4DUZE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzE02
3B8HA 4LF5I 2N3HA 2V34A 1UILA 2RSMA 4UTGA 4DU8A 3ZKDA 2L3CA 5IT9Q 2UXBE 1X48A 1NZ0A 3F0NA 2XEXA 2CZ9A 4P7AA 1OJ4A 1RR9A 4DKKA 4LFBI 4M30A 2BM1A 5LMNI 1HNZI 1H72C 1STUA 4FN5A 4MYUA 1J5EI 4DV4E 2L2MA 1PKPA 2DMYA 5FLXQ 4B3SE 2UXBI 4WFTA 4DPYA 4DR5I 4B3TE 1KKHA 4URLA 2KHXA 3LLHA 3T1YE 3K1JA 4KHPE 2UUCI 4K0KI 2VQFI 2B3TB 4X64E 3HULA 4M1KA 1X49A 2UXDE 2E1RA 1FI4A 3B82A 4FWHA 4NXNI 1N36E 1Z5AA 3OTOI 3VYXA 4YY3E 4JI4E 2UXDI 2EZ6A 2DEJA 2V2ZA 5A2QQ 1X47A 4XTJA 4DUZE 5CFFE 4DV3I 3C4TA 1KTVA 1MU5A 1N34I 5LL6R 1RREA 1IBKI 2B7VA 4JI8E 4DV0E 4Z7YA 4JYAI 1T4LB 4LF6E 2HHHI 2HK2A 2VQEI 3J7AM 1XNRE 2IHR1 1Z0VA 4HACB 4DR1I 4LF9E 1ZXNA 1A6FA 2WW4A 2UUAE 2HKEA 5GMEA 4DR3I 3ZZTA 2LUQA 1IBLE 3ADGA 4DUYI 2BM0A 1Z0WA 1XNRI 2UXCI 2DB2A 1S16A 5BR8I 2V8PA 2CPNA 1H74A 2A2DA 1N0UA 4DR2I 2UUAI 5LMUI 4JI2E 1RQ0A 4DR7E 1IBLI 4GKJI 3J81Q 4DR4I 2E5LE 4FW9A 3VYYA 2BV3A 4OX9E 3LPSA 3LTOA 2VF3A 4JI2I 3GONA 4DR7I 1XHKA 4M2ZA 1UEKA 3K17A 4MYTA 4LF7E 1J26A 1MX0A 4LF8E 1Z0EA 1HNWE 2OI2A 2UUBE 1XNQE 2V2VA 2EFGA 1B62A 4EMDA 1N32E 1IBME 4JI0E 1FWKA 1NHJA 4X65E 1PVGA 2NA2A 4DV4I 4LF8I 2A2CA 4B3RE 1NHHA 5L3JA 4B3SI 4RPFA 4B3TI 5IWAE 1FJGE 1H73A 4DV7E 4JV5E 4LF4E 4JI5E 1EI1A 4KQVA 3T1YI 3V5RA 3QT6A 4JI0I 4KHPI 1XMQE 1WHNA 1B63A 1MG7A 1QU6A 4DPTA 4X64I 4DR6E 2DIXA 3J80C 1XMOE 4PRXA 2Q2EB 4JI1E 4JI5I 4USKA 4R1FA 4OOGC 1T4OA 1N36I 1N33E 1Z0CA 1HR0E 2LBSB 4HY1A 3V2UC 3CWVA 4YY3I 2JVAA 3PYEA 4JI4I 4DV1E 1D6TA 1Z0GA 4JI3E 4DUZI 4X66E 4DV5E 1YZ9A 4JI6E 4USMA 4GKKE 4B3ME 4FWGA 2RS7A 1HNXE 4JI8I 3JAMC 4DV0I 4LFCE 4FWDA 4LF6I 4JI7E 1ZM3A 4X62E 4P52A 4JI3I 4X66I 1GQEA 3J7Yp 4JI6I 3WU3A 4LF9I 4AQYE 5GMDA 1NHIA 2NUFA 1YYWA 4WUDA 3WU5A 4Z7CA 1KVKA 4LFAE 1FNMA 1ZM4A 2X36A 5IT9C 1ZM2A 3QT8A 4PRVA 2DEIA 1DARA 2RTXA 2LJPA 2V2QA 3QT7A 4AQYI 3J7AG 1WHQA 3PYFA 2NPFA 3PYGA 2F4VE 2L2NA 4YHHE 1FKAE 4LFBE 2LRSA 5FLXC 5LMNE 3ADJA 4WUCA 2E5LI 1J5EE 1YYKA 2HKJA 2ZITA 3M6AA 1Z59A 1ELOA 4DV6E 4X8WA 2LTRA 4DR5E 2R42A 4OX9I 4DPXA 1K47A 1N0VC 4DV2E 4YHHI 2F4VI 3P1XA 4JG4A 3B78A 2UUCE 4K0KE 2VQFE 4LF7I 3T1HE 2HFSA 1PIEA 3C4BA 3ZKBA 4DU7A 1HNWI 4DV6I 2UUBI 1XNQI 4UT4A 3ZZUA 2J7KA 1T4NA 4NXME 2X7IA 4DV2I 4DPUA 2AJ4A 1N32I 4NXNE 1IBMI 5A2QC 2R3VA 4X65I 3T1HI 3OTOE 3PYDA 3QT5A 1FWLA 4HXZA 3HTXA 4B3RI 1ZM9A 3WU4A 1O0WA 2L33A 1EA6A 5IWAI 4DV3E 1FJGI 1N34E 4DV7I 2MDRA 1Z0BA 2LJHA 2L2KB 4LF4I 4JV5I 1I94E 4NXMI 1IBKE 1ZXMA 4WUBA 3ZZ0A 1S4EA 1XMQI 3H4LA 4JYAE 4HACA 1BKNA 4DR6I 3D4JA 2HHHE 2RS6A 2YT4A 1Z5BA 2B7TA 2VQEE 1XMOI 2ZM6E 2LTSA 3Q1QA 1YYOA 1WUUA 4DR1E 4WYQB 4JI1I 1H7SA 1I94I 1EKZA 2GS8A 2NUEA 1U2RA 3J80Q 2ZBKB 1N33I 4DR3E 1VISA 3LNUA 1HR0I 2L3JA 3ADIA 1DI2A 1Z0TA 4DV1I 4DUYE 2HK3A 2ZM6I 4DV5I 2UU9E 2UXCE 4ED4A 4GKKI 5BR8E 2HFUA 4B3MI 1HNXI 2NUGA 4DPWA 1H7UA 2N3GA 4DR2E 3J81C 4I3HA 4LFCI 1Z5CA 5LMUE 1ZBTA 4JI7I 3ZM7A 4ZVIA 3WU6A 4X62I 1KIJA 4GKJE 3JAMQ 4LF5E 2UU9I 3ADLA 4DR4E 1UHZA 4DXLA 2JY9A 1RC7A 4PU9A 4LFAI 2LUPB 4HYMA 1QZRA 1HNZE
chains in the Genus database with same CATH superfamily
5JEAB 2EOFA 3M7NG 4IJDA 2EM5A 2YTQA 2EQ0A 3B8HA 2D9HA 2YTIA 4LF5I 2N3HA 2WZOA 4F54A 2V34A 2F1DA 1Y4SA 4IFDA 1UILA 2RSMA 4UTGA 4WSGA 3ZKDA 2L3CA 4DU8A 1A1GA 5IT9Q 3VHTB 2K7IA 2UXBE 1X48A 3M85G 1NZ0A 1A1LA 1E3HA 3F0NA 2XEXA 4WX9A 2PO1A 2LVHA 2CZ9A 4P7AA 1OJ4A 1BB8A 1RR9A 4DKKA 2CGEA 4LFBI 2J7JA 2WNRB 2EOXA 4M30A 2BM1A 5LMNI 2EL6A 1HNZI 1H72C 2BA0G 4J8ZA 3PYGA 3BF2A 1STUA 4FN5A 4MYUA 3LMLA 4BC9A 1J5EI 3DF6A 3HPSA 4DV4E 3P3GA 2DGCA 2L2MA 3P3CA 1G2DC 1PKPA 2DMYA 5FLXQ 4B3SE 2UXBI 4BCAA 1BBOA 2F8BA 4WFTA 4DPYA 4DR5I 4B3TE 1KKHA 4IFDC 2EM0A 1X6FA 5A6JA 1RMDA 2EMFA 5AE2A 4URLA 2KHXA 2YRHA 3LLHA 3T1YE 2RPCA 4LCFA 3K1JA 2MC5A 4KHPE 1WJPA 2UUCI 1YH8A 4K0KI 1GTKA 2VQFI 4P78A 5AE1A 2B3TB 2K4VA 4X64E 1UBDC 2O1WA 1DGCA 3HULA 1YUJA 2JOXA 4M1KA 5EKWA 1X49A 2LV2A 1YFHA 2EM9A 2UXDE 1WRJA 5C0XF 2Q8UA 1A1KA 2JXPA 2M7QA 5DNYA 2L8TA 2E1RA 1FI4A 1N3GA 1NEIA 3B82A 4IZKA 3BIDA 4FWHA 3K6QA 2GO4A 3KZZA 2GHFA 4NXNI 3MSWA 1N36E 1E3PA 2JEBA 4GQUA 1Z5AA 2EPMX 3OTOI 1A1FA 1PJTA 3VYXA 2PO2A 2EPLX 2EMXA 3GMEA 2YSOA 4YY3E 4JI4E 2UXDI 2EZ6A 2DEJA 2V2ZA 3Q6MA 5A2QQ 1X47A 1EH8A 4MU3A 4DUZE 4XTJA 5CFFE 4DV3I 3C4TA 3C6MA 1KTVA 1MU5A 2EJ4A 1UDSA 2BA1G 2EMBA 2M4IA 5LL6R 2O1TA 3HKMA 1RREA 5JEAF 1IBKI 1OYSA 2EPUA 2HC5A 2YTJA 1XXEA 2B7VA 5LLQA 3QG5C 2MDGA 4JI8E 2PNLA 2R1FA 4U3BA 4DV0E 1UDNA 4Z7YA 4JYAI 1T4LB 4R2CA 4LF6E 2HHHI 1SR9A 2VF1A 4ISAA 4IZJB 2L92A 4FW4A 5AASA 1IMUA 2HK2A 3Q6NA 2VQEI 3J7AM 3EQ1A 1XNRE 2IHR1 2M9AA 2YU8A 1Z0VA 4HACB 4DR1I 3M85D 5JEAD 2CT1A 1TF6A 5K36F 4LF9E 1ZXNA 3P76A 4OO1E 4LFBE 1A6FA 3L7ZA 2WW4A 4MLVA 2UUAE 2C39B 2HKEA 5GMEA 4N4RB 4DR3I 2CG9A 4OO1A 2GQ0A 4R8OA 4N3OA 3ZZTA 2LUQA 2NN6D 1IBLE 3ADGA 4DUYI 2EM2A 3FIGA 5T6JA 1G2FC 1Z1BA 1Z0WA 2BM0A 2C37B 1Y6ZA 2DB2A 4R2QA 2Z5BB 1XNRI 2UXCI 1S16A 5K36D 4GEQB 5BR8I 2V8PA 2RSIA 2CPNA 4F6MA 2DMIA 2JE6B 1H74A 2A2DA 1N0UA 2CSHA 2EPKX 1X5WA 4DR2I 2UUAI 2EPCA 3AUZA 2NN6E 5LMUI 1T39A 1OYPA 4JI2E 1RQ0A 5A6AA 2WCC3 4DR7E 4O43A 3BBGA 1IBLI 4P7DA 1R6LA 5KL4A 2PNZB 2NN6A 2Z5CA 4GKJI 4OO1C 3J81Q 2O1UA 4DR4I 2E5LE 2PO0B 2H36X 3C6KA 3PS3A 1F2IG 2IOPA 5KL6A 2E72A 4M9VC 4FW9A 4F2JC 5K36A 2YTDA 3VYYA 2AE8A 2YSPA 2C38A 2BV3A 2EMHA 4OX9E 1X6EA 3LPSA 3LTOA 2HGHA 4HEIA 5A6KA 2VF3A 5JEAC 4JI2I 3GONA 4DR7I 4R2RA 2EM6A 1XHKA 4M2ZA 4MU0A 1UEKA 4BA2A 3K17A 4MYTA 3IWCA 2YTPA 2YTFA 4BBYA 4LF7E 2V86A 4O5GA 1J26A 1MX0A 3F6HA 4L5NC 4LF8E 2BBGA 4BHBA 1Z0EA 2NN6C 1HNWE 3MHSC 1YHCA 2OI2A 2UUBE 5ADZA 4TUGA 1XNQE 4MDTA 4R03A 2V2VA 2EFGA 4R2SA 1B62A 1B69A 4IFDB 1GZ6A 4EMDA 2PRTA 5K36C 3IWDA 1N32E 1IBME 4JI0E 4IS1C 1FWKA 1NHJA 2EL5A 3L00A 3EPJA 3HPZA 1MEYC 4X65E 2EMGA 2NA2A 4ZYEA 1PVGA 1MGTA 1ZR9A 2PO1B 4DV4I 2EP3A 2EL4A 2M1SA 2EN6A 2O1VA 2A2CA 4B3RE 4LF8I 3MHHC 3JU0A 1NHHA 5L3JA 2EMYA 4B3SI 2YTGA 4RPFA 4B3TI 5IWAE 3UHMA 4IZJD 1USUA 1FJGE 1H73A 2VE7C 4DV7E 4JV5E 1PJSA 4JI5E 4LF4E 1EI1A 4KQVA 3T1YI 3V5RA 5TSEA 3QT6A 2ENCA 2EOEA 4JI0I 4KHPI 1XMQE 1WHNA 1N33I 3H1CA 1ZBQA 5KL7A 1B63A 1MG7A 1QU6A 3CDJA 4DPTA 4X64I 4HTGA 2EM4A 4DR6E 5A6BD 5DNXA 2YZTA 2EPOA 3THNA 2DIXA 2E1MA 2EPNA 2JWOA 5C0XD 2WBSA 3J80C 3M99B 4LTYA 5AC5A 1XMOE 4PRXA 2Q2EB 1KYQA 1A1IA 2JEAA 2EOYA 4JI1E 2EMIA 4BHCA 4JI5I 2V89A 4USKA 4Q28A 4R1FA 3DD6A 2A25A 4OOGC 4AM3A 1T4OA 2YTEA 1N36I 2HJJA 1N33E 1Z0CA 1HR0E 2LBSB 3M7ND 2EPRA 4HY1A 3V2UC 3CWVA 4IZKB 5C0XE 4YY3I 2BR2A 2LMZA 2JVAA 3PYEA 4FW6A 4JI4I 1VI7A 4DV1E 2GO3A 2EMKA 1D6TA 4BA1A 3U1YA 1Z0GA 2KOUA 4JI3E 2JEBB 4DUZI 2LCEA 4X66E 4DV5E 1RHYA 1YZ9A 4JI6E 2JP9A 3NZKA 5C0XA 4ZYHA 4GKKE 4USMA 4B3ME 4FWGA 2RS7A 2MC6A 2ODRD 2BB8A 2LJUA 1HNXE 1P42A 2PO2B 3CDIA 4JI8I 3JAMC 2KONA 2EMAA 4DV0I 2EQ1A 4BMJA 4LFCE 5KL5A 1USVA 4FWDA 2BA0D 4O24A 4LF6I 1NCSA 2EM3A 3EPLA 4MU4A 4U3DA 4JI7E 1AH5A 2V85A 2MKNA 2WP8A 1ZM3A 2ENAA 4X62E 2NABA 4FW7A 4P52A 2IOQA 5JEAE 2EWLA 4JI3I 4IFDF 4X66I 4WXCA 2YPNA 1GQEA 3J7Yp 4JI6I 2YU5A 1LLMC 3WU3A 3HXLA 4LF9I 1Y4UA 5KL2A 1EH6A 4AQYE 5GMDA 1NHIA 2ENHA 5JEAA 2NUFA 2IESA 1YYWA 4GZNC 5IXMB 4WUDA 3WU5A 4Z7CA 5C0XC 1KVKA 4LFAE 2EOOA 5FWKA 1AAYA 4QNJA 1L4SA 1Y5YA 1ZU1A 2EN4A 1FNMA 1ZM4A 2X36A 3THOB 4NHRA 5IT9C 1ZM2A 4LCGA 3QT8A 2IERA 2EOIA 4F9AB 3L7ZB 2JT2A 4PRVA 2DEIA 4IFDD 1JK1A 1DARA 5K36E 2EPAA 2L6MA 2RTXA 2LJPA 2EN7A 4OZEA 2WNRA 2V2QA 4OO1B 3QT7A 2CVEA 3B4TA 4AQYI 4ZYDA 4FW3A 3J7AG 1R6MA 4R2DA 1WHQA 2EOZA 2V83A 3PYFA 2NPFA 3TQMA 4M0VA 2LT7A 5FLXC 5AE3A 2L2NA 2EN8A 4YHHE 1FKAE 2V88A 2LRSA 4R2AA 2EN3A 1Y60A 5LMNE 2YWQA 4DMIA 2ODRC 3ADJA 3EPKA 3UK3C 2GPIA 3GLLA 2EOQA 1N34I 4WUCA 1IQOA 3HJCA 2YTOA 3KZYA 4MLQA 2E5LI 1J5EE 1YYKA 2HKJA 2ZITA 3M6AA 1EH7A 1YPNA 1Z59A 1YUIA 2BA1D 4IS9A 4F6NA 5EL9A 4RHBB 2VESA 1ELOA 4DV6E 4X8WA 1QNTA 2LTRA 4DR5E 2NN6B 2R42A 2Z5CB 4OX9I 3PS1A 1IQSA 2EPXA 2V8QB 5F3WA 2B9DA 2I13A 4DPXA 2JOBA 1BBGA 2EOJA 1K47A 4DV2E 1N0VC 4YHHI 2F4VI 3P1XA 3JTZA 4JG4A 2EN1A 4I8OA 3B78A 2UUCE 5K36B 2CTDA 4K0KE 2VQFE 2DLKA 3T1HE 2C38B 5ELWA 2HFSA 2O3ZA 4LF7I 1KJKA 1PIEA 3AV0A 4AIDA 3C4BA 3ZKBA 1PDAA 4DU7A 2ELYA 2EN2A 1HNWI 4DV6I 2UUBI 4BA2B 1XNQI 2ELZA 2VRDA 4BS9A 4WPYA 4BC7A 4UT4A 3ZZUA 1T38A 1T4NA 2JPAA 2J7KA 4NXME 2X7IA 4DV2I 2FV4B 2AJ4A 4DPUA 1N32I 4NXNE 4Q35B 1IBMI 4OKGA 5A2QC 4F9BB 2R3VA 2EOMA 2Z5EA 5DNLA 4X65I 2YTNA 3OTOE 3PYDA 3T1HI 1X3CA 3QT5A 1TN9A 1FWLA 4HXZA 1A1JA 3HTXA 4B3RI 2DRPA 5DRRA 1ZM9A 1SFEA 3WU4A 1O0WA 2L33A 4MQYA 2FTXB 3KWRA 3GCMA 2YRKA 4J3DA 1EA6A 1TF3A 2J65A 5IWAI 4DV3E 2EE8A 1FJGI 1N34E 2EQ3A 4DV7I 2EORA 2MDRA 5KL3A 2LJHA 2L2KB 1Z0BA 4LF4I 1I94E 4JV5I 4NXMI 1IBKE 4IZJA 2GLIA 1ZXMA 3KRNA 2MKDA 4WUBA 3BGHA 3ZZ0A 1S4EA 1X6HA 1XMQI 2EOSA 2JR1A 3H4LA 4OO1F 4ZYGA 2EOHA 1OYRA 4LCHA 4JYAE 4HACA 2EMZA 1BKNA 4DR6I 3D4JA 2HHHE 1JK2A 4AIMA 4NBQA 4R2PA 3F6GA 4KWYA 5A6BA 2EM7A 2RS6A 2YT4A 1Z5BA 2C39A 2B7TA 4LU9A 2VQEE 1XMOI 3EPHA 2ZM6E 2LTSA 2G7HA 3Q1QA 1YYOA 1A1HA 1WUUA 4DR1E 3IWBA 1WXRA 4WYQB 4LOMA 2DLQA 1H7SA 1EKZA 4MU1A 4JI1I 1I94I 1UN6B 2YRMA 3PS2A 2GS8A 2NUEA 5DRQA 1U2RA 2ADRA 2C37A 2ZBKB 3J80Q 4DR3E 1VISA 2Z5BA 2EMCA 4WXDA 3DJWA 3LNUA 1HR0I 2L3JA 3ADIA 4LPFA 2JEAB 2JE6A 2F4VE 3RMPA 3OMLA 1DI2A 1Z0TA 2NN6F 1UDQA 4DV1I 2I9IA 2EPPA 5AC4A 4DUYE 4F9CB 2HK3A 2ZM6I 4DV5I 2UU9E 2UXCE 2PNMA 3H09A 4ED4A 2RQLA 2V87A 4GKKI 3ZOQB 3P3EA 3VK6A 5BR8E 2HFUA 4B3MI 1HNXI 4QNKA 4NZVA 4R2EA 1PJQA 2NUGA 2BR2B 4FW5A 4DPWA 2EM8A 2N3GA 4DR2E 1H7UA 4TUIA 1UDOA 3J81C 2PNZA 4BA1B 4I3HA 4LFCI 2PO0A 1Z5CA 1HK7A 2EMLA 2FGGA 2JYAA 2N8XA 1ZBTA 5IV8B 5LMUE 4L8NA 5C0XB 2WBUA 4JI7I 2WBTA 4X9JA 3K85A 5DROA 4ZVIA 3WU6A 3ZM7A 4X62I 4FK5C 3HQ1A 1KIJA 4GKJE 3JAMQ 4LF5E 2UU9I 4KZSA 3PRYA 2LO3A 3ADLA 4DR4E 2DSYA 2EPZA 1P47A 1UHZA 1YSAC 4DXLA 4RH8A 2JY9A 1RC7A 1DQ3A 2WP8B 4PU9A 4LFAI 2LUPB 4HYMA 3U1KA 2EMWA 2R76A 4WSPA 2LE2A 1ZAAC 3P06A 3ECRA 4IFDE 4OO1D 5A69A 1QZRA 5DRPA 1HNZE 4O4KA
chains in the Genus database with same CATH topology
3B8HA 4LF5I 2N3HA 2WZOA 4F54A 2V34A 1Y4SA 1UILA 2RSMA 4UTGA 4DU8A 3ZKDA 2L3CA 5IT9Q 2UXBE 1X48A 1NZ0A 3F0NA 2XEXA 2CZ9A 4P7AA 1OJ4A 1RR9A 4DKKA 2CGEA 4LFBI 4M30A 2BM1A 5LMNI 1HNZI 1H72C 4J8ZA 1STUA 4FN5A 4MYUA 3LMLA 4BC9A 1J5EI 3DF6A 3HPSA 4DV4E 2L2MA 1PKPA 2DMYA 5FLXQ 4B3SE 2UXBI 4BCAA 2F8BA 4WFTA 4DPYA 4DR5I 4B3TE 1KKHA 5AE2A 4URLA 2KHXA 3LLHA 3T1YE 3K1JA 2MC5A 4KHPE 2UUCI 4K0KI 2VQFI 4P78A 5AE1A 2B3TB 2K4VA 4X64E 2O1WA 3HULA 4M1KA 2JOXA 1X49A 2UXDE 2M7QA 5DNYA 2L8TA 2E1RA 1FI4A 3B82A 4IZKA 4FWHA 3K6QA 4NXNI 3MSWA 1N36E 1Z5AA 3OTOI 3VYXA 4YY3E 4JI4E 2UXDI 2EZ6A 2DEJA 2V2ZA 3Q6MA 5A2QQ 1X47A 4XTJA 4DUZE 5CFFE 4DV3I 3C4TA 1KTVA 1MU5A 2O1TA 1N34I 5LL6R 2M4IA 1RREA 1IBKI 2B7VA 4JI8E 2PNLA 4DV0E 4Z7YA 4JYAI 1T4LB 4LF6E 2HHHI 1SR9A 2VF1A 4IZJB 2L92A 5AASA 2HK2A 3Q6NA 2VQEI 3J7AM 1XNRE 2IHR1 1Z0VA 4HACB 4DR1I 4LF9E 1ZXNA 1A6FA 2WW4A 2UUAE 2HKEA 5GMEA 4DR3I 2CG9A 2GQ0A 4R8OA 4N3OA 3ZZTA 2LUQA 1IBLE 3ADGA 4DUYI 3FIGA 5T6JA 2BM0A 1Z0WA 1XNRI 2UXCI 1Y6ZA 2DB2A 2Z5BB 1S16A 4GEQB 5BR8I 2V8PA 2CPNA 1H74A 2A2DA 1N0UA 4DR2I 2UUAI 3AUZA 5LMUI 4JI2E 1RQ0A 4DR7E 1IBLI 4P7DA 4GKJI 2Z5CA 3J81Q 2O1UA 4DR4I 2E5LE 2H36X 2IOPA 4FW9A 3VYYA 2BV3A 4OX9E 3LPSA 3LTOA 2VF3A 4JI2I 3GONA 4DR7I 1XHKA 4M2ZA 1UEKA 3K17A 4MYTA 3IWCA 4BBYA 4LF7E 2V86A 1J26A 1MX0A 3F6HA 4L5NC 4LF8E 1Z0EA 1HNWE 2OI2A 2UUBE 5ADZA 4TUGA 1XNQE 4R03A 2V2VA 2EFGA 1B62A 1GZ6A 4EMDA 3IWDA 1N32E 1IBME 4JI0E 1FWKA 1NHJA 3HPZA 4X65E 1PVGA 2NA2A 4DV4I 2O1VA 2M1SA 4LF8I 2A2CA 4B3RE 3JU0A 1NHHA 5L3JA 4B3SI 4RPFA 4B3TI 5IWAE 4IZJD 1USUA 1FJGE 1H73A 2VE7C 4DV7E 4JV5E 4LF4E 4JI5E 1EI1A 4KQVA 3T1YI 3V5RA 3QT6A 4JI0I 4KHPI 1XMQE 1WHNA 1ZBQA 1B63A 1MG7A 1QU6A 4DPTA 4X64I 4DR6E 2YZTA 2DIXA 2E1MA 2JWOA 3J80C 4LTYA 1XMOE 4PRXA 2Q2EB 4JI1E 4JI5I 2V89A 4USKA 4Q28A 4R1FA 4OOGC 1T4OA 1N36I 1N33E 1Z0CA 1HR0E 2LBSB 4HY1A 3V2UC 3CWVA 4IZKB 4YY3I 2LMZA 2JVAA 3PYEA 4JI4I 4DV1E 1D6TA 1Z0GA 2KOUA 4JI3E 4DUZI 4X66E 4DV5E 1YZ9A 4JI6E 4USMA 4GKKE 4B3ME 4FWGA 2RS7A 2MC6A 2ODRD 1HNXE 4JI8I 3JAMC 2KONA 4DV0I 4BMJA 4LFCE 1USVA 4FWDA 4LF6I 4JI7E 2V85A 1ZM3A 4X62E 4P52A 2IOQA 2EWLA 4JI3I 4X66I 1GQEA 3J7Yp 4JI6I 3WU3A 3HXLA 4LF9I 1Y4UA 4AQYE 5GMDA 1NHIA 2NUFA 1YYWA 4WUDA 3WU5A 4Z7CA 1KVKA 4LFAE 5FWKA 1FNMA 1ZM4A 2X36A 5IT9C 1ZM2A 3QT8A 4F9AB 4PRVA 2DEIA 1DARA 2L6MA 2RTXA 2LJPA 2V2QA 3QT7A 4AQYI 3J7AG 1WHQA 2V83A 3PYFA 2NPFA 4M0VA 2F4VE 5FLXC 2L2NA 5AE3A 1FKAE 4YHHE 2V88A 2LRSA 4LFBE 3PYGA 5LMNE 4DMIA 2ODRC 3ADJA 4WUCA 3HJCA 2E5LI 1J5EE 1YYKA 2HKJA 2ZITA 3M6AA 1Z59A 1ELOA 4DV6E 4X8WA 2LTRA 4DR5E 2R42A 2Z5CB 4OX9I 5F3WA 2V8QB 2B9DA 4DPXA 2JOBA 1K47A 1N0VC 4DV2E 4YHHI 2F4VI 3P1XA 3JTZA 4JG4A 4I8OA 3B78A 2UUCE 4K0KE 2VQFE 4LF7I 3T1HE 2HFSA 1PIEA 3AV0A 3C4BA 3ZKBA 4DU7A 1HNWI 4DV6I 2UUBI 1XNQI 4BS9A 4WPYA 4BC7A 4UT4A 3ZZUA 2J7KA 1T4NA 4NXME 2X7IA 4DV2I 2FV4B 2AJ4A 4DPUA 1N32I 4NXNE 1IBMI 5A2QC 4F9BB 2R3VA 2Z5EA 4X65I 3T1HI 3OTOE 3PYDA 3QT5A 1FWLA 4HXZA 3HTXA 4B3RI 1ZM9A 3WU4A 1O0WA 2L33A 2FTXB 3KWRA 1EA6A 5IWAI 4DV3E 1FJGI 1N34E 4DV7I 2MDRA 1Z0BA 2LJHA 2L2KB 4LF4I 4JV5I 1I94E 4NXMI 1IBKE 4IZJA 1ZXMA 4WUBA 3ZZ0A 1S4EA 1XMQI 2JR1A 3H4LA 4JYAE 4HACA 1BKNA 4DR6I 3D4JA 2HHHE 3F6GA 2RS6A 2YT4A 1Z5BA 2B7TA 4LU9A 2VQEE 1XMOI 2ZM6E 2LTSA 2G7HA 3Q1QA 1YYOA 1WUUA 4DR1E 3IWBA 1WXRA 4WYQB 4JI1I 1H7SA 1I94I 1EKZA 2GS8A 2NUEA 1U2RA 3J80Q 2ZBKB 1N33I 4DR3E 1VISA 2Z5BA 3LNUA 3DJWA 1HR0I 2L3JA 3ADIA 3RMPA 3OMLA 1DI2A 1Z0TA 4DV1I 4DUYE 4F9CB 2HK3A 2ZM6I 4DV5I 2UU9E 2UXCE 2PNMA 3H09A 4ED4A 2V87A 4GKKI 3ZOQB 3VK6A 5BR8E 2HFUA 4B3MI 1HNXI 2NUGA 4DPWA 1H7UA 2N3GA 4DR2E 4TUIA 3J81C 4I3HA 4LFCI 1Z5CA 1HK7A 2FGGA 5LMUE 1ZBTA 4L8NA 4JI7I 3K85A 3ZM7A 4ZVIA 3WU6A 4X62I 3HQ1A 1KIJA 4GKJE 3JAMQ 4LF5E 2UU9I 4KZSA 3PRYA 3ADLA 4DR4E 2DSYA 1UHZA 4DXLA 2JY9A 1RC7A 1DQ3A 4PU9A 4LFAI 2LUPB 4HYMA 4WSPA 2LE2A 3P06A 1QZRA 1HNZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8H A;  4LF5 I;  2N3H A;  2V34 A;  1UIL A;  2RSM A;  4UTG A;  4DU8 A;  3ZKD A;  2L3C A;  5IT9 Q;  2UXB E;  1X48 A;  1NZ0 A;  3F0N A;  2XEX A;  2CZ9 A;  4P7A A;  1OJ4 A;  1RR9 A;  4DKK A;  4LFB I;  4M30 A;  2BM1 A;  5LMN I;  1HNZ I;  1H72 C;  1STU A;  4FN5 A;  4MYU A;  1J5E I;  4DV4 E;  2L2M A;  1PKP A;  2DMY A;  5FLX Q;  4B3S E;  2UXB I;  4WFT A;  4DPY A;  4DR5 I;  4B3T E;  1KKH A;  4URL A;  2KHX A;  3LLH A;  3T1Y E;  3K1J A;  4KHP E;  2UUC I;  4K0K I;  2VQF I;  2B3T B;  4X64 E;  3HUL A;  4M1K A;  1X49 A;  2UXD E;  2E1R A;  1FI4 A;  3B82 A;  4FWH A;  4NXN I;  1N36 E;  1Z5A A;  3OTO I;  3VYX A;  4YY3 E;  4JI4 E;  2UXD I;  2EZ6 A;  2DEJ A;  2V2Z A;  5A2Q Q;  1X47 A;  4XTJ A;  4DUZ E;  5CFF E;  4DV3 I;  3C4T A;  1KTV A;  1MU5 A;  1N34 I;  5LL6 R;  1RRE A;  1IBK I;  2B7V A;  4JI8 E;  4DV0 E;  4Z7Y A;  4JYA I;  1T4L B;  4LF6 E;  2HHH I;  2HK2 A;  2VQE I;  3J7A M;  1XNR E;  2IHR 1;  1Z0V A;  4HAC B;  4DR1 I;  4LF9 E;  1ZXN A;  1A6F A;  2WW4 A;  2UUA E;  2HKE A;  5GME A;  4DR3 I;  3ZZT A;  2LUQ A;  1IBL E;  3ADG A;  4DUY I;  2BM0 A;  1Z0W A;  1XNR I;  2UXC I;  2DB2 A;  1S16 A;  5BR8 I;  2V8P A;  2CPN A;  1H74 A;  2A2D A;  1N0U A;  4DR2 I;  2UUA I;  5LMU I;  4JI2 E;  1RQ0 A;  4DR7 E;  1IBL I;  4GKJ I;  3J81 Q;  4DR4 I;  2E5L E;  4FW9 A;  3VYY A;  2BV3 A;  4OX9 E;  3LPS A;  3LTO A;  2VF3 A;  4JI2 I;  3GON A;  4DR7 I;  1XHK A;  4M2Z A;  1UEK A;  3K17 A;  4MYT A;  4LF7 E;  1J26 A;  1MX0 A;  4LF8 E;  1Z0E A;  1HNW E;  2OI2 A;  2UUB E;  1XNQ E;  2V2V A;  2EFG A;  1B62 A;  4EMD A;  1N32 E;  1IBM E;  4JI0 E;  1FWK A;  1NHJ A;  4X65 E;  1PVG A;  2NA2 A;  4DV4 I;  4LF8 I;  2A2C A;  4B3R E;  1NHH A;  5L3J A;  4B3S I;  4RPF A;  4B3T I;  5IWA E;  1FJG E;  1H73 A;  4DV7 E;  4JV5 E;  4LF4 E;  4JI5 E;  1EI1 A;  4KQV A;  3T1Y I;  3V5R A;  3QT6 A;  4JI0 I;  4KHP I;  1XMQ E;  1WHN A;  1B63 A;  1MG7 A;  1QU6 A;  4DPT A;  4X64 I;  4DR6 E;  2DIX A;  3J80 C;  1XMO E;  4PRX A;  2Q2E B;  4JI1 E;  4JI5 I;  4USK A;  4R1F A;  4OOG C;  1T4O A;  1N36 I;  1N33 E;  1Z0C A;  1HR0 E;  2LBS B;  4HY1 A;  3V2U C;  3CWV A;  4YY3 I;  2JVA A;  3PYE A;  4JI4 I;  4DV1 E;  1D6T A;  1Z0G A;  4JI3 E;  4DUZ I;  4X66 E;  4DV5 E;  1YZ9 A;  4JI6 E;  4USM A;  4GKK E;  4B3M E;  4FWG A;  2RS7 A;  1HNX E;  4JI8 I;  3JAM C;  4DV0 I;  4LFC E;  4FWD A;  4LF6 I;  4JI7 E;  1ZM3 A;  4X62 E;  4P52 A;  4JI3 I;  4X66 I;  1GQE A;  3J7Y p;  4JI6 I;  3WU3 A;  4LF9 I;  4AQY E;  5GMD A;  1NHI A;  2NUF A;  1YYW A;  4WUD A;  3WU5 A;  4Z7C A;  1KVK A;  4LFA E;  1FNM A;  1ZM4 A;  2X36 A;  5IT9 C;  1ZM2 A;  3QT8 A;  4PRV A;  2DEI A;  1DAR A;  2RTX A;  2LJP A;  2V2Q A;  3QT7 A;  4AQY I;  3J7A G;  1WHQ A;  3PYF A;  2NPF A;  3PYG A;  2F4V E;  2L2N A;  4YHH E;  1FKA E;  4LFB E;  2LRS A;  5FLX C;  5LMN E;  3ADJ A;  4WUC A;  2E5L I;  1J5E E;  1YYK A;  2HKJ A;  2ZIT A;  3M6A A;  1Z59 A;  1ELO A;  4DV6 E;  4X8W A;  2LTR A;  4DR5 E;  2R42 A;  4OX9 I;  4DPX A;  1K47 A;  1N0V C;  4DV2 E;  4YHH I;  2F4V I;  3P1X A;  4JG4 A;  3B78 A;  2UUC E;  4K0K E;  2VQF E;  4LF7 I;  3T1H E;  2HFS A;  1PIE A;  3C4B A;  3ZKB A;  4DU7 A;  1HNW I;  4DV6 I;  2UUB I;  1XNQ I;  4UT4 A;  3ZZU A;  2J7K A;  1T4N A;  4NXM E;  2X7I A;  4DV2 I;  4DPU A;  2AJ4 A;  1N32 I;  4NXN E;  1IBM I;  5A2Q C;  2R3V A;  4X65 I;  3T1H I;  3OTO E;  3PYD A;  3QT5 A;  1FWL A;  4HXZ A;  3HTX A;  4B3R I;  1ZM9 A;  3WU4 A;  1O0W A;  2L33 A;  1EA6 A;  5IWA I;  4DV3 E;  1FJG I;  1N34 E;  4DV7 I;  2MDR A;  1Z0B A;  2LJH A;  2L2K B;  4LF4 I;  4JV5 I;  1I94 E;  4NXM I;  1IBK E;  1ZXM A;  4WUB A;  3ZZ0 A;  1S4E A;  1XMQ I;  3H4L A;  4JYA E;  4HAC A;  1BKN A;  4DR6 I;  3D4J A;  2HHH E;  2RS6 A;  2YT4 A;  1Z5B A;  2B7T A;  2VQE E;  1XMO I;  2ZM6 E;  2LTS A;  3Q1Q A;  1YYO A;  1WUU A;  4DR1 E;  4WYQ B;  4JI1 I;  1H7S A;  1I94 I;  1EKZ A;  2GS8 A;  2NUE A;  1U2R A;  3J80 Q;  2ZBK B;  1N33 I;  4DR3 E;  1VIS A;  3LNU A;  1HR0 I;  2L3J A;  3ADI A;  1DI2 A;  1Z0T A;  4DV1 I;  4DUY E;  2HK3 A;  2ZM6 I;  4DV5 I;  2UU9 E;  2UXC E;  4ED4 A;  4GKK I;  5BR8 E;  2HFU A;  4B3M I;  1HNX I;  2NUG A;  4DPW A;  1H7U A;  2N3G A;  4DR2 E;  3J81 C;  4I3H A;  4LFC I;  1Z5C A;  5LMU E;  1ZBT A;  4JI7 I;  3ZM7 A;  4ZVI A;  3WU6 A;  4X62 I;  1KIJ A;  4GKJ E;  3JAM Q;  4LF5 E;  2UU9 I;  3ADL A;  4DR4 E;  1UHZ A;  4DXL A;  2JY9 A;  1RC7 A;  4PU9 A;  4LFA I;  2LUP B;  4HYM A;  1QZR A;  1HNZ E; 
#chains in the Genus database with same CATH topology
 5JEA B;  2EOF A;  3M7N G;  4IJD A;  2EM5 A;  2YTQ A;  2EQ0 A;  3B8H A;  2D9H A;  2YTI A;  4LF5 I;  2N3H A;  2WZO A;  4F54 A;  2V34 A;  2F1D A;  1Y4S A;  4IFD A;  1UIL A;  2RSM A;  4UTG A;  4WSG A;  3ZKD A;  2L3C A;  4DU8 A;  1A1G A;  5IT9 Q;  3VHT B;  2K7I A;  2UXB E;  1X48 A;  3M85 G;  1NZ0 A;  1A1L A;  1E3H A;  3F0N A;  2XEX A;  4WX9 A;  2PO1 A;  2LVH A;  2CZ9 A;  4P7A A;  1OJ4 A;  1BB8 A;  1RR9 A;  4DKK A;  2CGE A;  4LFB I;  2J7J A;  2WNR B;  2EOX A;  4M30 A;  2BM1 A;  5LMN I;  2EL6 A;  1HNZ I;  1H72 C;  2BA0 G;  4J8Z A;  3PYG A;  3BF2 A;  1STU A;  4FN5 A;  4MYU A;  3LML A;  4BC9 A;  1J5E I;  3DF6 A;  3HPS A;  4DV4 E;  3P3G A;  2DGC A;  2L2M A;  3P3C A;  1G2D C;  1PKP A;  2DMY A;  5FLX Q;  4B3S E;  2UXB I;  4BCA A;  1BBO A;  2F8B A;  4WFT A;  4DPY A;  4DR5 I;  4B3T E;  1KKH A;  4IFD C;  2EM0 A;  1X6F A;  5A6J A;  1RMD A;  2EMF A;  5AE2 A;  4URL A;  2KHX A;  2YRH A;  3LLH A;  3T1Y E;  2RPC A;  4LCF A;  3K1J A;  2MC5 A;  4KHP E;  1WJP A;  2UUC I;  1YH8 A;  4K0K I;  1GTK A;  2VQF I;  4P78 A;  5AE1 A;  2B3T B;  2K4V A;  4X64 E;  1UBD C;  2O1W A;  1DGC A;  3HUL A;  1YUJ A;  2JOX A;  4M1K A;  5EKW A;  1X49 A;  2LV2 A;  1YFH A;  2EM9 A;  2UXD E;  1WRJ A;  5C0X F;  2Q8U A;  1A1K A;  2JXP A;  2M7Q A;  5DNY A;  2L8T A;  2E1R A;  1FI4 A;  1N3G A;  1NEI A;  3B82 A;  4IZK A;  3BID A;  4FWH A;  3K6Q A;  2GO4 A;  3KZZ A;  2GHF A;  4NXN I;  3MSW A;  1N36 E;  1E3P A;  2JEB A;  4GQU A;  1Z5A A;  2EPM X;  3OTO I;  1A1F A;  1PJT A;  3VYX A;  2PO2 A;  2EPL X;  2EMX A;  3GME A;  2YSO A;  4YY3 E;  4JI4 E;  2UXD I;  2EZ6 A;  2DEJ A;  2V2Z A;  3Q6M A;  5A2Q Q;  1X47 A;  1EH8 A;  4MU3 A;  4DUZ E;  4XTJ A;  5CFF E;  4DV3 I;  3C4T A;  3C6M A;  1KTV A;  1MU5 A;  2EJ4 A;  1UDS A;  2BA1 G;  2EMB A;  2M4I A;  5LL6 R;  2O1T A;  3HKM A;  1RRE A;  5JEA F;  1IBK I;  1OYS A;  2EPU A;  2HC5 A;  2YTJ A;  1XXE A;  2B7V A;  5LLQ A;  3QG5 C;  2MDG A;  4JI8 E;  2PNL A;  2R1F A;  4U3B A;  4DV0 E;  1UDN A;  4Z7Y A;  4JYA I;  1T4L B;  4R2C A;  4LF6 E;  2HHH I;  1SR9 A;  2VF1 A;  4ISA A;  4IZJ B;  2L92 A;  4FW4 A;  5AAS A;  1IMU A;  2HK2 A;  3Q6N A;  2VQE I;  3J7A M;  3EQ1 A;  1XNR E;  2IHR 1;  2M9A A;  2YU8 A;  1Z0V A;  4HAC B;  4DR1 I;  3M85 D;  5JEA D;  2CT1 A;  1TF6 A;  5K36 F;  4LF9 E;  1ZXN A;  3P76 A;  4OO1 E;  4LFB E;  1A6F A;  3L7Z A;  2WW4 A;  4MLV A;  2UUA E;  2C39 B;  2HKE A;  5GME A;  4N4R B;  4DR3 I;  2CG9 A;  4OO1 A;  2GQ0 A;  4R8O A;  4N3O A;  3ZZT A;  2LUQ A;  2NN6 D;  1IBL E;  3ADG A;  4DUY I;  2EM2 A;  3FIG A;  5T6J A;  1G2F C;  1Z1B A;  1Z0W A;  2BM0 A;  2C37 B;  1Y6Z A;  2DB2 A;  4R2Q A;  2Z5B B;  1XNR I;  2UXC I;  1S16 A;  5K36 D;  4GEQ B;  5BR8 I;  2V8P A;  2RSI A;  2CPN A;  4F6M A;  2DMI A;  2JE6 B;  1H74 A;  2A2D A;  1N0U A;  2CSH A;  2EPK X;  1X5W A;  4DR2 I;  2UUA I;  2EPC A;  3AUZ A;  2NN6 E;  5LMU I;  1T39 A;  1OYP A;  4JI2 E;  1RQ0 A;  5A6A A;  2WCC 3;  4DR7 E;  4O43 A;  3BBG A;  1IBL I;  4P7D A;  1R6L A;  5KL4 A;  2PNZ B;  2NN6 A;  2Z5C A;  4GKJ I;  4OO1 C;  3J81 Q;  2O1U A;  4DR4 I;  2E5L E;  2PO0 B;  2H36 X;  3C6K A;  3PS3 A;  1F2I G;  2IOP A;  5KL6 A;  2E72 A;  4M9V C;  4FW9 A;  4F2J C;  5K36 A;  2YTD A;  3VYY A;  2AE8 A;  2YSP A;  2C38 A;  2BV3 A;  2EMH A;  4OX9 E;  1X6E A;  3LPS A;  3LTO A;  2HGH A;  4HEI A;  5A6K A;  2VF3 A;  5JEA C;  4JI2 I;  3GON A;  4DR7 I;  4R2R A;  2EM6 A;  1XHK A;  4M2Z A;  4MU0 A;  1UEK A;  4BA2 A;  3K17 A;  4MYT A;  3IWC A;  2YTP A;  2YTF A;  4BBY A;  4LF7 E;  2V86 A;  4O5G A;  1J26 A;  1MX0 A;  3F6H A;  4L5N C;  4LF8 E;  2BBG A;  4BHB A;  1Z0E A;  2NN6 C;  1HNW E;  3MHS C;  1YHC A;  2OI2 A;  2UUB E;  5ADZ A;  4TUG A;  1XNQ E;  4MDT A;  4R03 A;  2V2V A;  2EFG A;  4R2S A;  1B62 A;  1B69 A;  4IFD B;  1GZ6 A;  4EMD A;  2PRT A;  5K36 C;  3IWD A;  1N32 E;  1IBM E;  4JI0 E;  4IS1 C;  1FWK A;  1NHJ A;  2EL5 A;  3L00 A;  3EPJ A;  3HPZ A;  1MEY C;  4X65 E;  2EMG A;  2NA2 A;  4ZYE A;  1PVG A;  1MGT A;  1ZR9 A;  2PO1 B;  4DV4 I;  2EP3 A;  2EL4 A;  2M1S A;  2EN6 A;  2O1V A;  2A2C A;  4B3R E;  4LF8 I;  3MHH C;  3JU0 A;  1NHH A;  5L3J A;  2EMY A;  4B3S I;  2YTG A;  4RPF A;  4B3T I;  5IWA E;  3UHM A;  4IZJ D;  1USU A;  1FJG E;  1H73 A;  2VE7 C;  4DV7 E;  4JV5 E;  1PJS A;  4JI5 E;  4LF4 E;  1EI1 A;  4KQV A;  3T1Y I;  3V5R A;  5TSE A;  3QT6 A;  2ENC A;  2EOE A;  4JI0 I;  4KHP I;  1XMQ E;  1WHN A;  1N33 I;  3H1C A;  1ZBQ A;  5KL7 A;  1B63 A;  1MG7 A;  1QU6 A;  3CDJ A;  4DPT A;  4X64 I;  4HTG A;  2EM4 A;  4DR6 E;  5A6B D;  5DNX A;  2YZT A;  2EPO A;  3THN A;  2DIX A;  2E1M A;  2EPN A;  2JWO A;  5C0X D;  2WBS A;  3J80 C;  3M99 B;  4LTY A;  5AC5 A;  1XMO E;  4PRX A;  2Q2E B;  1KYQ A;  1A1I A;  2JEA A;  2EOY A;  4JI1 E;  2EMI A;  4BHC A;  4JI5 I;  2V89 A;  4USK A;  4Q28 A;  4R1F A;  3DD6 A;  2A25 A;  4OOG C;  4AM3 A;  1T4O A;  2YTE A;  1N36 I;  2HJJ A;  1N33 E;  1Z0C A;  1HR0 E;  2LBS B;  3M7N D;  2EPR A;  4HY1 A;  3V2U C;  3CWV A;  4IZK B;  5C0X E;  4YY3 I;  2BR2 A;  2LMZ A;  2JVA A;  3PYE A;  4FW6 A;  4JI4 I;  1VI7 A;  4DV1 E;  2GO3 A;  2EMK A;  1D6T A;  4BA1 A;  3U1Y A;  1Z0G A;  2KOU A;  4JI3 E;  2JEB B;  4DUZ I;  2LCE A;  4X66 E;  4DV5 E;  1RHY A;  1YZ9 A;  4JI6 E;  2JP9 A;  3NZK A;  5C0X A;  4ZYH A;  4GKK E;  4USM A;  4B3M E;  4FWG A;  2RS7 A;  2MC6 A;  2ODR D;  2BB8 A;  2LJU A;  1HNX E;  1P42 A;  2PO2 B;  3CDI A;  4JI8 I;  3JAM C;  2KON A;  2EMA A;  4DV0 I;  2EQ1 A;  4BMJ A;  4LFC E;  5KL5 A;  1USV A;  4FWD A;  2BA0 D;  4O24 A;  4LF6 I;  1NCS A;  2EM3 A;  3EPL A;  4MU4 A;  4U3D A;  4JI7 E;  1AH5 A;  2V85 A;  2MKN A;  2WP8 A;  1ZM3 A;  2ENA A;  4X62 E;  2NAB A;  4FW7 A;  4P52 A;  2IOQ A;  5JEA E;  2EWL A;  4JI3 I;  4IFD F;  4X66 I;  4WXC A;  2YPN A;  1GQE A;  3J7Y p;  4JI6 I;  2YU5 A;  1LLM C;  3WU3 A;  3HXL A;  4LF9 I;  1Y4U A;  5KL2 A;  1EH6 A;  4AQY E;  5GMD A;  1NHI A;  2ENH A;  5JEA A;  2NUF A;  2IES A;  1YYW A;  4GZN C;  5IXM B;  4WUD A;  3WU5 A;  4Z7C A;  5C0X C;  1KVK A;  4LFA E;  2EOO A;  5FWK A;  1AAY A;  4QNJ A;  1L4S A;  1Y5Y A;  1ZU1 A;  2EN4 A;  1FNM A;  1ZM4 A;  2X36 A;  3THO B;  4NHR A;  5IT9 C;  1ZM2 A;  4LCG A;  3QT8 A;  2IER A;  2EOI A;  4F9A B;  3L7Z B;  2JT2 A;  4PRV A;  2DEI A;  4IFD D;  1JK1 A;  1DAR A;  5K36 E;  2EPA A;  2L6M A;  2RTX A;  2LJP A;  2EN7 A;  4OZE A;  2WNR A;  2V2Q A;  4OO1 B;  3QT7 A;  2CVE A;  3B4T A;  4AQY I;  4ZYD A;  4FW3 A;  3J7A G;  1R6M A;  4R2D A;  1WHQ A;  2EOZ A;  2V83 A;  3PYF A;  2NPF A;  3TQM A;  4M0V A;  2LT7 A;  5FLX C;  5AE3 A;  2L2N A;  2EN8 A;  4YHH E;  1FKA E;  2V88 A;  2LRS A;  4R2A A;  2EN3 A;  1Y60 A;  5LMN E;  2YWQ A;  4DMI A;  2ODR C;  3ADJ A;  3EPK A;  3UK3 C;  2GPI A;  3GLL A;  2EOQ A;  1N34 I;  4WUC A;  1IQO A;  3HJC A;  2YTO A;  3KZY A;  4MLQ A;  2E5L I;  1J5E E;  1YYK A;  2HKJ A;  2ZIT A;  3M6A A;  1EH7 A;  1YPN A;  1Z59 A;  1YUI A;  2BA1 D;  4IS9 A;  4F6N A;  5EL9 A;  4RHB B;  2VES A;  1ELO A;  4DV6 E;  4X8W A;  1QNT A;  2LTR A;  4DR5 E;  2NN6 B;  2R42 A;  2Z5C B;  4OX9 I;  3PS1 A;  1IQS A;  2EPX A;  2V8Q B;  5F3W A;  2B9D A;  2I13 A;  4DPX A;  2JOB A;  1BBG A;  2EOJ A;  1K47 A;  4DV2 E;  1N0V C;  4YHH I;  2F4V I;  3P1X A;  3JTZ A;  4JG4 A;  2EN1 A;  4I8O A;  3B78 A;  2UUC E;  5K36 B;  2CTD A;  4K0K E;  2VQF E;  2DLK A;  3T1H E;  2C38 B;  5ELW A;  2HFS A;  2O3Z A;  4LF7 I;  1KJK A;  1PIE A;  3AV0 A;  4AID A;  3C4B A;  3ZKB A;  1PDA A;  4DU7 A;  2ELY A;  2EN2 A;  1HNW I;  4DV6 I;  2UUB I;  4BA2 B;  1XNQ I;  2ELZ A;  2VRD A;  4BS9 A;  4WPY A;  4BC7 A;  4UT4 A;  3ZZU A;  1T38 A;  1T4N A;  2JPA A;  2J7K A;  4NXM E;  2X7I A;  4DV2 I;  2FV4 B;  2AJ4 A;  4DPU A;  1N32 I;  4NXN E;  4Q35 B;  1IBM I;  4OKG A;  5A2Q C;  4F9B B;  2R3V A;  2EOM A;  2Z5E A;  5DNL A;  4X65 I;  2YTN A;  3OTO E;  3PYD A;  3T1H I;  1X3C A;  3QT5 A;  1TN9 A;  1FWL A;  4HXZ A;  1A1J A;  3HTX A;  4B3R I;  2DRP A;  5DRR A;  1ZM9 A;  1SFE A;  3WU4 A;  1O0W A;  2L33 A;  4MQY A;  2FTX B;  3KWR A;  3GCM A;  2YRK A;  4J3D A;  1EA6 A;  1TF3 A;  2J65 A;  5IWA I;  4DV3 E;  2EE8 A;  1FJG I;  1N34 E;  2EQ3 A;  4DV7 I;  2EOR A;  2MDR A;  5KL3 A;  2LJH A;  2L2K B;  1Z0B A;  4LF4 I;  1I94 E;  4JV5 I;  4NXM I;  1IBK E;  4IZJ A;  2GLI A;  1ZXM A;  3KRN A;  2MKD A;  4WUB A;  3BGH A;  3ZZ0 A;  1S4E A;  1X6H A;  1XMQ I;  2EOS A;  2JR1 A;  3H4L A;  4OO1 F;  4ZYG A;  2EOH A;  1OYR A;  4LCH A;  4JYA E;  4HAC A;  2EMZ A;  1BKN A;  4DR6 I;  3D4J A;  2HHH E;  1JK2 A;  4AIM A;  4NBQ A;  4R2P A;  3F6G A;  4KWY A;  5A6B A;  2EM7 A;  2RS6 A;  2YT4 A;  1Z5B A;  2C39 A;  2B7T A;  4LU9 A;  2VQE E;  1XMO I;  3EPH A;  2ZM6 E;  2LTS A;  2G7H A;  3Q1Q A;  1YYO A;  1A1H A;  1WUU A;  4DR1 E;  3IWB A;  1WXR A;  4WYQ B;  4LOM A;  2DLQ A;  1H7S A;  1EKZ A;  4MU1 A;  4JI1 I;  1I94 I;  1UN6 B;  2YRM A;  3PS2 A;  2GS8 A;  2NUE A;  5DRQ A;  1U2R A;  2ADR A;  2C37 A;  2ZBK B;  3J80 Q;  4DR3 E;  1VIS A;  2Z5B A;  2EMC A;  4WXD A;  3DJW A;  3LNU A;  1HR0 I;  2L3J A;  3ADI A;  4LPF A;  2JEA B;  2JE6 A;  2F4V E;  3RMP A;  3OML A;  1DI2 A;  1Z0T A;  2NN6 F;  1UDQ A;  4DV1 I;  2I9I A;  2EPP A;  5AC4 A;  4DUY E;  4F9C B;  2HK3 A;  2ZM6 I;  4DV5 I;  2UU9 E;  2UXC E;  2PNM A;  3H09 A;  4ED4 A;  2RQL A;  2V87 A;  4GKK I;  3ZOQ B;  3P3E A;  3VK6 A;  5BR8 E;  2HFU A;  4B3M I;  1HNX I;  4QNK A;  4NZV A;  4R2E A;  1PJQ A;  2NUG A;  2BR2 B;  4FW5 A;  4DPW A;  2EM8 A;  2N3G A;  4DR2 E;  1H7U A;  4TUI A;  1UDO A;  3J81 C;  2PNZ A;  4BA1 B;  4I3H A;  4LFC I;  2PO0 A;  1Z5C A;  1HK7 A;  2EML A;  2FGG A;  2JYA A;  2N8X A;  1ZBT A;  5IV8 B;  5LMU E;  4L8N A;  5C0X B;  2WBU A;  4JI7 I;  2WBT A;  4X9J A;  3K85 A;  5DRO A;  4ZVI A;  3WU6 A;  3ZM7 A;  4X62 I;  4FK5 C;  3HQ1 A;  1KIJ A;  4GKJ E;  3JAM Q;  4LF5 E;  2UU9 I;  4KZS A;  3PRY A;  2LO3 A;  3ADL A;  4DR4 E;  2DSY A;  2EPZ A;  1P47 A;  1UHZ A;  1YSA C;  4DXL A;  4RH8 A;  2JY9 A;  1RC7 A;  1DQ3 A;  2WP8 B;  4PU9 A;  4LFA I;  2LUP B;  4HYM A;  3U1K A;  2EMW A;  2R76 A;  4WSP A;  2LE2 A;  1ZAA C;  3P06 A;  3ECR A;  4IFD E;  4OO1 D;  5A69 A;  1QZR A;  5DRP A;  1HNZ E;  4O4K A; 
#chains in the Genus database with same CATH homology
 3B8H A;  4LF5 I;  2N3H A;  2WZO A;  4F54 A;  2V34 A;  1Y4S A;  1UIL A;  2RSM A;  4UTG A;  4DU8 A;  3ZKD A;  2L3C A;  5IT9 Q;  2UXB E;  1X48 A;  1NZ0 A;  3F0N A;  2XEX A;  2CZ9 A;  4P7A A;  1OJ4 A;  1RR9 A;  4DKK A;  2CGE A;  4LFB I;  4M30 A;  2BM1 A;  5LMN I;  1HNZ I;  1H72 C;  4J8Z A;  1STU A;  4FN5 A;  4MYU A;  3LML A;  4BC9 A;  1J5E I;  3DF6 A;  3HPS A;  4DV4 E;  2L2M A;  1PKP A;  2DMY A;  5FLX Q;  4B3S E;  2UXB I;  4BCA A;  2F8B A;  4WFT A;  4DPY A;  4DR5 I;  4B3T E;  1KKH A;  5AE2 A;  4URL A;  2KHX A;  3LLH A;  3T1Y E;  3K1J A;  2MC5 A;  4KHP E;  2UUC I;  4K0K I;  2VQF I;  4P78 A;  5AE1 A;  2B3T B;  2K4V A;  4X64 E;  2O1W A;  3HUL A;  4M1K A;  2JOX A;  1X49 A;  2UXD E;  2M7Q A;  5DNY A;  2L8T A;  2E1R A;  1FI4 A;  3B82 A;  4IZK A;  4FWH A;  3K6Q A;  4NXN I;  3MSW A;  1N36 E;  1Z5A A;  3OTO I;  3VYX A;  4YY3 E;  4JI4 E;  2UXD I;  2EZ6 A;  2DEJ A;  2V2Z A;  3Q6M A;  5A2Q Q;  1X47 A;  4XTJ A;  4DUZ E;  5CFF E;  4DV3 I;  3C4T A;  1KTV A;  1MU5 A;  2O1T A;  1N34 I;  5LL6 R;  2M4I A;  1RRE A;  1IBK I;  2B7V A;  4JI8 E;  2PNL A;  4DV0 E;  4Z7Y A;  4JYA I;  1T4L B;  4LF6 E;  2HHH I;  1SR9 A;  2VF1 A;  4IZJ B;  2L92 A;  5AAS A;  2HK2 A;  3Q6N A;  2VQE I;  3J7A M;  1XNR E;  2IHR 1;  1Z0V A;  4HAC B;  4DR1 I;  4LF9 E;  1ZXN A;  1A6F A;  2WW4 A;  2UUA E;  2HKE A;  5GME A;  4DR3 I;  2CG9 A;  2GQ0 A;  4R8O A;  4N3O A;  3ZZT A;  2LUQ A;  1IBL E;  3ADG A;  4DUY I;  3FIG A;  5T6J A;  2BM0 A;  1Z0W A;  1XNR I;  2UXC I;  1Y6Z A;  2DB2 A;  2Z5B B;  1S16 A;  4GEQ B;  5BR8 I;  2V8P A;  2CPN A;  1H74 A;  2A2D A;  1N0U A;  4DR2 I;  2UUA I;  3AUZ A;  5LMU I;  4JI2 E;  1RQ0 A;  4DR7 E;  1IBL I;  4P7D A;  4GKJ I;  2Z5C A;  3J81 Q;  2O1U A;  4DR4 I;  2E5L E;  2H36 X;  2IOP A;  4FW9 A;  3VYY A;  2BV3 A;  4OX9 E;  3LPS A;  3LTO A;  2VF3 A;  4JI2 I;  3GON A;  4DR7 I;  1XHK A;  4M2Z A;  1UEK A;  3K17 A;  4MYT A;  3IWC A;  4BBY A;  4LF7 E;  2V86 A;  1J26 A;  1MX0 A;  3F6H A;  4L5N C;  4LF8 E;  1Z0E A;  1HNW E;  2OI2 A;  2UUB E;  5ADZ A;  4TUG A;  1XNQ E;  4R03 A;  2V2V A;  2EFG A;  1B62 A;  1GZ6 A;  4EMD A;  3IWD A;  1N32 E;  1IBM E;  4JI0 E;  1FWK A;  1NHJ A;  3HPZ A;  4X65 E;  1PVG A;  2NA2 A;  4DV4 I;  2O1V A;  2M1S A;  4LF8 I;  2A2C A;  4B3R E;  3JU0 A;  1NHH A;  5L3J A;  4B3S I;  4RPF A;  4B3T I;  5IWA E;  4IZJ D;  1USU A;  1FJG E;  1H73 A;  2VE7 C;  4DV7 E;  4JV5 E;  4LF4 E;  4JI5 E;  1EI1 A;  4KQV A;  3T1Y I;  3V5R A;  3QT6 A;  4JI0 I;  4KHP I;  1XMQ E;  1WHN A;  1ZBQ A;  1B63 A;  1MG7 A;  1QU6 A;  4DPT A;  4X64 I;  4DR6 E;  2YZT A;  2DIX A;  2E1M A;  2JWO A;  3J80 C;  4LTY A;  1XMO E;  4PRX A;  2Q2E B;  4JI1 E;  4JI5 I;  2V89 A;  4USK A;  4Q28 A;  4R1F A;  4OOG C;  1T4O A;  1N36 I;  1N33 E;  1Z0C A;  1HR0 E;  2LBS B;  4HY1 A;  3V2U C;  3CWV A;  4IZK B;  4YY3 I;  2LMZ A;  2JVA A;  3PYE A;  4JI4 I;  4DV1 E;  1D6T A;  1Z0G A;  2KOU A;  4JI3 E;  4DUZ I;  4X66 E;  4DV5 E;  1YZ9 A;  4JI6 E;  4USM A;  4GKK E;  4B3M E;  4FWG A;  2RS7 A;  2MC6 A;  2ODR D;  1HNX E;  4JI8 I;  3JAM C;  2KON A;  4DV0 I;  4BMJ A;  4LFC E;  1USV A;  4FWD A;  4LF6 I;  4JI7 E;  2V85 A;  1ZM3 A;  4X62 E;  4P52 A;  2IOQ A;  2EWL A;  4JI3 I;  4X66 I;  1GQE A;  3J7Y p;  4JI6 I;  3WU3 A;  3HXL A;  4LF9 I;  1Y4U A;  4AQY E;  5GMD A;  1NHI A;  2NUF A;  1YYW A;  4WUD A;  3WU5 A;  4Z7C A;  1KVK A;  4LFA E;  5FWK A;  1FNM A;  1ZM4 A;  2X36 A;  5IT9 C;  1ZM2 A;  3QT8 A;  4F9A B;  4PRV A;  2DEI A;  1DAR A;  2L6M A;  2RTX A;  2LJP A;  2V2Q A;  3QT7 A;  4AQY I;  3J7A G;  1WHQ A;  2V83 A;  3PYF A;  2NPF A;  4M0V A;  2F4V E;  5FLX C;  2L2N A;  5AE3 A;  1FKA E;  4YHH E;  2V88 A;  2LRS A;  4LFB E;  3PYG A;  5LMN E;  4DMI A;  2ODR C;  3ADJ A;  4WUC A;  3HJC A;  2E5L I;  1J5E E;  1YYK A;  2HKJ A;  2ZIT A;  3M6A A;  1Z59 A;  1ELO A;  4DV6 E;  4X8W A;  2LTR A;  4DR5 E;  2R42 A;  2Z5C B;  4OX9 I;  5F3W A;  2V8Q B;  2B9D A;  4DPX A;  2JOB A;  1K47 A;  1N0V C;  4DV2 E;  4YHH I;  2F4V I;  3P1X A;  3JTZ A;  4JG4 A;  4I8O A;  3B78 A;  2UUC E;  4K0K E;  2VQF E;  4LF7 I;  3T1H E;  2HFS A;  1PIE A;  3AV0 A;  3C4B A;  3ZKB A;  4DU7 A;  1HNW I;  4DV6 I;  2UUB I;  1XNQ I;  4BS9 A;  4WPY A;  4BC7 A;  4UT4 A;  3ZZU A;  2J7K A;  1T4N A;  4NXM E;  2X7I A;  4DV2 I;  2FV4 B;  2AJ4 A;  4DPU A;  1N32 I;  4NXN E;  1IBM I;  5A2Q C;  4F9B B;  2R3V A;  2Z5E A;  4X65 I;  3T1H I;  3OTO E;  3PYD A;  3QT5 A;  1FWL A;  4HXZ A;  3HTX A;  4B3R I;  1ZM9 A;  3WU4 A;  1O0W A;  2L33 A;  2FTX B;  3KWR A;  1EA6 A;  5IWA I;  4DV3 E;  1FJG I;  1N34 E;  4DV7 I;  2MDR A;  1Z0B A;  2LJH A;  2L2K B;  4LF4 I;  4JV5 I;  1I94 E;  4NXM I;  1IBK E;  4IZJ A;  1ZXM A;  4WUB A;  3ZZ0 A;  1S4E A;  1XMQ I;  2JR1 A;  3H4L A;  4JYA E;  4HAC A;  1BKN A;  4DR6 I;  3D4J A;  2HHH E;  3F6G A;  2RS6 A;  2YT4 A;  1Z5B A;  2B7T A;  4LU9 A;  2VQE E;  1XMO I;  2ZM6 E;  2LTS A;  2G7H A;  3Q1Q A;  1YYO A;  1WUU A;  4DR1 E;  3IWB A;  1WXR A;  4WYQ B;  4JI1 I;  1H7S A;  1I94 I;  1EKZ A;  2GS8 A;  2NUE A;  1U2R A;  3J80 Q;  2ZBK B;  1N33 I;  4DR3 E;  1VIS A;  2Z5B A;  3LNU A;  3DJW A;  1HR0 I;  2L3J A;  3ADI A;  3RMP A;  3OML A;  1DI2 A;  1Z0T A;  4DV1 I;  4DUY E;  4F9C B;  2HK3 A;  2ZM6 I;  4DV5 I;  2UU9 E;  2UXC E;  2PNM A;  3H09 A;  4ED4 A;  2V87 A;  4GKK I;  3ZOQ B;  3VK6 A;  5BR8 E;  2HFU A;  4B3M I;  1HNX I;  2NUG A;  4DPW A;  1H7U A;  2N3G A;  4DR2 E;  4TUI A;  3J81 C;  4I3H A;  4LFC I;  1Z5C A;  1HK7 A;  2FGG A;  5LMU E;  1ZBT A;  4L8N A;  4JI7 I;  3K85 A;  3ZM7 A;  4ZVI A;  3WU6 A;  4X62 I;  3HQ1 A;  1KIJ A;  4GKJ E;  3JAM Q;  4LF5 E;  2UU9 I;  4KZS A;  3PRY A;  3ADL A;  4DR4 E;  2DSY A;  1UHZ A;  4DXL A;  2JY9 A;  1RC7 A;  1DQ3 A;  4PU9 A;  4LFA I;  2LUP B;  4HYM A;  4WSP A;  2LE2 A;  3P06 A;  1QZR A;  1HNZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...