4KHPE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4khpE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpE02
2VQEI 2ZITA 2N3HA 2EFGA 4DR3I 3ZKBA 1XMQE 4MYUA 2UUCI 1QZRA 2DEJA 4DR1E 3F0NA 3M6AA 2VF3A 2UXBI 5BR8E 1N34I 4X66I 1ZM3A 3OTOI 2X36A 4JV5I 4WUCA 1HNXI 1RR9A 1PVGA 3QT5A 3ZKDA 3K1JA 4OX9I 1X48A 4RPFA 1XNQE 4WUDA 4DV1E 4DV6E 4LFBI 4K0KI 4JI8I 2L3JA 3H4LA 1Z5BA 1N36I 1FWKA 4MYTA 2DB2A 2E1RA 1T4LB 4DXLA 4DU8A 4DV3I 4M30A 4JI6E 3QT7A 2RTXA 2LUPB 1XNRE 2V2ZA 2HFUA 3ADGA 1Z5CA 1FNMA 4AQYI 4YHHI 2R3VA 2UU9I 1WHQA 3J7Yp 4R1FA 4X65E 2F4VE 4DR2E 4YY3E 4JI0E 3Q1QA 4NXNI 1H7UA 1A6FA 3HTXA 2ZM6I 5A2QQ 1KVKA 1OJ4A 4JI4I 1N0UA 4UTGA 4B3TI 2NPFA 1I94E 4OOGC 4LF8I 4LF6E 5LL6R 5IT9C 1XMQI 2LRSA 1X49A 2LBSB 2NUFA 4LF7E 4PU9A 4WYQB 1B62A 1X47A 4DR4E 5GMEA 3V5RA 3LNUA 1Z5AA 3GONA 4KHPE 1Z0TA 1EKZA 2B3TB 2JY9A 3JAMQ 4LF5E 2YT4A 4FN5A 3K17A 1YYOA 2V8PA 3PYFA 1XNQI 1ELOA 3QT6A 4LFAE 4DV1I 4DV6I 2WW4A 3B8HA 4PRVA 1K47A 4X62E 2X7IA 2LTSA 4JI3E 2J7KA 1O0WA 1Z0GA 4HYMA 1MG7A 3QT8A 1T4OA 1HR0I 3VYXA 1FI4A 4DV7E 4JI5E 2UUBE 2VQFE 3PYGA 1U2RA 4JI6I 3J7AM 3WU5A 1PIEA 1XNRI 1IBME 4DR6E 4DV2E 2V34A 4B3RE 2EZ6A 4DUZE 3J80C 1DI2A 4X65I 2F4VI 3J7AG 3ZZTA 4DR2I 1DARA 5GMDA 4ZVIA 4YY3I 3T1HE 4JI0I 3JAMC 2LTRA 1T4NA 3ADJA 4LFCE 2HFSA 4UT4A 1N0VC 1I94I 3WU4A 4LF6I 2L2NA 4DUYE 5IT9Q 2JVAA 2LJPA 1STUA 3WU6A 2KHXA 4LF9E 1J26A 1WUUA 2NUGA 2AJ4A 3PYDA 4LF7I 1N33E 2UUAE 4DR7E 2UXCE 4KQVA 1FKAE 2DIXA 2GS8A 5LMUE 4DR4I 4WUBA 2VQEE 4KHPI 4XTJA 4DPXA 2MDRA 4DR3E 3ZZ0A 1H74A 4LF5I 1B63A 1J5EE 4FWDA 4DV0E 1S4EA 1H7SA 4LFAI 1UHZA 1IBKE 4X62I 4JI3I 2HHHE 4FWGA 2OI2A 4JYAE 5FLXQ 1N34E 2ZBKB 2N3GA 2NA2A 4DV7I 4EMDA 4JI5I 2UUBI 2VQFI 1YYWA 5LMNE 1D6TA 1XMOE 1RREA 1RQ0A 4B3ME 3C4BA 1IBMI 4DR6I 3J80Q 4I3HA 4DV2I 1RC7A 4DR1I 4B3RI 4URLA 4DUZI 4DV5E 4LFBE 5BR8I 5CFFE 2CZ9A 4DPYA 1ZBTA 3T1HI 3ZM7A 4LFCI 4PRXA 4HACA 4DU7A 2L3CA 1Z0VA 2UXDE 2UU9E 4P52A 1KIJA 2BV3A 4DUYI 2BM0A 4HXZA 4LF9I 5IWAE 3ZZUA 5FLXC 3B82A 4DPWA 1FJGE 2HKJA 1N33I 2UUAI 4JI1E 4DR7I 3LLHA 1Z59A 3T1YE 4M2ZA 3PYEA 1NZ0A 1HNZE 4GKKE 1ZM9A 5LMUI 1ZM4A 4LF4E 4DPUA 1ZXMA 2L2KB 1J5EI 4NXME 4DV0I 1NHHA 3J81Q 1H73A 3ADLA 1H72C 1IBKI 4DV4E 2HHHI 4X64E 4JYAI 2A2CA 1KTVA 4USKA 4JI7E 4JI2E 4B3SE 2A2DA 3VYYA 4DPTA 1YZ9A 5LMNI 2L2MA 1HNWE 1ZM2A 1XMOI 4B3MI 4GKJE 1IBLE 4WFTA 2E5LE 1N32E 1ZXNA 4DV5I 1NHJA 4DR5E 1WHNA 4FW9A 2RSMA 4M1KA 2HK2A 2DEIA 1HR0E 1XHKA 2LJHA 4ED4A 2UUCE 4DKKA 1UEKA 3LTOA 3ADIA 2HKEA 2RS7A 3B78A 3J81C 2UXDI 4HACB 2UXBE 2V2VA 2Q2EB 4X8WA 4X66E 3OTOE 1YYKA 4JV5E 5IWAI 1HNXE 1Z0CA 4HY1A 1NHIA 1FJGI 1UILA 2B7VA 1EI1A 4JI1I 1Z0BA 2NUEA 3WU3A 3T1YI 1FWLA 1S16A 4OX9E 2R42A 4P7AA 2L33A 1HNZI 4GKKI 3C4TA 1PKPA 1Z0EA 1QU6A 4Z7YA 4K0KE 4JI8E 1BKNA 3D4JA 4LF4I 1MX0A 5L3JA 1N36E 2V2QA 1KKHA 2IHR1 4NXMI 2DMYA 4DV3E 3HULA 3LPSA 2CPNA 2LUQA 3P1XA 2BM1A 1MU5A 4JG4A 2B7TA 1Z0WA 4DV4I 4X64I 4AQYE 4YHHE 2XEXA 4FWHA 1GQEA 3CWVA 4JI7I 4JI2I 1VISA 3V2UC 4B3SI 1HNWI 4NXNE 4USMA 4GKJI 1IBLI 2ZM6E 2UXCI 2HK3A 4Z7CA 4JI4E 2E5LI 1N32I 1EA6A 5A2QC 4B3TE 4DR5I 4LF8E 2RS6A
chains in the Genus database with same CATH superfamily
4R2AA 2VQEI 3THNA 2ZITA 2GHFA 5DNXA 5ADZA 2N3HA 1Y5YA 3DF6A 2GLIA 3BGHA 2EFGA 4IS9A 3U1YA 4DR3I 1X5WA 3ZKBA 1XMQE 2CG9A 5DRQA 2JPAA 4MYUA 5K36D 2EM6A 2UUCI 5C0XF 2YSPA 2EN2A 2EPNA 1B69A 1QZRA 2DEJA 5K36B 5KL7A 2PO2A 2ENHA 4DR1E 3F0NA 3M6AA 1UDNA 3M85D 2V8QB 1Y6ZA 2C38A 2ELZA 2M4IA 2VF3A 4AIDA 3JU0A 2UXBI 4O43A 5BR8E 2F8BA 2PO1B 1N34I 3K6QA 4X66I 1ZM3A 3UK3C 3OTOI 2YTOA 3DJWA 2LE2A 1TN9A 2X36A 3C6MA 4WUCA 1HNXI 1RR9A 4JV5I 1PVGA 4BA1A 4R2DA 3QT5A 1MEYC 3ZKDA 2EN8A 2EWLA 4ZYHA 3K1JA 4IFDB 4OX9I 1X48A 4RPFA 2LVHA 1XNQE 4P78A 5K36C 5DROA 4WUDA 4BC9A 2EPOA 4DV1E 4IZKA 4DV6E 4LFBI 1IMUA 2LCEA 4K0KI 4R8OA 4JI8I 1OYPA 4MLVA 2EPZA 1G2DC 2L3JA 3H4LA 2ENCA 1Z5BA 2JEBA 1N36I 4ZYGA 2RSIA 1FWKA 2EMIA 1BBGA 2L8TA 4MYTA 4R2EA 2DB2A 2E1RA 1T4LB 4DXLA 3MSWA 3P76A 4DU8A 4DV3I 4M30A 4BBYA 4JI6E 2RTXA 3QT7A 3IWCA 2LUPB 1XNRE 2L92A 2H36X 4O5GA 4ZYDA 2V2ZA 2HFUA 3ADGA 1Y4UA 1A1LA 3MHSC 1Z5CA 1FNMA 2YSOA 3BBGA 2EPCA 1AAYA 2R3VA 4YHHI 4AQYI 5ELWA 2UU9I 1WHQA 3J7Yp 1YFHA 4Q28A 4R1FA 2EE8A 4X65E 1KYQA 2F4VE 3PS1A 2GQ0A 2JE6B 2L6MA 1BBOA 4J8ZA 1LLMC 2EN6A 4DR2E 2YTFA 5KL3A 4ISAA 4YY3E 4F54A 4JI0E 1ZBQA 2YU5A 2KOUA 4NXNI 3Q1QA 1H7UA 1A6FA 3U1KA 3UHMA 3HTXA 2ZM6I 5A2QQ 1KVKA 1OJ4A 2NN6A 4JI4I 4AM3A 1N0UA 4FK5C 3DD6A 4UTGA 4B3TI 2NPFA 1I94E 5K36F 4OOGC 3HQ1A 4LF8I 1E3HA 3CDJA 1N3GA 4LF6E 3P3GA 2IERA 5LL6R 4BHBA 2EM0A 5DNLA 2EMYA 2PO0A 1L4SA 5IT9C 1XMQI 2LRSA 1X49A 2LBSB 2EJ4A 4FW5A 2NN6E 5AC4A 2NUFA 4LF7E 5AE2A 1A1GA 4PU9A 2RPCA 2CGEA 4WYQB 3LMLA 1UDOA 1USUA 2WBUA 1A1IA 4RH8A 1B62A 1X6EA 2YTGA 4L8NA 4F6MA 1SFEA 4IFDF 1X47A 4DR4E 5AC5A 4ZYEA 5GMEA 3V5RA 3M7NG 3LNUA 1Z5AA 2JOBA 2Z5CB 2EMHA 1GTKA 3GONA 5DRRA 1MGTA 2EPPA 2VE7C 2DGCA 4KHPE 1Z0TA 1UDQA 4FW7A 4LCFA 2DLKA 1EKZA 2B3TB 2YRKA 4GZNC 2JY9A 3JAMQ 4LF5E 2YT4A 3JTZA 1R6MA 4FN5A 3K17A 1YYOA 2V8PA 3KZZA 2C37B 3PYFA 3PS2A 4R2PA 4WXCA 2EPXA 1ELOA 2GO3A 1XNQI 4F9CB 3QT6A 5JEAF 4LFAE 2BA0D 3VK6A 5IXMB 2YTQA 4DV1I 4DV6I 5AASA 2WW4A 3B8HA 2JYAA 1K47A 3NZKA 2YTIA 4X62E 2X7IA 2LTSA 1NEIA 4LTYA 4JI3E 1O0WA 1Z0GA 2J7KA 4HYMA 4M9VC 2HJJA 1MG7A 2EOJA 5AE1A 1TF6A 1OYRA 4IZKB 5C0XA 2CT1A 1T4OA 2DRPA 3QT8A 1HR0I 2FTXB 4MDTA 2EOZA 3VYXA 2BR2B 1FI4A 2EPLX 4OZEA 2EQ3A 2YRHA 4DV7E 4JI5E 2UUBE 3EPJA 2EOXA 2VQFE 2C39B 4WSGA 3PYGA 4OO1E 1U2RA 2O3ZA 4HEIA 3B4TA 4FW4A 4MQYA 4JI6I 2PNZA 3J7AM 4MU1A 3WU5A 1T39A 1PIEA 4HTGA 1XNRI 1IBME 4DR6E 2YTNA 4F2JC 4DV2E 4I8OA 2V34A 4B3RE 3THOB 2EZ6A 3J80C 4DUZE 2EOOA 1DI2A 1P42A 2A25A 4X65I 1SR9A 2F4VI 2YTJA 3K85A 3J7AG 3ZZTA 4DR2I 4TUIA 1DARA 1X6HA 2KONA 3H09A 4F9BB 4ZVIA 5GMDA 3T1HE 4JI0I 4YY3I 2EMXA 4TUGA 3HULA 3L7ZA 1A1JA 2HC5A 2ENAA 2LTRA 1T4NA 3ADJA 3JAMC 4LFCE 2HFSA 2NN6D 4UT4A 2EOEA 1N0VC 2EMBA 1I94I 5T6JA 5FWKA 2NN6B 3WU4A 3EPKA 4LF6I 1YPNA 2JOXA 2L2NA 2V89A 2JEAA 2FGGA 4DUYE 2YRMA 5IT9Q 4N3OA 2JVAA 2EM5A 2LJPA 4Q35B 1STUA 2WNRA 3WU6A 4BA2A 4P7DA 2KHXA 4NZVA 4LF9E 3RMPA 1J26A 1WUUA 2NUGA 2Q8UA 2AJ4A 3PYDA 4LF7I 4IZJA 1N33E 4R03A 5KL5A 2UUAE 2EMKA 4DR7E 2UXCE 1EH6A 2WZOA 3P06A 4KQVA 2VRDA 4KWYA 2DIXA 2K7IA 4O4KA 5A6BA 1FKAE 2CVEA 2GS8A 2JXPA 3OMLA 5LMUE 4DR4I 1XXEA 2Z5EA 4WUBA 2EOFA 4LU9A 2NN6C 3EPLA 3BF2A 2VQEE 4KHPI 1EH7A 3PRYA 4XTJA 4DPXA 2MDRA 4DR3E 3GMEA 3ZZ0A 2EOHA 1H74A 4U3DA 2EOYA 1RHYA 4LF5I 1B63A 2EOMA 1J5EE 5K36A 2ADRA 1EH8A 2I9IA 4DV0E 4FWDA 1S4EA 1H7SA 2Z5BB 4OO1D 1UBDC 2CTDA 4LFAI 2EOSA 1UHZA 4MU3A 2MDGA 2PO1A 1A1HA 1IBKE 4X62I 4OO1B 2VF1A 4JI3I 2HHHE 4FWGA 3AUZA 2WP8B 2BB8A 2EMGA 2OI2A 4JYAE 3Q6MA 3QG5C 2K4VA 5FLXQ 4PRVA 1N34E 2ZBKB 2N3GA 2NA2A 4BMJA 3P3EA 4DV7I 2LJUA 4EMDA 4JI5I 1USVA 1BB8A 2UUBI 1RMDA 2EMCA 1A1KA 1YYWA 2VQFI 1IQOA 5LMNE 4IFDA 1D6TA 4MLQA 1XMOE 2JR1A 1RREA 1RQ0A 3F6GA 3C4BA 4B3ME 1YUJA 2GO4A 4MU0A 1IBMI 4DR6I 3ZOQB 4I3HA 3TQMA 3J80Q 4GEQB 1RC7A 4DV2I 4DR1I 4B3RI 4URLA 2ODRD 4DUZI 2EN4A 4DV5E 2PO2B 4IS1C 4LFBE 5BR8I 3KRNA 2V85A 2C38B 5F3WA 4LPFA 4OO1C 1PJSA 5CFFE 2CZ9A 1GZ6A 2EL6A 4DPYA 4NBQA 1ZBTA 1YH8A 5JEAA 1YSAC 3T1HI 2BA1D 2DSYA 2EMLA 5A69A 3HPZA 2EMFA 2MKDA 3ZM7A 4BA1B 3Q6NA 1DQ3A 2JT2A 4LFCI 2EOIA 4BCAA 3PS3A 4PRXA 5DNYA 4HACA 3KWRA 1Z1BA 4WSPA 4DU7A 2L3CA 1Z0VA 1PJTA 3H1CA 2EN1A 2UXDE 4BHCA 4U3BA 2E72A 2JE6A 2MC5A 2UU9E 2LMZA 4P52A 1KIJA 2BV3A 5JEAE 4DUYI 5LLQA 2BM0A 2EM7A 4HXZA 2LV2A 1E3PA 5EL9A 2ODRC 4LF9I 5IWAE 3ZZUA 1QNTA 5FLXC 2EL4A 2JEBB 3MHHC 3B82A 3HJCA 4DPWA 5EKWA 1FJGE 2HKJA 1OYSA 4IZJD 1N33I 1ZU1A 2UUAI 3L00A 3KZYA 4JI1E 4LCHA 4DR7I 2EPMX 4WXDA 3LLHA 1Z59A 3T1YE 1TF3A 4M2ZA 5C0XE 2JWOA 2IOQA 5A6BD 1NZ0A 3PYEA 2EP3A 1HNZE 4GKKE 1ZM9A 5LMUI 2V83A 2BA0G 3BIDA 5KL2A 1ZM4A 4KZSA 2YTEA 4LF4E 4OO1F 1WRJA 4DPUA 2M9AA 4BS9A 3EPHA 2IOPA 1AH5A 1JK2A 1F2IG 2L2KB 2MC6A 1ZXMA 2VESA 4WX9A 4F6NA 1J5EI 5DRPA 2LT7A 4NXME 1DGCA 2V87A 1NHHA 2F1DA 4FW3A 5TSEA 3J81Q 2DLQA 4DV0I 1H73A 2EN7A 3ADLA 2EQ1A 3M99B 1IQSA 2NABA 2O1TA 1H72C 2E1MA 1G2FC 1IBKI 1ZR9A 4DV4E 3M85G 2HHHI 2Z5CA 4X64E 2O1UA 4WPYA 4JYAI 2A2CA 1KTVA 2EORA 1UN6B 4USKA 4JI7E 4JI2E 4J3DA 2J7JA 2JP9A 4B3SE 3VYYA 2A2DA 2C37A 2EM3A 2PO0B 1PJQA 3C6KA 3GCMA 1YZ9A 4DPTA 5LMNI 4IFDD 2L2MA 4X9JA 1HNWE 1ZM2A 1XMOI 4R2SA 4B3MI 2GPIA 4GKJE 1IBLE 4WFTA 2E5LE 1N32E 2EM2A 1ZXNA 4DV5I 1NHJA 4DR5E 4F9AB 1NCSA 1WHNA 3FIGA 2BR2A 4QNKA 1Y60A 1YUIA 2EOQA 4FW9A 2RSMA 4M1KA 2HK2A 2DEIA 1HR0E 4R2QA 1XHKA 2PNLA 2YPNA 5JEAD 2C39A 3P3CA 2IESA 2LJHA 2YTPA 2EM9A 4ED4A 5IV8B 2EMWA 2R76A 3ECRA 2PRTA 2UUCE 4DKKA 1UEKA 3LTOA 3ADIA 4AIMA 5JEAB 2HKEA 2B9DA 2FV4B 2RS7A 2V86A 4M0VA 4QNJA 3B78A 2EPAA 3J81C 2EPRA 1PDAA 2EMZA 3HPSA 4IFDC 3IWDA 1UDSA 2M7QA 2UXDI 4HACB 2D9HA 4GQUA 1WJPA 2UXBE 2V2VA 5C0XD 3EQ1A 2EN3A 2Q2EB 4X8WA 4N4RB 5K36E 1P47A 4X66E 3OTOE 1YYKA 5C0XB 4JV5E 5IWAI 1HNXE 1Z0CA 4HY1A 2N8XA 1NHIA 4O24A 1A1FA 2BBGA 2J65A 1FJGI 1UILA 2B7VA 3HXLA 1EI1A 2EM4A 4JI1I 3AV0A 2NUEA 1Z0BA 3WU3A 1WXRA 5JEAC 2WBSA 3T1YI 1FWLA 1S16A 4OX9E 2PNZB 2R42A 2EMAA 4P7AA 2L33A 5A6KA 3F6HA 1HNZI 4GKKI 3C4TA 1PKPA 2I13A 1Z0EA 1QU6A 2YZTA 3M7ND 4Z7YA 5KL4A 4K0KE 4JI8E 1BKNA 3D4JA 3GLLA 4LF4I 2DMIA 2EQ0A 3CDIA 2NN6F 3HKMA 1MX0A 1VI7A 2EPUA 1N36E 2V2QA 2M1SA 1X6FA 4BC7A 2HGHA 5L3JA 4IFDE 1KJKA 1KKHA 5C0XC 2IHR1 1ZAAC 5A6JA 5A6AA 4NXMI 2CSHA 2DMYA 4RHBB 4DV3E 2CPNA 3P1XA 2LUQA 4R2RA 2MKNA 1MU5A 2BM1A 3LPSA 4MU4A 3L7ZB 2ELYA 2YWQA 4JG4A 2B7TA 4DMIA 5AE3A 1Z0WA 2WBTA 2AE8A 1X3CA 3VHTB 1JK1A 4DV4I 4X64I 4AQYE 2EPKX 2LO3A 4YHHE 3IWBA 2XEXA 4FWHA 4L5NC 2WCC3 1GQEA 3CWVA 4FW6A 4JI7I 4JI2I 1VISA 4IJDA 5KL6A 3V2UC 4B3SI 2JEAB 4BA2B 4OKGA 1T38A 2WNRB 2V88A 2Z5BA 1HNWI 2EM8A 2BA1G 1YHCA 4R2CA 4NXNE 4USMA 2RQLA 2YTDA 2R1FA 1IBLI 4GKJI 1R6LA 2EL5A 2O1VA 2ZM6E 2O1WA 4IZJB 4OO1A 2HK3A 4Z7CA 2UXCI 4JI4E 2G7HA 2YU8A 1HK7A 2E5LI 4NHRA 2PNMA 1N32I 2WP8A 1EA6A 5A2QC 4B3TE 1Y4SA 4DR5I 4LCGA 4LF8E 2RS6A 4LOMA
chains in the Genus database with same CATH topology
2VQEI 2ZITA 5ADZA 2N3HA 2EFGA 3DF6A 4DR3I 3ZKBA 1XMQE 2CG9A 4MYUA 2UUCI 1QZRA 2DEJA 4DR1E 3F0NA 3M6AA 2V8QB 1Y6ZA 2M4IA 2VF3A 3JU0A 2UXBI 5BR8E 2F8BA 1N34I 3K6QA 4X66I 1ZM3A 3OTOI 3DJWA 2LE2A 2X36A 4WUCA 1HNXI 4JV5I 1RR9A 1PVGA 3QT5A 3ZKDA 2EWLA 3K1JA 4OX9I 1X48A 4RPFA 1XNQE 4P78A 4WUDA 4BC9A 4DV1E 4IZKA 4DV6E 4LFBI 4K0KI 4R8OA 4JI8I 2L3JA 3H4LA 1Z5BA 1N36I 1FWKA 2L8TA 4MYTA 2DB2A 2E1RA 1T4LB 4DXLA 3MSWA 4DU8A 4DV3I 4M30A 4BBYA 4JI6E 2RTXA 3QT7A 3IWCA 2LUPB 1XNRE 2L92A 2H36X 2V2ZA 2HFUA 3ADGA 1Y4UA 1Z5CA 1FNMA 4AQYI 4YHHI 2R3VA 2UU9I 1WHQA 3J7Yp 4Q28A 4R1FA 4X65E 2F4VE 2GQ0A 2L6MA 4J8ZA 4DR2E 4YY3E 4F54A 4JI0E 1ZBQA 3Q1QA 2KOUA 4NXNI 1H7UA 1A6FA 3HTXA 2ZM6I 5A2QQ 1KVKA 1OJ4A 4JI4I 1N0UA 4UTGA 4B3TI 2NPFA 1I94E 4OOGC 3HQ1A 4LF8I 4LF6E 5LL6R 5IT9C 1XMQI 2LRSA 1X49A 2LBSB 2NUFA 4LF7E 5AE2A 4PU9A 2CGEA 4WYQB 3LMLA 1USUA 1B62A 4L8NA 1X47A 4DR4E 5GMEA 3V5RA 3LNUA 1Z5AA 2JOBA 2Z5CB 3GONA 2VE7C 4KHPE 1Z0TA 1EKZA 2B3TB 2JY9A 3JAMQ 4LF5E 2YT4A 3JTZA 4FN5A 3K17A 1YYOA 2V8PA 3PYFA 1XNQI 1ELOA 4F9CB 3QT6A 4LFAE 3VK6A 4DV1I 4DV6I 5AASA 2WW4A 3B8HA 4PRVA 1K47A 4X62E 2X7IA 2LTSA 4LTYA 4JI3E 1O0WA 1Z0GA 2J7KA 4HYMA 1MG7A 5AE1A 4IZKB 3QT8A 1T4OA 1HR0I 2FTXB 3VYXA 1FI4A 4DV7E 4JI5E 2UUBE 2VQFE 3PYGA 1U2RA 4JI6I 3J7AM 3WU5A 1PIEA 1XNRI 1IBME 4DR6E 4DV2E 4I8OA 2V34A 4B3RE 2EZ6A 3J80C 4DUZE 1DI2A 4X65I 1SR9A 2F4VI 3K85A 3J7AG 3ZZTA 4DR2I 4TUIA 1DARA 5GMDA 2KONA 3H09A 4F9BB 4ZVIA 4YY3I 3T1HE 4JI0I 4TUGA 3JAMC 2LTRA 1T4NA 3ADJA 4LFCE 2HFSA 4UT4A 1N0VC 1I94I 5T6JA 5FWKA 3WU4A 4LF6I 2JOXA 2L2NA 2V89A 2FGGA 4DUYE 5IT9Q 4N3OA 2JVAA 2LJPA 1STUA 3WU6A 4P7DA 2KHXA 4LF9E 3RMPA 1J26A 1WUUA 2NUGA 2AJ4A 3PYDA 4LF7I 4IZJA 1N33E 4R03A 2UUAE 4DR7E 2UXCE 2WZOA 3P06A 4KQVA 1FKAE 2DIXA 2GS8A 3OMLA 5LMUE 4DR4I 2Z5EA 4WUBA 4LU9A 2VQEE 4KHPI 3PRYA 4XTJA 4DPXA 2MDRA 4DR3E 3ZZ0A 1H74A 4LF5I 1B63A 1J5EE 4DV0E 4FWDA 1S4EA 1H7SA 2Z5BB 4LFAI 1UHZA 1IBKE 4X62I 2VF1A 4JI3I 2HHHE 4FWGA 3AUZA 2OI2A 4JYAE 3Q6MA 2K4VA 5FLXQ 1N34E 2ZBKB 2N3GA 2NA2A 4BMJA 4DV7I 4EMDA 4JI5I 1USVA 2UUBI 2VQFI 1YYWA 5LMNE 1D6TA 1XMOE 2JR1A 1RREA 1RQ0A 3F6GA 3C4BA 4B3ME 1IBMI 4DR6I 3ZOQB 4I3HA 3J80Q 4GEQB 1RC7A 4DV2I 4DR1I 4B3RI 4URLA 2ODRD 4DUZI 4DV5E 4LFBE 5BR8I 2V85A 5F3WA 5CFFE 2CZ9A 1GZ6A 4DPYA 1ZBTA 3T1HI 2DSYA 3HPZA 3ZM7A 3Q6NA 1DQ3A 4LFCI 4BCAA 4PRXA 5DNYA 4HACA 3KWRA 4WSPA 4DU7A 2L3CA 1Z0VA 2UXDE 2MC5A 2UU9E 2LMZA 4P52A 1KIJA 2BV3A 4DUYI 2BM0A 4HXZA 2ODRC 4LF9I 5IWAE 3ZZUA 5FLXC 3HJCA 3B82A 4DPWA 1FJGE 2HKJA 4IZJD 1N33I 2UUAI 4JI1E 4DR7I 3LLHA 1Z59A 3T1YE 4M2ZA 2JWOA 2IOQA 3PYEA 1NZ0A 1HNZE 4GKKE 1ZM9A 5LMUI 2V83A 1ZM4A 4KZSA 4LF4E 4DPUA 4BS9A 2IOPA 1ZXMA 2L2KB 2MC6A 1J5EI 4NXME 4DV0I 2V87A 1NHHA 3J81Q 1H73A 3ADLA 2O1TA 1H72C 2E1MA 1IBKI 4DV4E 2HHHI 2Z5CA 4X64E 2O1UA 4WPYA 4JYAI 2A2CA 1KTVA 4USKA 4JI7E 4JI2E 4B3SE 3VYYA 2A2DA 4DPTA 1YZ9A 5LMNI 2L2MA 1HNWE 1ZM2A 1XMOI 4B3MI 4GKJE 1IBLE 4WFTA 2E5LE 1N32E 1ZXNA 4DV5I 1NHJA 4DR5E 4F9AB 1WHNA 3FIGA 4FW9A 2RSMA 4M1KA 2HK2A 2DEIA 1HR0E 2PNLA 1XHKA 2LJHA 4ED4A 2UUCE 4DKKA 1UEKA 3LTOA 3ADIA 2HKEA 2B9DA 2FV4B 2RS7A 2V86A 4M0VA 3B78A 3J81C 3HPSA 3IWDA 2M7QA 2UXDI 4HACB 2UXBE 2V2VA 2Q2EB 4X8WA 4X66E 3OTOE 1YYKA 4JV5E 5IWAI 1HNXE 1Z0CA 4HY1A 1NHIA 1FJGI 1UILA 2B7VA 3HXLA 1EI1A 4JI1I 3AV0A 2NUEA 1Z0BA 3WU3A 1WXRA 3T1YI 1FWLA 1S16A 4OX9E 2R42A 4P7AA 2L33A 3F6HA 1HNZI 4GKKI 3C4TA 1PKPA 1Z0EA 1QU6A 2YZTA 4Z7YA 4K0KE 4JI8E 1BKNA 3D4JA 4LF4I 1MX0A 5L3JA 1N36E 2V2QA 2M1SA 4BC7A 1KKHA 2IHR1 4NXMI 2DMYA 4DV3E 3HULA 3LPSA 2CPNA 2LUQA 3P1XA 2BM1A 1MU5A 4JG4A 2B7TA 4DMIA 5AE3A 1Z0WA 4DV4I 4X64I 4AQYE 4YHHE 2XEXA 3IWBA 4FWHA 4L5NC 1GQEA 3CWVA 4JI7I 4JI2I 1VISA 3V2UC 4B3SI 2V88A 2Z5BA 1HNWI 4NXNE 4USMA 4GKJI 1IBLI 2O1VA 2ZM6E 2O1WA 4IZJB 2UXCI 2HK3A 4Z7CA 4JI4E 2G7HA 1HK7A 2E5LI 1N32I 2PNMA 1EA6A 5A2QC 4B3TE 1Y4SA 4DR5I 4LF8E 2RS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE I;  2ZIT A;  2N3H A;  2EFG A;  4DR3 I;  3ZKB A;  1XMQ E;  4MYU A;  2UUC I;  1QZR A;  2DEJ A;  4DR1 E;  3F0N A;  3M6A A;  2VF3 A;  2UXB I;  5BR8 E;  1N34 I;  4X66 I;  1ZM3 A;  3OTO I;  2X36 A;  4JV5 I;  4WUC A;  1HNX I;  1RR9 A;  1PVG A;  3QT5 A;  3ZKD A;  3K1J A;  4OX9 I;  1X48 A;  4RPF A;  1XNQ E;  4WUD A;  4DV1 E;  4DV6 E;  4LFB I;  4K0K I;  4JI8 I;  2L3J A;  3H4L A;  1Z5B A;  1N36 I;  1FWK A;  4MYT A;  2DB2 A;  2E1R A;  1T4L B;  4DXL A;  4DU8 A;  4DV3 I;  4M30 A;  4JI6 E;  3QT7 A;  2RTX A;  2LUP B;  1XNR E;  2V2Z A;  2HFU A;  3ADG A;  1Z5C A;  1FNM A;  4AQY I;  4YHH I;  2R3V A;  2UU9 I;  1WHQ A;  3J7Y p;  4R1F A;  4X65 E;  2F4V E;  4DR2 E;  4YY3 E;  4JI0 E;  3Q1Q A;  4NXN I;  1H7U A;  1A6F A;  3HTX A;  2ZM6 I;  5A2Q Q;  1KVK A;  1OJ4 A;  4JI4 I;  1N0U A;  4UTG A;  4B3T I;  2NPF A;  1I94 E;  4OOG C;  4LF8 I;  4LF6 E;  5LL6 R;  5IT9 C;  1XMQ I;  2LRS A;  1X49 A;  2LBS B;  2NUF A;  4LF7 E;  4PU9 A;  4WYQ B;  1B62 A;  1X47 A;  4DR4 E;  5GME A;  3V5R A;  3LNU A;  1Z5A A;  3GON A;  4KHP E;  1Z0T A;  1EKZ A;  2B3T B;  2JY9 A;  3JAM Q;  4LF5 E;  2YT4 A;  4FN5 A;  3K17 A;  1YYO A;  2V8P A;  3PYF A;  1XNQ I;  1ELO A;  3QT6 A;  4LFA E;  4DV1 I;  4DV6 I;  2WW4 A;  3B8H A;  4PRV A;  1K47 A;  4X62 E;  2X7I A;  2LTS A;  4JI3 E;  2J7K A;  1O0W A;  1Z0G A;  4HYM A;  1MG7 A;  3QT8 A;  1T4O A;  1HR0 I;  3VYX A;  1FI4 A;  4DV7 E;  4JI5 E;  2UUB E;  2VQF E;  3PYG A;  1U2R A;  4JI6 I;  3J7A M;  3WU5 A;  1PIE A;  1XNR I;  1IBM E;  4DR6 E;  4DV2 E;  2V34 A;  4B3R E;  2EZ6 A;  4DUZ E;  3J80 C;  1DI2 A;  4X65 I;  2F4V I;  3J7A G;  3ZZT A;  4DR2 I;  1DAR A;  5GMD A;  4ZVI A;  4YY3 I;  3T1H E;  4JI0 I;  3JAM C;  2LTR A;  1T4N A;  3ADJ A;  4LFC E;  2HFS A;  4UT4 A;  1N0V C;  1I94 I;  3WU4 A;  4LF6 I;  2L2N A;  4DUY E;  5IT9 Q;  2JVA A;  2LJP A;  1STU A;  3WU6 A;  2KHX A;  4LF9 E;  1J26 A;  1WUU A;  2NUG A;  2AJ4 A;  3PYD A;  4LF7 I;  1N33 E;  2UUA E;  4DR7 E;  2UXC E;  4KQV A;  1FKA E;  2DIX A;  2GS8 A;  5LMU E;  4DR4 I;  4WUB A;  2VQE E;  4KHP I;  4XTJ A;  4DPX A;  2MDR A;  4DR3 E;  3ZZ0 A;  1H74 A;  4LF5 I;  1B63 A;  1J5E E;  4FWD A;  4DV0 E;  1S4E A;  1H7S A;  4LFA I;  1UHZ A;  1IBK E;  4X62 I;  4JI3 I;  2HHH E;  4FWG A;  2OI2 A;  4JYA E;  5FLX Q;  1N34 E;  2ZBK B;  2N3G A;  2NA2 A;  4DV7 I;  4EMD A;  4JI5 I;  2UUB I;  2VQF I;  1YYW A;  5LMN E;  1D6T A;  1XMO E;  1RRE A;  1RQ0 A;  4B3M E;  3C4B A;  1IBM I;  4DR6 I;  3J80 Q;  4I3H A;  4DV2 I;  1RC7 A;  4DR1 I;  4B3R I;  4URL A;  4DUZ I;  4DV5 E;  4LFB E;  5BR8 I;  5CFF E;  2CZ9 A;  4DPY A;  1ZBT A;  3T1H I;  3ZM7 A;  4LFC I;  4PRX A;  4HAC A;  4DU7 A;  2L3C A;  1Z0V A;  2UXD E;  2UU9 E;  4P52 A;  1KIJ A;  2BV3 A;  4DUY I;  2BM0 A;  4HXZ A;  4LF9 I;  5IWA E;  3ZZU A;  5FLX C;  3B82 A;  4DPW A;  1FJG E;  2HKJ A;  1N33 I;  2UUA I;  4JI1 E;  4DR7 I;  3LLH A;  1Z59 A;  3T1Y E;  4M2Z A;  3PYE A;  1NZ0 A;  1HNZ E;  4GKK E;  1ZM9 A;  5LMU I;  1ZM4 A;  4LF4 E;  4DPU A;  1ZXM A;  2L2K B;  1J5E I;  4NXM E;  4DV0 I;  1NHH A;  3J81 Q;  1H73 A;  3ADL A;  1H72 C;  1IBK I;  4DV4 E;  2HHH I;  4X64 E;  4JYA I;  2A2C A;  1KTV A;  4USK A;  4JI7 E;  4JI2 E;  4B3S E;  2A2D A;  3VYY A;  4DPT A;  1YZ9 A;  5LMN I;  2L2M A;  1HNW E;  1ZM2 A;  1XMO I;  4B3M I;  4GKJ E;  1IBL E;  4WFT A;  2E5L E;  1N32 E;  1ZXN A;  4DV5 I;  1NHJ A;  4DR5 E;  1WHN A;  4FW9 A;  2RSM A;  4M1K A;  2HK2 A;  2DEI A;  1HR0 E;  1XHK A;  2LJH A;  4ED4 A;  2UUC E;  4DKK A;  1UEK A;  3LTO A;  3ADI A;  2HKE A;  2RS7 A;  3B78 A;  3J81 C;  2UXD I;  4HAC B;  2UXB E;  2V2V A;  2Q2E B;  4X8W A;  4X66 E;  3OTO E;  1YYK A;  4JV5 E;  5IWA I;  1HNX E;  1Z0C A;  4HY1 A;  1NHI A;  1FJG I;  1UIL A;  2B7V A;  1EI1 A;  4JI1 I;  1Z0B A;  2NUE A;  3WU3 A;  3T1Y I;  1FWL A;  1S16 A;  4OX9 E;  2R42 A;  4P7A A;  2L33 A;  1HNZ I;  4GKK I;  3C4T A;  1PKP A;  1Z0E A;  1QU6 A;  4Z7Y A;  4K0K E;  4JI8 E;  1BKN A;  3D4J A;  4LF4 I;  1MX0 A;  5L3J A;  1N36 E;  2V2Q A;  1KKH A;  2IHR 1;  4NXM I;  2DMY A;  4DV3 E;  3HUL A;  3LPS A;  2CPN A;  2LUQ A;  3P1X A;  2BM1 A;  1MU5 A;  4JG4 A;  2B7T A;  1Z0W A;  4DV4 I;  4X64 I;  4AQY E;  4YHH E;  2XEX A;  4FWH A;  1GQE A;  3CWV A;  4JI7 I;  4JI2 I;  1VIS A;  3V2U C;  4B3S I;  1HNW I;  4NXN E;  4USM A;  4GKJ I;  1IBL I;  2ZM6 E;  2UXC I;  2HK3 A;  4Z7C A;  4JI4 E;  2E5L I;  1N32 I;  1EA6 A;  5A2Q C;  4B3T E;  4DR5 I;  4LF8 E;  2RS6 A; 
#chains in the Genus database with same CATH topology
 4R2A A;  2VQE I;  3THN A;  2ZIT A;  2GHF A;  5DNX A;  5ADZ A;  2N3H A;  1Y5Y A;  3DF6 A;  2GLI A;  3BGH A;  2EFG A;  4IS9 A;  3U1Y A;  4DR3 I;  1X5W A;  3ZKB A;  1XMQ E;  2CG9 A;  5DRQ A;  2JPA A;  4MYU A;  5K36 D;  2EM6 A;  2UUC I;  5C0X F;  2YSP A;  2EN2 A;  2EPN A;  1B69 A;  1QZR A;  2DEJ A;  5K36 B;  5KL7 A;  2PO2 A;  2ENH A;  4DR1 E;  3F0N A;  3M6A A;  1UDN A;  3M85 D;  2V8Q B;  1Y6Z A;  2C38 A;  2ELZ A;  2M4I A;  2VF3 A;  4AID A;  3JU0 A;  2UXB I;  4O43 A;  5BR8 E;  2F8B A;  2PO1 B;  1N34 I;  3K6Q A;  4X66 I;  1ZM3 A;  3UK3 C;  3OTO I;  2YTO A;  3DJW A;  2LE2 A;  1TN9 A;  2X36 A;  3C6M A;  4WUC A;  1HNX I;  1RR9 A;  4JV5 I;  1PVG A;  4BA1 A;  4R2D A;  3QT5 A;  1MEY C;  3ZKD A;  2EN8 A;  2EWL A;  4ZYH A;  3K1J A;  4IFD B;  4OX9 I;  1X48 A;  4RPF A;  2LVH A;  1XNQ E;  4P78 A;  5K36 C;  5DRO A;  4WUD A;  4BC9 A;  2EPO A;  4DV1 E;  4IZK A;  4DV6 E;  4LFB I;  1IMU A;  2LCE A;  4K0K I;  4R8O A;  4JI8 I;  1OYP A;  4MLV A;  2EPZ A;  1G2D C;  2L3J A;  3H4L A;  2ENC A;  1Z5B A;  2JEB A;  1N36 I;  4ZYG A;  2RSI A;  1FWK A;  2EMI A;  1BBG A;  2L8T A;  4MYT A;  4R2E A;  2DB2 A;  2E1R A;  1T4L B;  4DXL A;  3MSW A;  3P76 A;  4DU8 A;  4DV3 I;  4M30 A;  4BBY A;  4JI6 E;  2RTX A;  3QT7 A;  3IWC A;  2LUP B;  1XNR E;  2L92 A;  2H36 X;  4O5G A;  4ZYD A;  2V2Z A;  2HFU A;  3ADG A;  1Y4U A;  1A1L A;  3MHS C;  1Z5C A;  1FNM A;  2YSO A;  3BBG A;  2EPC A;  1AAY A;  2R3V A;  4YHH I;  4AQY I;  5ELW A;  2UU9 I;  1WHQ A;  3J7Y p;  1YFH A;  4Q28 A;  4R1F A;  2EE8 A;  4X65 E;  1KYQ A;  2F4V E;  3PS1 A;  2GQ0 A;  2JE6 B;  2L6M A;  1BBO A;  4J8Z A;  1LLM C;  2EN6 A;  4DR2 E;  2YTF A;  5KL3 A;  4ISA A;  4YY3 E;  4F54 A;  4JI0 E;  1ZBQ A;  2YU5 A;  2KOU A;  4NXN I;  3Q1Q A;  1H7U A;  1A6F A;  3U1K A;  3UHM A;  3HTX A;  2ZM6 I;  5A2Q Q;  1KVK A;  1OJ4 A;  2NN6 A;  4JI4 I;  4AM3 A;  1N0U A;  4FK5 C;  3DD6 A;  4UTG A;  4B3T I;  2NPF A;  1I94 E;  5K36 F;  4OOG C;  3HQ1 A;  4LF8 I;  1E3H A;  3CDJ A;  1N3G A;  4LF6 E;  3P3G A;  2IER A;  5LL6 R;  4BHB A;  2EM0 A;  5DNL A;  2EMY A;  2PO0 A;  1L4S A;  5IT9 C;  1XMQ I;  2LRS A;  1X49 A;  2LBS B;  2EJ4 A;  4FW5 A;  2NN6 E;  5AC4 A;  2NUF A;  4LF7 E;  5AE2 A;  1A1G A;  4PU9 A;  2RPC A;  2CGE A;  4WYQ B;  3LML A;  1UDO A;  1USU A;  2WBU A;  1A1I A;  4RH8 A;  1B62 A;  1X6E A;  2YTG A;  4L8N A;  4F6M A;  1SFE A;  4IFD F;  1X47 A;  4DR4 E;  5AC5 A;  4ZYE A;  5GME A;  3V5R A;  3M7N G;  3LNU A;  1Z5A A;  2JOB A;  2Z5C B;  2EMH A;  1GTK A;  3GON A;  5DRR A;  1MGT A;  2EPP A;  2VE7 C;  2DGC A;  4KHP E;  1Z0T A;  1UDQ A;  4FW7 A;  4LCF A;  2DLK A;  1EKZ A;  2B3T B;  2YRK A;  4GZN C;  2JY9 A;  3JAM Q;  4LF5 E;  2YT4 A;  3JTZ A;  1R6M A;  4FN5 A;  3K17 A;  1YYO A;  2V8P A;  3KZZ A;  2C37 B;  3PYF A;  3PS2 A;  4R2P A;  4WXC A;  2EPX A;  1ELO A;  2GO3 A;  1XNQ I;  4F9C B;  3QT6 A;  5JEA F;  4LFA E;  2BA0 D;  3VK6 A;  5IXM B;  2YTQ A;  4DV1 I;  4DV6 I;  5AAS A;  2WW4 A;  3B8H A;  2JYA A;  1K47 A;  3NZK A;  2YTI A;  4X62 E;  2X7I A;  2LTS A;  1NEI A;  4LTY A;  4JI3 E;  1O0W A;  1Z0G A;  2J7K A;  4HYM A;  4M9V C;  2HJJ A;  1MG7 A;  2EOJ A;  5AE1 A;  1TF6 A;  1OYR A;  4IZK B;  5C0X A;  2CT1 A;  1T4O A;  2DRP A;  3QT8 A;  1HR0 I;  2FTX B;  4MDT A;  2EOZ A;  3VYX A;  2BR2 B;  1FI4 A;  2EPL X;  4OZE A;  2EQ3 A;  2YRH A;  4DV7 E;  4JI5 E;  2UUB E;  3EPJ A;  2EOX A;  2VQF E;  2C39 B;  4WSG A;  3PYG A;  4OO1 E;  1U2R A;  2O3Z A;  4HEI A;  3B4T A;  4FW4 A;  4MQY A;  4JI6 I;  2PNZ A;  3J7A M;  4MU1 A;  3WU5 A;  1T39 A;  1PIE A;  4HTG A;  1XNR I;  1IBM E;  4DR6 E;  2YTN A;  4F2J C;  4DV2 E;  4I8O A;  2V34 A;  4B3R E;  3THO B;  2EZ6 A;  3J80 C;  4DUZ E;  2EOO A;  1DI2 A;  1P42 A;  2A25 A;  4X65 I;  1SR9 A;  2F4V I;  2YTJ A;  3K85 A;  3J7A G;  3ZZT A;  4DR2 I;  4TUI A;  1DAR A;  1X6H A;  2KON A;  3H09 A;  4F9B B;  4ZVI A;  5GMD A;  3T1H E;  4JI0 I;  4YY3 I;  2EMX A;  4TUG A;  3HUL A;  3L7Z A;  1A1J A;  2HC5 A;  2ENA A;  2LTR A;  1T4N A;  3ADJ A;  3JAM C;  4LFC E;  2HFS A;  2NN6 D;  4UT4 A;  2EOE A;  1N0V C;  2EMB A;  1I94 I;  5T6J A;  5FWK A;  2NN6 B;  3WU4 A;  3EPK A;  4LF6 I;  1YPN A;  2JOX A;  2L2N A;  2V89 A;  2JEA A;  2FGG A;  4DUY E;  2YRM A;  5IT9 Q;  4N3O A;  2JVA A;  2EM5 A;  2LJP A;  4Q35 B;  1STU A;  2WNR A;  3WU6 A;  4BA2 A;  4P7D A;  2KHX A;  4NZV A;  4LF9 E;  3RMP A;  1J26 A;  1WUU A;  2NUG A;  2Q8U A;  2AJ4 A;  3PYD A;  4LF7 I;  4IZJ A;  1N33 E;  4R03 A;  5KL5 A;  2UUA E;  2EMK A;  4DR7 E;  2UXC E;  1EH6 A;  2WZO A;  3P06 A;  4KQV A;  2VRD A;  4KWY A;  2DIX A;  2K7I A;  4O4K A;  5A6B A;  1FKA E;  2CVE A;  2GS8 A;  2JXP A;  3OML A;  5LMU E;  4DR4 I;  1XXE A;  2Z5E A;  4WUB A;  2EOF A;  4LU9 A;  2NN6 C;  3EPL A;  3BF2 A;  2VQE E;  4KHP I;  1EH7 A;  3PRY A;  4XTJ A;  4DPX A;  2MDR A;  4DR3 E;  3GME A;  3ZZ0 A;  2EOH A;  1H74 A;  4U3D A;  2EOY A;  1RHY A;  4LF5 I;  1B63 A;  2EOM A;  1J5E E;  5K36 A;  2ADR A;  1EH8 A;  2I9I A;  4DV0 E;  4FWD A;  1S4E A;  1H7S A;  2Z5B B;  4OO1 D;  1UBD C;  2CTD A;  4LFA I;  2EOS A;  1UHZ A;  4MU3 A;  2MDG A;  2PO1 A;  1A1H A;  1IBK E;  4X62 I;  4OO1 B;  2VF1 A;  4JI3 I;  2HHH E;  4FWG A;  3AUZ A;  2WP8 B;  2BB8 A;  2EMG A;  2OI2 A;  4JYA E;  3Q6M A;  3QG5 C;  2K4V A;  5FLX Q;  4PRV A;  1N34 E;  2ZBK B;  2N3G A;  2NA2 A;  4BMJ A;  3P3E A;  4DV7 I;  2LJU A;  4EMD A;  4JI5 I;  1USV A;  1BB8 A;  2UUB I;  1RMD A;  2EMC A;  1A1K A;  1YYW A;  2VQF I;  1IQO A;  5LMN E;  4IFD A;  1D6T A;  4MLQ A;  1XMO E;  2JR1 A;  1RRE A;  1RQ0 A;  3F6G A;  3C4B A;  4B3M E;  1YUJ A;  2GO4 A;  4MU0 A;  1IBM I;  4DR6 I;  3ZOQ B;  4I3H A;  3TQM A;  3J80 Q;  4GEQ B;  1RC7 A;  4DV2 I;  4DR1 I;  4B3R I;  4URL A;  2ODR D;  4DUZ I;  2EN4 A;  4DV5 E;  2PO2 B;  4IS1 C;  4LFB E;  5BR8 I;  3KRN A;  2V85 A;  2C38 B;  5F3W A;  4LPF A;  4OO1 C;  1PJS A;  5CFF E;  2CZ9 A;  1GZ6 A;  2EL6 A;  4DPY A;  4NBQ A;  1ZBT A;  1YH8 A;  5JEA A;  1YSA C;  3T1H I;  2BA1 D;  2DSY A;  2EML A;  5A69 A;  3HPZ A;  2EMF A;  2MKD A;  3ZM7 A;  4BA1 B;  3Q6N A;  1DQ3 A;  2JT2 A;  4LFC I;  2EOI A;  4BCA A;  3PS3 A;  4PRX A;  5DNY A;  4HAC A;  3KWR A;  1Z1B A;  4WSP A;  4DU7 A;  2L3C A;  1Z0V A;  1PJT A;  3H1C A;  2EN1 A;  2UXD E;  4BHC A;  4U3B A;  2E72 A;  2JE6 A;  2MC5 A;  2UU9 E;  2LMZ A;  4P52 A;  1KIJ A;  2BV3 A;  5JEA E;  4DUY I;  5LLQ A;  2BM0 A;  2EM7 A;  4HXZ A;  2LV2 A;  1E3P A;  5EL9 A;  2ODR C;  4LF9 I;  5IWA E;  3ZZU A;  1QNT A;  5FLX C;  2EL4 A;  2JEB B;  3MHH C;  3B82 A;  3HJC A;  4DPW A;  5EKW A;  1FJG E;  2HKJ A;  1OYS A;  4IZJ D;  1N33 I;  1ZU1 A;  2UUA I;  3L00 A;  3KZY A;  4JI1 E;  4LCH A;  4DR7 I;  2EPM X;  4WXD A;  3LLH A;  1Z59 A;  3T1Y E;  1TF3 A;  4M2Z A;  5C0X E;  2JWO A;  2IOQ A;  5A6B D;  1NZ0 A;  3PYE A;  2EP3 A;  1HNZ E;  4GKK E;  1ZM9 A;  5LMU I;  2V83 A;  2BA0 G;  3BID A;  5KL2 A;  1ZM4 A;  4KZS A;  2YTE A;  4LF4 E;  4OO1 F;  1WRJ A;  4DPU A;  2M9A A;  4BS9 A;  3EPH A;  2IOP A;  1AH5 A;  1JK2 A;  1F2I G;  2L2K B;  2MC6 A;  1ZXM A;  2VES A;  4WX9 A;  4F6N A;  1J5E I;  5DRP A;  2LT7 A;  4NXM E;  1DGC A;  2V87 A;  1NHH A;  2F1D A;  4FW3 A;  5TSE A;  3J81 Q;  2DLQ A;  4DV0 I;  1H73 A;  2EN7 A;  3ADL A;  2EQ1 A;  3M99 B;  1IQS A;  2NAB A;  2O1T A;  1H72 C;  2E1M A;  1G2F C;  1IBK I;  1ZR9 A;  4DV4 E;  3M85 G;  2HHH I;  2Z5C A;  4X64 E;  2O1U A;  4WPY A;  4JYA I;  2A2C A;  1KTV A;  2EOR A;  1UN6 B;  4USK A;  4JI7 E;  4JI2 E;  4J3D A;  2J7J A;  2JP9 A;  4B3S E;  3VYY A;  2A2D A;  2C37 A;  2EM3 A;  2PO0 B;  1PJQ A;  3C6K A;  3GCM A;  1YZ9 A;  4DPT A;  5LMN I;  4IFD D;  2L2M A;  4X9J A;  1HNW E;  1ZM2 A;  1XMO I;  4R2S A;  4B3M I;  2GPI A;  4GKJ E;  1IBL E;  4WFT A;  2E5L E;  1N32 E;  2EM2 A;  1ZXN A;  4DV5 I;  1NHJ A;  4DR5 E;  4F9A B;  1NCS A;  1WHN A;  3FIG A;  2BR2 A;  4QNK A;  1Y60 A;  1YUI A;  2EOQ A;  4FW9 A;  2RSM A;  4M1K A;  2HK2 A;  2DEI A;  1HR0 E;  4R2Q A;  1XHK A;  2PNL A;  2YPN A;  5JEA D;  2C39 A;  3P3C A;  2IES A;  2LJH A;  2YTP A;  2EM9 A;  4ED4 A;  5IV8 B;  2EMW A;  2R76 A;  3ECR A;  2PRT A;  2UUC E;  4DKK A;  1UEK A;  3LTO A;  3ADI A;  4AIM A;  5JEA B;  2HKE A;  2B9D A;  2FV4 B;  2RS7 A;  2V86 A;  4M0V A;  4QNJ A;  3B78 A;  2EPA A;  3J81 C;  2EPR A;  1PDA A;  2EMZ A;  3HPS A;  4IFD C;  3IWD A;  1UDS A;  2M7Q A;  2UXD I;  4HAC B;  2D9H A;  4GQU A;  1WJP A;  2UXB E;  2V2V A;  5C0X D;  3EQ1 A;  2EN3 A;  2Q2E B;  4X8W A;  4N4R B;  5K36 E;  1P47 A;  4X66 E;  3OTO E;  1YYK A;  5C0X B;  4JV5 E;  5IWA I;  1HNX E;  1Z0C A;  4HY1 A;  2N8X A;  1NHI A;  4O24 A;  1A1F A;  2BBG A;  2J65 A;  1FJG I;  1UIL A;  2B7V A;  3HXL A;  1EI1 A;  2EM4 A;  4JI1 I;  3AV0 A;  2NUE A;  1Z0B A;  3WU3 A;  1WXR A;  5JEA C;  2WBS A;  3T1Y I;  1FWL A;  1S16 A;  4OX9 E;  2PNZ B;  2R42 A;  2EMA A;  4P7A A;  2L33 A;  5A6K A;  3F6H A;  1HNZ I;  4GKK I;  3C4T A;  1PKP A;  2I13 A;  1Z0E A;  1QU6 A;  2YZT A;  3M7N D;  4Z7Y A;  5KL4 A;  4K0K E;  4JI8 E;  1BKN A;  3D4J A;  3GLL A;  4LF4 I;  2DMI A;  2EQ0 A;  3CDI A;  2NN6 F;  3HKM A;  1MX0 A;  1VI7 A;  2EPU A;  1N36 E;  2V2Q A;  2M1S A;  1X6F A;  4BC7 A;  2HGH A;  5L3J A;  4IFD E;  1KJK A;  1KKH A;  5C0X C;  2IHR 1;  1ZAA C;  5A6J A;  5A6A A;  4NXM I;  2CSH A;  2DMY A;  4RHB B;  4DV3 E;  2CPN A;  3P1X A;  2LUQ A;  4R2R A;  2MKN A;  1MU5 A;  2BM1 A;  3LPS A;  4MU4 A;  3L7Z B;  2ELY A;  2YWQ A;  4JG4 A;  2B7T A;  4DMI A;  5AE3 A;  1Z0W A;  2WBT A;  2AE8 A;  1X3C A;  3VHT B;  1JK1 A;  4DV4 I;  4X64 I;  4AQY E;  2EPK X;  2LO3 A;  4YHH E;  3IWB A;  2XEX A;  4FWH A;  4L5N C;  2WCC 3;  1GQE A;  3CWV A;  4FW6 A;  4JI7 I;  4JI2 I;  1VIS A;  4IJD A;  5KL6 A;  3V2U C;  4B3S I;  2JEA B;  4BA2 B;  4OKG A;  1T38 A;  2WNR B;  2V88 A;  2Z5B A;  1HNW I;  2EM8 A;  2BA1 G;  1YHC A;  4R2C A;  4NXN E;  4USM A;  2RQL A;  2YTD A;  2R1F A;  1IBL I;  4GKJ I;  1R6L A;  2EL5 A;  2O1V A;  2ZM6 E;  2O1W A;  4IZJ B;  4OO1 A;  2HK3 A;  4Z7C A;  2UXC I;  4JI4 E;  2G7H A;  2YU8 A;  1HK7 A;  2E5L I;  4NHR A;  2PNM A;  1N32 I;  2WP8 A;  1EA6 A;  5A2Q C;  4B3T E;  1Y4S A;  4DR5 I;  4LCG A;  4LF8 E;  2RS6 A;  4LOM A; 
#chains in the Genus database with same CATH homology
 2VQE I;  2ZIT A;  5ADZ A;  2N3H A;  2EFG A;  3DF6 A;  4DR3 I;  3ZKB A;  1XMQ E;  2CG9 A;  4MYU A;  2UUC I;  1QZR A;  2DEJ A;  4DR1 E;  3F0N A;  3M6A A;  2V8Q B;  1Y6Z A;  2M4I A;  2VF3 A;  3JU0 A;  2UXB I;  5BR8 E;  2F8B A;  1N34 I;  3K6Q A;  4X66 I;  1ZM3 A;  3OTO I;  3DJW A;  2LE2 A;  2X36 A;  4WUC A;  1HNX I;  4JV5 I;  1RR9 A;  1PVG A;  3QT5 A;  3ZKD A;  2EWL A;  3K1J A;  4OX9 I;  1X48 A;  4RPF A;  1XNQ E;  4P78 A;  4WUD A;  4BC9 A;  4DV1 E;  4IZK A;  4DV6 E;  4LFB I;  4K0K I;  4R8O A;  4JI8 I;  2L3J A;  3H4L A;  1Z5B A;  1N36 I;  1FWK A;  2L8T A;  4MYT A;  2DB2 A;  2E1R A;  1T4L B;  4DXL A;  3MSW A;  4DU8 A;  4DV3 I;  4M30 A;  4BBY A;  4JI6 E;  2RTX A;  3QT7 A;  3IWC A;  2LUP B;  1XNR E;  2L92 A;  2H36 X;  2V2Z A;  2HFU A;  3ADG A;  1Y4U A;  1Z5C A;  1FNM A;  4AQY I;  4YHH I;  2R3V A;  2UU9 I;  1WHQ A;  3J7Y p;  4Q28 A;  4R1F A;  4X65 E;  2F4V E;  2GQ0 A;  2L6M A;  4J8Z A;  4DR2 E;  4YY3 E;  4F54 A;  4JI0 E;  1ZBQ A;  3Q1Q A;  2KOU A;  4NXN I;  1H7U A;  1A6F A;  3HTX A;  2ZM6 I;  5A2Q Q;  1KVK A;  1OJ4 A;  4JI4 I;  1N0U A;  4UTG A;  4B3T I;  2NPF A;  1I94 E;  4OOG C;  3HQ1 A;  4LF8 I;  4LF6 E;  5LL6 R;  5IT9 C;  1XMQ I;  2LRS A;  1X49 A;  2LBS B;  2NUF A;  4LF7 E;  5AE2 A;  4PU9 A;  2CGE A;  4WYQ B;  3LML A;  1USU A;  1B62 A;  4L8N A;  1X47 A;  4DR4 E;  5GME A;  3V5R A;  3LNU A;  1Z5A A;  2JOB A;  2Z5C B;  3GON A;  2VE7 C;  4KHP E;  1Z0T A;  1EKZ A;  2B3T B;  2JY9 A;  3JAM Q;  4LF5 E;  2YT4 A;  3JTZ A;  4FN5 A;  3K17 A;  1YYO A;  2V8P A;  3PYF A;  1XNQ I;  1ELO A;  4F9C B;  3QT6 A;  4LFA E;  3VK6 A;  4DV1 I;  4DV6 I;  5AAS A;  2WW4 A;  3B8H A;  4PRV A;  1K47 A;  4X62 E;  2X7I A;  2LTS A;  4LTY A;  4JI3 E;  1O0W A;  1Z0G A;  2J7K A;  4HYM A;  1MG7 A;  5AE1 A;  4IZK B;  3QT8 A;  1T4O A;  1HR0 I;  2FTX B;  3VYX A;  1FI4 A;  4DV7 E;  4JI5 E;  2UUB E;  2VQF E;  3PYG A;  1U2R A;  4JI6 I;  3J7A M;  3WU5 A;  1PIE A;  1XNR I;  1IBM E;  4DR6 E;  4DV2 E;  4I8O A;  2V34 A;  4B3R E;  2EZ6 A;  3J80 C;  4DUZ E;  1DI2 A;  4X65 I;  1SR9 A;  2F4V I;  3K85 A;  3J7A G;  3ZZT A;  4DR2 I;  4TUI A;  1DAR A;  5GMD A;  2KON A;  3H09 A;  4F9B B;  4ZVI A;  4YY3 I;  3T1H E;  4JI0 I;  4TUG A;  3JAM C;  2LTR A;  1T4N A;  3ADJ A;  4LFC E;  2HFS A;  4UT4 A;  1N0V C;  1I94 I;  5T6J A;  5FWK A;  3WU4 A;  4LF6 I;  2JOX A;  2L2N A;  2V89 A;  2FGG A;  4DUY E;  5IT9 Q;  4N3O A;  2JVA A;  2LJP A;  1STU A;  3WU6 A;  4P7D A;  2KHX A;  4LF9 E;  3RMP A;  1J26 A;  1WUU A;  2NUG A;  2AJ4 A;  3PYD A;  4LF7 I;  4IZJ A;  1N33 E;  4R03 A;  2UUA E;  4DR7 E;  2UXC E;  2WZO A;  3P06 A;  4KQV A;  1FKA E;  2DIX A;  2GS8 A;  3OML A;  5LMU E;  4DR4 I;  2Z5E A;  4WUB A;  4LU9 A;  2VQE E;  4KHP I;  3PRY A;  4XTJ A;  4DPX A;  2MDR A;  4DR3 E;  3ZZ0 A;  1H74 A;  4LF5 I;  1B63 A;  1J5E E;  4DV0 E;  4FWD A;  1S4E A;  1H7S A;  2Z5B B;  4LFA I;  1UHZ A;  1IBK E;  4X62 I;  2VF1 A;  4JI3 I;  2HHH E;  4FWG A;  3AUZ A;  2OI2 A;  4JYA E;  3Q6M A;  2K4V A;  5FLX Q;  1N34 E;  2ZBK B;  2N3G A;  2NA2 A;  4BMJ A;  4DV7 I;  4EMD A;  4JI5 I;  1USV A;  2UUB I;  2VQF I;  1YYW A;  5LMN E;  1D6T A;  1XMO E;  2JR1 A;  1RRE A;  1RQ0 A;  3F6G A;  3C4B A;  4B3M E;  1IBM I;  4DR6 I;  3ZOQ B;  4I3H A;  3J80 Q;  4GEQ B;  1RC7 A;  4DV2 I;  4DR1 I;  4B3R I;  4URL A;  2ODR D;  4DUZ I;  4DV5 E;  4LFB E;  5BR8 I;  2V85 A;  5F3W A;  5CFF E;  2CZ9 A;  1GZ6 A;  4DPY A;  1ZBT A;  3T1H I;  2DSY A;  3HPZ A;  3ZM7 A;  3Q6N A;  1DQ3 A;  4LFC I;  4BCA A;  4PRX A;  5DNY A;  4HAC A;  3KWR A;  4WSP A;  4DU7 A;  2L3C A;  1Z0V A;  2UXD E;  2MC5 A;  2UU9 E;  2LMZ A;  4P52 A;  1KIJ A;  2BV3 A;  4DUY I;  2BM0 A;  4HXZ A;  2ODR C;  4LF9 I;  5IWA E;  3ZZU A;  5FLX C;  3HJC A;  3B82 A;  4DPW A;  1FJG E;  2HKJ A;  4IZJ D;  1N33 I;  2UUA I;  4JI1 E;  4DR7 I;  3LLH A;  1Z59 A;  3T1Y E;  4M2Z A;  2JWO A;  2IOQ A;  3PYE A;  1NZ0 A;  1HNZ E;  4GKK E;  1ZM9 A;  5LMU I;  2V83 A;  1ZM4 A;  4KZS A;  4LF4 E;  4DPU A;  4BS9 A;  2IOP A;  1ZXM A;  2L2K B;  2MC6 A;  1J5E I;  4NXM E;  4DV0 I;  2V87 A;  1NHH A;  3J81 Q;  1H73 A;  3ADL A;  2O1T A;  1H72 C;  2E1M A;  1IBK I;  4DV4 E;  2HHH I;  2Z5C A;  4X64 E;  2O1U A;  4WPY A;  4JYA I;  2A2C A;  1KTV A;  4USK A;  4JI7 E;  4JI2 E;  4B3S E;  3VYY A;  2A2D A;  4DPT A;  1YZ9 A;  5LMN I;  2L2M A;  1HNW E;  1ZM2 A;  1XMO I;  4B3M I;  4GKJ E;  1IBL E;  4WFT A;  2E5L E;  1N32 E;  1ZXN A;  4DV5 I;  1NHJ A;  4DR5 E;  4F9A B;  1WHN A;  3FIG A;  4FW9 A;  2RSM A;  4M1K A;  2HK2 A;  2DEI A;  1HR0 E;  2PNL A;  1XHK A;  2LJH A;  4ED4 A;  2UUC E;  4DKK A;  1UEK A;  3LTO A;  3ADI A;  2HKE A;  2B9D A;  2FV4 B;  2RS7 A;  2V86 A;  4M0V A;  3B78 A;  3J81 C;  3HPS A;  3IWD A;  2M7Q A;  2UXD I;  4HAC B;  2UXB E;  2V2V A;  2Q2E B;  4X8W A;  4X66 E;  3OTO E;  1YYK A;  4JV5 E;  5IWA I;  1HNX E;  1Z0C A;  4HY1 A;  1NHI A;  1FJG I;  1UIL A;  2B7V A;  3HXL A;  1EI1 A;  4JI1 I;  3AV0 A;  2NUE A;  1Z0B A;  3WU3 A;  1WXR A;  3T1Y I;  1FWL A;  1S16 A;  4OX9 E;  2R42 A;  4P7A A;  2L33 A;  3F6H A;  1HNZ I;  4GKK I;  3C4T A;  1PKP A;  1Z0E A;  1QU6 A;  2YZT A;  4Z7Y A;  4K0K E;  4JI8 E;  1BKN A;  3D4J A;  4LF4 I;  1MX0 A;  5L3J A;  1N36 E;  2V2Q A;  2M1S A;  4BC7 A;  1KKH A;  2IHR 1;  4NXM I;  2DMY A;  4DV3 E;  3HUL A;  3LPS A;  2CPN A;  2LUQ A;  3P1X A;  2BM1 A;  1MU5 A;  4JG4 A;  2B7T A;  4DMI A;  5AE3 A;  1Z0W A;  4DV4 I;  4X64 I;  4AQY E;  4YHH E;  2XEX A;  3IWB A;  4FWH A;  4L5N C;  1GQE A;  3CWV A;  4JI7 I;  4JI2 I;  1VIS A;  3V2U C;  4B3S I;  2V88 A;  2Z5B A;  1HNW I;  4NXN E;  4USM A;  4GKJ I;  1IBL I;  2O1V A;  2ZM6 E;  2O1W A;  4IZJ B;  2UXC I;  2HK3 A;  4Z7C A;  4JI4 E;  2G7H A;  1HK7 A;  2E5L I;  1N32 I;  2PNM A;  1EA6 A;  5A2Q C;  4B3T E;  1Y4S A;  4DR5 I;  4LF8 E;  2RS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...