4KHPE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4khpE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpE02
2JVAA 3ZKDA 3ADLA 4JI3E 4WUBA 1H7SA 2IHR1 4JI3I 1YYKA 2N3GA 4DR6I 4DKKA 4EMDA 2B3TB 1I94E 2CZ9A 2RS7A 1I94I 2KHXA 4LFAE 1XNQE 1XNRE 3Q1QA 4B3RE 1FKAE 4DUZE 4DV3I 4JI0I 4UT4A 2BM0A 2BM1A 4LFAI 1YYWA 3K1JA 1XNRI 4B3RI 4DUZI 4P52A 3ZZTA 4HACA 1XMQE 1DARA 4KQVA 2L3JA 1HNWE 2OI2A 4B3MI 4AQYE 4LFCE 1GQEA 1VISA 4DV5E 1HNWI 2LBSB 4LFCI 5L3JA 4LFBI 5GMEA 2EFGA 3WU5A 4DV4E 4FWHA 3C4BA 1N34I 2HKJA 3K17A 2LUQA 2VF3A 3ADJA 1FJGE 4NXME 4YHHE 4USMA 3VYYA 4B3SI 1FJGI 4WYQB 3LLHA 1S16A 3WU3A 4DR2E 4YHHI 4JI7E 1K47A 4LF7E 2N3HA 1N32E 4DR2I 4YY3I 4JI7I 1Z0WA 1EI1A 1A6FA 4USKA 3J7AM 4DPXA 2RTXA 3QT7A 2LUPB 4DU7A 1WHQA 3J80Q 4DR1I 1J26A 2NPFA 2UUCI 4X66E 5CFFE 4DU8A 2HHHI 4X66I 4JYAI 4LF8E 3J80C 1YZ9A 4GKJI 2RS6A 3B82A 4DXLA 4JV5I 4GKKE 1N36E 5A2QC 3M6AA 3QT6A 2V2QA 1YYOA 4GKKI 2DB2A 4DR4E 4B3TE 3V5RA 1KVKA 1FWLA 1S4EA 1Z5AA 2ZM6E 4DR4I 1J5EE 1XHKA 4WUDA 3V2UC 4B3TI 4OX9E 1QU6A 4JI5E 2X36A 1DI2A 1N0VC 1Z0TA 1OJ4A 1J5EI 3B78A 1Z0VA 3HULA 1Z5CA 4JI5I 1ZM3A 1T4OA 5LL6R 2E1RA 4DV1E 4JI1E 2UUAE 1ZM9A 1ZM2A 4DV1I 4JI1I 2UUAI 1RR9A 1ZXMA 2UU9E 2AJ4A 2X7IA 4HXZA 4LF6E 3P1XA 2UU9I 3J7AG 2LRSA 3GONA 4LF6I 1HNZE 3LPSA 2LTSA 2HFSA 1XNQI 4OOGC 2L2KB 1RQ0A 3QT5A 1HNZI 2DEJA 3J81Q 1NHJA 1XMQI 4X64E 1MG7A 1T4NA 1QZRA 1IBLE 4FN5A 3T1YE 3ZKBA 4AQYI 4X64I 1MU5A 4DV5I 3J81C 4K0KE 4JG4A 1ZXNA 1H73A 2DEIA 3PYDA 4DV4I 3WU4A 2L2MA 1KTVA 4X65E 4HY1A 1HR0E 4LF5E 1FNMA 4JI8E 4DV6E 4X65I 4NXMI 2HK2A 2BV3A 4LF5I 1B63A 4JI8I 2V34A 4DPWA 5FLXQ 1B62A 3PYFA 4DV7E 2VQEE 4WUCA 4M1KA 4LF7I 1N32I 2VQEI 4NXNE 2R3VA 1PIEA 5FLXC 4P7AA 1WHNA 4NXNI 1BKNA 3JAMQ 2V2VA 1STUA 2XEXA 1H72C 3C4TA 1U2RA 3T1HE 1WUUA 1N33E 2UUBE 5LMUE 2NA2A 2MDRA 3F0NA 1Z0EA 2CPNA 1NHIA 1N33I 4LF8I 2UUBI 1IBKE 3JAMC 2UXCE 4DR3E 5LMNE 1N36I 1IBKI 4DPYA 4JI6E 4DV0E 2UXCI 4DR3I 3B8HA 1NZ0A 5IT9Q 4JI6I 4DV0I 2L3CA 4URLA 2ZM6I 2YT4A 1H7UA 1UEKA 2UXDE 4OX9I 1Z0BA 1Z0CA 3OTOE 3H4LA 1N0UA 3PYEA 3OTOI 3ZM7A 2B7VA 4UTGA 2DMYA 1O0WA 2HKEA 2ZITA 2J7KA 2WW4A 4DV2E 1RREA 1UHZA 4DR6E 4PRXA 1PVGA 1NHHA 2LJPA 1UILA 4DV2I 4M30A 1KKHA 1Z59A 1H74A 4LF9E 4M2ZA 4DV3E 4JI0E 5GMDA 4PU9A 1XMOE 2JY9A 4LF9I 1MX0A 3ADGA 4X62E 1ELOA 2V2ZA 1XMOI 1IBLI 3T1YI 1X48A 4X62I 2A2DA 4B3ME 4DPTA 4PRVA 2GS8A 1FI4A 4K0KI 2DIXA 4R1FA 1KIJA 4KHPE 2NUEA 4FWGA 4LFBE 1HNXE 3ZZ0A 1ZBTA 2LJHA 3D4JA 4KHPI 4Z7YA 1HR0I 2B7TA 1N34E 1T4LB 1EKZA 1X49A 4FW9A 1HNXI 4XTJA 4JI2E 4DV6I 2E5LE 1ZM4A 1X47A 2EZ6A 4JI2I 2A2CA 2E5LI 4B3SE 4DUYE 4DV7I 2VQFE 2HFUA 4ZVIA 4HYMA 2V8PA 4DR5E 4DUYI 2VQFI 4X8WA 4YY3E 4DR5I 3J7Yp 3HTXA 1IBME 2LTRA 4DR1E 4JI4E 2L33A 2R42A 3QT8A 4DR7E 3T1HI 1IBMI 3LTOA 1RC7A 4LF4E 2UUCE 5LMUI 4JI4I 4DPUA 4DR7I 1Z0GA 1PKPA 2NUGA 4LF4I 5A2QQ 2HHHE 3LNUA 4I3HA 4JYAE 4FWDA 5IWAE 1EA6A 1Z5BA 3CWVA 4ED4A 4GKJE 5LMNI 3ADIA 4JV5E 4RPFA 1D6TA 5IWAI 2F4VE 2Q2EB 3VYXA 5BR8E 2RSMA 4MYUA 1FWKA 4MYTA 2F4VI 5BR8I 2HK3A 4Z7CA 2UXBE 5IT9C 2UXDI 3PYGA 2NUFA 4WFTA 4HACB 2ZBKB 2UXBI 2L2NA 3ZZUA 3WU6A
chains in the Genus database with same CATH superfamily
2JVAA 4OKGA 2V83A 1UDQA 4BA1B 3ZKDA 4GZNC 3ADLA 2EOFA 4GQUA 1HK7A 4JI3E 5JEAC 4WUBA 1H7SA 2IHR1 3GMEA 2YTNA 2EPZA 4IZJD 2EOXA 4JI3I 1YYKA 2FTXB 2N3GA 2EORA 5AC5A 2GQ0A 4DR6I 4DKKA 3UK3C 4MQYA 4EMDA 2B3TB 1I94E 2M1SA 2CZ9A 3Q6NA 5DNLA 2EM3A 2RS7A 1XXEA 2EN6A 2YTJA 3PRYA 4MU0A 1SR9A 1I94I 2KHXA 4LFAE 2EMKA 3DJWA 4P78A 2C37A 2EL4A 1XNQE 1XNRE 3Q1QA 3KWRA 4B3RE 2ELZA 1FKAE 4DUZE 4DV3I 2K7IA 2KONA 4JI0I 4UT4A 5A6AA 2BM0A 2BM1A 5JEAA 1YYWA 3K1JA 4LFAI 5K36D 1XNRI 5F3WA 1IQOA 4B3RI 2N8XA 5ADZA 2JE6A 4DUZI 4P52A 3ZZTA 2JR1A 4HACA 1XMQE 1BB8A 1DARA 4N3OA 4ZYGA 4KQVA 4X9JA 2BR2A 2EMYA 2EMXA 2L3JA 1HNWE 2YU5A 2YTIA 1QNTA 2OI2A 4B3MI 2E1MA 4AQYE 2EOEA 1X5WA 4LFCE 1GQEA 2EMCA 3P3EA 4MU4A 4OO1C 4BA1A 1VISA 4DV5E 1HNWI 3DF6A 2CGEA 5KL6A 2CG9A 2EOIA 2LBSB 4LFCI 5L3JA 2CT1A 2Z5CB 1L4SA 4IS1C 4LFBI 5GMEA 2EFGA 1ZU1A 3WU5A 4DV4E 4FWHA 3C4BA 1N34I 3HPZA 2GHFA 2HKJA 3K17A 2JOBA 1JK1A 2DSYA 2LUQA 2VF3A 5C0XD 3ADJA 1FJGE 4NXME 2EPOA 2V8QB 1R6LA 2V88A 3M85D 2DRPA 5DRRA 2EM2A 4YHHE 4OO1A 4USMA 4HTGA 3VYYA 2GLIA 4B3SI 1FJGI 2YTDA 4WYQB 3JU0A 4FW7A 3LLHA 1S16A 3WU3A 2J65A 4DR2E 3FIGA 1UBDC 1YUIA 2C39A 2NN6B 4JI7E 2WBUA 1K47A 4YHHI 1MGTA 4LF7E 2N3HA 2WCC3 2O1TA 2LMZA 1Y4UA 2MKDA 1N32E 4R2AA 3GLLA 4BBYA 4DR2I 4YY3I 1SFEA 3PS1A 3RMPA 4JI7I 1Z0WA 1EI1A 1A6FA 1BBGA 5KL4A 2WNRA 4USKA 3HXLA 5DRPA 4LPFA 3J7AM 2JP9A 4DPXA 2RTXA 3QT7A 2LUPB 2EOZA 3VHTB 3BGHA 1UDSA 2JT2A 4DU7A 3EPKA 1WHQA 3J80Q 4DR1I 1J26A 4M0VA 5C0XE 2F8BA 4F9AB 1B69A 2ODRC 2L92A 4HEIA 3U1YA 2NPFA 2O1VA 4BMJA 2UUCI 2PO1A 4X66E 1A1FA 5CFFE 1USVA 1ZR9A 4DU8A 4ZYEA 2IERA 2ADRA 2HHHI 4X66I 4JYAI 2RPCA 4LF8E 1USUA 2EOYA 3J80C 1YZ9A 2EMLA 2RS6A 4GKJI 3B82A 4DXLA 1N3GA 2EPNA 4JV5I 4GKKE 3UHMA 1N36E 2C37B 5A2QC 2YTEA 5JEAD 3M6AA 3QT6A 2JYAA 2V2QA 1YYOA 2JEAA 4GKKI 5C0XF 4OZEA 1WJPA 2DB2A 2HC5A 2YRMA 4DR4E 4BCAA 4B3TE 3V5RA 3F6GA 1F2IG 2HGHA 1FWLA 1KVKA 1S4EA 2NN6F 1Z5AA 3THOB 2R76A 3F6HA 2ZM6E 2IESA 4DR4I 1J5EE 1XHKA 2BR2B 4WUDA 2B9DA 3V2UC 4B3TI 4OX9E 1QU6A 4IFDA 4AM3A 4JI5E 2EMHA 2X36A 1P47A 1DI2A 3B4TA 3P3CA 1N0VC 5AE3A 1Z0TA 2BA1G 4N4RB 1OJ4A 1J5EI 3B78A 2LVHA 1Z0VA 3HULA 1Z5CA 4JI5I 2CSHA 3JTZA 2PRTA 1A1KA 1ZM3A 1T4OA 5LL6R 2EL5A 2E1RA 4DV1E 4JI1E 2UUAE 2IOQA 4WSGA 1ZM9A 5KL3A 4F9CB 1ZM2A 5JEAE 3TQMA 2LCEA 2V89A 2ENCA 1Y6ZA 4DV1I 4JI1I 2UUAI 2C38A 2WBSA 1RR9A 1ZXMA 2EM5A 2UU9E 2AJ4A 4Q35B 2X7IA 4HXZA 1Y4SA 3HPSA 1A1IA 4LF6E 3IWDA 4F54A 1OYPA 2PNMA 3P1XA 4OO1B 2UU9I 2MDGA 3J7AG 5IXMB 2LRSA 3GONA 4LF6I 2DLKA 3IWBA 4O43A 2LTSA 1HNZE 2HFSA 3LPSA 1XNQI 2C39B 2LJUA 2I13A 4OOGC 2L2KB 1RQ0A 4J3DA 2CTDA 3P06A 4MDTA 4R2RA 3QT5A 2EPUA 5JEAF 1HNZI 1LLMC 2WP8A 2DEJA 5EL9A 3J81Q 1NHJA 2V86A 2WNRB 2VE7C 2EE8A 1XMQI 2LE2A 4X64E 2L6MA 1MG7A 2O3ZA 5EKWA 1T4NA 2YWQA 2EM6A 1QZRA 4L5NC 1AAYA 2Z5BB 1IBLE 4FN5A 3T1YE 3ZKBA 2DMIA 4AQYI 4X64I 4OO1E 2IOPA 1MU5A 2EOHA 2FV4B 2WZOA 5IV8B 1G2DC 4DV5I 3KZZA 3VK6A 2BA0G 3J81C 2GO4A 4R2QA 2PO1B 2WBTA 2EN1A 4K0KE 4JG4A 4TUGA 1ZXNA 2GPIA 1H73A 1DQ3A 3GCMA 2DEIA 2EOOA 1E3PA 3PYDA 2EWLA 4R2SA 4DV4I 3WU4A 2L2MA 1A1JA 2EM9A 1KTVA 4X65E 4TUIA 4ZYHA 3HQ1A 1HR0E 4HY1A 4IZKA 3CDJA 4LF5E 1FNMA 4JI8E 5KL7A 1EH8A 2ODRD 4DV6E 2NN6D 4X65I 3M7NG 1YFHA 4NXMI 1A1GA 2HK2A 2BV3A 2JEAB 2EOMA 4LF5I 4OO1F 4R8OA 1IQSA 2YU8A 1B63A 4JI8I 2EP3A 2V34A 4DPWA 2MC6A 3C6KA 1WXRA 4NZVA 4QNJA 1B62A 5FLXQ 5K36C 5A6BA 1VI7A 4IZJA 4L8NA 3PS3A 5A6KA 2VQEE 4DV7E 3PYFA 4WUCA 4M1KA 1NCSA 1AH5A 3EPJA 4LF7I 4IFDB 2EPKX 1YPNA 2JXPA 3NZKA 1N32I 2M9AA 2PO0A 2VQEI 3L00A 2EOJA 4O24A 2LT7A 4AIDA 4NXNE 3MHHC 2DGCA 2R3VA 2Z5BA 3CDIA 2EMIA 4BHBA 1PIEA 3M85G 5FLXC 1MEYC 4P7AA 2EMGA 1WHNA 2K4VA 2L8TA 3BIDA 2ENAA 1GZ6A 4LTYA 1A1LA 3L7ZA 4NXNI 2YTPA 3IWCA 5T6JA 5KL2A 1BKNA 4MU3A 2NN6E 4R2PA 2V2VA 1STUA 4MLVA 2AE8A 3JAMQ 2XEXA 1H72C 4ISAA 4R03A 2EJ4A 3C4TA 5AE2A 5K36A 3QG5C 2JPAA 4P7DA 4WXDA 3EPHA 3T1HE 1U2RA 1WUUA 2PNLA 1N33E 2C38B 2EN2A 3H1CA 2UUBE 2VF1A 5LMUE 2NA2A 2MDRA 3F0NA 1Z0EA 2CPNA 3HJCA 2VESA 1NHIA 2Z5EA 1N33I 1YUJA 4LF8I 2UUBI 1NEIA 1IBKE 3JAMC 2UXCE 5DNXA 4DR3E 3H09A 5TSEA 1EH6A 2ELYA 1X6FA 2BB8A 5LMNE 4LCFA 2VRDA 1N36I 4BC9A 1IBKI 4DPYA 4JI6E 4DV0E 5AASA 3KRNA 2UXCI 1JK2A 4DR3I 2EM7A 3B8HA 3AUZA 1NZ0A 2WP8B 2EN3A 5IT9Q 4JI6I 4DV0I 1UN6B 2EMAA 2BBGA 4U3DA 3ECRA 2O1WA 4I8OA 5DRQA 3K6QA 2L3CA 1ZBQA 2BA1D 5DNYA 2EOSA 1PJSA 4URLA 2ENHA 2ZM6I 1X3CA 2YT4A 4LU9A 1YSAC 1H7UA 1P42A 2UXDE 1UEKA 4RH8A 2O1UA 4OX9I 1Z0BA 2KOUA 1Z0CA 3OTOE 2Q8UA 2PNZA 3U1KA 4FW6A 3H4LA 4WX9A 1N0UA 4BA2A 2YRKA 4NHRA 3PYEA 3OTOI 2R1FA 4F6NA 3ZM7A 2B7VA 1PJTA 4UTGA 2I9IA 4ZYDA 2DMYA 3OMLA 2EPPA 4OO1D 1O0WA 4U3BA 2HKEA 3PS2A 2EQ3A 2RQLA 1R6MA 4IZKB 2F1DA 3C6MA 4F6MA 2ZITA 2J7KA 2WW4A 5FWKA 4DV2E 1RREA 2A25A 1T38A 1UHZA 4DR6E 4PRXA 2EPAA 1PVGA 1NHHA 5A6BD 2V87A 2LJPA 1UILA 2YTQA 4DV2I 3EQ1A 2EM0A 1YH8A 4M30A 1KKHA 4R2CA 4IZJB 5A6JA 1OYSA 1KYQA 1BBOA 5LLQA 1Z59A 2EPCA 1H74A 4KZSA 1EH7A 4LF9E 1UDNA 4M2ZA 2EQ1A 2HJJA 4DV3E 4JI0E 2PO0B 3BBGA 5GMDA 4PU9A 2RSIA 3P3GA 1XMOE 2JY9A 4LF9I 1MX0A 3ADGA 1X6HA 4X62E 2BA0D 1ELOA 2J7JA 3L7ZB 2V2ZA 1XMOI 4IJDA 1IBLI 1E3HA 3T1YI 2D9HA 1X48A 1UDOA 4X62I 2A2DA 4IFDC 2M4IA 4FK5C 4KWYA 4B3ME 4DPTA 5K36B 4PRVA 1X6EA 2MC5A 2GS8A 4AIMA 1FI4A 4K0KI 2DIXA 4R1FA 1KIJA 3LMLA 5A69A 4KHPE 2DLQA 2NUEA 4O4KA 2YTFA 4FWGA 4BHCA 3M7ND 3DD6A 5ELWA 3THNA 2LV2A 4LFBE 1HNXE 2EPXA 3ZZ0A 1ZBTA 2E72A 2EL6A 2H36X 2LJHA 3D4JA 3MSWA 4J8ZA 4Z7YA 4KHPI 1HR0I 2B7TA 1N34E 1T4LB 1EKZA 1X49A 5AE1A 3ZOQB 2YSOA 2EPRA 2GO3A 4JI2E 4FW9A 4XTJA 4DV6I 2G7HA 1HNXI 2E5LE 3KZYA 1ZM4A 4IFDD 1RMDA 1X47A 1YHCA 2PO2B 2EZ6A 5K36E 4IS9A 4JI2I 4LCGA 2JEBB 1TN9A 2YTOA 4MLQA 2A2CA 2E5LI 4B3SE 2EM8A 4DUYE 2YTGA 4DV7I 2VQFE 2HFUA 4ZVIA 4HYMA 2EOQA 5C0XB 4MU1A 2V8PA 1IMUA 4DR5E 1KJKA 4DUYI 2EPLX 4Q28A 2VQFI 3EPLA 4X8WA 1G2FC 3K85A 4YY3E 2LO3A 4DMIA 4F9BB 4M9VC 2EMZA 2PNZB 4DR5I 1A1HA 3J7Yp 1TF3A 4BA2B 3HTXA 2YSPA 3AV0A 4LOMA 2EN7A 2EMBA 1IBME 2JWOA 1PDAA 2LTRA 4QNKA 4R2EA 4DR1E 4JI4E 2L33A 2R42A 3QT8A 4DR7E 5K36F 4NBQA 4IFDE 2NABA 3Q6MA 5C0XC 3MHSC 4O5GA 2EN8A 1RC7A 3LTOA 4LF4E 3BF2A 3T1HI 1IBMI 2UUCE 5LMUI 4JI4I 4DPUA 4DR7I 1Z0GA 1PKPA 2NN6C 2CVEA 2Z5CA 2YZTA 2NUGA 4LF4I 4BC7A 1TF6A 5A2QQ 2HHHE 3LNUA 2YRHA 4JYAE 4FWDA 2EMWA 5IWAE 1EA6A 4LCHA 4I3HA 1Z5BA 1Y60A 3CWVA 2FGGA 4FW5A 4ED4A 2YPNA 4F2JC 4GKJE 2PO2A 4FW3A 4RHBB 5LMNI 3ADIA 4JV5E 4RPFA 2V85A 1D6TA 1OYRA 1GTKA 2JEBA 5IWAI 2F4VE 2Q2EB 4WXCA 3VYXA 1ZAAC 5BR8E 1T39A 4GEQB 4WPYA 3P76A 2RSMA 4MYUA 2EPMX 5C0XA 2JOXA 1FWKA 4IFDF 5AC4A 2EN4A 4MYTA 4FW4A 2F4VI 5BR8I 4WSPA 2EM4A 4BS9A 1Z1BA 2HK3A 2NN6A 4Z7CA 4R2DA 2EQ0A 1PJQA 5JEAB 2UXBE 5IT9C 2UXDI 3HKMA 2MKNA 3M99B 2JE6B 1Y5YA 2NUFA 1DGCA 4WFTA 3PYGA 4HACB 2M7QA 5DROA 2ZBKB 1WRJA 2UXBI 2L2NA 5KL5A 1RHYA 3ZZUA 3WU6A 2EMFA
chains in the Genus database with same CATH topology
2JVAA 2V83A 3ZKDA 3ADLA 1HK7A 4JI3E 4WUBA 1H7SA 2IHR1 4IZJD 4JI3I 1YYKA 2FTXB 2N3GA 2GQ0A 4DR6I 4DKKA 4EMDA 2B3TB 1I94E 2M1SA 2CZ9A 3Q6NA 2RS7A 3PRYA 1SR9A 1I94I 2KHXA 4LFAE 3DJWA 4P78A 1XNQE 1XNRE 3Q1QA 4B3RE 3KWRA 1FKAE 4DUZE 4DV3I 2KONA 4JI0I 4UT4A 2BM0A 2BM1A 4LFAI 1YYWA 3K1JA 1XNRI 5F3WA 4B3RI 5ADZA 4DUZI 4P52A 3ZZTA 2JR1A 4HACA 1XMQE 1DARA 4N3OA 4KQVA 2L3JA 1HNWE 2OI2A 4B3MI 2E1MA 4AQYE 4LFCE 1GQEA 1VISA 4DV5E 1HNWI 3DF6A 2CGEA 2CG9A 2LBSB 4LFCI 5L3JA 2Z5CB 4LFBI 5GMEA 2EFGA 3WU5A 4DV4E 4FWHA 3C4BA 1N34I 3HPZA 2HKJA 3K17A 2JOBA 2DSYA 2LUQA 2VF3A 3ADJA 1FJGE 4NXME 2V8QB 2V88A 4YHHE 4USMA 3VYYA 4B3SI 1FJGI 4WYQB 3JU0A 3LLHA 1S16A 3WU3A 4DR2E 3FIGA 4YHHI 4JI7E 1K47A 4LF7E 2N3HA 2O1TA 2LMZA 1Y4UA 1N32E 4DR2I 4BBYA 4YY3I 4JI7I 3RMPA 1Z0WA 1EI1A 1A6FA 4USKA 3HXLA 3J7AM 4DPXA 2RTXA 3QT7A 2LUPB 4DU7A 1WHQA 3J80Q 4DR1I 1J26A 4M0VA 2F8BA 4F9AB 2ODRC 2L92A 2NPFA 2O1VA 4BMJA 2UUCI 4X66E 5CFFE 1USVA 4DU8A 2HHHI 4X66I 4JYAI 4LF8E 1USUA 3J80C 1YZ9A 4GKJI 2RS6A 3B82A 4DXLA 4JV5I 4GKKE 1N36E 5A2QC 3M6AA 3QT6A 2V2QA 1YYOA 4GKKI 2DB2A 4DR4E 4BCAA 4B3TE 3V5RA 3F6GA 1KVKA 1FWLA 1S4EA 1Z5AA 3F6HA 2ZM6E 4DR4I 1J5EE 1XHKA 4WUDA 3V2UC 2B9DA 4B3TI 4OX9E 1QU6A 4JI5E 2X36A 1DI2A 1N0VC 5AE3A 1Z0TA 1OJ4A 1J5EI 3B78A 1Z0VA 3HULA 1Z5CA 4JI5I 3JTZA 1ZM3A 1T4OA 5LL6R 2E1RA 4DV1E 4JI1E 2UUAE 2IOQA 1ZM9A 1ZM2A 4F9CB 2V89A 1Y6ZA 4DV1I 4JI1I 2UUAI 1RR9A 1ZXMA 2UU9E 2AJ4A 2X7IA 4HXZA 1Y4SA 3HPSA 4LF6E 3IWDA 4F54A 2PNMA 3P1XA 2UU9I 3J7AG 2LRSA 3GONA 4LF6I 3IWBA 1HNZE 3LPSA 2LTSA 2HFSA 1XNQI 4OOGC 2L2KB 1RQ0A 3P06A 3QT5A 1HNZI 2DEJA 3J81Q 1NHJA 2V86A 2VE7C 1XMQI 2LE2A 4X64E 2L6MA 1MG7A 1T4NA 1QZRA 4L5NC 2Z5BB 1IBLE 4FN5A 3T1YE 3ZKBA 4AQYI 4X64I 2IOPA 1MU5A 2FV4B 2WZOA 4DV5I 3VK6A 3J81C 4K0KE 4JG4A 4TUGA 1ZXNA 1H73A 1DQ3A 2DEIA 3PYDA 2EWLA 4DV4I 3WU4A 2L2MA 1KTVA 4X65E 4TUIA 3HQ1A 1HR0E 4HY1A 4IZKA 4LF5E 1FNMA 4JI8E 2ODRD 4DV6E 4X65I 4NXMI 2HK2A 2BV3A 4LF5I 4R8OA 1B63A 4JI8I 2V34A 4DPWA 2MC6A 5FLXQ 1WXRA 1B62A 4IZJA 4L8NA 3PYFA 4DV7E 2VQEE 4WUCA 4M1KA 4LF7I 1N32I 2VQEI 4NXNE 2R3VA 2Z5BA 1PIEA 5FLXC 4P7AA 1WHNA 2K4VA 2L8TA 1GZ6A 4LTYA 4NXNI 3IWCA 5T6JA 1BKNA 3JAMQ 2V2VA 1STUA 2XEXA 1H72C 4R03A 3C4TA 5AE2A 1U2RA 4P7DA 2PNLA 3T1HE 1WUUA 1N33E 2UUBE 2VF1A 5LMUE 2NA2A 2MDRA 3F0NA 1Z0EA 2CPNA 3HJCA 1NHIA 2Z5EA 1N33I 4LF8I 2UUBI 1IBKE 3JAMC 2UXCE 4DR3E 3H09A 5LMNE 1N36I 1IBKI 4BC9A 4DPYA 4JI6E 4DV0E 5AASA 2UXCI 4DR3I 3B8HA 3AUZA 1NZ0A 5IT9Q 4JI6I 4DV0I 2O1WA 4I8OA 3K6QA 2L3CA 1ZBQA 5DNYA 4URLA 2ZM6I 2YT4A 4LU9A 1H7UA 1UEKA 2O1UA 2UXDE 4OX9I 1Z0BA 2KOUA 1Z0CA 3OTOE 3H4LA 1N0UA 3PYEA 3OTOI 3ZM7A 2B7VA 4UTGA 2DMYA 3OMLA 1O0WA 2HKEA 4IZKB 2ZITA 2J7KA 2WW4A 5FWKA 4DV2E 1RREA 1UHZA 4DR6E 4PRXA 1PVGA 1NHHA 2V87A 2LJPA 1UILA 4DV2I 4M30A 1KKHA 4IZJB 1Z59A 1H74A 4KZSA 4LF9E 4M2ZA 4DV3E 4JI0E 5GMDA 4PU9A 1XMOE 2JY9A 4LF9I 1MX0A 3ADGA 4X62E 1ELOA 2V2ZA 1XMOI 1IBLI 3T1YI 1X48A 4X62I 2A2DA 2M4IA 4B3ME 4DPTA 4PRVA 2MC5A 2GS8A 1FI4A 4K0KI 2DIXA 4R1FA 1KIJA 3LMLA 4KHPE 2NUEA 4FWGA 4LFBE 1HNXE 3ZZ0A 1ZBTA 2LJHA 3D4JA 2H36X 4KHPI 3MSWA 4J8ZA 4Z7YA 1HR0I 2B7TA 1N34E 1T4LB 1EKZA 1X49A 5AE1A 3ZOQB 4FW9A 4XTJA 1HNXI 4JI2E 4DV6I 2G7HA 2E5LE 1ZM4A 1X47A 2EZ6A 4JI2I 2A2CA 2E5LI 4B3SE 4DUYE 4DV7I 2VQFE 2HFUA 4ZVIA 4HYMA 2V8PA 4DR5E 4DUYI 4Q28A 2VQFI 3K85A 4X8WA 4YY3E 4DMIA 4F9BB 4DR5I 3J7Yp 3HTXA 3AV0A 1IBME 2JWOA 2LTRA 4DR1E 4JI4E 2L33A 2R42A 3QT8A 4DR7E 3Q6MA 3T1HI 1IBMI 3LTOA 1RC7A 4LF4E 2UUCE 5LMUI 4JI4I 4DPUA 4DR7I 1Z0GA 1PKPA 2Z5CA 2YZTA 2NUGA 4LF4I 4BC7A 5A2QQ 2HHHE 3LNUA 4I3HA 4JYAE 4FWDA 5IWAE 1EA6A 1Z5BA 3CWVA 2FGGA 4ED4A 4GKJE 5LMNI 3ADIA 4JV5E 4RPFA 2V85A 1D6TA 5IWAI 2F4VE 2Q2EB 3VYXA 5BR8E 4GEQB 4WPYA 2RSMA 4MYUA 2JOXA 1FWKA 4MYTA 2F4VI 5BR8I 4WSPA 4BS9A 2HK3A 4Z7CA 2UXBE 5IT9C 2UXDI 3PYGA 2NUFA 4WFTA 4HACB 2M7QA 2ZBKB 2UXBI 2L2NA 3ZZUA 3WU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVA A;  3ZKD A;  3ADL A;  4JI3 E;  4WUB A;  1H7S A;  2IHR 1;  4JI3 I;  1YYK A;  2N3G A;  4DR6 I;  4DKK A;  4EMD A;  2B3T B;  1I94 E;  2CZ9 A;  2RS7 A;  1I94 I;  2KHX A;  4LFA E;  1XNQ E;  1XNR E;  3Q1Q A;  4B3R E;  1FKA E;  4DUZ E;  4DV3 I;  4JI0 I;  4UT4 A;  2BM0 A;  2BM1 A;  4LFA I;  1YYW A;  3K1J A;  1XNR I;  4B3R I;  4DUZ I;  4P52 A;  3ZZT A;  4HAC A;  1XMQ E;  1DAR A;  4KQV A;  2L3J A;  1HNW E;  2OI2 A;  4B3M I;  4AQY E;  4LFC E;  1GQE A;  1VIS A;  4DV5 E;  1HNW I;  2LBS B;  4LFC I;  5L3J A;  4LFB I;  5GME A;  2EFG A;  3WU5 A;  4DV4 E;  4FWH A;  3C4B A;  1N34 I;  2HKJ A;  3K17 A;  2LUQ A;  2VF3 A;  3ADJ A;  1FJG E;  4NXM E;  4YHH E;  4USM A;  3VYY A;  4B3S I;  1FJG I;  4WYQ B;  3LLH A;  1S16 A;  3WU3 A;  4DR2 E;  4YHH I;  4JI7 E;  1K47 A;  4LF7 E;  2N3H A;  1N32 E;  4DR2 I;  4YY3 I;  4JI7 I;  1Z0W A;  1EI1 A;  1A6F A;  4USK A;  3J7A M;  4DPX A;  2RTX A;  3QT7 A;  2LUP B;  4DU7 A;  1WHQ A;  3J80 Q;  4DR1 I;  1J26 A;  2NPF A;  2UUC I;  4X66 E;  5CFF E;  4DU8 A;  2HHH I;  4X66 I;  4JYA I;  4LF8 E;  3J80 C;  1YZ9 A;  4GKJ I;  2RS6 A;  3B82 A;  4DXL A;  4JV5 I;  4GKK E;  1N36 E;  5A2Q C;  3M6A A;  3QT6 A;  2V2Q A;  1YYO A;  4GKK I;  2DB2 A;  4DR4 E;  4B3T E;  3V5R A;  1KVK A;  1FWL A;  1S4E A;  1Z5A A;  2ZM6 E;  4DR4 I;  1J5E E;  1XHK A;  4WUD A;  3V2U C;  4B3T I;  4OX9 E;  1QU6 A;  4JI5 E;  2X36 A;  1DI2 A;  1N0V C;  1Z0T A;  1OJ4 A;  1J5E I;  3B78 A;  1Z0V A;  3HUL A;  1Z5C A;  4JI5 I;  1ZM3 A;  1T4O A;  5LL6 R;  2E1R A;  4DV1 E;  4JI1 E;  2UUA E;  1ZM9 A;  1ZM2 A;  4DV1 I;  4JI1 I;  2UUA I;  1RR9 A;  1ZXM A;  2UU9 E;  2AJ4 A;  2X7I A;  4HXZ A;  4LF6 E;  3P1X A;  2UU9 I;  3J7A G;  2LRS A;  3GON A;  4LF6 I;  1HNZ E;  3LPS A;  2LTS A;  2HFS A;  1XNQ I;  4OOG C;  2L2K B;  1RQ0 A;  3QT5 A;  1HNZ I;  2DEJ A;  3J81 Q;  1NHJ A;  1XMQ I;  4X64 E;  1MG7 A;  1T4N A;  1QZR A;  1IBL E;  4FN5 A;  3T1Y E;  3ZKB A;  4AQY I;  4X64 I;  1MU5 A;  4DV5 I;  3J81 C;  4K0K E;  4JG4 A;  1ZXN A;  1H73 A;  2DEI A;  3PYD A;  4DV4 I;  3WU4 A;  2L2M A;  1KTV A;  4X65 E;  4HY1 A;  1HR0 E;  4LF5 E;  1FNM A;  4JI8 E;  4DV6 E;  4X65 I;  4NXM I;  2HK2 A;  2BV3 A;  4LF5 I;  1B63 A;  4JI8 I;  2V34 A;  4DPW A;  5FLX Q;  1B62 A;  3PYF A;  4DV7 E;  2VQE E;  4WUC A;  4M1K A;  4LF7 I;  1N32 I;  2VQE I;  4NXN E;  2R3V A;  1PIE A;  5FLX C;  4P7A A;  1WHN A;  4NXN I;  1BKN A;  3JAM Q;  2V2V A;  1STU A;  2XEX A;  1H72 C;  3C4T A;  1U2R A;  3T1H E;  1WUU A;  1N33 E;  2UUB E;  5LMU E;  2NA2 A;  2MDR A;  3F0N A;  1Z0E A;  2CPN A;  1NHI A;  1N33 I;  4LF8 I;  2UUB I;  1IBK E;  3JAM C;  2UXC E;  4DR3 E;  5LMN E;  1N36 I;  1IBK I;  4DPY A;  4JI6 E;  4DV0 E;  2UXC I;  4DR3 I;  3B8H A;  1NZ0 A;  5IT9 Q;  4JI6 I;  4DV0 I;  2L3C A;  4URL A;  2ZM6 I;  2YT4 A;  1H7U A;  1UEK A;  2UXD E;  4OX9 I;  1Z0B A;  1Z0C A;  3OTO E;  3H4L A;  1N0U A;  3PYE A;  3OTO I;  3ZM7 A;  2B7V A;  4UTG A;  2DMY A;  1O0W A;  2HKE A;  2ZIT A;  2J7K A;  2WW4 A;  4DV2 E;  1RRE A;  1UHZ A;  4DR6 E;  4PRX A;  1PVG A;  1NHH A;  2LJP A;  1UIL A;  4DV2 I;  4M30 A;  1KKH A;  1Z59 A;  1H74 A;  4LF9 E;  4M2Z A;  4DV3 E;  4JI0 E;  5GMD A;  4PU9 A;  1XMO E;  2JY9 A;  4LF9 I;  1MX0 A;  3ADG A;  4X62 E;  1ELO A;  2V2Z A;  1XMO I;  1IBL I;  3T1Y I;  1X48 A;  4X62 I;  2A2D A;  4B3M E;  4DPT A;  4PRV A;  2GS8 A;  1FI4 A;  4K0K I;  2DIX A;  4R1F A;  1KIJ A;  4KHP E;  2NUE A;  4FWG A;  4LFB E;  1HNX E;  3ZZ0 A;  1ZBT A;  2LJH A;  3D4J A;  4KHP I;  4Z7Y A;  1HR0 I;  2B7T A;  1N34 E;  1T4L B;  1EKZ A;  1X49 A;  4FW9 A;  1HNX I;  4XTJ A;  4JI2 E;  4DV6 I;  2E5L E;  1ZM4 A;  1X47 A;  2EZ6 A;  4JI2 I;  2A2C A;  2E5L I;  4B3S E;  4DUY E;  4DV7 I;  2VQF E;  2HFU A;  4ZVI A;  4HYM A;  2V8P A;  4DR5 E;  4DUY I;  2VQF I;  4X8W A;  4YY3 E;  4DR5 I;  3J7Y p;  3HTX A;  1IBM E;  2LTR A;  4DR1 E;  4JI4 E;  2L33 A;  2R42 A;  3QT8 A;  4DR7 E;  3T1H I;  1IBM I;  3LTO A;  1RC7 A;  4LF4 E;  2UUC E;  5LMU I;  4JI4 I;  4DPU A;  4DR7 I;  1Z0G A;  1PKP A;  2NUG A;  4LF4 I;  5A2Q Q;  2HHH E;  3LNU A;  4I3H A;  4JYA E;  4FWD A;  5IWA E;  1EA6 A;  1Z5B A;  3CWV A;  4ED4 A;  4GKJ E;  5LMN I;  3ADI A;  4JV5 E;  4RPF A;  1D6T A;  5IWA I;  2F4V E;  2Q2E B;  3VYX A;  5BR8 E;  2RSM A;  4MYU A;  1FWK A;  4MYT A;  2F4V I;  5BR8 I;  2HK3 A;  4Z7C A;  2UXB E;  5IT9 C;  2UXD I;  3PYG A;  2NUF A;  4WFT A;  4HAC B;  2ZBK B;  2UXB I;  2L2N A;  3ZZU A;  3WU6 A; 
#chains in the Genus database with same CATH topology
 2JVA A;  4OKG A;  2V83 A;  1UDQ A;  4BA1 B;  3ZKD A;  4GZN C;  3ADL A;  2EOF A;  4GQU A;  1HK7 A;  4JI3 E;  5JEA C;  4WUB A;  1H7S A;  2IHR 1;  3GME A;  2YTN A;  2EPZ A;  4IZJ D;  2EOX A;  4JI3 I;  1YYK A;  2FTX B;  2N3G A;  2EOR A;  5AC5 A;  2GQ0 A;  4DR6 I;  4DKK A;  3UK3 C;  4MQY A;  4EMD A;  2B3T B;  1I94 E;  2M1S A;  2CZ9 A;  3Q6N A;  5DNL A;  2EM3 A;  2RS7 A;  1XXE A;  2EN6 A;  2YTJ A;  3PRY A;  4MU0 A;  1SR9 A;  1I94 I;  2KHX A;  4LFA E;  2EMK A;  3DJW A;  4P78 A;  2C37 A;  2EL4 A;  1XNQ E;  1XNR E;  3Q1Q A;  3KWR A;  4B3R E;  2ELZ A;  1FKA E;  4DUZ E;  4DV3 I;  2K7I A;  2KON A;  4JI0 I;  4UT4 A;  5A6A A;  2BM0 A;  2BM1 A;  5JEA A;  1YYW A;  3K1J A;  4LFA I;  5K36 D;  1XNR I;  5F3W A;  1IQO A;  4B3R I;  2N8X A;  5ADZ A;  2JE6 A;  4DUZ I;  4P52 A;  3ZZT A;  2JR1 A;  4HAC A;  1XMQ E;  1BB8 A;  1DAR A;  4N3O A;  4ZYG A;  4KQV A;  4X9J A;  2BR2 A;  2EMY A;  2EMX A;  2L3J A;  1HNW E;  2YU5 A;  2YTI A;  1QNT A;  2OI2 A;  4B3M I;  2E1M A;  4AQY E;  2EOE A;  1X5W A;  4LFC E;  1GQE A;  2EMC A;  3P3E A;  4MU4 A;  4OO1 C;  4BA1 A;  1VIS A;  4DV5 E;  1HNW I;  3DF6 A;  2CGE A;  5KL6 A;  2CG9 A;  2EOI A;  2LBS B;  4LFC I;  5L3J A;  2CT1 A;  2Z5C B;  1L4S A;  4IS1 C;  4LFB I;  5GME A;  2EFG A;  1ZU1 A;  3WU5 A;  4DV4 E;  4FWH A;  3C4B A;  1N34 I;  3HPZ A;  2GHF A;  2HKJ A;  3K17 A;  2JOB A;  1JK1 A;  2DSY A;  2LUQ A;  2VF3 A;  5C0X D;  3ADJ A;  1FJG E;  4NXM E;  2EPO A;  2V8Q B;  1R6L A;  2V88 A;  3M85 D;  2DRP A;  5DRR A;  2EM2 A;  4YHH E;  4OO1 A;  4USM A;  4HTG A;  3VYY A;  2GLI A;  4B3S I;  1FJG I;  2YTD A;  4WYQ B;  3JU0 A;  4FW7 A;  3LLH A;  1S16 A;  3WU3 A;  2J65 A;  4DR2 E;  3FIG A;  1UBD C;  1YUI A;  2C39 A;  2NN6 B;  4JI7 E;  2WBU A;  1K47 A;  4YHH I;  1MGT A;  4LF7 E;  2N3H A;  2WCC 3;  2O1T A;  2LMZ A;  1Y4U A;  2MKD A;  1N32 E;  4R2A A;  3GLL A;  4BBY A;  4DR2 I;  4YY3 I;  1SFE A;  3PS1 A;  3RMP A;  4JI7 I;  1Z0W A;  1EI1 A;  1A6F A;  1BBG A;  5KL4 A;  2WNR A;  4USK A;  3HXL A;  5DRP A;  4LPF A;  3J7A M;  2JP9 A;  4DPX A;  2RTX A;  3QT7 A;  2LUP B;  2EOZ A;  3VHT B;  3BGH A;  1UDS A;  2JT2 A;  4DU7 A;  3EPK A;  1WHQ A;  3J80 Q;  4DR1 I;  1J26 A;  4M0V A;  5C0X E;  2F8B A;  4F9A B;  1B69 A;  2ODR C;  2L92 A;  4HEI A;  3U1Y A;  2NPF A;  2O1V A;  4BMJ A;  2UUC I;  2PO1 A;  4X66 E;  1A1F A;  5CFF E;  1USV A;  1ZR9 A;  4DU8 A;  4ZYE A;  2IER A;  2ADR A;  2HHH I;  4X66 I;  4JYA I;  2RPC A;  4LF8 E;  1USU A;  2EOY A;  3J80 C;  1YZ9 A;  2EML A;  2RS6 A;  4GKJ I;  3B82 A;  4DXL A;  1N3G A;  2EPN A;  4JV5 I;  4GKK E;  3UHM A;  1N36 E;  2C37 B;  5A2Q C;  2YTE A;  5JEA D;  3M6A A;  3QT6 A;  2JYA A;  2V2Q A;  1YYO A;  2JEA A;  4GKK I;  5C0X F;  4OZE A;  1WJP A;  2DB2 A;  2HC5 A;  2YRM A;  4DR4 E;  4BCA A;  4B3T E;  3V5R A;  3F6G A;  1F2I G;  2HGH A;  1FWL A;  1KVK A;  1S4E A;  2NN6 F;  1Z5A A;  3THO B;  2R76 A;  3F6H A;  2ZM6 E;  2IES A;  4DR4 I;  1J5E E;  1XHK A;  2BR2 B;  4WUD A;  2B9D A;  3V2U C;  4B3T I;  4OX9 E;  1QU6 A;  4IFD A;  4AM3 A;  4JI5 E;  2EMH A;  2X36 A;  1P47 A;  1DI2 A;  3B4T A;  3P3C A;  1N0V C;  5AE3 A;  1Z0T A;  2BA1 G;  4N4R B;  1OJ4 A;  1J5E I;  3B78 A;  2LVH A;  1Z0V A;  3HUL A;  1Z5C A;  4JI5 I;  2CSH A;  3JTZ A;  2PRT A;  1A1K A;  1ZM3 A;  1T4O A;  5LL6 R;  2EL5 A;  2E1R A;  4DV1 E;  4JI1 E;  2UUA E;  2IOQ A;  4WSG A;  1ZM9 A;  5KL3 A;  4F9C B;  1ZM2 A;  5JEA E;  3TQM A;  2LCE A;  2V89 A;  2ENC A;  1Y6Z A;  4DV1 I;  4JI1 I;  2UUA I;  2C38 A;  2WBS A;  1RR9 A;  1ZXM A;  2EM5 A;  2UU9 E;  2AJ4 A;  4Q35 B;  2X7I A;  4HXZ A;  1Y4S A;  3HPS A;  1A1I A;  4LF6 E;  3IWD A;  4F54 A;  1OYP A;  2PNM A;  3P1X A;  4OO1 B;  2UU9 I;  2MDG A;  3J7A G;  5IXM B;  2LRS A;  3GON A;  4LF6 I;  2DLK A;  3IWB A;  4O43 A;  2LTS A;  1HNZ E;  2HFS A;  3LPS A;  1XNQ I;  2C39 B;  2LJU A;  2I13 A;  4OOG C;  2L2K B;  1RQ0 A;  4J3D A;  2CTD A;  3P06 A;  4MDT A;  4R2R A;  3QT5 A;  2EPU A;  5JEA F;  1HNZ I;  1LLM C;  2WP8 A;  2DEJ A;  5EL9 A;  3J81 Q;  1NHJ A;  2V86 A;  2WNR B;  2VE7 C;  2EE8 A;  1XMQ I;  2LE2 A;  4X64 E;  2L6M A;  1MG7 A;  2O3Z A;  5EKW A;  1T4N A;  2YWQ A;  2EM6 A;  1QZR A;  4L5N C;  1AAY A;  2Z5B B;  1IBL E;  4FN5 A;  3T1Y E;  3ZKB A;  2DMI A;  4AQY I;  4X64 I;  4OO1 E;  2IOP A;  1MU5 A;  2EOH A;  2FV4 B;  2WZO A;  5IV8 B;  1G2D C;  4DV5 I;  3KZZ A;  3VK6 A;  2BA0 G;  3J81 C;  2GO4 A;  4R2Q A;  2PO1 B;  2WBT A;  2EN1 A;  4K0K E;  4JG4 A;  4TUG A;  1ZXN A;  2GPI A;  1H73 A;  1DQ3 A;  3GCM A;  2DEI A;  2EOO A;  1E3P A;  3PYD A;  2EWL A;  4R2S A;  4DV4 I;  3WU4 A;  2L2M A;  1A1J A;  2EM9 A;  1KTV A;  4X65 E;  4TUI A;  4ZYH A;  3HQ1 A;  1HR0 E;  4HY1 A;  4IZK A;  3CDJ A;  4LF5 E;  1FNM A;  4JI8 E;  5KL7 A;  1EH8 A;  2ODR D;  4DV6 E;  2NN6 D;  4X65 I;  3M7N G;  1YFH A;  4NXM I;  1A1G A;  2HK2 A;  2BV3 A;  2JEA B;  2EOM A;  4LF5 I;  4OO1 F;  4R8O A;  1IQS A;  2YU8 A;  1B63 A;  4JI8 I;  2EP3 A;  2V34 A;  4DPW A;  2MC6 A;  3C6K A;  1WXR A;  4NZV A;  4QNJ A;  1B62 A;  5FLX Q;  5K36 C;  5A6B A;  1VI7 A;  4IZJ A;  4L8N A;  3PS3 A;  5A6K A;  2VQE E;  4DV7 E;  3PYF A;  4WUC A;  4M1K A;  1NCS A;  1AH5 A;  3EPJ A;  4LF7 I;  4IFD B;  2EPK X;  1YPN A;  2JXP A;  3NZK A;  1N32 I;  2M9A A;  2PO0 A;  2VQE I;  3L00 A;  2EOJ A;  4O24 A;  2LT7 A;  4AID A;  4NXN E;  3MHH C;  2DGC A;  2R3V A;  2Z5B A;  3CDI A;  2EMI A;  4BHB A;  1PIE A;  3M85 G;  5FLX C;  1MEY C;  4P7A A;  2EMG A;  1WHN A;  2K4V A;  2L8T A;  3BID A;  2ENA A;  1GZ6 A;  4LTY A;  1A1L A;  3L7Z A;  4NXN I;  2YTP A;  3IWC A;  5T6J A;  5KL2 A;  1BKN A;  4MU3 A;  2NN6 E;  4R2P A;  2V2V A;  1STU A;  4MLV A;  2AE8 A;  3JAM Q;  2XEX A;  1H72 C;  4ISA A;  4R03 A;  2EJ4 A;  3C4T A;  5AE2 A;  5K36 A;  3QG5 C;  2JPA A;  4P7D A;  4WXD A;  3EPH A;  3T1H E;  1U2R A;  1WUU A;  2PNL A;  1N33 E;  2C38 B;  2EN2 A;  3H1C A;  2UUB E;  2VF1 A;  5LMU E;  2NA2 A;  2MDR A;  3F0N A;  1Z0E A;  2CPN A;  3HJC A;  2VES A;  1NHI A;  2Z5E A;  1N33 I;  1YUJ A;  4LF8 I;  2UUB I;  1NEI A;  1IBK E;  3JAM C;  2UXC E;  5DNX A;  4DR3 E;  3H09 A;  5TSE A;  1EH6 A;  2ELY A;  1X6F A;  2BB8 A;  5LMN E;  4LCF A;  2VRD A;  1N36 I;  4BC9 A;  1IBK I;  4DPY A;  4JI6 E;  4DV0 E;  5AAS A;  3KRN A;  2UXC I;  1JK2 A;  4DR3 I;  2EM7 A;  3B8H A;  3AUZ A;  1NZ0 A;  2WP8 B;  2EN3 A;  5IT9 Q;  4JI6 I;  4DV0 I;  1UN6 B;  2EMA A;  2BBG A;  4U3D A;  3ECR A;  2O1W A;  4I8O A;  5DRQ A;  3K6Q A;  2L3C A;  1ZBQ A;  2BA1 D;  5DNY A;  2EOS A;  1PJS A;  4URL A;  2ENH A;  2ZM6 I;  1X3C A;  2YT4 A;  4LU9 A;  1YSA C;  1H7U A;  1P42 A;  2UXD E;  1UEK A;  4RH8 A;  2O1U A;  4OX9 I;  1Z0B A;  2KOU A;  1Z0C A;  3OTO E;  2Q8U A;  2PNZ A;  3U1K A;  4FW6 A;  3H4L A;  4WX9 A;  1N0U A;  4BA2 A;  2YRK A;  4NHR A;  3PYE A;  3OTO I;  2R1F A;  4F6N A;  3ZM7 A;  2B7V A;  1PJT A;  4UTG A;  2I9I A;  4ZYD A;  2DMY A;  3OML A;  2EPP A;  4OO1 D;  1O0W A;  4U3B A;  2HKE A;  3PS2 A;  2EQ3 A;  2RQL A;  1R6M A;  4IZK B;  2F1D A;  3C6M A;  4F6M A;  2ZIT A;  2J7K A;  2WW4 A;  5FWK A;  4DV2 E;  1RRE A;  2A25 A;  1T38 A;  1UHZ A;  4DR6 E;  4PRX A;  2EPA A;  1PVG A;  1NHH A;  5A6B D;  2V87 A;  2LJP A;  1UIL A;  2YTQ A;  4DV2 I;  3EQ1 A;  2EM0 A;  1YH8 A;  4M30 A;  1KKH A;  4R2C A;  4IZJ B;  5A6J A;  1OYS A;  1KYQ A;  1BBO A;  5LLQ A;  1Z59 A;  2EPC A;  1H74 A;  4KZS A;  1EH7 A;  4LF9 E;  1UDN A;  4M2Z A;  2EQ1 A;  2HJJ A;  4DV3 E;  4JI0 E;  2PO0 B;  3BBG A;  5GMD A;  4PU9 A;  2RSI A;  3P3G A;  1XMO E;  2JY9 A;  4LF9 I;  1MX0 A;  3ADG A;  1X6H A;  4X62 E;  2BA0 D;  1ELO A;  2J7J A;  3L7Z B;  2V2Z A;  1XMO I;  4IJD A;  1IBL I;  1E3H A;  3T1Y I;  2D9H A;  1X48 A;  1UDO A;  4X62 I;  2A2D A;  4IFD C;  2M4I A;  4FK5 C;  4KWY A;  4B3M E;  4DPT A;  5K36 B;  4PRV A;  1X6E A;  2MC5 A;  2GS8 A;  4AIM A;  1FI4 A;  4K0K I;  2DIX A;  4R1F A;  1KIJ A;  3LML A;  5A69 A;  4KHP E;  2DLQ A;  2NUE A;  4O4K A;  2YTF A;  4FWG A;  4BHC A;  3M7N D;  3DD6 A;  5ELW A;  3THN A;  2LV2 A;  4LFB E;  1HNX E;  2EPX A;  3ZZ0 A;  1ZBT A;  2E72 A;  2EL6 A;  2H36 X;  2LJH A;  3D4J A;  3MSW A;  4J8Z A;  4Z7Y A;  4KHP I;  1HR0 I;  2B7T A;  1N34 E;  1T4L B;  1EKZ A;  1X49 A;  5AE1 A;  3ZOQ B;  2YSO A;  2EPR A;  2GO3 A;  4JI2 E;  4FW9 A;  4XTJ A;  4DV6 I;  2G7H A;  1HNX I;  2E5L E;  3KZY A;  1ZM4 A;  4IFD D;  1RMD A;  1X47 A;  1YHC A;  2PO2 B;  2EZ6 A;  5K36 E;  4IS9 A;  4JI2 I;  4LCG A;  2JEB B;  1TN9 A;  2YTO A;  4MLQ A;  2A2C A;  2E5L I;  4B3S E;  2EM8 A;  4DUY E;  2YTG A;  4DV7 I;  2VQF E;  2HFU A;  4ZVI A;  4HYM A;  2EOQ A;  5C0X B;  4MU1 A;  2V8P A;  1IMU A;  4DR5 E;  1KJK A;  4DUY I;  2EPL X;  4Q28 A;  2VQF I;  3EPL A;  4X8W A;  1G2F C;  3K85 A;  4YY3 E;  2LO3 A;  4DMI A;  4F9B B;  4M9V C;  2EMZ A;  2PNZ B;  4DR5 I;  1A1H A;  3J7Y p;  1TF3 A;  4BA2 B;  3HTX A;  2YSP A;  3AV0 A;  4LOM A;  2EN7 A;  2EMB A;  1IBM E;  2JWO A;  1PDA A;  2LTR A;  4QNK A;  4R2E A;  4DR1 E;  4JI4 E;  2L33 A;  2R42 A;  3QT8 A;  4DR7 E;  5K36 F;  4NBQ A;  4IFD E;  2NAB A;  3Q6M A;  5C0X C;  3MHS C;  4O5G A;  2EN8 A;  1RC7 A;  3LTO A;  4LF4 E;  3BF2 A;  3T1H I;  1IBM I;  2UUC E;  5LMU I;  4JI4 I;  4DPU A;  4DR7 I;  1Z0G A;  1PKP A;  2NN6 C;  2CVE A;  2Z5C A;  2YZT A;  2NUG A;  4LF4 I;  4BC7 A;  1TF6 A;  5A2Q Q;  2HHH E;  3LNU A;  2YRH A;  4JYA E;  4FWD A;  2EMW A;  5IWA E;  1EA6 A;  4LCH A;  4I3H A;  1Z5B A;  1Y60 A;  3CWV A;  2FGG A;  4FW5 A;  4ED4 A;  2YPN A;  4F2J C;  4GKJ E;  2PO2 A;  4FW3 A;  4RHB B;  5LMN I;  3ADI A;  4JV5 E;  4RPF A;  2V85 A;  1D6T A;  1OYR A;  1GTK A;  2JEB A;  5IWA I;  2F4V E;  2Q2E B;  4WXC A;  3VYX A;  1ZAA C;  5BR8 E;  1T39 A;  4GEQ B;  4WPY A;  3P76 A;  2RSM A;  4MYU A;  2EPM X;  5C0X A;  2JOX A;  1FWK A;  4IFD F;  5AC4 A;  2EN4 A;  4MYT A;  4FW4 A;  2F4V I;  5BR8 I;  4WSP A;  2EM4 A;  4BS9 A;  1Z1B A;  2HK3 A;  2NN6 A;  4Z7C A;  4R2D A;  2EQ0 A;  1PJQ A;  5JEA B;  2UXB E;  5IT9 C;  2UXD I;  3HKM A;  2MKN A;  3M99 B;  2JE6 B;  1Y5Y A;  2NUF A;  1DGC A;  4WFT A;  3PYG A;  4HAC B;  2M7Q A;  5DRO A;  2ZBK B;  1WRJ A;  2UXB I;  2L2N A;  5KL5 A;  1RHY A;  3ZZU A;  3WU6 A;  2EMF A; 
#chains in the Genus database with same CATH homology
 2JVA A;  2V83 A;  3ZKD A;  3ADL A;  1HK7 A;  4JI3 E;  4WUB A;  1H7S A;  2IHR 1;  4IZJ D;  4JI3 I;  1YYK A;  2FTX B;  2N3G A;  2GQ0 A;  4DR6 I;  4DKK A;  4EMD A;  2B3T B;  1I94 E;  2M1S A;  2CZ9 A;  3Q6N A;  2RS7 A;  3PRY A;  1SR9 A;  1I94 I;  2KHX A;  4LFA E;  3DJW A;  4P78 A;  1XNQ E;  1XNR E;  3Q1Q A;  4B3R E;  3KWR A;  1FKA E;  4DUZ E;  4DV3 I;  2KON A;  4JI0 I;  4UT4 A;  2BM0 A;  2BM1 A;  4LFA I;  1YYW A;  3K1J A;  1XNR I;  5F3W A;  4B3R I;  5ADZ A;  4DUZ I;  4P52 A;  3ZZT A;  2JR1 A;  4HAC A;  1XMQ E;  1DAR A;  4N3O A;  4KQV A;  2L3J A;  1HNW E;  2OI2 A;  4B3M I;  2E1M A;  4AQY E;  4LFC E;  1GQE A;  1VIS A;  4DV5 E;  1HNW I;  3DF6 A;  2CGE A;  2CG9 A;  2LBS B;  4LFC I;  5L3J A;  2Z5C B;  4LFB I;  5GME A;  2EFG A;  3WU5 A;  4DV4 E;  4FWH A;  3C4B A;  1N34 I;  3HPZ A;  2HKJ A;  3K17 A;  2JOB A;  2DSY A;  2LUQ A;  2VF3 A;  3ADJ A;  1FJG E;  4NXM E;  2V8Q B;  2V88 A;  4YHH E;  4USM A;  3VYY A;  4B3S I;  1FJG I;  4WYQ B;  3JU0 A;  3LLH A;  1S16 A;  3WU3 A;  4DR2 E;  3FIG A;  4YHH I;  4JI7 E;  1K47 A;  4LF7 E;  2N3H A;  2O1T A;  2LMZ A;  1Y4U A;  1N32 E;  4DR2 I;  4BBY A;  4YY3 I;  4JI7 I;  3RMP A;  1Z0W A;  1EI1 A;  1A6F A;  4USK A;  3HXL A;  3J7A M;  4DPX A;  2RTX A;  3QT7 A;  2LUP B;  4DU7 A;  1WHQ A;  3J80 Q;  4DR1 I;  1J26 A;  4M0V A;  2F8B A;  4F9A B;  2ODR C;  2L92 A;  2NPF A;  2O1V A;  4BMJ A;  2UUC I;  4X66 E;  5CFF E;  1USV A;  4DU8 A;  2HHH I;  4X66 I;  4JYA I;  4LF8 E;  1USU A;  3J80 C;  1YZ9 A;  4GKJ I;  2RS6 A;  3B82 A;  4DXL A;  4JV5 I;  4GKK E;  1N36 E;  5A2Q C;  3M6A A;  3QT6 A;  2V2Q A;  1YYO A;  4GKK I;  2DB2 A;  4DR4 E;  4BCA A;  4B3T E;  3V5R A;  3F6G A;  1KVK A;  1FWL A;  1S4E A;  1Z5A A;  3F6H A;  2ZM6 E;  4DR4 I;  1J5E E;  1XHK A;  4WUD A;  3V2U C;  2B9D A;  4B3T I;  4OX9 E;  1QU6 A;  4JI5 E;  2X36 A;  1DI2 A;  1N0V C;  5AE3 A;  1Z0T A;  1OJ4 A;  1J5E I;  3B78 A;  1Z0V A;  3HUL A;  1Z5C A;  4JI5 I;  3JTZ A;  1ZM3 A;  1T4O A;  5LL6 R;  2E1R A;  4DV1 E;  4JI1 E;  2UUA E;  2IOQ A;  1ZM9 A;  1ZM2 A;  4F9C B;  2V89 A;  1Y6Z A;  4DV1 I;  4JI1 I;  2UUA I;  1RR9 A;  1ZXM A;  2UU9 E;  2AJ4 A;  2X7I A;  4HXZ A;  1Y4S A;  3HPS A;  4LF6 E;  3IWD A;  4F54 A;  2PNM A;  3P1X A;  2UU9 I;  3J7A G;  2LRS A;  3GON A;  4LF6 I;  3IWB A;  1HNZ E;  3LPS A;  2LTS A;  2HFS A;  1XNQ I;  4OOG C;  2L2K B;  1RQ0 A;  3P06 A;  3QT5 A;  1HNZ I;  2DEJ A;  3J81 Q;  1NHJ A;  2V86 A;  2VE7 C;  1XMQ I;  2LE2 A;  4X64 E;  2L6M A;  1MG7 A;  1T4N A;  1QZR A;  4L5N C;  2Z5B B;  1IBL E;  4FN5 A;  3T1Y E;  3ZKB A;  4AQY I;  4X64 I;  2IOP A;  1MU5 A;  2FV4 B;  2WZO A;  4DV5 I;  3VK6 A;  3J81 C;  4K0K E;  4JG4 A;  4TUG A;  1ZXN A;  1H73 A;  1DQ3 A;  2DEI A;  3PYD A;  2EWL A;  4DV4 I;  3WU4 A;  2L2M A;  1KTV A;  4X65 E;  4TUI A;  3HQ1 A;  1HR0 E;  4HY1 A;  4IZK A;  4LF5 E;  1FNM A;  4JI8 E;  2ODR D;  4DV6 E;  4X65 I;  4NXM I;  2HK2 A;  2BV3 A;  4LF5 I;  4R8O A;  1B63 A;  4JI8 I;  2V34 A;  4DPW A;  2MC6 A;  5FLX Q;  1WXR A;  1B62 A;  4IZJ A;  4L8N A;  3PYF A;  4DV7 E;  2VQE E;  4WUC A;  4M1K A;  4LF7 I;  1N32 I;  2VQE I;  4NXN E;  2R3V A;  2Z5B A;  1PIE A;  5FLX C;  4P7A A;  1WHN A;  2K4V A;  2L8T A;  1GZ6 A;  4LTY A;  4NXN I;  3IWC A;  5T6J A;  1BKN A;  3JAM Q;  2V2V A;  1STU A;  2XEX A;  1H72 C;  4R03 A;  3C4T A;  5AE2 A;  1U2R A;  4P7D A;  2PNL A;  3T1H E;  1WUU A;  1N33 E;  2UUB E;  2VF1 A;  5LMU E;  2NA2 A;  2MDR A;  3F0N A;  1Z0E A;  2CPN A;  3HJC A;  1NHI A;  2Z5E A;  1N33 I;  4LF8 I;  2UUB I;  1IBK E;  3JAM C;  2UXC E;  4DR3 E;  3H09 A;  5LMN E;  1N36 I;  1IBK I;  4BC9 A;  4DPY A;  4JI6 E;  4DV0 E;  5AAS A;  2UXC I;  4DR3 I;  3B8H A;  3AUZ A;  1NZ0 A;  5IT9 Q;  4JI6 I;  4DV0 I;  2O1W A;  4I8O A;  3K6Q A;  2L3C A;  1ZBQ A;  5DNY A;  4URL A;  2ZM6 I;  2YT4 A;  4LU9 A;  1H7U A;  1UEK A;  2O1U A;  2UXD E;  4OX9 I;  1Z0B A;  2KOU A;  1Z0C A;  3OTO E;  3H4L A;  1N0U A;  3PYE A;  3OTO I;  3ZM7 A;  2B7V A;  4UTG A;  2DMY A;  3OML A;  1O0W A;  2HKE A;  4IZK B;  2ZIT A;  2J7K A;  2WW4 A;  5FWK A;  4DV2 E;  1RRE A;  1UHZ A;  4DR6 E;  4PRX A;  1PVG A;  1NHH A;  2V87 A;  2LJP A;  1UIL A;  4DV2 I;  4M30 A;  1KKH A;  4IZJ B;  1Z59 A;  1H74 A;  4KZS A;  4LF9 E;  4M2Z A;  4DV3 E;  4JI0 E;  5GMD A;  4PU9 A;  1XMO E;  2JY9 A;  4LF9 I;  1MX0 A;  3ADG A;  4X62 E;  1ELO A;  2V2Z A;  1XMO I;  1IBL I;  3T1Y I;  1X48 A;  4X62 I;  2A2D A;  2M4I A;  4B3M E;  4DPT A;  4PRV A;  2MC5 A;  2GS8 A;  1FI4 A;  4K0K I;  2DIX A;  4R1F A;  1KIJ A;  3LML A;  4KHP E;  2NUE A;  4FWG A;  4LFB E;  1HNX E;  3ZZ0 A;  1ZBT A;  2LJH A;  3D4J A;  2H36 X;  4KHP I;  3MSW A;  4J8Z A;  4Z7Y A;  1HR0 I;  2B7T A;  1N34 E;  1T4L B;  1EKZ A;  1X49 A;  5AE1 A;  3ZOQ B;  4FW9 A;  4XTJ A;  1HNX I;  4JI2 E;  4DV6 I;  2G7H A;  2E5L E;  1ZM4 A;  1X47 A;  2EZ6 A;  4JI2 I;  2A2C A;  2E5L I;  4B3S E;  4DUY E;  4DV7 I;  2VQF E;  2HFU A;  4ZVI A;  4HYM A;  2V8P A;  4DR5 E;  4DUY I;  4Q28 A;  2VQF I;  3K85 A;  4X8W A;  4YY3 E;  4DMI A;  4F9B B;  4DR5 I;  3J7Y p;  3HTX A;  3AV0 A;  1IBM E;  2JWO A;  2LTR A;  4DR1 E;  4JI4 E;  2L33 A;  2R42 A;  3QT8 A;  4DR7 E;  3Q6M A;  3T1H I;  1IBM I;  3LTO A;  1RC7 A;  4LF4 E;  2UUC E;  5LMU I;  4JI4 I;  4DPU A;  4DR7 I;  1Z0G A;  1PKP A;  2Z5C A;  2YZT A;  2NUG A;  4LF4 I;  4BC7 A;  5A2Q Q;  2HHH E;  3LNU A;  4I3H A;  4JYA E;  4FWD A;  5IWA E;  1EA6 A;  1Z5B A;  3CWV A;  2FGG A;  4ED4 A;  4GKJ E;  5LMN I;  3ADI A;  4JV5 E;  4RPF A;  2V85 A;  1D6T A;  5IWA I;  2F4V E;  2Q2E B;  3VYX A;  5BR8 E;  4GEQ B;  4WPY A;  2RSM A;  4MYU A;  2JOX A;  1FWK A;  4MYT A;  2F4V I;  5BR8 I;  4WSP A;  4BS9 A;  2HK3 A;  4Z7C A;  2UXB E;  5IT9 C;  2UXD I;  3PYG A;  2NUF A;  4WFT A;  4HAC B;  2M7Q A;  2ZBK B;  2UXB I;  2L2N A;  3ZZU A;  3WU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...