4KHPE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4khpE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4khpE02
4DV7I 1DI2A 1X47A 1VISA 4FWDA 4OOGC 4M30A 4DKKA 2F4VE 4WFTA 2BV3A 1HNWI 4DR7I 2UXDI 4DR4E 3ZZUA 1K47A 4JI3I 4LFAI 4MYTA 5LMNI 4LF9I 1FJGI 4HXZA 1O0WA 4LF4E 2ZBKB 5A2QC 1PKPA 1ZM9A 3CWVA 3ADJA 1ELOA 4DU7A 3C4BA 2CPNA 2R42A 1KIJA 4B3RI 1FWLA 4KHPI 1IBMI 1ZM2A 1J5EI 4JI5E 2JVAA 1N36E 1RR9A 4UTGA 4DV5E 2DEIA 4GKKE 4JI8I 2HHHE 1YYKA 1EI1A 4DV7E 4I3HA 4JI7E 3T1YI 4URLA 5IWAE 1N34I 2Q2EB 1HR0I 4X64E 4NXNE 4DV6E 5LMNE 3LNUA 2L2KB 2UUCI 2DEJA 5BR8I 4M2ZA 2A2CA 4LF6I 2UXCE 4FN5A 3ZZ0A 3ADLA 3OTOI 1H72C 1B62A 1FWKA 1NHHA 3T1HE 4PRXA 1J5EE 3QT6A 4YHHE 1N0VC 1WHNA 5LL6R 4DU8A 2V8PA 3J81Q 1UEKA 3J7AM 4DR3I 4MYUA 1PIEA 4ZVIA 4DV1I 2VQEI 3VYXA 1ZM4A 4B3MI 2BM0A 3D4JA 3M6AA 2RS7A 2LTSA 4JI4E 2UUAI 4NXME 2L3CA 1RQ0A 1YZ9A 2L33A 1XMQE 3B78A 4DPUA 4WUCA 2LRSA 4LFCI 3ADGA 1DARA 2B7TA 2E5LE 4AQYI 4JI0I 1N32I 1STUA 1WHQA 2XEXA 1Z59A 3WU4A 4DV0I 2RS6A 1HNZI 1FNMA 1X49A 4GKJI 2LBSB 5LMUI 4KQVA 5A2QQ 1RC7A 2UXBE 4DV3E 4DV2E 1QZRA 5FLXC 4YY3E 1I94I 2HKJA 2HK2A 4R1FA 4JI2E 4OX9E 3B82A 5CFFE 1S4EA 1FKAE 4K0KE 1H74A 1XHKA 1IBLE 4DR2E 1EKZA 2UU9I 3LTOA 4DUZI 3V5RA 5IT9Q 4M1KA 4AQYE 3QT5A 1T4OA 2UUBE 4DR1I 4DV0E 2V34A 1MX0A 4HY1A 5IT9C 1HNWE 3J7Yp 2B7VA 4DR7E 2UXDE 1XMOI 2NUGA 4GKJE 2L2MA 3PYDA 4FWHA 4LF5I 4JI3E 4DR5I 2EZ6A 2IHR1 4LFAE 4Z7YA 3J7AG 4LF9E 1U2RA 3LPSA 1FJGE 1Z0TA 3QT8A 4JYAI 1RREA 3PYGA 4B3RE 5GMDA 2LJHA 4DPTA 2VQFI 1Z0GA 4P7AA 4KHPE 2ZM6I 1IBME 2HKEA 4X65I 1KKHA 4DXLA 1GQEA 4JI6I 1UHZA 4DR1E 2J7KA 4XTJA 4JI8E 2NUEA 2V2ZA 1XNRI 4JV5I 3T1YE 3B8HA 1N34E 2AJ4A 2OI2A 1HR0E 1NHIA 4LF5E 4DR6I 2LUPB 3V2UC 2RTXA 1XNQI 4B3TI 4X62I 2UUCE 4USKA 5BR8E 1YYWA 2VF3A 4JI1I 4X66I 4LF6E 3F0NA 4UT4A 4WUBA 3OTOE 3ZM7A 2F4VI 1B63A 4DR4I 1PVGA 4JI6E 1NZ0A 2ZITA 4EMDA 1Z5BA 4DPYA 4ED4A 3VYYA 3HTXA 5FLXQ 4LF4I 4PRVA 3HULA 4DR3E 4DV1E 4LF8I 2VQEE 2LTRA 4B3ME 2YT4A 5GMEA 3JAMQ 1XNQE 3LLHA 2DIXA 3C4TA 1IBKI 4JI5I 2LJPA 2HFSA 1N36I 2UUAE 4RPFA 2L3JA 4DV5I 4GKKI 4X66E 4HYMA 1X48A 2HHHI 3J80Q 4JI7I 3K17A 4WYQB 4LFCE 2B3TB 3JAMC 5IWAI 4X64I 1H7SA 2HK3A 4NXNI 1J26A 3H4LA 4PU9A 4DV6I 3WU5A 5L3JA 1Z5AA 1WUUA 4JI0E 1A6FA 3J80C 1N32E 2NUFA 1EA6A 2BM1A 4HACA 2UXCI 1NHJA 2WW4A 1Z0BA 1YYOA 4FW9A 1HNZE 2X7IA 3Q1QA 4LF8E 1ZXMA 5LMUE 4HACB 4FWGA 1D6TA 4DPWA 2NA2A 1BKNA 4JG4A 1IBKE 4LF7I 3T1HI 1HNXI 4YHHI 4DV4I 1I94E 1ZM3A 3ADIA 2RSMA 4DPXA 1Z5CA 4USMA 1MG7A 2UU9E 1Z0EA 4DUZE 3K1JA 3ZZTA 4B3SI 4DUYI 4JI4I 2LUQA 4X8WA 3GONA 2R3VA 4NXMI 1XMQI 4LFBI 2DMYA 2N3HA 1ZXNA 3PYFA 1XMOE 2CZ9A 1ZBTA 2L2NA 1N33I 4DR5E 1FI4A 2A2DA 2E5LI 4LF7E 1MU5A 1HNXE 4DV4E 1Z0WA 4JYAE 4P52A 3ZKBA 2N3GA 1QU6A 2MDRA 3WU6A 2VQFE 2GS8A 1KTVA 2HFUA 2ZM6E 3QT7A 2EFGA 2UXBI 4X65E 1N0UA 4DV2I 4DV3I 3ZKDA 2JY9A 4B3SE 3J81C 4DUYE 4YY3I 1T4NA 1UILA 4LFBE 2V2QA 1XNRE 4JV5E 3WU3A 1Z0CA 2NPFA 1OJ4A 4JI2I 4OX9I 4K0KI 3P1XA 1H7UA 1T4LB 1Z0VA 1IBLI 1KVKA 2KHXA 1H73A 4WUDA 4DR2I 2X36A 1N33E 2E1RA 1S16A 4DR6E 4Z7CA 4B3TE 4X62E 2DB2A 2UUBI 3PYEA 2V2VA 4JI1E
chains in the Genus database with same CATH superfamily
2EMFA 4DV7I 2YPNA 1DI2A 2YRMA 1X47A 1X6FA 1VISA 1AAYA 4FWDA 2LCEA 4OOGC 4M30A 3L7ZA 4DKKA 2F4VE 4WFTA 2BV3A 1HNWI 4DR7I 3BBGA 2UXDI 2EPCA 3K85A 4R2SA 4DR4E 3ZZUA 1K47A 2EP3A 4ZYHA 5C0XE 4JI3I 2EN6A 2IESA 1UDOA 4R2DA 4LPFA 4MYTA 4LFAI 2YRKA 4BC9A 5LMNI 4LF9I 2ELYA 2PO0A 3IWDA 1FJGI 5IV8B 4HXZA 1O0WA 3RMPA 3L7ZB 1AH5A 3C6KA 2LV2A 3JU0A 5DNLA 4OZEA 2M9AA 4LF4E 1X5WA 2EORA 2ZBKB 5A2QC 1PKPA 4WSGA 1Y60A 2EMIA 5A6KA 1ZM9A 3CWVA 1BB8A 3ADJA 1ELOA 1Y4SA 3C4BA 2CPNA 2R42A 2EPXA 1KIJA 4MQYA 4DU7A 4R2PA 5C0XB 4B3RI 2EM9A 1IQSA 1FWLA 2EMAA 4ISAA 1IBMI 4KHPI 5K36A 1ZM2A 2EPKX 1J5EI 3UHMA 4JI5E 2JVAA 1N36E 1OYSA 4R2EA 2MC5A 1RR9A 4UTGA 4DV5E 2DEIA 3P76A 5IXMB 4GKKE 3IWCA 2EM7A 2BA0D 4JI8I 3C6MA 2V83A 2HHHE 1YYKA 1X3CA 4DV7E 1EI1A 4JI7E 1RHYA 4LCHA 4I3HA 3T1YI 1HK7A 2O1UA 4URLA 2NN6A 4MU4A 5K36B 2EM8A 5KL6A 5IWAE 1USVA 1N34I 4RHBB 2EMHA 2ENAA 1ZAAC 2Q2EB 1HR0I 4X64E 4GEQB 4OO1E 4IZKA 4NXNE 2EN4A 2EOSA 2CG9A 4TUIA 4DV6E 1IQOA 4IFDA 5LMNE 3LNUA 3CDJA 2L2KB 2MKNA 2UUCI 3U1KA 2H36X 2DEJA 3K6QA 3BIDA 5BR8I 4M2ZA 5A6BD 2A2CA 1G2FC 2NN6B 5JEAD 4LF6I 2UXCE 4FN5A 2YU5A 2E72A 3ZZ0A 3ADLA 4FW5A 3OTOI 1H72C 1B62A 2EOIA 1PJTA 2EOFA 1FWKA 2LVHA 1TF3A 1NHHA 5AE1A 4BA1B 5AE2A 1VI7A 3T1HE 3EPHA 4PRXA 1J5EE 3QT6A 4YHHE 2EM5A 4LOMA 5AE3A 1YHCA 2RSIA 2VE7C 1N0VC 1WHNA 2EM0A 2GPIA 5LL6R 4DU8A 1WJPA 2V8PA 1UDQA 1UEKA 5L3JA 3J81Q 3J7AM 2I9IA 4R2AA 2EMWA 2GQ0A 3EQ1A 2EMBA 2I13A 3DF6A 1JK2A 4DR3I 4MYUA 1PIEA 4ZVIA 4DV1I 2VQEI 3VYXA 2D9HA 2FGGA 1ZM4A 4B3MI 4TUGA 2GO4A 2BM0A 3F6HA 4O43A 3D4JA 2GLIA 4BHBA 5JEAF 3PS2A 4OO1C 2EOHA 3HXLA 3M6AA 2RS7A 2FV4B 2LTSA 4JI4E 2EOXA 2J7JA 4BS9A 2L3CA 1RQ0A 1YUIA 4NXME 1YZ9A 2UUAI 2L33A 1XMQE 3B78A 1L4SA 4QNKA 4DPUA 2ODRC 3IWBA 2EL4A 4WUCA 1E3HA 2LRSA 1LLMC 4LFCI 3M99B 3ADGA 3KZYA 1PJSA 1DARA 2EM3A 2WBUA 4F6MA 1PJQA 1ZR9A 2B7TA 2IOPA 2JEBA 2E5LE 4NZVA 4AQYI 2PRTA 2JE6A 4JI0I 1N32I 1STUA 2F8BA 1WHQA 3HPSA 2XEXA 1IMUA 2YTQA 1Z59A 2LJUA 2YU8A 3WU4A 1SFEA 2WCC3 1YFHA 2V8QB 3MSWA 4DV0I 2RS6A 1HNZI 1FNMA 4GZNC 4BCAA 4FW4A 1MEYC 5A6AA 5ADZA 1TF6A 1X6HA 4P78A 1X49A 5A6JA 2EPZA 4WPYA 2CT1A 5C0XD 4NBQA 2JPAA 4GKJI 2LBSB 5LMUI 2BR2A 5A69A 4KQVA 5A2QQ 4BA2B 1RC7A 2EN2A 2UXBE 4DV3E 4DV2E 4HEIA 1OYPA 2V89A 1QZRA 1BBGA 3Q6MA 4ZYDA 1WXRA 2EPOA 4YY3E 5FLXC 1P47A 2G7HA 2BA1G 1I94I 4ZYEA 2HKJA 2EPRA 4WSPA 4F9CB 2F1DA 2HK2A 2AE8A 4R1FA 3GLLA 1JK1A 2Z5CA 2YRHA 4JI2E 4OX9E 3B82A 1YPNA 5CFFE 1S4EA 2M7QA 1A1FA 1FKAE 2L8TA 2YTGA 3OMLA 4K0KE 1H74A 1XHKA 2EN3A 5AC4A 1IBLE 4DR2E 1UDSA 3ZOQB 5K36E 2K7IA 2YWQA 4AM3A 2PO0B 4R03A 1ZBQA 1EKZA 2UU9I 3LTOA 5FWKA 4DUZI 1DQ3A 3V5RA 3THOB 2EOEA 4LCGA 3HJCA 4M1KA 5IT9Q 1B69A 4AQYE 3QT5A 2Z5CB 1T4OA 2EJ4A 2UUBE 2Z5EA 4DR1I 2EMLA 2MDGA 4OKGA 1A1KA 2NN6E 4DV0E 5C0XF 2V34A 1MX0A 2CSHA 2ELZA 4HY1A 5IT9C 2EMZA 1HNWE 2ENHA 3J7Yp 2B7VA 4BHCA 4DR7E 2UXDE 2O3ZA 2NUGA 4GKJE 2DRPA 1XMOI 5ELWA 4OO1D 2L2MA 4R2RA 3PYDA 3PS3A 4FWHA 4LF5I 4JI3E 4DR5I 2EZ6A 2EOQA 2IHR1 2R1FA 4IFDE 1NCSA 4R2QA 4LFAE 4Z7YA 2IOQA 3J7AG 2ODRD 5C0XC 4LF9E 1U2RA 2JXPA 3LPSA 2LMZA 2BBGA 1FJGE 5EL9A 4MLVA 2LE2A 3P3GA 1Z0TA 2BA1D 2EOZA 3QT8A 4JYAI 3L00A 1RREA 4M9VC 2MC6A 4AIMA 3PYGA 2DGCA 4KWYA 4IZKB 4DV6I 1GZ6A 2EOOA 2M1SA 1Y4UA 4IFDB 2DLQA 4B3RE 2EWLA 4M0VA 5GMDA 2LJHA 4DPTA 2VQFI 1Z0GA 4P7AA 4KHPE 2NABA 1IBME 2ZM6I 5K36C 2HKEA 3GMEA 2EN1A 4N4RB 4X65I 2EL6A 4OO1A 1A1GA 2B9DA 1KKHA 4KZSA 4DXLA 1GQEA 1UBDC 4JI6I 1UHZA 4DR1E 2K4VA 2J7KA 4XTJA 5EKWA 4JI8E 1A1JA 4O5GA 2NUEA 2V2ZA 4N3OA 1XNRI 3CDIA 4JV5I 2C37A 4OO1F 3T1YE 1T39A 4IS9A 2EPLX 1ZU1A 5A6BA 3B8HA 3H09A 2NN6C 4AIDA 5JEAA 1N34E 2AJ4A 2OI2A 2EPPA 5TSEA 1HR0E 1NHIA 4LCFA 2JOXA 4LF5E 4DR6I 2LUPB 3V2UC 2RTXA 1XNQI 2JOBA 4FW3A 4B3TI 5DROA 3KZZA 4X62I 2UUCE 1KJKA 1A1HA 2C37B 4J3DA 3U1YA 2PO1A 4USKA 5BR8E 1YYWA 2VF3A 4JI1I 4X66I 4FW6A 4IZJD 5JEAB 4LF6E 3F0NA 4F6NA 4U3DA 2DMIA 4UT4A 4NHRA 1R6LA 2YTPA 4WUBA 5KL4A 3OTOE 3ZM7A 2F4VI 1XXEA 1B63A 2YSPA 2PNZA 1A1LA 1YUJA 3MHHC 5AC5A 2PO1B 4DR4I 1DGCA 2V86A 1GTKA 3ECRA 2M4IA 2HGHA 1PVGA 2EMCA 4BMJA 1QNTA 5AASA 4IS1C 4JI6E 2PO2A 2PNLA 1NZ0A 4O24A 4MDTA 1Z1BA 2L92A 3MHSC 4WX9A 2ZITA 3PS1A 2PNMA 3P3CA 2YTJA 1Z5BA 4EMDA 4DPYA 4ED4A 3VYYA 5DRPA 2LT7A 3HTXA 3GCMA 2PNZB 5FLXQ 4LF4I 2RQLA 2FTXB 1SR9A 2WNRA 2A25A 3KRNA 3VHTB 4IZJA 4PRVA 3P06A 3HULA 4DR3E 2JEBB 4MLQA 4DV1E 4LF8I 2VQEE 3HQ1A 2LTRA 2JT2A 2JE6B 4B3ME 2WP8A 2YT4A 2EM2A 5GMEA 3JAMQ 4BBYA 1XNQE 3LLHA 2DIXA 1G2DC 3C4TA 1IBKI 3DJWA 2RPCA 1MGTA 2LO3A 4JI5I 5DNYA 2KOUA 2LJPA 2HFSA 1N36I 2UUAE 4RPFA 3BF2A 2L3JA 4DV5I 3KWRA 4X66E 2YTIA 2VESA 2IERA 4GKKI 4HYMA 1X48A 2BB8A 2HHHI 3J80Q 4JI7I 1OYRA 2VRDA 2WBSA 3K17A 4WYQB 5KL7A 2WP8B 4LFCE 2B3TB 3JAMC 5KL3A 3P3EA 5K36D 5IWAI 2EOJA 2Z5BA 3B4TA 2CTDA 2VF1A 4X64I 1H7SA 4I8OA 2HK3A 1Y6ZA 4NXNI 2JWOA 4QNJA 1J26A 2O1VA 4J8ZA 4Q35B 3H4LA 4PU9A 5KL5A 3WU5A 2GHFA 4LU9A 1WUUA 1Z5AA 4JI0E 2HC5A 3BGHA 2EQ0A 3J80C 1N32E 1A6FA 2NUFA 1EA6A 4WXCA 5LLQA 2BM1A 4HACA 2E1MA 2NN6D 2YTEA 2UXCI 3LMLA 1NHJA 2EPMX 1Z0BA 1YYOA 2WW4A 2EL5A 1F2IG 3VK6A 2O1WA 2Z5BB 3H1CA 1A1IA 2JP9A 4FW9A 1HNZE 2X7IA 4WXDA 3M85G 2CGEA 1P42A 3PRYA 2V88A 3EPJA 2EOMA 3Q1QA 2EM6A 2EPNA 4LF8E 2YTFA 3EPKA 1ZXMA 1UN6B 4F9BB 4L5NC 2BR2B 4IFDD 5LMUE 2J65A 4HACB 4FWGA 1D6TA 4DPWA 2NA2A 1BKNA 4JG4A 1IBKE 2EMGA 3T1HI 4LF7I 2DSYA 1HNXI 5KL2A 3AV0A 4ZYGA 4YHHI 4DV4I 2GO3A 1I94E 2YZTA 2C38A 2WBTA 2ADRA 2O1TA 2JEAA 1ZM3A 5K36F 3ADIA 4U3BA 3Q6NA 4F2JC 5F3WA 1N3GA 2RSMA 2EPUA 3F6GA 1Z5CA 4DPXA 3HKMA 2C39A 4USMA 1MG7A 2ENCA 1UDNA 2UU9E 1Z0EA 4DUZE 2C38B 2JEAB 2NN6F 3K1JA 3ZZTA 4B3SI 4DUYI 2EM4A 4R2CA 4BC7A 4BA1A 2LUQA 4JI4I 4X8WA 3GONA 2R3VA 2MKDA 4NXMI 2L6MA 2HJJA 1XMQI 5C0XA 2EOYA 4LFBI 2R76A 2EN7A 1T38A 5JEAE 2DMYA 4O4KA 2C39B 4LTYA 3M7NG 4IFDF 2N3HA 2JR1A 5DRQA 1WRJA 1ZXNA 2JYAA 3PYFA 2KONA 4GQUA 3M85D 1XMOE 4OO1B 2WZOA 2CZ9A 1ZBTA 2L2NA 4DMIA 1N33I 1R6MA 4DR5E 1FI4A 4F9AB 2A2DA 2E5LI 2EPAA 4LF7E 1EH8A 3TQMA 1X6EA 1HNXE 1MU5A 4IFDC 4FK5C 1PDAA 4DV4E 4MU1A 4X9JA 1KYQA 3JTZA 2EQ1A 1TN9A 2EMYA 2EQ3A 1Z0WA 1EH7A 4JYAE 3QG5C 2YTDA 4P52A 5DRRA 3UK3C 4MU0A 3ZKBA 1BBOA 2N3GA 1QU6A 4IJDA 1Y5YA 2V87A 4F54A 2YTOA 2MDRA 3WU6A 2VQFE 1E3PA 2GS8A 4HTGA 1KTVA 2ZM6E 2HFUA 3QT7A 2EE8A 2EFGA 2UXBI 4X65E 1N0UA 4DV2I 4DV3I 3ZKDA 2EMXA 2JY9A 4B3SE 2Q8UA 3J81C 4DUYE 1YH8A 4YY3I 5DNXA 1T4NA 1UILA 2V85A 3AUZA 2CVEA 2EMKA 1YSAC 4LFBE 4MU3A 2V2QA 1XNRE 4JV5E 3WU3A 1Z0CA 2NPFA 1OJ4A 4JI2I 4OX9I 3DD6A 4K0KI 5T6JA 4R8OA 3THNA 5JEAC 3FIGA 2N8XA 3P1XA 1H7UA 1T4LB 1Z0VA 1IBLI 3M7ND 1KVKA 2KHXA 2YSOA 1H73A 4WUDA 4DR2I 2X36A 1USUA 1EH6A 2PO2B 1N33E 2EN8A 4P7DA 3HPZA 3EPLA 4DR6E 1RMDA 1S16A 2E1RA 4FW7A 2DLKA 4Z7CA 4B3TE 3NZKA 2BA0G 4X62E 2YTNA 4L8NA 2DB2A 2UUBI 4BA2A 2WNRB 2V2VA 4JI1E 3PYEA 4IZJB 4RH8A 1NEIA 4Q28A
chains in the Genus database with same CATH topology
4DV7I 1DI2A 1X47A 1VISA 4FWDA 4OOGC 4M30A 4DKKA 2F4VE 4WFTA 2BV3A 1HNWI 4DR7I 2UXDI 3K85A 4DR4E 3ZZUA 1K47A 4JI3I 4LFAI 4MYTA 4BC9A 5LMNI 4LF9I 3IWDA 1FJGI 4HXZA 1O0WA 3RMPA 3JU0A 4LF4E 2ZBKB 5A2QC 1PKPA 1ZM9A 3CWVA 3ADJA 1ELOA 1Y4SA 3C4BA 2CPNA 2R42A 4DU7A 1KIJA 4B3RI 1FWLA 4KHPI 1IBMI 1ZM2A 1J5EI 4JI5E 2JVAA 1N36E 2MC5A 1RR9A 4UTGA 4DV5E 2DEIA 4GKKE 3IWCA 4JI8I 2V83A 2HHHE 1YYKA 1EI1A 4DV7E 4I3HA 4JI7E 3T1YI 1HK7A 2O1UA 4URLA 5IWAE 1USVA 1N34I 2Q2EB 1HR0I 4X64E 4GEQB 4IZKA 4NXNE 2CG9A 4TUIA 4DV6E 5LMNE 3LNUA 2L2KB 2UUCI 2H36X 2DEJA 3K6QA 5BR8I 4M2ZA 2A2CA 4LF6I 2UXCE 4FN5A 3ZZ0A 3ADLA 3OTOI 1H72C 1B62A 1FWKA 1NHHA 5AE1A 5AE2A 3T1HE 4PRXA 1J5EE 3QT6A 4YHHE 5AE3A 2VE7C 1N0VC 1WHNA 5LL6R 4DU8A 2V8PA 3J81Q 1UEKA 3J7AM 2GQ0A 4DR3I 3DF6A 4MYUA 1PIEA 4ZVIA 4DV1I 2VQEI 3VYXA 2FGGA 1ZM4A 4B3MI 4TUGA 2BM0A 3F6HA 3D4JA 3HXLA 3M6AA 2RS7A 2FV4B 2LTSA 4JI4E 2UUAI 4NXME 4BS9A 2L3CA 1RQ0A 1YZ9A 2L33A 1XMQE 3B78A 4DPUA 2ODRC 3IWBA 4WUCA 2LRSA 4LFCI 3ADGA 1DARA 2B7TA 2IOPA 2E5LE 4AQYI 4JI0I 1N32I 1STUA 2F8BA 1WHQA 3HPSA 2XEXA 1Z59A 3WU4A 2V8QB 3MSWA 4DV0I 2RS6A 1HNZI 1FNMA 4BCAA 5ADZA 4P78A 1X49A 4WPYA 4GKJI 2LBSB 5LMUI 4KQVA 5A2QQ 1RC7A 2UXBE 4DV3E 4DV2E 1QZRA 2V89A 3Q6MA 1WXRA 4YY3E 5FLXC 1I94I 2G7HA 2HKJA 4WSPA 4F9CB 2HK2A 4R1FA 2Z5CA 4JI2E 4OX9E 3B82A 5CFFE 1S4EA 2M7QA 1FKAE 4K0KE 2L8TA 3OMLA 1H74A 1XHKA 1IBLE 4DR2E 3ZOQB 4R03A 1ZBQA 1EKZA 2UU9I 3LTOA 5FWKA 4DUZI 1DQ3A 3V5RA 5IT9Q 4M1KA 3HJCA 4AQYE 3QT5A 2Z5CB 1T4OA 2UUBE 2Z5EA 4DR1I 4DV0E 2V34A 1MX0A 4HY1A 5IT9C 1HNWE 4DR7E 2B7VA 3J7Yp 2UXDE 1XMOI 2NUGA 4GKJE 2L2MA 3PYDA 4FWHA 4LF5I 4JI3E 4DR5I 2EZ6A 2IHR1 4LFAE 4Z7YA 2IOQA 3J7AG 2ODRD 4LF9E 1U2RA 3LPSA 2LMZA 1FJGE 2LE2A 1Z0TA 3QT8A 4JYAI 1RREA 2MC6A 3PYGA 4IZKB 1GZ6A 2M1SA 1Y4UA 4B3RE 2EWLA 4M0VA 5GMDA 2LJHA 4DPTA 2VQFI 1Z0GA 4P7AA 4KHPE 2ZM6I 1IBME 2HKEA 4X65I 2B9DA 1KKHA 4KZSA 4DXLA 1GQEA 4JI6I 1UHZA 4DR1E 2K4VA 2J7KA 4XTJA 4JI8E 2NUEA 2V2ZA 4N3OA 1XNRI 4JV5I 3T1YE 3B8HA 3H09A 1N34E 2AJ4A 2OI2A 1HR0E 1NHIA 2JOXA 4LF5E 4DR6I 2LUPB 3V2UC 2RTXA 1XNQI 2JOBA 4B3TI 4X62I 2UUCE 4USKA 5BR8E 1YYWA 2VF3A 4JI1I 4X66I 4IZJD 4LF6E 3F0NA 4UT4A 4WUBA 3OTOE 3ZM7A 2F4VI 1B63A 4DR4I 2V86A 2M4IA 1PVGA 4BMJA 5AASA 4JI6E 2PNLA 1NZ0A 2L92A 2ZITA 2PNMA 4EMDA 1Z5BA 4DPYA 4ED4A 3VYYA 3HTXA 5FLXQ 4LF4I 4PRVA 2FTXB 1SR9A 4IZJA 3P06A 3HULA 4DR3E 4DV1E 4LF8I 2VQEE 3HQ1A 2LTRA 4B3ME 2YT4A 5GMEA 3JAMQ 4BBYA 1XNQE 3LLHA 2DIXA 3C4TA 1IBKI 3DJWA 4JI5I 5DNYA 2KOUA 2LJPA 2HFSA 1N36I 2UUAE 4RPFA 2L3JA 4DV5I 3KWRA 4X66E 4GKKI 4HYMA 1X48A 2HHHI 3J80Q 4JI7I 3K17A 4WYQB 4LFCE 2B3TB 3JAMC 5IWAI 2Z5BA 2VF1A 4X64I 1H7SA 4I8OA 2HK3A 1Y6ZA 4NXNI 2JWOA 1J26A 2O1VA 4J8ZA 3H4LA 4PU9A 4DV6I 3WU5A 4LU9A 1Z5AA 1WUUA 5L3JA 4JI0E 1A6FA 3J80C 1N32E 2NUFA 1EA6A 2BM1A 4HACA 2E1MA 2UXCI 3LMLA 1NHJA 2WW4A 1Z0BA 1YYOA 2Z5BB 4FW9A 3VK6A 2O1WA 1HNZE 2X7IA 2CGEA 3PRYA 2V88A 3Q1QA 4LF8E 1ZXMA 4F9BB 4L5NC 5LMUE 4HACB 4FWGA 1D6TA 4DPWA 2NA2A 1BKNA 4JG4A 1IBKE 4LF7I 3T1HI 2DSYA 1HNXI 3AV0A 4YHHI 4DV4I 1I94E 2YZTA 2O1TA 1ZM3A 3ADIA 3Q6NA 5F3WA 2RSMA 3F6GA 4DPXA 1Z5CA 4USMA 1MG7A 2UU9E 1Z0EA 4DUZE 3K1JA 3ZZTA 4B3SI 4DUYI 4BC7A 4JI4I 2LUQA 4X8WA 3GONA 2R3VA 4NXMI 2L6MA 1XMQI 4LFBI 2DMYA 4LTYA 2N3HA 2JR1A 1ZXNA 3PYFA 2KONA 1XMOE 2WZOA 2CZ9A 1ZBTA 2L2NA 4DMIA 1N33I 4DR5E 1FI4A 4F9AB 2A2DA 2E5LI 4LF7E 1MU5A 1HNXE 4DV4E 3JTZA 1Z0WA 4JYAE 4P52A 3ZKBA 2N3GA 1QU6A 2V87A 4F54A 2MDRA 3WU6A 2VQFE 2GS8A 1KTVA 2HFUA 2ZM6E 3QT7A 2EFGA 2UXBI 4X65E 1N0UA 4DV2I 4DV3I 3ZKDA 2JY9A 4B3SE 3J81C 4DUYE 4YY3I 1T4NA 1UILA 2V85A 3AUZA 4LFBE 2V2QA 1XNRE 4JV5E 3WU3A 1Z0CA 2NPFA 1OJ4A 4JI2I 4OX9I 4K0KI 5T6JA 4R8OA 3FIGA 3P1XA 1H7UA 1T4LB 1Z0VA 1IBLI 1KVKA 2KHXA 1H73A 4WUDA 4DR2I 2X36A 1USUA 1N33E 4P7DA 3HPZA 1S16A 4DR6E 2E1RA 4Z7CA 4B3TE 4X62E 4L8NA 2DB2A 2UUBI 3PYEA 2V2VA 4JI1E 4IZJB 4Q28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 I;  1DI2 A;  1X47 A;  1VIS A;  4FWD A;  4OOG C;  4M30 A;  4DKK A;  2F4V E;  4WFT A;  2BV3 A;  1HNW I;  4DR7 I;  2UXD I;  4DR4 E;  3ZZU A;  1K47 A;  4JI3 I;  4LFA I;  4MYT A;  5LMN I;  4LF9 I;  1FJG I;  4HXZ A;  1O0W A;  4LF4 E;  2ZBK B;  5A2Q C;  1PKP A;  1ZM9 A;  3CWV A;  3ADJ A;  1ELO A;  4DU7 A;  3C4B A;  2CPN A;  2R42 A;  1KIJ A;  4B3R I;  1FWL A;  4KHP I;  1IBM I;  1ZM2 A;  1J5E I;  4JI5 E;  2JVA A;  1N36 E;  1RR9 A;  4UTG A;  4DV5 E;  2DEI A;  4GKK E;  4JI8 I;  2HHH E;  1YYK A;  1EI1 A;  4DV7 E;  4I3H A;  4JI7 E;  3T1Y I;  4URL A;  5IWA E;  1N34 I;  2Q2E B;  1HR0 I;  4X64 E;  4NXN E;  4DV6 E;  5LMN E;  3LNU A;  2L2K B;  2UUC I;  2DEJ A;  5BR8 I;  4M2Z A;  2A2C A;  4LF6 I;  2UXC E;  4FN5 A;  3ZZ0 A;  3ADL A;  3OTO I;  1H72 C;  1B62 A;  1FWK A;  1NHH A;  3T1H E;  4PRX A;  1J5E E;  3QT6 A;  4YHH E;  1N0V C;  1WHN A;  5LL6 R;  4DU8 A;  2V8P A;  3J81 Q;  1UEK A;  3J7A M;  4DR3 I;  4MYU A;  1PIE A;  4ZVI A;  4DV1 I;  2VQE I;  3VYX A;  1ZM4 A;  4B3M I;  2BM0 A;  3D4J A;  3M6A A;  2RS7 A;  2LTS A;  4JI4 E;  2UUA I;  4NXM E;  2L3C A;  1RQ0 A;  1YZ9 A;  2L33 A;  1XMQ E;  3B78 A;  4DPU A;  4WUC A;  2LRS A;  4LFC I;  3ADG A;  1DAR A;  2B7T A;  2E5L E;  4AQY I;  4JI0 I;  1N32 I;  1STU A;  1WHQ A;  2XEX A;  1Z59 A;  3WU4 A;  4DV0 I;  2RS6 A;  1HNZ I;  1FNM A;  1X49 A;  4GKJ I;  2LBS B;  5LMU I;  4KQV A;  5A2Q Q;  1RC7 A;  2UXB E;  4DV3 E;  4DV2 E;  1QZR A;  5FLX C;  4YY3 E;  1I94 I;  2HKJ A;  2HK2 A;  4R1F A;  4JI2 E;  4OX9 E;  3B82 A;  5CFF E;  1S4E A;  1FKA E;  4K0K E;  1H74 A;  1XHK A;  1IBL E;  4DR2 E;  1EKZ A;  2UU9 I;  3LTO A;  4DUZ I;  3V5R A;  5IT9 Q;  4M1K A;  4AQY E;  3QT5 A;  1T4O A;  2UUB E;  4DR1 I;  4DV0 E;  2V34 A;  1MX0 A;  4HY1 A;  5IT9 C;  1HNW E;  3J7Y p;  2B7V A;  4DR7 E;  2UXD E;  1XMO I;  2NUG A;  4GKJ E;  2L2M A;  3PYD A;  4FWH A;  4LF5 I;  4JI3 E;  4DR5 I;  2EZ6 A;  2IHR 1;  4LFA E;  4Z7Y A;  3J7A G;  4LF9 E;  1U2R A;  3LPS A;  1FJG E;  1Z0T A;  3QT8 A;  4JYA I;  1RRE A;  3PYG A;  4B3R E;  5GMD A;  2LJH A;  4DPT A;  2VQF I;  1Z0G A;  4P7A A;  4KHP E;  2ZM6 I;  1IBM E;  2HKE A;  4X65 I;  1KKH A;  4DXL A;  1GQE A;  4JI6 I;  1UHZ A;  4DR1 E;  2J7K A;  4XTJ A;  4JI8 E;  2NUE A;  2V2Z A;  1XNR I;  4JV5 I;  3T1Y E;  3B8H A;  1N34 E;  2AJ4 A;  2OI2 A;  1HR0 E;  1NHI A;  4LF5 E;  4DR6 I;  2LUP B;  3V2U C;  2RTX A;  1XNQ I;  4B3T I;  4X62 I;  2UUC E;  4USK A;  5BR8 E;  1YYW A;  2VF3 A;  4JI1 I;  4X66 I;  4LF6 E;  3F0N A;  4UT4 A;  4WUB A;  3OTO E;  3ZM7 A;  2F4V I;  1B63 A;  4DR4 I;  1PVG A;  4JI6 E;  1NZ0 A;  2ZIT A;  4EMD A;  1Z5B A;  4DPY A;  4ED4 A;  3VYY A;  3HTX A;  5FLX Q;  4LF4 I;  4PRV A;  3HUL A;  4DR3 E;  4DV1 E;  4LF8 I;  2VQE E;  2LTR A;  4B3M E;  2YT4 A;  5GME A;  3JAM Q;  1XNQ E;  3LLH A;  2DIX A;  3C4T A;  1IBK I;  4JI5 I;  2LJP A;  2HFS A;  1N36 I;  2UUA E;  4RPF A;  2L3J A;  4DV5 I;  4GKK I;  4X66 E;  4HYM A;  1X48 A;  2HHH I;  3J80 Q;  4JI7 I;  3K17 A;  4WYQ B;  4LFC E;  2B3T B;  3JAM C;  5IWA I;  4X64 I;  1H7S A;  2HK3 A;  4NXN I;  1J26 A;  3H4L A;  4PU9 A;  4DV6 I;  3WU5 A;  5L3J A;  1Z5A A;  1WUU A;  4JI0 E;  1A6F A;  3J80 C;  1N32 E;  2NUF A;  1EA6 A;  2BM1 A;  4HAC A;  2UXC I;  1NHJ A;  2WW4 A;  1Z0B A;  1YYO A;  4FW9 A;  1HNZ E;  2X7I A;  3Q1Q A;  4LF8 E;  1ZXM A;  5LMU E;  4HAC B;  4FWG A;  1D6T A;  4DPW A;  2NA2 A;  1BKN A;  4JG4 A;  1IBK E;  4LF7 I;  3T1H I;  1HNX I;  4YHH I;  4DV4 I;  1I94 E;  1ZM3 A;  3ADI A;  2RSM A;  4DPX A;  1Z5C A;  4USM A;  1MG7 A;  2UU9 E;  1Z0E A;  4DUZ E;  3K1J A;  3ZZT A;  4B3S I;  4DUY I;  4JI4 I;  2LUQ A;  4X8W A;  3GON A;  2R3V A;  4NXM I;  1XMQ I;  4LFB I;  2DMY A;  2N3H A;  1ZXN A;  3PYF A;  1XMO E;  2CZ9 A;  1ZBT A;  2L2N A;  1N33 I;  4DR5 E;  1FI4 A;  2A2D A;  2E5L I;  4LF7 E;  1MU5 A;  1HNX E;  4DV4 E;  1Z0W A;  4JYA E;  4P52 A;  3ZKB A;  2N3G A;  1QU6 A;  2MDR A;  3WU6 A;  2VQF E;  2GS8 A;  1KTV A;  2HFU A;  2ZM6 E;  3QT7 A;  2EFG A;  2UXB I;  4X65 E;  1N0U A;  4DV2 I;  4DV3 I;  3ZKD A;  2JY9 A;  4B3S E;  3J81 C;  4DUY E;  4YY3 I;  1T4N A;  1UIL A;  4LFB E;  2V2Q A;  1XNR E;  4JV5 E;  3WU3 A;  1Z0C A;  2NPF A;  1OJ4 A;  4JI2 I;  4OX9 I;  4K0K I;  3P1X A;  1H7U A;  1T4L B;  1Z0V A;  1IBL I;  1KVK A;  2KHX A;  1H73 A;  4WUD A;  4DR2 I;  2X36 A;  1N33 E;  2E1R A;  1S16 A;  4DR6 E;  4Z7C A;  4B3T E;  4X62 E;  2DB2 A;  2UUB I;  3PYE A;  2V2V A;  4JI1 E; 
#chains in the Genus database with same CATH topology
 2EMF A;  4DV7 I;  2YPN A;  1DI2 A;  2YRM A;  1X47 A;  1X6F A;  1VIS A;  1AAY A;  4FWD A;  2LCE A;  4OOG C;  4M30 A;  3L7Z A;  4DKK A;  2F4V E;  4WFT A;  2BV3 A;  1HNW I;  4DR7 I;  3BBG A;  2UXD I;  2EPC A;  3K85 A;  4R2S A;  4DR4 E;  3ZZU A;  1K47 A;  2EP3 A;  4ZYH A;  5C0X E;  4JI3 I;  2EN6 A;  2IES A;  1UDO A;  4R2D A;  4LPF A;  4MYT A;  4LFA I;  2YRK A;  4BC9 A;  5LMN I;  4LF9 I;  2ELY A;  2PO0 A;  3IWD A;  1FJG I;  5IV8 B;  4HXZ A;  1O0W A;  3RMP A;  3L7Z B;  1AH5 A;  3C6K A;  2LV2 A;  3JU0 A;  5DNL A;  4OZE A;  2M9A A;  4LF4 E;  1X5W A;  2EOR A;  2ZBK B;  5A2Q C;  1PKP A;  4WSG A;  1Y60 A;  2EMI A;  5A6K A;  1ZM9 A;  3CWV A;  1BB8 A;  3ADJ A;  1ELO A;  1Y4S A;  3C4B A;  2CPN A;  2R42 A;  2EPX A;  1KIJ A;  4MQY A;  4DU7 A;  4R2P A;  5C0X B;  4B3R I;  2EM9 A;  1IQS A;  1FWL A;  2EMA A;  4ISA A;  1IBM I;  4KHP I;  5K36 A;  1ZM2 A;  2EPK X;  1J5E I;  3UHM A;  4JI5 E;  2JVA A;  1N36 E;  1OYS A;  4R2E A;  2MC5 A;  1RR9 A;  4UTG A;  4DV5 E;  2DEI A;  3P76 A;  5IXM B;  4GKK E;  3IWC A;  2EM7 A;  2BA0 D;  4JI8 I;  3C6M A;  2V83 A;  2HHH E;  1YYK A;  1X3C A;  4DV7 E;  1EI1 A;  4JI7 E;  1RHY A;  4LCH A;  4I3H A;  3T1Y I;  1HK7 A;  2O1U A;  4URL A;  2NN6 A;  4MU4 A;  5K36 B;  2EM8 A;  5KL6 A;  5IWA E;  1USV A;  1N34 I;  4RHB B;  2EMH A;  2ENA A;  1ZAA C;  2Q2E B;  1HR0 I;  4X64 E;  4GEQ B;  4OO1 E;  4IZK A;  4NXN E;  2EN4 A;  2EOS A;  2CG9 A;  4TUI A;  4DV6 E;  1IQO A;  4IFD A;  5LMN E;  3LNU A;  3CDJ A;  2L2K B;  2MKN A;  2UUC I;  3U1K A;  2H36 X;  2DEJ A;  3K6Q A;  3BID A;  5BR8 I;  4M2Z A;  5A6B D;  2A2C A;  1G2F C;  2NN6 B;  5JEA D;  4LF6 I;  2UXC E;  4FN5 A;  2YU5 A;  2E72 A;  3ZZ0 A;  3ADL A;  4FW5 A;  3OTO I;  1H72 C;  1B62 A;  2EOI A;  1PJT A;  2EOF A;  1FWK A;  2LVH A;  1TF3 A;  1NHH A;  5AE1 A;  4BA1 B;  5AE2 A;  1VI7 A;  3T1H E;  3EPH A;  4PRX A;  1J5E E;  3QT6 A;  4YHH E;  2EM5 A;  4LOM A;  5AE3 A;  1YHC A;  2RSI A;  2VE7 C;  1N0V C;  1WHN A;  2EM0 A;  2GPI A;  5LL6 R;  4DU8 A;  1WJP A;  2V8P A;  1UDQ A;  1UEK A;  5L3J A;  3J81 Q;  3J7A M;  2I9I A;  4R2A A;  2EMW A;  2GQ0 A;  3EQ1 A;  2EMB A;  2I13 A;  3DF6 A;  1JK2 A;  4DR3 I;  4MYU A;  1PIE A;  4ZVI A;  4DV1 I;  2VQE I;  3VYX A;  2D9H A;  2FGG A;  1ZM4 A;  4B3M I;  4TUG A;  2GO4 A;  2BM0 A;  3F6H A;  4O43 A;  3D4J A;  2GLI A;  4BHB A;  5JEA F;  3PS2 A;  4OO1 C;  2EOH A;  3HXL A;  3M6A A;  2RS7 A;  2FV4 B;  2LTS A;  4JI4 E;  2EOX A;  2J7J A;  4BS9 A;  2L3C A;  1RQ0 A;  1YUI A;  4NXM E;  1YZ9 A;  2UUA I;  2L33 A;  1XMQ E;  3B78 A;  1L4S A;  4QNK A;  4DPU A;  2ODR C;  3IWB A;  2EL4 A;  4WUC A;  1E3H A;  2LRS A;  1LLM C;  4LFC I;  3M99 B;  3ADG A;  3KZY A;  1PJS A;  1DAR A;  2EM3 A;  2WBU A;  4F6M A;  1PJQ A;  1ZR9 A;  2B7T A;  2IOP A;  2JEB A;  2E5L E;  4NZV A;  4AQY I;  2PRT A;  2JE6 A;  4JI0 I;  1N32 I;  1STU A;  2F8B A;  1WHQ A;  3HPS A;  2XEX A;  1IMU A;  2YTQ A;  1Z59 A;  2LJU A;  2YU8 A;  3WU4 A;  1SFE A;  2WCC 3;  1YFH A;  2V8Q B;  3MSW A;  4DV0 I;  2RS6 A;  1HNZ I;  1FNM A;  4GZN C;  4BCA A;  4FW4 A;  1MEY C;  5A6A A;  5ADZ A;  1TF6 A;  1X6H A;  4P78 A;  1X49 A;  5A6J A;  2EPZ A;  4WPY A;  2CT1 A;  5C0X D;  4NBQ A;  2JPA A;  4GKJ I;  2LBS B;  5LMU I;  2BR2 A;  5A69 A;  4KQV A;  5A2Q Q;  4BA2 B;  1RC7 A;  2EN2 A;  2UXB E;  4DV3 E;  4DV2 E;  4HEI A;  1OYP A;  2V89 A;  1QZR A;  1BBG A;  3Q6M A;  4ZYD A;  1WXR A;  2EPO A;  4YY3 E;  5FLX C;  1P47 A;  2G7H A;  2BA1 G;  1I94 I;  4ZYE A;  2HKJ A;  2EPR A;  4WSP A;  4F9C B;  2F1D A;  2HK2 A;  2AE8 A;  4R1F A;  3GLL A;  1JK1 A;  2Z5C A;  2YRH A;  4JI2 E;  4OX9 E;  3B82 A;  1YPN A;  5CFF E;  1S4E A;  2M7Q A;  1A1F A;  1FKA E;  2L8T A;  2YTG A;  3OML A;  4K0K E;  1H74 A;  1XHK A;  2EN3 A;  5AC4 A;  1IBL E;  4DR2 E;  1UDS A;  3ZOQ B;  5K36 E;  2K7I A;  2YWQ A;  4AM3 A;  2PO0 B;  4R03 A;  1ZBQ A;  1EKZ A;  2UU9 I;  3LTO A;  5FWK A;  4DUZ I;  1DQ3 A;  3V5R A;  3THO B;  2EOE A;  4LCG A;  3HJC A;  4M1K A;  5IT9 Q;  1B69 A;  4AQY E;  3QT5 A;  2Z5C B;  1T4O A;  2EJ4 A;  2UUB E;  2Z5E A;  4DR1 I;  2EML A;  2MDG A;  4OKG A;  1A1K A;  2NN6 E;  4DV0 E;  5C0X F;  2V34 A;  1MX0 A;  2CSH A;  2ELZ A;  4HY1 A;  5IT9 C;  2EMZ A;  1HNW E;  2ENH A;  3J7Y p;  2B7V A;  4BHC A;  4DR7 E;  2UXD E;  2O3Z A;  2NUG A;  4GKJ E;  2DRP A;  1XMO I;  5ELW A;  4OO1 D;  2L2M A;  4R2R A;  3PYD A;  3PS3 A;  4FWH A;  4LF5 I;  4JI3 E;  4DR5 I;  2EZ6 A;  2EOQ A;  2IHR 1;  2R1F A;  4IFD E;  1NCS A;  4R2Q A;  4LFA E;  4Z7Y A;  2IOQ A;  3J7A G;  2ODR D;  5C0X C;  4LF9 E;  1U2R A;  2JXP A;  3LPS A;  2LMZ A;  2BBG A;  1FJG E;  5EL9 A;  4MLV A;  2LE2 A;  3P3G A;  1Z0T A;  2BA1 D;  2EOZ A;  3QT8 A;  4JYA I;  3L00 A;  1RRE A;  4M9V C;  2MC6 A;  4AIM A;  3PYG A;  2DGC A;  4KWY A;  4IZK B;  4DV6 I;  1GZ6 A;  2EOO A;  2M1S A;  1Y4U A;  4IFD B;  2DLQ A;  4B3R E;  2EWL A;  4M0V A;  5GMD A;  2LJH A;  4DPT A;  2VQF I;  1Z0G A;  4P7A A;  4KHP E;  2NAB A;  1IBM E;  2ZM6 I;  5K36 C;  2HKE A;  3GME A;  2EN1 A;  4N4R B;  4X65 I;  2EL6 A;  4OO1 A;  1A1G A;  2B9D A;  1KKH A;  4KZS A;  4DXL A;  1GQE A;  1UBD C;  4JI6 I;  1UHZ A;  4DR1 E;  2K4V A;  2J7K A;  4XTJ A;  5EKW A;  4JI8 E;  1A1J A;  4O5G A;  2NUE A;  2V2Z A;  4N3O A;  1XNR I;  3CDI A;  4JV5 I;  2C37 A;  4OO1 F;  3T1Y E;  1T39 A;  4IS9 A;  2EPL X;  1ZU1 A;  5A6B A;  3B8H A;  3H09 A;  2NN6 C;  4AID A;  5JEA A;  1N34 E;  2AJ4 A;  2OI2 A;  2EPP A;  5TSE A;  1HR0 E;  1NHI A;  4LCF A;  2JOX A;  4LF5 E;  4DR6 I;  2LUP B;  3V2U C;  2RTX A;  1XNQ I;  2JOB A;  4FW3 A;  4B3T I;  5DRO A;  3KZZ A;  4X62 I;  2UUC E;  1KJK A;  1A1H A;  2C37 B;  4J3D A;  3U1Y A;  2PO1 A;  4USK A;  5BR8 E;  1YYW A;  2VF3 A;  4JI1 I;  4X66 I;  4FW6 A;  4IZJ D;  5JEA B;  4LF6 E;  3F0N A;  4F6N A;  4U3D A;  2DMI A;  4UT4 A;  4NHR A;  1R6L A;  2YTP A;  4WUB A;  5KL4 A;  3OTO E;  3ZM7 A;  2F4V I;  1XXE A;  1B63 A;  2YSP A;  2PNZ A;  1A1L A;  1YUJ A;  3MHH C;  5AC5 A;  2PO1 B;  4DR4 I;  1DGC A;  2V86 A;  1GTK A;  3ECR A;  2M4I A;  2HGH A;  1PVG A;  2EMC A;  4BMJ A;  1QNT A;  5AAS A;  4IS1 C;  4JI6 E;  2PO2 A;  2PNL A;  1NZ0 A;  4O24 A;  4MDT A;  1Z1B A;  2L92 A;  3MHS C;  4WX9 A;  2ZIT A;  3PS1 A;  2PNM A;  3P3C A;  2YTJ A;  1Z5B A;  4EMD A;  4DPY A;  4ED4 A;  3VYY A;  5DRP A;  2LT7 A;  3HTX A;  3GCM A;  2PNZ B;  5FLX Q;  4LF4 I;  2RQL A;  2FTX B;  1SR9 A;  2WNR A;  2A25 A;  3KRN A;  3VHT B;  4IZJ A;  4PRV A;  3P06 A;  3HUL A;  4DR3 E;  2JEB B;  4MLQ A;  4DV1 E;  4LF8 I;  2VQE E;  3HQ1 A;  2LTR A;  2JT2 A;  2JE6 B;  4B3M E;  2WP8 A;  2YT4 A;  2EM2 A;  5GME A;  3JAM Q;  4BBY A;  1XNQ E;  3LLH A;  2DIX A;  1G2D C;  3C4T A;  1IBK I;  3DJW A;  2RPC A;  1MGT A;  2LO3 A;  4JI5 I;  5DNY A;  2KOU A;  2LJP A;  2HFS A;  1N36 I;  2UUA E;  4RPF A;  3BF2 A;  2L3J A;  4DV5 I;  3KWR A;  4X66 E;  2YTI A;  2VES A;  2IER A;  4GKK I;  4HYM A;  1X48 A;  2BB8 A;  2HHH I;  3J80 Q;  4JI7 I;  1OYR A;  2VRD A;  2WBS A;  3K17 A;  4WYQ B;  5KL7 A;  2WP8 B;  4LFC E;  2B3T B;  3JAM C;  5KL3 A;  3P3E A;  5K36 D;  5IWA I;  2EOJ A;  2Z5B A;  3B4T A;  2CTD A;  2VF1 A;  4X64 I;  1H7S A;  4I8O A;  2HK3 A;  1Y6Z A;  4NXN I;  2JWO A;  4QNJ A;  1J26 A;  2O1V A;  4J8Z A;  4Q35 B;  3H4L A;  4PU9 A;  5KL5 A;  3WU5 A;  2GHF A;  4LU9 A;  1WUU A;  1Z5A A;  4JI0 E;  2HC5 A;  3BGH A;  2EQ0 A;  3J80 C;  1N32 E;  1A6F A;  2NUF A;  1EA6 A;  4WXC A;  5LLQ A;  2BM1 A;  4HAC A;  2E1M A;  2NN6 D;  2YTE A;  2UXC I;  3LML A;  1NHJ A;  2EPM X;  1Z0B A;  1YYO A;  2WW4 A;  2EL5 A;  1F2I G;  3VK6 A;  2O1W A;  2Z5B B;  3H1C A;  1A1I A;  2JP9 A;  4FW9 A;  1HNZ E;  2X7I A;  4WXD A;  3M85 G;  2CGE A;  1P42 A;  3PRY A;  2V88 A;  3EPJ A;  2EOM A;  3Q1Q A;  2EM6 A;  2EPN A;  4LF8 E;  2YTF A;  3EPK A;  1ZXM A;  1UN6 B;  4F9B B;  4L5N C;  2BR2 B;  4IFD D;  5LMU E;  2J65 A;  4HAC B;  4FWG A;  1D6T A;  4DPW A;  2NA2 A;  1BKN A;  4JG4 A;  1IBK E;  2EMG A;  3T1H I;  4LF7 I;  2DSY A;  1HNX I;  5KL2 A;  3AV0 A;  4ZYG A;  4YHH I;  4DV4 I;  2GO3 A;  1I94 E;  2YZT A;  2C38 A;  2WBT A;  2ADR A;  2O1T A;  2JEA A;  1ZM3 A;  5K36 F;  3ADI A;  4U3B A;  3Q6N A;  4F2J C;  5F3W A;  1N3G A;  2RSM A;  2EPU A;  3F6G A;  1Z5C A;  4DPX A;  3HKM A;  2C39 A;  4USM A;  1MG7 A;  2ENC A;  1UDN A;  2UU9 E;  1Z0E A;  4DUZ E;  2C38 B;  2JEA B;  2NN6 F;  3K1J A;  3ZZT A;  4B3S I;  4DUY I;  2EM4 A;  4R2C A;  4BC7 A;  4BA1 A;  2LUQ A;  4JI4 I;  4X8W A;  3GON A;  2R3V A;  2MKD A;  4NXM I;  2L6M A;  2HJJ A;  1XMQ I;  5C0X A;  2EOY A;  4LFB I;  2R76 A;  2EN7 A;  1T38 A;  5JEA E;  2DMY A;  4O4K A;  2C39 B;  4LTY A;  3M7N G;  4IFD F;  2N3H A;  2JR1 A;  5DRQ A;  1WRJ A;  1ZXN A;  2JYA A;  3PYF A;  2KON A;  4GQU A;  3M85 D;  1XMO E;  4OO1 B;  2WZO A;  2CZ9 A;  1ZBT A;  2L2N A;  4DMI A;  1N33 I;  1R6M A;  4DR5 E;  1FI4 A;  4F9A B;  2A2D A;  2E5L I;  2EPA A;  4LF7 E;  1EH8 A;  3TQM A;  1X6E A;  1HNX E;  1MU5 A;  4IFD C;  4FK5 C;  1PDA A;  4DV4 E;  4MU1 A;  4X9J A;  1KYQ A;  3JTZ A;  2EQ1 A;  1TN9 A;  2EMY A;  2EQ3 A;  1Z0W A;  1EH7 A;  4JYA E;  3QG5 C;  2YTD A;  4P52 A;  5DRR A;  3UK3 C;  4MU0 A;  3ZKB A;  1BBO A;  2N3G A;  1QU6 A;  4IJD A;  1Y5Y A;  2V87 A;  4F54 A;  2YTO A;  2MDR A;  3WU6 A;  2VQF E;  1E3P A;  2GS8 A;  4HTG A;  1KTV A;  2ZM6 E;  2HFU A;  3QT7 A;  2EE8 A;  2EFG A;  2UXB I;  4X65 E;  1N0U A;  4DV2 I;  4DV3 I;  3ZKD A;  2EMX A;  2JY9 A;  4B3S E;  2Q8U A;  3J81 C;  4DUY E;  1YH8 A;  4YY3 I;  5DNX A;  1T4N A;  1UIL A;  2V85 A;  3AUZ A;  2CVE A;  2EMK A;  1YSA C;  4LFB E;  4MU3 A;  2V2Q A;  1XNR E;  4JV5 E;  3WU3 A;  1Z0C A;  2NPF A;  1OJ4 A;  4JI2 I;  4OX9 I;  3DD6 A;  4K0K I;  5T6J A;  4R8O A;  3THN A;  5JEA C;  3FIG A;  2N8X A;  3P1X A;  1H7U A;  1T4L B;  1Z0V A;  1IBL I;  3M7N D;  1KVK A;  2KHX A;  2YSO A;  1H73 A;  4WUD A;  4DR2 I;  2X36 A;  1USU A;  1EH6 A;  2PO2 B;  1N33 E;  2EN8 A;  4P7D A;  3HPZ A;  3EPL A;  4DR6 E;  1RMD A;  1S16 A;  2E1R A;  4FW7 A;  2DLK A;  4Z7C A;  4B3T E;  3NZK A;  2BA0 G;  4X62 E;  2YTN A;  4L8N A;  2DB2 A;  2UUB I;  4BA2 A;  2WNR B;  2V2V A;  4JI1 E;  3PYE A;  4IZJ B;  4RH8 A;  1NEI A;  4Q28 A; 
#chains in the Genus database with same CATH homology
 4DV7 I;  1DI2 A;  1X47 A;  1VIS A;  4FWD A;  4OOG C;  4M30 A;  4DKK A;  2F4V E;  4WFT A;  2BV3 A;  1HNW I;  4DR7 I;  2UXD I;  3K85 A;  4DR4 E;  3ZZU A;  1K47 A;  4JI3 I;  4LFA I;  4MYT A;  4BC9 A;  5LMN I;  4LF9 I;  3IWD A;  1FJG I;  4HXZ A;  1O0W A;  3RMP A;  3JU0 A;  4LF4 E;  2ZBK B;  5A2Q C;  1PKP A;  1ZM9 A;  3CWV A;  3ADJ A;  1ELO A;  1Y4S A;  3C4B A;  2CPN A;  2R42 A;  4DU7 A;  1KIJ A;  4B3R I;  1FWL A;  4KHP I;  1IBM I;  1ZM2 A;  1J5E I;  4JI5 E;  2JVA A;  1N36 E;  2MC5 A;  1RR9 A;  4UTG A;  4DV5 E;  2DEI A;  4GKK E;  3IWC A;  4JI8 I;  2V83 A;  2HHH E;  1YYK A;  1EI1 A;  4DV7 E;  4I3H A;  4JI7 E;  3T1Y I;  1HK7 A;  2O1U A;  4URL A;  5IWA E;  1USV A;  1N34 I;  2Q2E B;  1HR0 I;  4X64 E;  4GEQ B;  4IZK A;  4NXN E;  2CG9 A;  4TUI A;  4DV6 E;  5LMN E;  3LNU A;  2L2K B;  2UUC I;  2H36 X;  2DEJ A;  3K6Q A;  5BR8 I;  4M2Z A;  2A2C A;  4LF6 I;  2UXC E;  4FN5 A;  3ZZ0 A;  3ADL A;  3OTO I;  1H72 C;  1B62 A;  1FWK A;  1NHH A;  5AE1 A;  5AE2 A;  3T1H E;  4PRX A;  1J5E E;  3QT6 A;  4YHH E;  5AE3 A;  2VE7 C;  1N0V C;  1WHN A;  5LL6 R;  4DU8 A;  2V8P A;  3J81 Q;  1UEK A;  3J7A M;  2GQ0 A;  4DR3 I;  3DF6 A;  4MYU A;  1PIE A;  4ZVI A;  4DV1 I;  2VQE I;  3VYX A;  2FGG A;  1ZM4 A;  4B3M I;  4TUG A;  2BM0 A;  3F6H A;  3D4J A;  3HXL A;  3M6A A;  2RS7 A;  2FV4 B;  2LTS A;  4JI4 E;  2UUA I;  4NXM E;  4BS9 A;  2L3C A;  1RQ0 A;  1YZ9 A;  2L33 A;  1XMQ E;  3B78 A;  4DPU A;  2ODR C;  3IWB A;  4WUC A;  2LRS A;  4LFC I;  3ADG A;  1DAR A;  2B7T A;  2IOP A;  2E5L E;  4AQY I;  4JI0 I;  1N32 I;  1STU A;  2F8B A;  1WHQ A;  3HPS A;  2XEX A;  1Z59 A;  3WU4 A;  2V8Q B;  3MSW A;  4DV0 I;  2RS6 A;  1HNZ I;  1FNM A;  4BCA A;  5ADZ A;  4P78 A;  1X49 A;  4WPY A;  4GKJ I;  2LBS B;  5LMU I;  4KQV A;  5A2Q Q;  1RC7 A;  2UXB E;  4DV3 E;  4DV2 E;  1QZR A;  2V89 A;  3Q6M A;  1WXR A;  4YY3 E;  5FLX C;  1I94 I;  2G7H A;  2HKJ A;  4WSP A;  4F9C B;  2HK2 A;  4R1F A;  2Z5C A;  4JI2 E;  4OX9 E;  3B82 A;  5CFF E;  1S4E A;  2M7Q A;  1FKA E;  4K0K E;  2L8T A;  3OML A;  1H74 A;  1XHK A;  1IBL E;  4DR2 E;  3ZOQ B;  4R03 A;  1ZBQ A;  1EKZ A;  2UU9 I;  3LTO A;  5FWK A;  4DUZ I;  1DQ3 A;  3V5R A;  5IT9 Q;  4M1K A;  3HJC A;  4AQY E;  3QT5 A;  2Z5C B;  1T4O A;  2UUB E;  2Z5E A;  4DR1 I;  4DV0 E;  2V34 A;  1MX0 A;  4HY1 A;  5IT9 C;  1HNW E;  4DR7 E;  2B7V A;  3J7Y p;  2UXD E;  1XMO I;  2NUG A;  4GKJ E;  2L2M A;  3PYD A;  4FWH A;  4LF5 I;  4JI3 E;  4DR5 I;  2EZ6 A;  2IHR 1;  4LFA E;  4Z7Y A;  2IOQ A;  3J7A G;  2ODR D;  4LF9 E;  1U2R A;  3LPS A;  2LMZ A;  1FJG E;  2LE2 A;  1Z0T A;  3QT8 A;  4JYA I;  1RRE A;  2MC6 A;  3PYG A;  4IZK B;  1GZ6 A;  2M1S A;  1Y4U A;  4B3R E;  2EWL A;  4M0V A;  5GMD A;  2LJH A;  4DPT A;  2VQF I;  1Z0G A;  4P7A A;  4KHP E;  2ZM6 I;  1IBM E;  2HKE A;  4X65 I;  2B9D A;  1KKH A;  4KZS A;  4DXL A;  1GQE A;  4JI6 I;  1UHZ A;  4DR1 E;  2K4V A;  2J7K A;  4XTJ A;  4JI8 E;  2NUE A;  2V2Z A;  4N3O A;  1XNR I;  4JV5 I;  3T1Y E;  3B8H A;  3H09 A;  1N34 E;  2AJ4 A;  2OI2 A;  1HR0 E;  1NHI A;  2JOX A;  4LF5 E;  4DR6 I;  2LUP B;  3V2U C;  2RTX A;  1XNQ I;  2JOB A;  4B3T I;  4X62 I;  2UUC E;  4USK A;  5BR8 E;  1YYW A;  2VF3 A;  4JI1 I;  4X66 I;  4IZJ D;  4LF6 E;  3F0N A;  4UT4 A;  4WUB A;  3OTO E;  3ZM7 A;  2F4V I;  1B63 A;  4DR4 I;  2V86 A;  2M4I A;  1PVG A;  4BMJ A;  5AAS A;  4JI6 E;  2PNL A;  1NZ0 A;  2L92 A;  2ZIT A;  2PNM A;  4EMD A;  1Z5B A;  4DPY A;  4ED4 A;  3VYY A;  3HTX A;  5FLX Q;  4LF4 I;  4PRV A;  2FTX B;  1SR9 A;  4IZJ A;  3P06 A;  3HUL A;  4DR3 E;  4DV1 E;  4LF8 I;  2VQE E;  3HQ1 A;  2LTR A;  4B3M E;  2YT4 A;  5GME A;  3JAM Q;  4BBY A;  1XNQ E;  3LLH A;  2DIX A;  3C4T A;  1IBK I;  3DJW A;  4JI5 I;  5DNY A;  2KOU A;  2LJP A;  2HFS A;  1N36 I;  2UUA E;  4RPF A;  2L3J A;  4DV5 I;  3KWR A;  4X66 E;  4GKK I;  4HYM A;  1X48 A;  2HHH I;  3J80 Q;  4JI7 I;  3K17 A;  4WYQ B;  4LFC E;  2B3T B;  3JAM C;  5IWA I;  2Z5B A;  2VF1 A;  4X64 I;  1H7S A;  4I8O A;  2HK3 A;  1Y6Z A;  4NXN I;  2JWO A;  1J26 A;  2O1V A;  4J8Z A;  3H4L A;  4PU9 A;  4DV6 I;  3WU5 A;  4LU9 A;  1Z5A A;  1WUU A;  5L3J A;  4JI0 E;  1A6F A;  3J80 C;  1N32 E;  2NUF A;  1EA6 A;  2BM1 A;  4HAC A;  2E1M A;  2UXC I;  3LML A;  1NHJ A;  2WW4 A;  1Z0B A;  1YYO A;  2Z5B B;  4FW9 A;  3VK6 A;  2O1W A;  1HNZ E;  2X7I A;  2CGE A;  3PRY A;  2V88 A;  3Q1Q A;  4LF8 E;  1ZXM A;  4F9B B;  4L5N C;  5LMU E;  4HAC B;  4FWG A;  1D6T A;  4DPW A;  2NA2 A;  1BKN A;  4JG4 A;  1IBK E;  4LF7 I;  3T1H I;  2DSY A;  1HNX I;  3AV0 A;  4YHH I;  4DV4 I;  1I94 E;  2YZT A;  2O1T A;  1ZM3 A;  3ADI A;  3Q6N A;  5F3W A;  2RSM A;  3F6G A;  4DPX A;  1Z5C A;  4USM A;  1MG7 A;  2UU9 E;  1Z0E A;  4DUZ E;  3K1J A;  3ZZT A;  4B3S I;  4DUY I;  4BC7 A;  4JI4 I;  2LUQ A;  4X8W A;  3GON A;  2R3V A;  4NXM I;  2L6M A;  1XMQ I;  4LFB I;  2DMY A;  4LTY A;  2N3H A;  2JR1 A;  1ZXN A;  3PYF A;  2KON A;  1XMO E;  2WZO A;  2CZ9 A;  1ZBT A;  2L2N A;  4DMI A;  1N33 I;  4DR5 E;  1FI4 A;  4F9A B;  2A2D A;  2E5L I;  4LF7 E;  1MU5 A;  1HNX E;  4DV4 E;  3JTZ A;  1Z0W A;  4JYA E;  4P52 A;  3ZKB A;  2N3G A;  1QU6 A;  2V87 A;  4F54 A;  2MDR A;  3WU6 A;  2VQF E;  2GS8 A;  1KTV A;  2HFU A;  2ZM6 E;  3QT7 A;  2EFG A;  2UXB I;  4X65 E;  1N0U A;  4DV2 I;  4DV3 I;  3ZKD A;  2JY9 A;  4B3S E;  3J81 C;  4DUY E;  4YY3 I;  1T4N A;  1UIL A;  2V85 A;  3AUZ A;  4LFB E;  2V2Q A;  1XNR E;  4JV5 E;  3WU3 A;  1Z0C A;  2NPF A;  1OJ4 A;  4JI2 I;  4OX9 I;  4K0K I;  5T6J A;  4R8O A;  3FIG A;  3P1X A;  1H7U A;  1T4L B;  1Z0V A;  1IBL I;  1KVK A;  2KHX A;  1H73 A;  4WUD A;  4DR2 I;  2X36 A;  1USU A;  1N33 E;  4P7D A;  3HPZ A;  1S16 A;  4DR6 E;  2E1R A;  4Z7C A;  4B3T E;  4X62 E;  4L8N A;  2DB2 A;  2UUB I;  3PYE A;  2V2V A;  4JI1 E;  4IZJ B;  4Q28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...