FJG E;  2UXB E;  1XNQ E;  4USK A;  1HR0 E;  2LRS A;  2UUA I;  1H74 A;  4FWD A;  5ADZ A;  2ODR C;  3K6Q A;  2L3C A;  5LMU E;  2HKJ A;  2V2V A;  2UUC I;  2NUE A;  4DV6 E;  4DV4 I;  4LFB I;  1GQE A;  1N33 E;  2O1V A;  5IT9 C;  2GQ0 A;  1MU5 A;  2PNL A;  4DR2 E;  1YYW A;  3ZOQ B;  1ZBT A;  4LF4 E;  3KWR A;  2VQE E;  3B78 A;  3PRY A;  5GME A;  4B3R E;  3J80 Q;  1UEK A;  4JV5 I;  4DR5 E;  4IZK A;  2VF3 A;  3H09 A;  2V8Q B;  1J5E I;  4PRV A;  1KVK A;  4LF5 I;  4JI3 E;  3OML A;  3JAM Q;  1EI1 A;  4JI8 I;  2L92 A;  4DV1 E;  2Z5E A;  4M30 A;  4LU9 A;  1Z5A A;  1KTV A;  2E1R A;  1N36 E;  4DR6 E;  2N3H A;  3GON A;  2V86 A;  4IZJ D;  1XMO I;  2RS7 A;  2IHR 1;  1N0U A;  2NUF A;  1XNR E;  4LF8 I;  3HUL A;  4DR1 I;  4F9C B;  4DU7 A;  4YHH I;  4FWH A;  4WYQ B;  4JI7 I;  4LF6 E;  1FWL A;  1PIE A;  4PRX A;  2FV4 B;  2YT4 A;  2V83 A;  2LUQ A;  4DV3 E;  4WUB A;  1IBK I;  1WHQ A;  4HYM A;  1EA6 A;  1ZM9 A;  4JI0 I;  4DPT A;  4X64 E;  1RC7 A;  4DV0 I;  4JI1 I;  1NHI A;  2DB2 A;  2L2N A;  4IZJ B;  3FIG A;  1J26 A;  4DV2 E;  3P1X A;  4LFA I;  4X66 E;  4KHP E;  3QT5 A;  5BR8 E;  2B9D A;  3LNU A;  5FLX C;  1D6T A;  4NXN I;  1K47 A;  1PKP A;  4DR7 I;  4WPY A;  1Z0G A;  4JYA I;  1B63 A;  2HK3 A;  4DMI A;  4UT4 A;  2UUA E;  2HFS A;  4Z7Y A;  2Z5C A;  1HK7 A;  3PYF A;  4X65 I;  2UUC E;  1MX0 A;  3OTO I;  3AV0 A;  2V34 A;  3F0N A;  4LFB E;  1MG7 A;  4M1K A;  4YY3 I;  4FN5 A;  4B3S I;  4HAC A;  4M2Z A;  4RPF A;  4F9B B;  2UUB I;  3J80 C;  4DPY A;  1Z0T A;  2WW4 A;  4WFT A;  1X49 A;  2NPF A;  3T1Y I;  1Z0C A;  2V87 A;  1BKN A;  2CPN A;  4JV5 E;  4UTG A;  2V2Z A;  2UXD E;  2MDR A;  1H72 C;  2Q2E B;  4XTJ A;  2GS8 A;  2X36 A;  4DV7 I;  3JAM C;  1RRE A;  4P78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...