4KHPE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4khpE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpE02
4P52A 4DR4I 4DV4I 4AQYI 2V34A 5FLXC 1XNQE 2B7TA 5GMEA 1WUUA 2UUBI 2HK3A 2A2DA 4YHHI 4FWDA 1NHJA 3PYGA 4JI2I 4DPXA 1X48A 1KVKA 2EZ6A 4DV1E 3QT5A 1QZRA 4X62I 1T4OA 4JI5E 4JI5I 1EKZA 1D6TA 2UUAI 4B3TI 4LF5E 3JAMQ 1MU5A 1IBKE 4X66I 2LTSA 4K0KE 2DEIA 1HNZI 2IHR1 1Z59A 4DR7I 4LFAE 3QT8A 2UU9E 2UU9I 4LF7I 4JI7I 3HTXA 4FWHA 3LLHA 4DR6I 4RPFA 3LTOA 1YYWA 1XMOI 1B62A 3ZKDA 1XNRI 1Z0WA 1YYKA 3PYDA 2ZM6I 4JV5I 1N0UA 2VQEE 1RREA 1N34I 4JI1E 2WW4A 4DV2E 2RS6A 2L3JA 4JI4E 4DV7E 1NHIA 4DV7I 2RSMA 1A6FA 4B3ME 4DKKA 1RR9A 4JI8I 4KHPI 4FW9A 4GKKE 4LF8I 3C4BA 1ZM4A 4FN5A 2VF3A 1PIEA 1Z0TA 2LRSA 5IWAI 4B3RE 4PU9A 2UUCI 2F4VI 4NXNI 2EFGA 1RQ0A 2V8PA 4DU8A 3JAMC 4DU7A 4LFCE 5A2QQ 4ZVIA 1J5EE 3VYYA 1KTVA 4P7AA 2KHXA 2VQFI 1ZXMA 4LF4I 4WYQB 1H74A 4GKJI 3LPSA 3K1JA 1XMQI 4HXZA 1X47A 4HACA 1PVGA 1I94I 3Q1QA 4HYMA 1H7SA 2Q2EB 1X49A 4R1FA 1WHNA 1ZM2A 2E1RA 3QT6A 4DPYA 2RTXA 4X64I 1K47A 3WU3A 2NUFA 1DARA 1UEKA 2XEXA 1UILA 1ELOA 4JI6E 4YY3I 1FKAE 4UTGA 1ZM3A 4DR4E 4OX9E 4OX9I 4DV4E 2HK2A 4LFBI 4AQYE 1MX0A 3QT7A 1KKHA 4USKA 4I3HA 1Z0BA 2HHHI 2UUBE 5A2QC 2E5LI 4YHHE 3HULA 3ZZ0A 4JI2E 2DIXA 3D4JA 3J80Q 1FJGI 4MYTA 4DV0I 2LJPA 3K17A 4DR3I 1U2RA 1T4NA 1ZM9A 3GONA 4PRVA 4M1KA 4LF6I 4DPWA 4DUZE 4X62E 4DUZI 2ZITA 4DR1E 4DR1I 4LF9I 4B3SI 2DB2A 1YYOA 1FWLA 3ZKBA 2UUAE 4B3TE 4X66E 4WUCA 5LMUI 3J81Q 1HNZE 1OJ4A 1S16A 4DR5I 3F0NA 4DR7E 4OOGC 1GQEA 4LF7E 2NPFA 4JI7E 4UT4A 1STUA 4DR6E 3B78A 2GS8A 1XMOE 1S4EA 1XNRE 2ZBKB 1B63A 2ZM6E 4JV5E 2HKJA 1N34E 1KIJA 4DPUA 1DI2A 3J80C 2B7VA 1N33E 1N33I 4JI8E 2LBSB 4KHPE 4JI0E 2L33A 1J26A 4JI0I 4LF8E 2UXDI 1EI1A 5CFFE 3T1YI 2HFUA 1ZBTA 1QU6A 4WUDA 5IWAE 2L2KB 2UUCE 2F4VE 2V2QA 1IBMI 4NXNE 3LNUA 2LUPB 1HR0I 1N36I 3B8HA 3J81C 4ED4A 2VQFE 4LF4E 4DV5I 1FNMA 4GKJE 3J7Yp 3ZZTA 1PKPA 4JI3I 3WU4A 2BM0A 4XTJA 1XMQE 2UXBI 3ADJA 1N32I 2BV3A 1O0WA 4WUBA 2JVAA 2L2NA 3OTOI 1I94E 4DUYI 1IBLI 1Z0EA 1HNXI 2LTRA 4X64E 2JY9A 4PRXA 1RC7A 2RS7A 5LMNI 2UXCI 4YY3E 4JYAI 1Z5CA 2X36A 5GMDA 4LFBE 3P1XA 2NA2A 4KQVA 3ZZUA 1HNWI 2HHHE 4NXMI 2E5LE 3PYEA 1FI4A 1FJGE 4DR3E 4DV0E 1MG7A 4DV6I 2X7IA 4DPTA 1XHKA 1N0VC 4LF6E 3ADGA 1NHHA 4LF9E 1XNQI 4B3SE 2N3HA 3C4TA 2B3TB 2CZ9A 2DMYA 3ADIA 2NUGA 5LMUE 3ZM7A 2LUQA 4DR5E 3M6AA 2HKEA 1WHQA 1VISA 4DXLA 4DV1I 1Z5AA 2N3GA 2OI2A 4EMDA 4URLA 1ZXNA 2V2VA 4LF5I 1IBKI 4WFTA 1Z0VA 5BR8E 5BR8I 4K0KI 2CPNA 4LFAI 3H4LA 3T1HE 3ADLA 3T1HI 3CWVA 1Z5BA 2UXDE 3T1YE 1Z0CA 1T4LB 1IBME 3WU5A 4MYUA 2VQEI 1HR0E 1H72C 4JI1I 4JG4A 2J7KA 1N36E 4DV2I 4JI4I 2YT4A 4USMA 1Z0GA 4B3MI 4M30A 4DV5E 1UHZA 4GKKI 5IT9Q 2A2CA 4HY1A 4JI3E 3PYFA 3VYXA 4M2ZA 3J7AG 1H73A 2UXBE 2HFSA 1N32E 4B3RI 5FLXQ 1NZ0A 2MDRA 1FWKA 1H7UA 2R3VA 4LFCI 3OTOE 4DUYE 3B82A 1J5EI 1IBLE 3WU6A 4Z7CA 2BM1A 1HNXE 1BKNA 3V5RA 2LJHA 4Z7YA 4DV3E 2AJ4A 4DV3I 5LL6R 3J7AM 5LMNE 2UXCE 4JYAE 3V2UC 5L3JA 1EA6A 4HACB 2V2ZA 4DR2E 1HNWE 2DEJA 4DR2I 4NXME 2L2MA 2L3CA 4X8WA 1YZ9A 4X65E 2NUEA 4X65I 4FWGA 2R42A 5IT9C 4DV6E 4JI6I
chains in the Genus database with same CATH superfamily
2YSOA 5IV8B 4P52A 4DR4I 2WP8A 1E3PA 4NHRA 4MLQA 2ODRD 4RH8A 4DV4I 2WP8B 4AQYI 2V34A 2EORA 5FLXC 1XNQE 2B7TA 4L8NA 5DROA 5GMEA 1WUUA 1YHCA 1PJSA 4FW6A 2EOMA 2UUBI 2V87A 2HK3A 2KOUA 4U3BA 2A2DA 2EPNA 3KZYA 4YHHI 2EOQA 2EN6A 1SFEA 3DJWA 2GHFA 2M7QA 4FWDA 3C6MA 1NHJA 4NZVA 3PYGA 4JI2I 5JEAF 4DPXA 1X48A 4X9JA 3H1CA 1KVKA 3JU0A 2ENCA 1B69A 2EZ6A 4OO1E 4DV1E 5EL9A 3QT5A 2WNRB 1QZRA 1YFHA 4X62I 4MQYA 1T4OA 4JI5E 2EOJA 3M7ND 4JI5I 2K7IA 1EKZA 2J7JA 2EMBA 4IFDF 1D6TA 2UUAI 4B3TI 3HXLA 4MDTA 2LCEA 4LF5E 1MU5A 1IBKE 3JAMQ 1X6FA 2EQ1A 5A6JA 4X66I 4F9CB 2LTSA 2PRTA 3HPZA 1X5WA 1A1HA 4K0KE 2DEIA 2EM5A 4BA1A 1HNZI 4JI6I 4IFDC 2IHR1 3VK6A 4BMJA 2DLQA 2WCC3 1Z59A 4BA1B 4DR7I 1MGTA 2YTIA 4IS1C 4LFAE 3QT8A 2ENAA 2UU9E 2UU9I 4LF7I 3M99B 5KL2A 3PS1A 4JI7I 3HTXA 4WXCA 2EPXA 3THOB 1JK1A 2L92A 2YRKA 3HKMA 1SR9A 5DNYA 3EPLA 4FWHA 3LLHA 4DR6I 2LE2A 4RPFA 3LTOA 2PO2A 1TF6A 1YYWA 2C39A 2VE7C 3KRNA 1PJTA 2PO2B 1XMOI 1B62A 2C39B 2V83A 3ZKDA 1XNRI 2ELZA 1Z0WA 1YYKA 3PYDA 2ZM6I 4JV5I 2EM0A 2JEAA 1N0UA 2VQEE 1A1JA 1RREA 1N34I 4JI1E 2JEAB 2WW4A 4DV2E 2RS6A 2L3JA 4JI4E 1YPNA 4DV7E 1NHIA 2O1WA 4DV7I 2EMCA 3K6QA 2RSMA 2F8BA 4OO1A 2VRDA 2CGEA 5AE2A 1A6FA 2YZTA 4B3ME 2LJUA 4DKKA 4OO1B 1RR9A 4JI8I 4KHPI 4FW9A 2MKNA 4GKKE 2WBSA 3C4BA 1ZM4A 4LF8I 3EQ1A 2VF3A 2HC5A 1PIEA 4FN5A 2YPNA 1IQOA 2BA0D 1Z0TA 2LRSA 2V8QB 2GLIA 1NEIA 4F9AB 5IWAI 4B3RE 2YTDA 2RQLA 4ISAA 4MU0A 4PU9A 2UUCI 4GZNC 2EPAA 5C0XC 2F4VI 2LO3A 4NXNI 2EFGA 1RQ0A 2V8PA 3P76A 4DU8A 3JAMC 4DU7A 5TSEA 4LFCE 5C0XD 5A2QQ 4ZVIA 2EOYA 2HJJA 1J5EE 2EM7A 3EPJA 3VYYA 1Z1BA 1KTVA 2V86A 3MHSC 4P7AA 2KHXA 4MU1A 2VESA 2VQFI 2EMLA 3LMLA 1ZXMA 2R1FA 4DR3I 4RHBB 4WYQB 4LF4I 1H74A 4ZYGA 2WBUA 2EPKX 4ZYHA 2AE8A 4Q28A 4GKJI 2YU5A 2V88A 3M85G 1UDSA 3LPSA 1YSAC 3UK3C 4LTYA 1MEYC 4R2EA 2V85A 4OKGA 2YTQA 4BS9A 5AASA 3K1JA 1EH6A 1XMQI 4R2DA 4HXZA 2YTPA 1X47A 2MDGA 5DRPA 2JP9A 4HACA 1T39A 1PVGA 1I94I 3Q1QA 4F54A 4HYMA 1H7SA 2Q2EB 1X49A 4KZSA 4R1FA 1WHNA 1ZM2A 5AC5A 2E1RA 4F6NA 1HK7A 5KL5A 3QT6A 4DPYA 1EH8A 2RTXA 2NN6F 4X64I 2EN8A 2EPZA 1K47A 3WU3A 2NUFA 1DARA 1UEKA 2XEXA 3BF2A 1VI7A 1UILA 1ELOA 3M7NG 2EN3A 4IZJD 2WZOA 2DGCA 1BB8A 4JI6E 4BBYA 4YY3I 1FKAE 3MHHC 4UTGA 1ZM3A 4DR4E 2LT7A 4OX9E 2NN6C 4OX9I 4DV4E 2HK2A 2EOHA 2M4IA 4LCGA 4LFBI 5K36D 4AQYE 2EN2A 2PO1A 1MX0A 3NZKA 1KKHA 3QT7A 1Y6ZA 4R2CA 4HEIA 4USKA 4I3HA 2PO1B 1Z0BA 2HHHI 2UUBE 2EMYA 3BIDA 1AAYA 4M9VC 5A2QC 2IESA 2J65A 1RMDA 2E5LI 4YHHE 2DRPA 3HULA 1PJQA 2L8TA 2CTDA 3ZZ0A 2C37A 4F6MA 4JI2E 2DIXA 3AUZA 2EMXA 5KL7A 1Y4SA 4MLVA 2C37B 2LJPA 3D4JA 3K17A 4MYTA 3J80Q 4TUGA 2DMIA 4DV0I 1U2RA 2YTOA 1T4NA 4R2QA 1ZM9A 3GONA 4LCHA 3RMPA 4PRVA 1X6HA 1R6MA 2WNRA 4BHBA 4M1KA 2EOEA 5T6JA 1A1GA 4WPYA 1AH5A 3DF6A 2PO0A 1BBOA 1WXRA 1OYPA 4LCFA 4DPWA 5FWKA 4LF6I 4DUZE 2BA1D 4X62E 2EOFA 2MC5A 2ZITA 4DR1E 2PO0B 5JEAC 4DUZI 2GQ0A 1ZR9A 1UDOA 4DR1I 2EMHA 1GZ6A 4R8OA 2JE6A 4LF9I 4B3SI 2DB2A 4L5NC 5JEAD 2EPRA 1YYOA 1FWLA 2JE6B 3DD6A 3ZKBA 1YUJA 2UUAE 4LOMA 4B3TE 2YTNA 2C38A 5A6BD 4J8ZA 4X66E 2C38B 4WUCA 4DMIA 5LMUI 3J81Q 2GO3A 2DLKA 2RSIA 1HNZE 1OJ4A 1S16A 4DR5I 2WBTA 4R03A 2EMWA 4AIDA 1P42A 3F0NA 3PRYA 4O4KA 4DR7E 2EMKA 1P47A 3P06A 3THNA 4FK5C 2B9DA 4OOGC 1GQEA 5KL4A 1A1LA 3CDJA 4IFDD 2PNLA 1EH7A 4LF7E 2NPFA 3TQMA 4JI7E 4UT4A 4P7DA 1STUA 3C6KA 5DNXA 2EOIA 5AC4A 4DR6E 1OYRA 3H09A 4IJDA 5K36E 4GEQB 2YRMA 3PS2A 2EMAA 1G2DC 3B78A 2GS8A 5C0XA 1XMOE 2EE8A 2YSPA 1BBGA 1WJPA 1S4EA 1XNRE 5C0XB 2NABA 1B63A 2ZBKB 2ZM6E 1PDAA 4JV5E 2IOPA 2HKJA 1DGCA 1N34E 1KIJA 4DPUA 1DI2A 1JK2A 3U1KA 2EOSA 2FV4B 2JT2A 2I9IA 3J80C 2ELYA 2EM3A 1IMUA 2L6MA 2B7VA 2YTGA 1N33E 1N33I 4J3DA 4JI8E 2LBSB 4KHPE 3K85A 5F3WA 4JI0E 2EM9A 2L33A 2RPCA 4WX9A 4LF8E 1J26A 4JI0I 2UXDI 1EI1A 5CFFE 2MC6A 4O43A 3T1YI 1TN9A 4R2AA 2EMGA 1X3CA 2HFUA 2EQ3A 4FW5A 1ZBTA 1QU6A 1OYSA 4WUDA 2EMFA 5IWAE 2L2KB 5JEAE 5KL3A 2EOOA 2UUCE 2F4VE 2V2QA 1IBMI 3OMLA 4BC7A 2E1MA 3JTZA 4NXNE 2LUPB 3LNUA 1R6LA 1HR0I 5ADZA 1N36I 4BCAA 3B8HA 3J81C 3EPHA 2BA0G 4ED4A 1GTKA 2VQFE 4AIMA 2LMZA 4LF4E 4DV5I 1F2IG 1FNMA 3HJCA 2Z5CB 4IZJA 4GKJE 2DSYA 3J7Yp 2JXPA 4IZJB 4IFDE 3ZZTA 2EM2A 2JYAA 1PKPA 1USVA 4JI3I 3WU4A 2R76A 3L00A 1IQSA 3IWDA 4IZKA 2BM0A 4KWYA 4XTJA 5DRRA 5K36A 1XMQE 2MKDA 5K36B 2Q8UA 3ADJA 1YH8A 4IZKB 3Q6NA 1N32I 2FGGA 2BV3A 2UXBI 1O0WA 4WUBA 5EKWA 4OO1F 3P3GA 3ZOQB 2JVAA 2L2NA 4I8OA 1UDNA 1L4SA 1I94E 3OTOI 4DUYI 1DQ3A 2JOBA 5A6AA 4MU3A 2CSHA 4R2RA 1E3HA 4WSGA 1IBLI 2BBGA 1FJGI 1TF3A 2ENHA 1Z0EA 1HNXI 1Y60A 4LU9A 4BC9A 4Q35B 5AE3A 2LTRA 4X64E 2JY9A 2VF1A 4PRXA 1RC7A 2EL5A 3L7ZA 2RS7A 5LLQA 5LMNI 3L7ZB 2UXCI 1ZBQA 2JEBA 4YY3E 4JYAI 1Z5CA 2X36A 5JEAA 2JEBB 4FW7A 5GMDA 2D9HA 3AV0A 3B4TA 2A25A 4HTGA 5JEAB 4LFBE 2EWLA 2PNMA 2H36X 2EPLX 3P1XA 2EM4A 2NA2A 4KQVA 2NN6D 3ZZUA 5KL6A 1A1KA 1HNWI 2HHHE 4NXMI 2IERA 2O1VA 5C0XE 1KYQA 2E5LE 2LVHA 3PYEA 2YTEA 2EMIA 1T38A 1WRJA 3VHTB 1FI4A 1RHYA 4IFDA 1FJGE 4DR3E 2E72A 2EJ4A 4DV0E 5IXMB 1MG7A 4IFDB 4LPFA 4BHCA 1ZAAC 4DV6I 2ODRC 2X7IA 4DPTA 1XHKA 1N0VC 2CG9A 3F6HA 3IWBA 4LF6E 5ELWA 4WXDA 2Z5BA 3ADGA 1NHHA 4LF9E 2Z5BB 4FW4A 2YWQA 1XNQI 4B3SE 2N3HA 2YRHA 3C4TA 1ZU1A 2M9AA 2B3TB 2EQ0A 1USUA 2EPMX 2CZ9A 2DMYA 3ADIA 4IS9A 2NUGA 1XXEA 5LMUE 2YTJA 3ZM7A 2LUQA 2EL4A 2BA1G 4DR5E 2O1TA 3M6AA 2G7HA 4N4RB 3HPSA 2HKEA 2O3ZA 2BR2A 2EOXA 1WHQA 2EPUA 1VISA 4R2SA 4DXLA 4DV1I 2JR1A 1Z5AA 2BR2B 2N3GA 2EPOA 4F9BB 2CVEA 2OI2A 5A6KA 1YUIA 1A1FA 4U3DA 4EMDA 2PNZA 3KWRA 4TUIA 4URLA 1ZXNA 2EM6A 2PNZB 2V2VA 2NN6E 2EPPA 4LF5I 1IBKI 4M0VA 4WFTA 4ZYDA 5AE1A 2HGHA 2GPIA 1Z0VA 5BR8E 5BR8I 3GLLA 3MSWA 4K0KI 2CPNA 2O1UA 2JPAA 4LFAI 1Y5YA 3H4LA 3T1HE 3ADLA 3T1HI 3CWVA 3PS3A 4QNJA 2EOZA 1Z5BA 4BA2A 2EMZA 3F6GA 3ECRA 3FIGA 2UXDE 2EM8A 4WSPA 3T1YE 3BBGA 4BA2B 3U1YA 1G2FC 1Z0CA 2FTXB 5A69A 1UN6B 1T4LB 1IBME 2N8XA 3WU5A 4MYUA 2VQEI 1A1IA 1HR0E 1H72C 4JI1I 4JG4A 2J7KA 1N36E 4DV2I 5DNLA 2LV2A 4JI4I 2YT4A 2YU8A 4USMA 1Z0GA 2Z5CA 3GCMA 4B3MI 4M30A 4DV5E 2EN7A 3P3EA 5C0XF 1UHZA 2ADRA 4GKKI 5IT9Q 1LLMC 2A2CA 4HY1A 4JI3E 4N3OA 3PYFA 3VYXA 4M2ZA 3J7AG 1H73A 1N3GA 2UXBE 2HFSA 2KONA 1N32E 2NN6A 4GQUA 5FLXQ 1NZ0A 4B3RI 2M1SA 2GO4A 2MDRA 2JOXA 2NN6B 1FWKA 1H7UA 4FW3A 2IOQA 3M85D 2R3VA 2JWOA 2BB8A 2YTFA 3Q6MA 4LFCI 3OTOE 4DUYE 2EL6A 1UBDC 3B82A 1J5EI 4O5GA 3KZZA 1IBLE 4NBQA 3WU6A 4R2PA 4Z7CA 2K4VA 3HQ1A 1HNXE 1BKNA 2BM1A 3V5RA 2LJHA 4OO1C 4Z7YA 4DV3E 1NCSA 3IWCA 2AJ4A 3UHMA 4DV3I 5LL6R 3J7AM 4OO1D 2Z5EA 5LMNE 3GMEA 2UXCE 3CDIA 4JYAE 2EP3A 3V2UC 1UDQA 2V89A 5L3JA 4OZEA 4AM3A 1Y4UA 4QNKA 4O24A 5A6BA 1EA6A 4F2JC 2CT1A 2I13A 4HACB 2V2ZA 2F1DA 4DR2E 1HNWE 2DEJA 4DR2I 2EPCA 3BGHA 4NXME 4MU4A 5K36F 3P3CA 2L2MA 2L3CA 4X8WA 1YZ9A 1X6EA 4P78A 4X65E 5DRQA 2NUEA 4X65I 2EN1A 3EPKA 4FWGA 1QNTA 4ZYEA 3QG5C 2R42A 5IT9C 2EN4A 4DV6E 1KJKA 5K36C
chains in the Genus database with same CATH topology
4P52A 4DR4I 2ODRD 4DV4I 4AQYI 2V34A 5FLXC 1XNQE 2B7TA 4L8NA 5GMEA 1WUUA 2UUBI 2V87A 2HK3A 2KOUA 2A2DA 4YHHI 3DJWA 2M7QA 4FWDA 1NHJA 3PYGA 4JI2I 4DPXA 1X48A 1KVKA 3JU0A 2EZ6A 4DV1E 3QT5A 1QZRA 4X62I 1T4OA 4JI5E 4JI5I 1EKZA 1D6TA 2UUAI 4B3TI 3HXLA 4LF5E 3JAMQ 1MU5A 1IBKE 4X66I 4F9CB 2LTSA 3HPZA 4K0KE 2DEIA 1HNZI 2IHR1 3VK6A 4BMJA 1Z59A 4DR7I 4LFAE 3QT8A 2UU9E 2UU9I 4LF7I 4JI7I 3HTXA 2L92A 1SR9A 5DNYA 4FWHA 3LLHA 4DR6I 2LE2A 4RPFA 3LTOA 1YYWA 2VE7C 1XMOI 1B62A 2V83A 3ZKDA 1XNRI 1Z0WA 1YYKA 3PYDA 2ZM6I 4JV5I 1N0UA 2VQEE 1RREA 1N34I 4JI1E 2WW4A 4DV2E 2RS6A 2L3JA 4JI4E 4DV7E 1NHIA 2O1WA 4DV7I 2RSMA 3K6QA 2F8BA 2CGEA 5AE2A 1A6FA 2YZTA 4B3ME 4DKKA 1RR9A 4JI8I 4KHPI 4FW9A 4GKKE 4LF8I 3C4BA 1ZM4A 4FN5A 2VF3A 1PIEA 1Z0TA 2LRSA 2V8QB 4F9AB 5IWAI 4B3RE 4PU9A 2UUCI 2F4VI 4NXNI 2EFGA 1RQ0A 2V8PA 4DU8A 3JAMC 4DU7A 4LFCE 5A2QQ 4ZVIA 1J5EE 3VYYA 1KTVA 2V86A 4P7AA 2KHXA 2VQFI 1ZXMA 3LMLA 4LF4I 4WYQB 1H74A 4GKJI 4Q28A 2V88A 3LPSA 4LTYA 2V85A 5AASA 4BS9A 3K1JA 1XMQI 4HXZA 1X47A 4HACA 1PVGA 1I94I 3Q1QA 4F54A 4HYMA 1H7SA 2Q2EB 1X49A 4KZSA 4R1FA 1WHNA 1ZM2A 2E1RA 1HK7A 3QT6A 4DPYA 2RTXA 4X64I 1K47A 3WU3A 2NUFA 1DARA 1UEKA 2XEXA 1UILA 1ELOA 4IZJD 2WZOA 4JI6E 4BBYA 4YY3I 1FKAE 4UTGA 1ZM3A 4DR4E 4OX9E 4OX9I 4DV4E 2HK2A 2M4IA 4LFBI 4AQYE 1MX0A 3QT7A 1KKHA 1Y6ZA 4USKA 4I3HA 1Z0BA 2HHHI 2UUBE 5A2QC 2E5LI 4YHHE 3HULA 2L8TA 3ZZ0A 4JI2E 2DIXA 3AUZA 1Y4SA 3D4JA 3J80Q 4MYTA 4DV0I 2LJPA 3K17A 4DR3I 1FJGI 4TUGA 1U2RA 1T4NA 1ZM9A 3GONA 3RMPA 4PRVA 4M1KA 5T6JA 4WPYA 3DF6A 4DPWA 4LF6I 1WXRA 5FWKA 4DUZE 4X62E 2MC5A 2ZITA 4DUZI 4DR1E 4DR1I 2GQ0A 4LF9I 1GZ6A 4R8OA 4B3SI 2DB2A 4L5NC 1YYOA 1FWLA 3ZKBA 2UUAE 4B3TE 4J8ZA 4X66E 4WUCA 4DMIA 5LMUI 3J81Q 1HNZE 1OJ4A 1S16A 4DR5I 4R03A 3F0NA 3PRYA 4DR7E 3P06A 2B9DA 4OOGC 1GQEA 2PNLA 4LF7E 2NPFA 4JI7E 4UT4A 4P7DA 1STUA 4DR6E 3H09A 4GEQB 3B78A 2GS8A 1XMOE 1S4EA 1XNRE 2ZBKB 1B63A 2ZM6E 2IOPA 4JV5E 2HKJA 1N34E 1KIJA 4DPUA 1DI2A 2FV4B 3J80C 2L6MA 2B7VA 1N33E 1N33I 4JI8E 2LBSB 4KHPE 3K85A 5F3WA 4JI0E 2L33A 1J26A 4JI0I 4LF8E 2UXDI 1EI1A 5CFFE 2MC6A 3T1YI 2HFUA 1ZBTA 1QU6A 4WUDA 5IWAE 2L2KB 2UUCE 2F4VE 2V2QA 1IBMI 3OMLA 4BC7A 2E1MA 3JTZA 4NXNE 2LUPB 3LNUA 1HR0I 5ADZA 1N36I 4BCAA 3B8HA 3J81C 4ED4A 2VQFE 2LMZA 4LF4E 4DV5I 3HJCA 1FNMA 4IZJA 2Z5CB 4GKJE 2DSYA 3J7Yp 4IZJB 3ZZTA 1PKPA 1USVA 4JI3I 3WU4A 3IWDA 4IZKA 2BM0A 4XTJA 1XMQE 4IZKB 3ADJA 2UXBI 1N32I 3Q6NA 2FGGA 2BV3A 1O0WA 4WUBA 3ZOQB 2JVAA 2L2NA 4I8OA 3OTOI 1I94E 4DUYI 1DQ3A 2JOBA 1IBLI 1Z0EA 1HNXI 4LU9A 4BC9A 5AE3A 2LTRA 4X64E 2JY9A 2VF1A 4PRXA 1RC7A 2RS7A 5LMNI 2UXCI 1ZBQA 4YY3E 4JYAI 1Z5CA 2X36A 5GMDA 3AV0A 4LFBE 2EWLA 2PNMA 2H36X 3P1XA 2NA2A 4KQVA 3ZZUA 1HNWI 2HHHE 4NXMI 2O1VA 2E5LE 3PYEA 1FI4A 1FJGE 4DR3E 4DV0E 1MG7A 4DV6I 2ODRC 2X7IA 4DPTA 1XHKA 1N0VC 2CG9A 3F6HA 3IWBA 4LF6E 2Z5BA 3ADGA 1NHHA 4LF9E 2Z5BB 1XNQI 4B3SE 2N3HA 3C4TA 2B3TB 1USUA 2CZ9A 2DMYA 3ADIA 2NUGA 5LMUE 3ZM7A 2LUQA 4DR5E 2O1TA 3M6AA 2G7HA 3HPSA 2HKEA 1WHQA 1VISA 4DXLA 4DV1I 2JR1A 1Z5AA 2N3GA 4F9BB 2OI2A 4EMDA 3KWRA 4TUIA 4URLA 1ZXNA 2V2VA 4LF5I 1IBKI 4M0VA 4WFTA 5AE1A 1Z0VA 5BR8E 5BR8I 3MSWA 4K0KI 2CPNA 2O1UA 4LFAI 3H4LA 3T1HE 3ADLA 3T1HI 3CWVA 1Z5BA 3F6GA 3FIGA 2UXDE 4WSPA 3T1YE 1Z0CA 2FTXB 1T4LB 1IBME 3WU5A 4MYUA 2VQEI 1HR0E 1H72C 4JI1I 4JG4A 2J7KA 1N36E 4DV2I 4JI4I 2YT4A 4USMA 1Z0GA 2Z5CA 4B3MI 4M30A 4DV5E 1UHZA 4GKKI 5IT9Q 2A2CA 4HY1A 4JI3E 4N3OA 3PYFA 3VYXA 4M2ZA 3J7AG 1H73A 2UXBE 2HFSA 2KONA 1N32E 4B3RI 5FLXQ 1NZ0A 2M1SA 2MDRA 2JOXA 1FWKA 1H7UA 2IOQA 2R3VA 2JWOA 3Q6MA 4LFCI 3OTOE 4DUYE 3B82A 1J5EI 1IBLE 3WU6A 4Z7CA 2K4VA 3HQ1A 1HNXE 1BKNA 2BM1A 3V5RA 2LJHA 4Z7YA 4DV3E 3IWCA 2AJ4A 4DV3I 5LL6R 3J7AM 2Z5EA 5LMNE 2UXCE 4JYAE 3V2UC 2V89A 5L3JA 1Y4UA 1EA6A 4HACB 2V2ZA 4DR2E 1HNWE 2DEJA 4DR2I 4NXME 2L2MA 2L3CA 4X8WA 1YZ9A 4P78A 4X65E 2NUEA 4X65I 4FWGA 2R42A 5IT9C 4DV6E 4JI6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P52 A;  4DR4 I;  4DV4 I;  4AQY I;  2V34 A;  5FLX C;  1XNQ E;  2B7T A;  5GME A;  1WUU A;  2UUB I;  2HK3 A;  2A2D A;  4YHH I;  4FWD A;  1NHJ A;  3PYG A;  4JI2 I;  4DPX A;  1X48 A;  1KVK A;  2EZ6 A;  4DV1 E;  3QT5 A;  1QZR A;  4X62 I;  1T4O A;  4JI5 E;  4JI5 I;  1EKZ A;  1D6T A;  2UUA I;  4B3T I;  4LF5 E;  3JAM Q;  1MU5 A;  1IBK E;  4X66 I;  2LTS A;  4K0K E;  2DEI A;  1HNZ I;  2IHR 1;  1Z59 A;  4DR7 I;  4LFA E;  3QT8 A;  2UU9 E;  2UU9 I;  4LF7 I;  4JI7 I;  3HTX A;  4FWH A;  3LLH A;  4DR6 I;  4RPF A;  3LTO A;  1YYW A;  1XMO I;  1B62 A;  3ZKD A;  1XNR I;  1Z0W A;  1YYK A;  3PYD A;  2ZM6 I;  4JV5 I;  1N0U A;  2VQE E;  1RRE A;  1N34 I;  4JI1 E;  2WW4 A;  4DV2 E;  2RS6 A;  2L3J A;  4JI4 E;  4DV7 E;  1NHI A;  4DV7 I;  2RSM A;  1A6F A;  4B3M E;  4DKK A;  1RR9 A;  4JI8 I;  4KHP I;  4FW9 A;  4GKK E;  4LF8 I;  3C4B A;  1ZM4 A;  4FN5 A;  2VF3 A;  1PIE A;  1Z0T A;  2LRS A;  5IWA I;  4B3R E;  4PU9 A;  2UUC I;  2F4V I;  4NXN I;  2EFG A;  1RQ0 A;  2V8P A;  4DU8 A;  3JAM C;  4DU7 A;  4LFC E;  5A2Q Q;  4ZVI A;  1J5E E;  3VYY A;  1KTV A;  4P7A A;  2KHX A;  2VQF I;  1ZXM A;  4LF4 I;  4WYQ B;  1H74 A;  4GKJ I;  3LPS A;  3K1J A;  1XMQ I;  4HXZ A;  1X47 A;  4HAC A;  1PVG A;  1I94 I;  3Q1Q A;  4HYM A;  1H7S A;  2Q2E B;  1X49 A;  4R1F A;  1WHN A;  1ZM2 A;  2E1R A;  3QT6 A;  4DPY A;  2RTX A;  4X64 I;  1K47 A;  3WU3 A;  2NUF A;  1DAR A;  1UEK A;  2XEX A;  1UIL A;  1ELO A;  4JI6 E;  4YY3 I;  1FKA E;  4UTG A;  1ZM3 A;  4DR4 E;  4OX9 E;  4OX9 I;  4DV4 E;  2HK2 A;  4LFB I;  4AQY E;  1MX0 A;  3QT7 A;  1KKH A;  4USK A;  4I3H A;  1Z0B A;  2HHH I;  2UUB E;  5A2Q C;  2E5L I;  4YHH E;  3HUL A;  3ZZ0 A;  4JI2 E;  2DIX A;  3D4J A;  3J80 Q;  1FJG I;  4MYT A;  4DV0 I;  2LJP A;  3K17 A;  4DR3 I;  1U2R A;  1T4N A;  1ZM9 A;  3GON A;  4PRV A;  4M1K A;  4LF6 I;  4DPW A;  4DUZ E;  4X62 E;  4DUZ I;  2ZIT A;  4DR1 E;  4DR1 I;  4LF9 I;  4B3S I;  2DB2 A;  1YYO A;  1FWL A;  3ZKB A;  2UUA E;  4B3T E;  4X66 E;  4WUC A;  5LMU I;  3J81 Q;  1HNZ E;  1OJ4 A;  1S16 A;  4DR5 I;  3F0N A;  4DR7 E;  4OOG C;  1GQE A;  4LF7 E;  2NPF A;  4JI7 E;  4UT4 A;  1STU A;  4DR6 E;  3B78 A;  2GS8 A;  1XMO E;  1S4E A;  1XNR E;  2ZBK B;  1B63 A;  2ZM6 E;  4JV5 E;  2HKJ A;  1N34 E;  1KIJ A;  4DPU A;  1DI2 A;  3J80 C;  2B7V A;  1N33 E;  1N33 I;  4JI8 E;  2LBS B;  4KHP E;  4JI0 E;  2L33 A;  1J26 A;  4JI0 I;  4LF8 E;  2UXD I;  1EI1 A;  5CFF E;  3T1Y I;  2HFU A;  1ZBT A;  1QU6 A;  4WUD A;  5IWA E;  2L2K B;  2UUC E;  2F4V E;  2V2Q A;  1IBM I;  4NXN E;  3LNU A;  2LUP B;  1HR0 I;  1N36 I;  3B8H A;  3J81 C;  4ED4 A;  2VQF E;  4LF4 E;  4DV5 I;  1FNM A;  4GKJ E;  3J7Y p;  3ZZT A;  1PKP A;  4JI3 I;  3WU4 A;  2BM0 A;  4XTJ A;  1XMQ E;  2UXB I;  3ADJ A;  1N32 I;  2BV3 A;  1O0W A;  4WUB A;  2JVA A;  2L2N A;  3OTO I;  1I94 E;  4DUY I;  1IBL I;  1Z0E A;  1HNX I;  2LTR A;  4X64 E;  2JY9 A;  4PRX A;  1RC7 A;  2RS7 A;  5LMN I;  2UXC I;  4YY3 E;  4JYA I;  1Z5C A;  2X36 A;  5GMD A;  4LFB E;  3P1X A;  2NA2 A;  4KQV A;  3ZZU A;  1HNW I;  2HHH E;  4NXM I;  2E5L E;  3PYE A;  1FI4 A;  1FJG E;  4DR3 E;  4DV0 E;  1MG7 A;  4DV6 I;  2X7I A;  4DPT A;  1XHK A;  1N0V C;  4LF6 E;  3ADG A;  1NHH A;  4LF9 E;  1XNQ I;  4B3S E;  2N3H A;  3C4T A;  2B3T B;  2CZ9 A;  2DMY A;  3ADI A;  2NUG A;  5LMU E;  3ZM7 A;  2LUQ A;  4DR5 E;  3M6A A;  2HKE A;  1WHQ A;  1VIS A;  4DXL A;  4DV1 I;  1Z5A A;  2N3G A;  2OI2 A;  4EMD A;  4URL A;  1ZXN A;  2V2V A;  4LF5 I;  1IBK I;  4WFT A;  1Z0V A;  5BR8 E;  5BR8 I;  4K0K I;  2CPN A;  4LFA I;  3H4L A;  3T1H E;  3ADL A;  3T1H I;  3CWV A;  1Z5B A;  2UXD E;  3T1Y E;  1Z0C A;  1T4L B;  1IBM E;  3WU5 A;  4MYU A;  2VQE I;  1HR0 E;  1H72 C;  4JI1 I;  4JG4 A;  2J7K A;  1N36 E;  4DV2 I;  4JI4 I;  2YT4 A;  4USM A;  1Z0G A;  4B3M I;  4M30 A;  4DV5 E;  1UHZ A;  4GKK I;  5IT9 Q;  2A2C A;  4HY1 A;  4JI3 E;  3PYF A;  3VYX A;  4M2Z A;  3J7A G;  1H73 A;  2UXB E;  2HFS A;  1N32 E;  4B3R I;  5FLX Q;  1NZ0 A;  2MDR A;  1FWK A;  1H7U A;  2R3V A;  4LFC I;  3OTO E;  4DUY E;  3B82 A;  1J5E I;  1IBL E;  3WU6 A;  4Z7C A;  2BM1 A;  1HNX E;  1BKN A;  3V5R A;  2LJH A;  4Z7Y A;  4DV3 E;  2AJ4 A;  4DV3 I;  5LL6 R;  3J7A M;  5LMN E;  2UXC E;  4JYA E;  3V2U C;  5L3J A;  1EA6 A;  4HAC B;  2V2Z A;  4DR2 E;  1HNW E;  2DEJ A;  4DR2 I;  4NXM E;  2L2M A;  2L3C A;  4X8W A;  1YZ9 A;  4X65 E;  2NUE A;  4X65 I;  4FWG A;  2R42 A;  5IT9 C;  4DV6 E;  4JI6 I; 
#chains in the Genus database with same CATH topology
 2YSO A;  5IV8 B;  4P52 A;  4DR4 I;  2WP8 A;  1E3P A;  4NHR A;  4MLQ A;  2ODR D;  4RH8 A;  4DV4 I;  2WP8 B;  4AQY I;  2V34 A;  2EOR A;  5FLX C;  1XNQ E;  2B7T A;  4L8N A;  5DRO A;  5GME A;  1WUU A;  1YHC A;  1PJS A;  4FW6 A;  2EOM A;  2UUB I;  2V87 A;  2HK3 A;  2KOU A;  4U3B A;  2A2D A;  2EPN A;  3KZY A;  4YHH I;  2EOQ A;  2EN6 A;  1SFE A;  3DJW A;  2GHF A;  2M7Q A;  4FWD A;  3C6M A;  1NHJ A;  4NZV A;  3PYG A;  4JI2 I;  5JEA F;  4DPX A;  1X48 A;  4X9J A;  3H1C A;  1KVK A;  3JU0 A;  2ENC A;  1B69 A;  2EZ6 A;  4OO1 E;  4DV1 E;  5EL9 A;  3QT5 A;  2WNR B;  1QZR A;  1YFH A;  4X62 I;  4MQY A;  1T4O A;  4JI5 E;  2EOJ A;  3M7N D;  4JI5 I;  2K7I A;  1EKZ A;  2J7J A;  2EMB A;  4IFD F;  1D6T A;  2UUA I;  4B3T I;  3HXL A;  4MDT A;  2LCE A;  4LF5 E;  1MU5 A;  1IBK E;  3JAM Q;  1X6F A;  2EQ1 A;  5A6J A;  4X66 I;  4F9C B;  2LTS A;  2PRT A;  3HPZ A;  1X5W A;  1A1H A;  4K0K E;  2DEI A;  2EM5 A;  4BA1 A;  1HNZ I;  4JI6 I;  4IFD C;  2IHR 1;  3VK6 A;  4BMJ A;  2DLQ A;  2WCC 3;  1Z59 A;  4BA1 B;  4DR7 I;  1MGT A;  2YTI A;  4IS1 C;  4LFA E;  3QT8 A;  2ENA A;  2UU9 E;  2UU9 I;  4LF7 I;  3M99 B;  5KL2 A;  3PS1 A;  4JI7 I;  3HTX A;  4WXC A;  2EPX A;  3THO B;  1JK1 A;  2L92 A;  2YRK A;  3HKM A;  1SR9 A;  5DNY A;  3EPL A;  4FWH A;  3LLH A;  4DR6 I;  2LE2 A;  4RPF A;  3LTO A;  2PO2 A;  1TF6 A;  1YYW A;  2C39 A;  2VE7 C;  3KRN A;  1PJT A;  2PO2 B;  1XMO I;  1B62 A;  2C39 B;  2V83 A;  3ZKD A;  1XNR I;  2ELZ A;  1Z0W A;  1YYK A;  3PYD A;  2ZM6 I;  4JV5 I;  2EM0 A;  2JEA A;  1N0U A;  2VQE E;  1A1J A;  1RRE A;  1N34 I;  4JI1 E;  2JEA B;  2WW4 A;  4DV2 E;  2RS6 A;  2L3J A;  4JI4 E;  1YPN A;  4DV7 E;  1NHI A;  2O1W A;  4DV7 I;  2EMC A;  3K6Q A;  2RSM A;  2F8B A;  4OO1 A;  2VRD A;  2CGE A;  5AE2 A;  1A6F A;  2YZT A;  4B3M E;  2LJU A;  4DKK A;  4OO1 B;  1RR9 A;  4JI8 I;  4KHP I;  4FW9 A;  2MKN A;  4GKK E;  2WBS A;  3C4B A;  1ZM4 A;  4LF8 I;  3EQ1 A;  2VF3 A;  2HC5 A;  1PIE A;  4FN5 A;  2YPN A;  1IQO A;  2BA0 D;  1Z0T A;  2LRS A;  2V8Q B;  2GLI A;  1NEI A;  4F9A B;  5IWA I;  4B3R E;  2YTD A;  2RQL A;  4ISA A;  4MU0 A;  4PU9 A;  2UUC I;  4GZN C;  2EPA A;  5C0X C;  2F4V I;  2LO3 A;  4NXN I;  2EFG A;  1RQ0 A;  2V8P A;  3P76 A;  4DU8 A;  3JAM C;  4DU7 A;  5TSE A;  4LFC E;  5C0X D;  5A2Q Q;  4ZVI A;  2EOY A;  2HJJ A;  1J5E E;  2EM7 A;  3EPJ A;  3VYY A;  1Z1B A;  1KTV A;  2V86 A;  3MHS C;  4P7A A;  2KHX A;  4MU1 A;  2VES A;  2VQF I;  2EML A;  3LML A;  1ZXM A;  2R1F A;  4DR3 I;  4RHB B;  4WYQ B;  4LF4 I;  1H74 A;  4ZYG A;  2WBU A;  2EPK X;  4ZYH A;  2AE8 A;  4Q28 A;  4GKJ I;  2YU5 A;  2V88 A;  3M85 G;  1UDS A;  3LPS A;  1YSA C;  3UK3 C;  4LTY A;  1MEY C;  4R2E A;  2V85 A;  4OKG A;  2YTQ A;  4BS9 A;  5AAS A;  3K1J A;  1EH6 A;  1XMQ I;  4R2D A;  4HXZ A;  2YTP A;  1X47 A;  2MDG A;  5DRP A;  2JP9 A;  4HAC A;  1T39 A;  1PVG A;  1I94 I;  3Q1Q A;  4F54 A;  4HYM A;  1H7S A;  2Q2E B;  1X49 A;  4KZS A;  4R1F A;  1WHN A;  1ZM2 A;  5AC5 A;  2E1R A;  4F6N A;  1HK7 A;  5KL5 A;  3QT6 A;  4DPY A;  1EH8 A;  2RTX A;  2NN6 F;  4X64 I;  2EN8 A;  2EPZ A;  1K47 A;  3WU3 A;  2NUF A;  1DAR A;  1UEK A;  2XEX A;  3BF2 A;  1VI7 A;  1UIL A;  1ELO A;  3M7N G;  2EN3 A;  4IZJ D;  2WZO A;  2DGC A;  1BB8 A;  4JI6 E;  4BBY A;  4YY3 I;  1FKA E;  3MHH C;  4UTG A;  1ZM3 A;  4DR4 E;  2LT7 A;  4OX9 E;  2NN6 C;  4OX9 I;  4DV4 E;  2HK2 A;  2EOH A;  2M4I A;  4LCG A;  4LFB I;  5K36 D;  4AQY E;  2EN2 A;  2PO1 A;  1MX0 A;  3NZK A;  1KKH A;  3QT7 A;  1Y6Z A;  4R2C A;  4HEI A;  4USK A;  4I3H A;  2PO1 B;  1Z0B A;  2HHH I;  2UUB E;  2EMY A;  3BID A;  1AAY A;  4M9V C;  5A2Q C;  2IES A;  2J65 A;  1RMD A;  2E5L I;  4YHH E;  2DRP A;  3HUL A;  1PJQ A;  2L8T A;  2CTD A;  3ZZ0 A;  2C37 A;  4F6M A;  4JI2 E;  2DIX A;  3AUZ A;  2EMX A;  5KL7 A;  1Y4S A;  4MLV A;  2C37 B;  2LJP A;  3D4J A;  3K17 A;  4MYT A;  3J80 Q;  4TUG A;  2DMI A;  4DV0 I;  1U2R A;  2YTO A;  1T4N A;  4R2Q A;  1ZM9 A;  3GON A;  4LCH A;  3RMP A;  4PRV A;  1X6H A;  1R6M A;  2WNR A;  4BHB A;  4M1K A;  2EOE A;  5T6J A;  1A1G A;  4WPY A;  1AH5 A;  3DF6 A;  2PO0 A;  1BBO A;  1WXR A;  1OYP A;  4LCF A;  4DPW A;  5FWK A;  4LF6 I;  4DUZ E;  2BA1 D;  4X62 E;  2EOF A;  2MC5 A;  2ZIT A;  4DR1 E;  2PO0 B;  5JEA C;  4DUZ I;  2GQ0 A;  1ZR9 A;  1UDO A;  4DR1 I;  2EMH A;  1GZ6 A;  4R8O A;  2JE6 A;  4LF9 I;  4B3S I;  2DB2 A;  4L5N C;  5JEA D;  2EPR A;  1YYO A;  1FWL A;  2JE6 B;  3DD6 A;  3ZKB A;  1YUJ A;  2UUA E;  4LOM A;  4B3T E;  2YTN A;  2C38 A;  5A6B D;  4J8Z A;  4X66 E;  2C38 B;  4WUC A;  4DMI A;  5LMU I;  3J81 Q;  2GO3 A;  2DLK A;  2RSI A;  1HNZ E;  1OJ4 A;  1S16 A;  4DR5 I;  2WBT A;  4R03 A;  2EMW A;  4AID A;  1P42 A;  3F0N A;  3PRY A;  4O4K A;  4DR7 E;  2EMK A;  1P47 A;  3P06 A;  3THN A;  4FK5 C;  2B9D A;  4OOG C;  1GQE A;  5KL4 A;  1A1L A;  3CDJ A;  4IFD D;  2PNL A;  1EH7 A;  4LF7 E;  2NPF A;  3TQM A;  4JI7 E;  4UT4 A;  4P7D A;  1STU A;  3C6K A;  5DNX A;  2EOI A;  5AC4 A;  4DR6 E;  1OYR A;  3H09 A;  4IJD A;  5K36 E;  4GEQ B;  2YRM A;  3PS2 A;  2EMA A;  1G2D C;  3B78 A;  2GS8 A;  5C0X A;  1XMO E;  2EE8 A;  2YSP A;  1BBG A;  1WJP A;  1S4E A;  1XNR E;  5C0X B;  2NAB A;  1B63 A;  2ZBK B;  2ZM6 E;  1PDA A;  4JV5 E;  2IOP A;  2HKJ A;  1DGC A;  1N34 E;  1KIJ A;  4DPU A;  1DI2 A;  1JK2 A;  3U1K A;  2EOS A;  2FV4 B;  2JT2 A;  2I9I A;  3J80 C;  2ELY A;  2EM3 A;  1IMU A;  2L6M A;  2B7V A;  2YTG A;  1N33 E;  1N33 I;  4J3D A;  4JI8 E;  2LBS B;  4KHP E;  3K85 A;  5F3W A;  4JI0 E;  2EM9 A;  2L33 A;  2RPC A;  4WX9 A;  4LF8 E;  1J26 A;  4JI0 I;  2UXD I;  1EI1 A;  5CFF E;  2MC6 A;  4O43 A;  3T1Y I;  1TN9 A;  4R2A A;  2EMG A;  1X3C A;  2HFU A;  2EQ3 A;  4FW5 A;  1ZBT A;  1QU6 A;  1OYS A;  4WUD A;  2EMF A;  5IWA E;  2L2K B;  5JEA E;  5KL3 A;  2EOO A;  2UUC E;  2F4V E;  2V2Q A;  1IBM I;  3OML A;  4BC7 A;  2E1M A;  3JTZ A;  4NXN E;  2LUP B;  3LNU A;  1R6L A;  1HR0 I;  5ADZ A;  1N36 I;  4BCA A;  3B8H A;  3J81 C;  3EPH A;  2BA0 G;  4ED4 A;  1GTK A;  2VQF E;  4AIM A;  2LMZ A;  4LF4 E;  4DV5 I;  1F2I G;  1FNM A;  3HJC A;  2Z5C B;  4IZJ A;  4GKJ E;  2DSY A;  3J7Y p;  2JXP A;  4IZJ B;  4IFD E;  3ZZT A;  2EM2 A;  2JYA A;  1PKP A;  1USV A;  4JI3 I;  3WU4 A;  2R76 A;  3L00 A;  1IQS A;  3IWD A;  4IZK A;  2BM0 A;  4KWY A;  4XTJ A;  5DRR A;  5K36 A;  1XMQ E;  2MKD A;  5K36 B;  2Q8U A;  3ADJ A;  1YH8 A;  4IZK B;  3Q6N A;  1N32 I;  2FGG A;  2BV3 A;  2UXB I;  1O0W A;  4WUB A;  5EKW A;  4OO1 F;  3P3G A;  3ZOQ B;  2JVA A;  2L2N A;  4I8O A;  1UDN A;  1L4S A;  1I94 E;  3OTO I;  4DUY I;  1DQ3 A;  2JOB A;  5A6A A;  4MU3 A;  2CSH A;  4R2R A;  1E3H A;  4WSG A;  1IBL I;  2BBG A;  1FJG I;  1TF3 A;  2ENH A;  1Z0E A;  1HNX I;  1Y60 A;  4LU9 A;  4BC9 A;  4Q35 B;  5AE3 A;  2LTR A;  4X64 E;  2JY9 A;  2VF1 A;  4PRX A;  1RC7 A;  2EL5 A;  3L7Z A;  2RS7 A;  5LLQ A;  5LMN I;  3L7Z B;  2UXC I;  1ZBQ A;  2JEB A;  4YY3 E;  4JYA I;  1Z5C A;  2X36 A;  5JEA A;  2JEB B;  4FW7 A;  5GMD A;  2D9H A;  3AV0 A;  3B4T A;  2A25 A;  4HTG A;  5JEA B;  4LFB E;  2EWL A;  2PNM A;  2H36 X;  2EPL X;  3P1X A;  2EM4 A;  2NA2 A;  4KQV A;  2NN6 D;  3ZZU A;  5KL6 A;  1A1K A;  1HNW I;  2HHH E;  4NXM I;  2IER A;  2O1V A;  5C0X E;  1KYQ A;  2E5L E;  2LVH A;  3PYE A;  2YTE A;  2EMI A;  1T38 A;  1WRJ A;  3VHT B;  1FI4 A;  1RHY A;  4IFD A;  1FJG E;  4DR3 E;  2E72 A;  2EJ4 A;  4DV0 E;  5IXM B;  1MG7 A;  4IFD B;  4LPF A;  4BHC A;  1ZAA C;  4DV6 I;  2ODR C;  2X7I A;  4DPT A;  1XHK A;  1N0V C;  2CG9 A;  3F6H A;  3IWB A;  4LF6 E;  5ELW A;  4WXD A;  2Z5B A;  3ADG A;  1NHH A;  4LF9 E;  2Z5B B;  4FW4 A;  2YWQ A;  1XNQ I;  4B3S E;  2N3H A;  2YRH A;  3C4T A;  1ZU1 A;  2M9A A;  2B3T B;  2EQ0 A;  1USU A;  2EPM X;  2CZ9 A;  2DMY A;  3ADI A;  4IS9 A;  2NUG A;  1XXE A;  5LMU E;  2YTJ A;  3ZM7 A;  2LUQ A;  2EL4 A;  2BA1 G;  4DR5 E;  2O1T A;  3M6A A;  2G7H A;  4N4R B;  3HPS A;  2HKE A;  2O3Z A;  2BR2 A;  2EOX A;  1WHQ A;  2EPU A;  1VIS A;  4R2S A;  4DXL A;  4DV1 I;  2JR1 A;  1Z5A A;  2BR2 B;  2N3G A;  2EPO A;  4F9B B;  2CVE A;  2OI2 A;  5A6K A;  1YUI A;  1A1F A;  4U3D A;  4EMD A;  2PNZ A;  3KWR A;  4TUI A;  4URL A;  1ZXN A;  2EM6 A;  2PNZ B;  2V2V A;  2NN6 E;  2EPP A;  4LF5 I;  1IBK I;  4M0V A;  4WFT A;  4ZYD A;  5AE1 A;  2HGH A;  2GPI A;  1Z0V A;  5BR8 E;  5BR8 I;  3GLL A;  3MSW A;  4K0K I;  2CPN A;  2O1U A;  2JPA A;  4LFA I;  1Y5Y A;  3H4L A;  3T1H E;  3ADL A;  3T1H I;  3CWV A;  3PS3 A;  4QNJ A;  2EOZ A;  1Z5B A;  4BA2 A;  2EMZ A;  3F6G A;  3ECR A;  3FIG A;  2UXD E;  2EM8 A;  4WSP A;  3T1Y E;  3BBG A;  4BA2 B;  3U1Y A;  1G2F C;  1Z0C A;  2FTX B;  5A69 A;  1UN6 B;  1T4L B;  1IBM E;  2N8X A;  3WU5 A;  4MYU A;  2VQE I;  1A1I A;  1HR0 E;  1H72 C;  4JI1 I;  4JG4 A;  2J7K A;  1N36 E;  4DV2 I;  5DNL A;  2LV2 A;  4JI4 I;  2YT4 A;  2YU8 A;  4USM A;  1Z0G A;  2Z5C A;  3GCM A;  4B3M I;  4M30 A;  4DV5 E;  2EN7 A;  3P3E A;  5C0X F;  1UHZ A;  2ADR A;  4GKK I;  5IT9 Q;  1LLM C;  2A2C A;  4HY1 A;  4JI3 E;  4N3O A;  3PYF A;  3VYX A;  4M2Z A;  3J7A G;  1H73 A;  1N3G A;  2UXB E;  2HFS A;  2KON A;  1N32 E;  2NN6 A;  4GQU A;  5FLX Q;  1NZ0 A;  4B3R I;  2M1S A;  2GO4 A;  2MDR A;  2JOX A;  2NN6 B;  1FWK A;  1H7U A;  4FW3 A;  2IOQ A;  3M85 D;  2R3V A;  2JWO A;  2BB8 A;  2YTF A;  3Q6M A;  4LFC I;  3OTO E;  4DUY E;  2EL6 A;  1UBD C;  3B82 A;  1J5E I;  4O5G A;  3KZZ A;  1IBL E;  4NBQ A;  3WU6 A;  4R2P A;  4Z7C A;  2K4V A;  3HQ1 A;  1HNX E;  1BKN A;  2BM1 A;  3V5R A;  2LJH A;  4OO1 C;  4Z7Y A;  4DV3 E;  1NCS A;  3IWC A;  2AJ4 A;  3UHM A;  4DV3 I;  5LL6 R;  3J7A M;  4OO1 D;  2Z5E A;  5LMN E;  3GME A;  2UXC E;  3CDI A;  4JYA E;  2EP3 A;  3V2U C;  1UDQ A;  2V89 A;  5L3J A;  4OZE A;  4AM3 A;  1Y4U A;  4QNK A;  4O24 A;  5A6B A;  1EA6 A;  4F2J C;  2CT1 A;  2I13 A;  4HAC B;  2V2Z A;  2F1D A;  4DR2 E;  1HNW E;  2DEJ A;  4DR2 I;  2EPC A;  3BGH A;  4NXM E;  4MU4 A;  5K36 F;  3P3C A;  2L2M A;  2L3C A;  4X8W A;  1YZ9 A;  1X6E A;  4P78 A;  4X65 E;  5DRQ A;  2NUE A;  4X65 I;  2EN1 A;  3EPK A;  4FWG A;  1QNT A;  4ZYE A;  3QG5 C;  2R42 A;  5IT9 C;  2EN4 A;  4DV6 E;  1KJK A;  5K36 C; 
#chains in the Genus database with same CATH homology
 4P52 A;  4DR4 I;  2ODR D;  4DV4 I;  4AQY I;  2V34 A;  5FLX C;  1XNQ E;  2B7T A;  4L8N A;  5GME A;  1WUU A;  2UUB I;  2V87 A;  2HK3 A;  2KOU A;  2A2D A;  4YHH I;  3DJW A;  2M7Q A;  4FWD A;  1NHJ A;  3PYG A;  4JI2 I;  4DPX A;  1X48 A;  1KVK A;  3JU0 A;  2EZ6 A;  4DV1 E;  3QT5 A;  1QZR A;  4X62 I;  1T4O A;  4JI5 E;  4JI5 I;  1EKZ A;  1D6T A;  2UUA I;  4B3T I;  3HXL A;  4LF5 E;  3JAM Q;  1MU5 A;  1IBK E;  4X66 I;  4F9C B;  2LTS A;  3HPZ A;  4K0K E;  2DEI A;  1HNZ I;  2IHR 1;  3VK6 A;  4BMJ A;  1Z59 A;  4DR7 I;  4LFA E;  3QT8 A;  2UU9 E;  2UU9 I;  4LF7 I;  4JI7 I;  3HTX A;  2L92 A;  1SR9 A;  5DNY A;  4FWH A;  3LLH A;  4DR6 I;  2LE2 A;  4RPF A;  3LTO A;  1YYW A;  2VE7 C;  1XMO I;  1B62 A;  2V83 A;  3ZKD A;  1XNR I;  1Z0W A;  1YYK A;  3PYD A;  2ZM6 I;  4JV5 I;  1N0U A;  2VQE E;  1RRE A;  1N34 I;  4JI1 E;  2WW4 A;  4DV2 E;  2RS6 A;  2L3J A;  4JI4 E;  4DV7 E;  1NHI A;  2O1W A;  4DV7 I;  2RSM A;  3K6Q A;  2F8B A;  2CGE A;  5AE2 A;  1A6F A;  2YZT A;  4B3M E;  4DKK A;  1RR9 A;  4JI8 I;  4KHP I;  4FW9 A;  4GKK E;  4LF8 I;  3C4B A;  1ZM4 A;  4FN5 A;  2VF3 A;  1PIE A;  1Z0T A;  2LRS A;  2V8Q B;  4F9A B;  5IWA I;  4B3R E;  4PU9 A;  2UUC I;  2F4V I;  4NXN I;  2EFG A;  1RQ0 A;  2V8P A;  4DU8 A;  3JAM C;  4DU7 A;  4LFC E;  5A2Q Q;  4ZVI A;  1J5E E;  3VYY A;  1KTV A;  2V86 A;  4P7A A;  2KHX A;  2VQF I;  1ZXM A;  3LML A;  4LF4 I;  4WYQ B;  1H74 A;  4GKJ I;  4Q28 A;  2V88 A;  3LPS A;  4LTY A;  2V85 A;  5AAS A;  4BS9 A;  3K1J A;  1XMQ I;  4HXZ A;  1X47 A;  4HAC A;  1PVG A;  1I94 I;  3Q1Q A;  4F54 A;  4HYM A;  1H7S A;  2Q2E B;  1X49 A;  4KZS A;  4R1F A;  1WHN A;  1ZM2 A;  2E1R A;  1HK7 A;  3QT6 A;  4DPY A;  2RTX A;  4X64 I;  1K47 A;  3WU3 A;  2NUF A;  1DAR A;  1UEK A;  2XEX A;  1UIL A;  1ELO A;  4IZJ D;  2WZO A;  4JI6 E;  4BBY A;  4YY3 I;  1FKA E;  4UTG A;  1ZM3 A;  4DR4 E;  4OX9 E;  4OX9 I;  4DV4 E;  2HK2 A;  2M4I A;  4LFB I;  4AQY E;  1MX0 A;  3QT7 A;  1KKH A;  1Y6Z A;  4USK A;  4I3H A;  1Z0B A;  2HHH I;  2UUB E;  5A2Q C;  2E5L I;  4YHH E;  3HUL A;  2L8T A;  3ZZ0 A;  4JI2 E;  2DIX A;  3AUZ A;  1Y4S A;  3D4J A;  3J80 Q;  4MYT A;  4DV0 I;  2LJP A;  3K17 A;  4DR3 I;  1FJG I;  4TUG A;  1U2R A;  1T4N A;  1ZM9 A;  3GON A;  3RMP A;  4PRV A;  4M1K A;  5T6J A;  4WPY A;  3DF6 A;  4DPW A;  4LF6 I;  1WXR A;  5FWK A;  4DUZ E;  4X62 E;  2MC5 A;  2ZIT A;  4DUZ I;  4DR1 E;  4DR1 I;  2GQ0 A;  4LF9 I;  1GZ6 A;  4R8O A;  4B3S I;  2DB2 A;  4L5N C;  1YYO A;  1FWL A;  3ZKB A;  2UUA E;  4B3T E;  4J8Z A;  4X66 E;  4WUC A;  4DMI A;  5LMU I;  3J81 Q;  1HNZ E;  1OJ4 A;  1S16 A;  4DR5 I;  4R03 A;  3F0N A;  3PRY A;  4DR7 E;  3P06 A;  2B9D A;  4OOG C;  1GQE A;  2PNL A;  4LF7 E;  2NPF A;  4JI7 E;  4UT4 A;  4P7D A;  1STU A;  4DR6 E;  3H09 A;  4GEQ B;  3B78 A;  2GS8 A;  1XMO E;  1S4E A;  1XNR E;  2ZBK B;  1B63 A;  2ZM6 E;  2IOP A;  4JV5 E;  2HKJ A;  1N34 E;  1KIJ A;  4DPU A;  1DI2 A;  2FV4 B;  3J80 C;  2L6M A;  2B7V A;  1N33 E;  1N33 I;  4JI8 E;  2LBS B;  4KHP E;  3K85 A;  5F3W A;  4JI0 E;  2L33 A;  1J26 A;  4JI0 I;  4LF8 E;  2UXD I;  1EI1 A;  5CFF E;  2MC6 A;  3T1Y I;  2HFU A;  1ZBT A;  1QU6 A;  4WUD A;  5IWA E;  2L2K B;  2UUC E;  2F4V E;  2V2Q A;  1IBM I;  3OML A;  4BC7 A;  2E1M A;  3JTZ A;  4NXN E;  2LUP B;  3LNU A;  1HR0 I;  5ADZ A;  1N36 I;  4BCA A;  3B8H A;  3J81 C;  4ED4 A;  2VQF E;  2LMZ A;  4LF4 E;  4DV5 I;  3HJC A;  1FNM A;  4IZJ A;  2Z5C B;  4GKJ E;  2DSY A;  3J7Y p;  4IZJ B;  3ZZT A;  1PKP A;  1USV A;  4JI3 I;  3WU4 A;  3IWD A;  4IZK A;  2BM0 A;  4XTJ A;  1XMQ E;  4IZK B;  3ADJ A;  2UXB I;  1N32 I;  3Q6N A;  2FGG A;  2BV3 A;  1O0W A;  4WUB A;  3ZOQ B;  2JVA A;  2L2N A;  4I8O A;  3OTO I;  1I94 E;  4DUY I;  1DQ3 A;  2JOB A;  1IBL I;  1Z0E A;  1HNX I;  4LU9 A;  4BC9 A;  5AE3 A;  2LTR A;  4X64 E;  2JY9 A;  2VF1 A;  4PRX A;  1RC7 A;  2RS7 A;  5LMN I;  2UXC I;  1ZBQ A;  4YY3 E;  4JYA I;  1Z5C A;  2X36 A;  5GMD A;  3AV0 A;  4LFB E;  2EWL A;  2PNM A;  2H36 X;  3P1X A;  2NA2 A;  4KQV A;  3ZZU A;  1HNW I;  2HHH E;  4NXM I;  2O1V A;  2E5L E;  3PYE A;  1FI4 A;  1FJG E;  4DR3 E;  4DV0 E;  1MG7 A;  4DV6 I;  2ODR C;  2X7I A;  4DPT A;  1XHK A;  1N0V C;  2CG9 A;  3F6H A;  3IWB A;  4LF6 E;  2Z5B A;  3ADG A;  1NHH A;  4LF9 E;  2Z5B B;  1XNQ I;  4B3S E;  2N3H A;  3C4T A;  2B3T B;  1USU A;  2CZ9 A;  2DMY A;  3ADI A;  2NUG A;  5LMU E;  3ZM7 A;  2LUQ A;  4DR5 E;  2O1T A;  3M6A A;  2G7H A;  3HPS A;  2HKE A;  1WHQ A;  1VIS A;  4DXL A;  4DV1 I;  2JR1 A;  1Z5A A;  2N3G A;  4F9B B;  2OI2 A;  4EMD A;  3KWR A;  4TUI A;  4URL A;  1ZXN A;  2V2V A;  4LF5 I;  1IBK I;  4M0V A;  4WFT A;  5AE1 A;  1Z0V A;  5BR8 E;  5BR8 I;  3MSW A;  4K0K I;  2CPN A;  2O1U A;  4LFA I;  3H4L A;  3T1H E;  3ADL A;  3T1H I;  3CWV A;  1Z5B A;  3F6G A;  3FIG A;  2UXD E;  4WSP A;  3T1Y E;  1Z0C A;  2FTX B;  1T4L B;  1IBM E;  3WU5 A;  4MYU A;  2VQE I;  1HR0 E;  1H72 C;  4JI1 I;  4JG4 A;  2J7K A;  1N36 E;  4DV2 I;  4JI4 I;  2YT4 A;  4USM A;  1Z0G A;  2Z5C A;  4B3M I;  4M30 A;  4DV5 E;  1UHZ A;  4GKK I;  5IT9 Q;  2A2C A;  4HY1 A;  4JI3 E;  4N3O A;  3PYF A;  3VYX A;  4M2Z A;  3J7A G;  1H73 A;  2UXB E;  2HFS A;  2KON A;  1N32 E;  4B3R I;  5FLX Q;  1NZ0 A;  2M1S A;  2MDR A;  2JOX A;  1FWK A;  1H7U A;  2IOQ A;  2R3V A;  2JWO A;  3Q6M A;  4LFC I;  3OTO E;  4DUY E;  3B82 A;  1J5E I;  1IBL E;  3WU6 A;  4Z7C A;  2K4V A;  3HQ1 A;  1HNX E;  1BKN A;  2BM1 A;  3V5R A;  2LJH A;  4Z7Y A;  4DV3 E;  3IWC A;  2AJ4 A;  4DV3 I;  5LL6 R;  3J7A M;  2Z5E A;  5LMN E;  2UXC E;  4JYA E;  3V2U C;  2V89 A;  5L3J A;  1Y4U A;  1EA6 A;  4HAC B;  2V2Z A;  4DR2 E;  1HNW E;  2DEJ A;  4DR2 I;  4NXM E;  2L2M A;  2L3C A;  4X8W A;  1YZ9 A;  4P78 A;  4X65 E;  2NUE A;  4X65 I;  4FWG A;  2R42 A;  5IT9 C;  4DV6 E;  4JI6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...