4DUZE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzE02
3PYDA 4DV1I 2OI2A 3J80Q 3B82A 3VYYA 4LF8I 3V2UC 4JI7E 2LUQA 2HKJA 1N0UA 3LNUA 2BM1A 3HTXA 2NUEA 4WUBA 1YYOA 1NHIA 4HXZA 4DPYA 2NUFA 4X66E 1WUUA 3K17A 1NHJA 2AJ4A 3C4BA 2LRSA 2VQEI 2UXCE 2VQEE 3WU5A 4JI5I 2F4VE 4K0KI 1Z0BA 1Z0GA 1S4EA 5LMNE 1FNMA 2ZM6I 2L2KB 4GKKI 4KHPI 4ZVIA 2VQFI 4LF7E 2V2ZA 4DR3I 1FKAE 1NHHA 1Z0EA 1S16A 1IBKE 4P7AA 4MYUA 3OTOI 4LF4I 2V34A 1BKNA 4UT4A 1N33I 1Z0WA 4DR4I 4URLA 4LF5E 1H7SA 4X64E 4DR6I 1RR9A 3F0NA 2L3JA 4JI8I 1ZM3A 4OX9E 3GONA 1X47A 2E5LI 1WHQA 4X64I 2R3VA 2KHXA 1XNRE 4DR1I 4DXLA 4DR5I 3ZM7A 4DV6I 4KQVA 3B78A 4DPTA 4LF6E 1GQEA 1HNXI 2DB2A 2HFSA 4JYAE 2L2NA 1IBLI 1STUA 5IWAE 5GMEA 4DR3E 4HYMA 4LF7I 3ZZ0A 4WUCA 1X49A 1PIEA 4LF9E 5GMDA 4LFBI 4DPUA 1OJ4A 2Q2EB 2UXBE 3WU6A 2XEXA 4DR2I 1X48A 4JI3E 2UUAE 2JVAA 2N3GA 2RSMA 4DV4E 2DEJA 4B3RE 4JI6I 4WFTA 3JAMQ 4JI8E 2WW4A 1ZBTA 3K1JA 4DPXA 4JI2E 4GKJI 1ZM4A 4Z7CA 1FJGE 4LF8E 4HY1A 1IBME 4B3SI 2LTRA 1XMOE 4B3SE 2R42A 4EMDA 3OTOE 4PRVA 3ZZTA 4DUZI 4JI0E 1I94I 1UEKA 5L3JA 2VF3A 4DR7I 2NPFA 4WYQB 4USMA 5LMUI 4JI4E 1XMQI 4KHPE 3M6AA 2UUCI 4HACB 4X8WA 1Z0TA 4DV7E 4DV2I 4LFCI 5FLXQ 4JI3I 1RQ0A 1HNZI 2RTXA 2RS7A 5A2QC 1FWKA 3PYEA 2X36A 2UUBE 2J7KA 4DV3I 1ZXMA 4DV4I 3WU3A 1RREA 3VYXA 1EI1A 4DU7A 2B3TB 4B3TI 4DV6E 4AQYI 2YT4A 4DR1E 1XNRI 2L2MA 2E5LE 1FI4A 3T1YE 1DARA 5IWAI 1Z59A 2MDRA 4DUYE 4OOGC 1NZ0A 1KIJA 4HACA 4M30A 1RC7A 3P1XA 1Z5BA 4FW9A 3J7AM 2B7VA 4FWHA 3J7Yp 4LF4E 1N36E 4DV5E 2UUCE 3LLHA 1XHKA 1O0WA 1HNWE 4NXNE 3C4TA 1XNQI 4JV5I 4JG4A 3J80C 2BM0A 1EKZA 1N34E 4AQYE 4DR4E 1N32E 1ZM9A 4JI0I 1T4NA 2LJHA 4B3TE 2ZM6E 4DU8A 3ADIA 4K0KE 2F4VI 1XMOI 4M2ZA 1ELOA 1IBMI 4JI5E 3ADJA 1H73A 2ZITA 1FJGI 2UXCI 3T1HE 1T4LB 2A2CA 2L33A 3QT7A 3T1HI 4JI2I 1H72C 3QT5A 2VQFE 4X62E 4GKKE 4X62I 2UXDI 1H7UA 4JI6E 4B3RI 5LMNI 2DEIA 1XNQE 4JV5E 4JI1I 3D4JA 2JY9A 3LPSA 1MG7A 1HR0E 1N36I 3LTOA 1YYKA 3HULA 4UTGA 1K47A 4DV2E 2ZBKB 4DV7I 5CFFE 3Q1QA 1Z5CA 2UU9I 4FWDA 2DMYA 4USKA 1KKHA 4X65I 4PRXA 4YHHE 1PVGA 3ZKDA 2UU9E 1N0VC 2LUPB 2V8PA 4OX9I 1HR0I 4YY3E 4DV0E 1MU5A 1Z0CA 3V5RA 1MX0A 1UILA 3QT6A 2UUAI 4DV0I 1N33E 2EFGA 1WHNA 2UXBI 1J26A 4LFBE 3ZKBA 3PYGA 4XTJA 4DKKA 2N3HA 2DIXA 3WU4A 2UUBI 4LFCE 1T4OA 1J5EE 5IT9Q 3H4LA 2HFUA 2LBSB 4X65E 2GS8A 1N34I 1YYWA 5LL6R 3ZZUA 2HK3A 4LF6I 4NXNI 1ZM2A 2LJPA 4DR7E 2CZ9A 4DV5I 4DUZE 1DI2A 1H74A 1Z5AA 1QZRA 4X66I 4NXME 4LFAI 4JI1E 1XMQE 4FN5A 5LMUE 2BV3A 2NUGA 4WUDA 4PU9A 1I94E 2UXDE 3J81Q 4DUYI 1U2RA 2RS6A 4Z7YA 1ZXNA 4LFAE 4ED4A 4P52A 1J5EI 4NXMI 1VISA 4MYTA 4I3HA 1KVKA 2L3CA 3CWVA 2EZ6A 3B8HA 1UHZA 4DV1E 1IBKI 2IHR1 4GKJE 4B3MI 1FWLA 5A2QQ 1YZ9A 4DR2E 2V2QA 2A2DA 1PKPA 2HHHI 4LF9I 1EA6A 1N32I 1Z0VA 3PYFA 5FLXC 4DV3E 1QU6A 1B62A 3JAMC 3J81C 5IT9C 1HNWI 3J7AG 1IBLE 4FWGA 1B63A 2LTSA 5BR8I 4M1KA 4R1FA 2E1RA 1HNZE 4RPFA 4JYAI 1HNXE 5BR8E 3QT8A 2X7IA 4DR5E 3ADGA 2HK2A 2HKEA 2NA2A 4YHHI 1A6FA 4DPWA 2B7TA 4JI7I 2HHHE 2CPNA 3T1YI 4YY3I 1D6TA 4DR6E 4JI4I 1KTVA 4LF5I 2V2VA 4B3ME 3ADLA
chains in the Genus database with same CATH superfamily
4DMIA 3M99B 3PYDA 2YTOA 4DV1I 2OI2A 3J80Q 2C38A 5KL2A 1WXRA 3B82A 3VYYA 1ZR9A 2DLKA 5K36E 4LF8I 2EQ3A 3U1KA 4BA2A 4IFDC 2YRMA 3V2UC 4JI7E 1A1KA 2LUQA 2HKJA 1N0UA 3LNUA 2BM1A 5K36A 3HTXA 1Y60A 2NUEA 2L92A 4WUBA 4IZJB 1YYOA 1KJKA 1NHIA 4HXZA 4DPYA 4MU4A 5C0XD 2EE8A 1P42A 1A1JA 3ZOQB 1YPNA 2PRTA 2EMHA 4X66E 1JK1A 4GEQB 2NUFA 1L4SA 5DNYA 1WUUA 1NHJA 3K17A 5C0XC 4R2DA 3L7ZB 2AJ4A 3C4BA 2LRSA 2EMBA 4ZYHA 2VQEI 2UXCE 2DMIA 5LLQA 2VQEE 1YUJA 3WU5A 1EH7A 4JI5I 2F4VE 4K0KI 4BC7A 1Z0BA 1Z0GA 2O1VA 1S4EA 5LMNE 1SFEA 4O5GA 1FNMA 2ZM6I 2BBGA 1T39A 1TF3A 1A1FA 3Q6NA 2JEBB 2EN8A 2EL6A 5EKWA 4RH8A 2L2KB 4GKKI 4Q35B 4KHPI 4OKGA 4ZVIA 2VQFI 3AUZA 4LF7E 2EPKX 2EMZA 4BCAA 2V2ZA 4DR3I 1FKAE 1NHHA 1Z0EA 3HPZA 1S16A 1IBKE 2C39B 4R03A 4P7AA 2O1WA 4MYUA 2IESA 4NZVA 5AASA 3OTOI 4LF4I 5DRRA 2EM3A 2EP3A 2EOOA 4F2JC 3GLLA 4R2SA 2Q8UA 2V34A 1BKNA 4UT4A 1N33I 3EPJA 2BB8A 1Z0WA 2FTXB 4LTYA 2CVEA 4EMDA 4DR4I 2N8XA 2YTFA 4X9JA 4URLA 4LF5E 1H7SA 2JR1A 5KL6A 4X64E 1LLMC 5ELWA 4F6MA 4DR6I 1RR9A 1WJPA 3F0NA 2EQ0A 2L3JA 1Y4SA 2YTQA 5KL4A 4JI8I 1ZM3A 4MU0A 4IFDB 3P76A 2EPUA 4J3DA 4OX9E 3GONA 1X47A 2JOXA 4WX9A 2WCC3 1P47A 2E5LI 1WHQA 4X64I 4IFDA 2R3VA 4RHBB 2KHXA 1XNRE 4DR1I 2FV4B 4DXLA 4DR5I 3ZM7A 4DV6I 3IWCA 2GO3A 4FW6A 5JEAA 4FK5C 4KQVA 3B78A 4DPTA 4LF6E 4R8OA 1GQEA 3HPSA 1BB8A 1HNXI 2DB2A 2HFSA 4JYAE 4KWYA 1YSAC 2LV2A 2L2NA 1UDQA 2NN6F 5JEAD 2EL5A 2EOYA 3GMEA 1IBLI 1STUA 2D9HA 5IWAE 2IOQA 5GMEA 1G2DC 4DR3E 4HYMA 2EN1A 2EL4A 4LF7I 2VF1A 3ZZ0A 2JP9A 3PS3A 4FW4A 4WUCA 1X49A 2EM2A 1PIEA 1X6FA 4LF9E 5GMDA 2PNZB 4LFBI 2HJJA 1VI7A 4DPUA 3THNA 4WSPA 1OJ4A 2Q2EB 2EM8A 2UXBE 3WU6A 2EJ4A 4J8ZA 5A6BA 2XEXA 2DGCA 4N3OA 1X48A 4DR2I 4JI3E 2UUAE 4GZNC 2EOSA 2JVAA 4BHBA 2YTEA 2N3GA 1UDNA 2MC6A 2RSMA 5AE2A 3VHTB 4DV4E 1IMUA 2DEJA 4B3RE 4JI6I 2JEAB 4WFTA 3UHMA 3JAMQ 5K36D 2NABA 3JU0A 4R2EA 4JI8E 2FGGA 1ZBQA 2WW4A 2LCEA 2CG9A 3KZYA 1ZBTA 3K1JA 4DPXA 5K36C 4F9CB 2C37A 4JI2E 4ZYEA 5IXMB 3PS2A 4GKJI 4WPYA 1ZM4A 4Z7CA 3P3CA 4LCGA 1FJGE 4ZYDA 4LF8E 4HY1A 2WBTA 1IBME 4B3SI 2LTRA 1XMOE 3K85A 4B3SE 4L8NA 2J7JA 2DRPA 2R42A 4IFDD 2ELZA 4WXCA 1OYPA 3OTOE 2JE6B 3LMLA 2CT1A 4PRVA 2L6MA 1EH8A 3ZZTA 4DUZI 2EMIA 1ZU1A 3RMPA 4JI0E 1I94I 1X6EA 1UEKA 3QG5C 2VF3A 5L3JA 4DR7I 2EMGA 2C39A 2NPFA 1DGCA 4WYQB 3PS1A 2ODRD 2JYAA 4JI4E 4USMA 5LMUI 2AE8A 2EMWA 4KHPE 2M9AA 3M6AA 1XMQI 4MLVA 2MC5A 2UUCI 1IQOA 3AV0A 4HACB 4X8WA 1Z0TA 2EOIA 4O43A 2JPAA 1E3PA 2ADRA 4DV7E 4DV2I 1YH8A 2GQ0A 1X6HA 2NN6C 2EMLA 4F54A 2E72A 4LFCI 5FLXQ 4LPFA 4JI3I 3P3EA 3C6MA 4NBQA 4OO1C 1RQ0A 1TF6A 3DF6A 1YHCA 5DNXA 2K4VA 1HNZI 2BA0D 5T6JA 5A6JA 3M85G 2RSIA 2RS7A 2RTXA 1PJQA 5A2QC 1FWKA 2YTDA 5JEAB 3PYEA 2X36A 1A1GA 1BBOA 4IZKB 4R2PA 2UUBE 2J7KA 5F3WA 1ZXMA 4DV3I 4DV4I 1X5WA 3MHHC 3WU3A 2JT2A 4OZEA 2EM6A 1USUA 2M7QA 2YZTA 1MGTA 1RREA 2F8BA 4LCFA 2Z5CB 2RQLA 2C37B 3VYXA 3EPLA 2IERA 1Y6ZA 1EI1A 4IZJA 2I9IA 2WP8A 4DU7A 5C0XF 2IOPA 2B3TB 4B3TI 2V83A 4DV6E 4AQYI 2YT4A 3M7NG 4O4KA 4DR1E 2L2MA 3CDIA 1XNRI 2ODRC 1PJSA 4P78A 4F6NA 2E5LE 2BA0G 4Q28A 3JTZA 2PNZA 4IS1C 2EPMX 2EMXA 1FI4A 3T1YE 1DARA 5IWAI 1Z59A 2MDRA 1JK2A 4DUYE 4N4RB 5KL7A 4OOGC 5A6BD 5A6KA 1NZ0A 1KIJA 4HACA 2EN6A 4M30A 2LO3A 2ENAA 1RC7A 2YRHA 3P1XA 1Z5BA 3PRYA 3DD6A 4FW9A 2MKDA 2EN7A 3J7AM 2YTNA 2BR2A 2B7VA 4P7DA 2V89A 4FWHA 4KZSA 4MLQA 3J7Yp 4LF4E 3H1CA 1DQ3A 3P06A 1N36E 2EORA 2Z5CA 2EWLA 4DV5E 5C0XB 2UUCE 2EMFA 3LLHA 4BS9A 1XHKA 1O0WA 1GTKA 1A1HA 4NXNE 1HNWE 3C4TA 4HEIA 1XNQI 1A1IA 4JV5I 4JG4A 5IV8B 4R2QA 2YSPA 3J80C 2BM0A 1RMDA 1EKZA 1N34E 4AQYE 1IQSA 4DR4E 3KWRA 1N32E 1ZM9A 4JI0I 1T4NA 2LJHA 4B3TE 3EPHA 2ZM6E 1BBGA 3KRNA 2EM7A 4DU8A 3ADIA 2JXPA 3THOB 4K0KE 3BIDA 4M2ZA 1ELOA 2VESA 4JI5E 1XMOI 3ADJA 4AIMA 1H73A 2ZITA 1IBMI 4MQYA 1FJGI 2UXCI 3T1HE 2RPCA 1T4LB 2A2CA 2L33A 5AE3A 2MKNA 5C0XA 2PO1B 3QT7A 3T1HI 2EM5A 2EPOA 4JI2I 3BF2A 1H72C 3QT5A 1G2FC 2VQFE 4I8OA 4X62E 2A25A 2YTGA 4GKKE 1E3HA 3CDJA 3K6QA 2BA1D 2JWOA 2JEAA 1N3GA 4X62I 2UXDI 2EN3A 4WXDA 1UN6B 1H7UA 2YSOA 4JI6E 3UK3C 2O3ZA 4B3RI 2H36X 2PNMA 1YFHA 5LMNI 2DEIA 1XNQE 4JV5E 2BR2B 3D4JA 2EOJA 2JY9A 1OYRA 4JI1I 3LPSA 2JEBA 1QNTA 2CTDA 1EH6A 1MG7A 5DNLA 5KL5A 1HR0E 4BA1B 1N36I 2GLIA 3LTOA 1WRJA 1YYKA 3HULA 4UTGA 1K47A 2R76A 4DV2E 2Z5EA 2ZBKB 5CFFE 4DV7I 2JE6A 3Q1QA 2PO2A 2EOMA 2GHFA 2R1FA 2YTPA 3U1YA 1Z5CA 1XXEA 2PO0A 2EPRA 1ZAAC 5A69A 2ENCA 2EPNA 3HQ1A 2UU9I 1X3CA 2M4IA 3B4TA 4FWDA 4OO1E 2DMYA 4USKA 1T38A 5FWKA 1KKHA 2WNRA 4X65I 4MDTA 2EPZA 2F4VI 3HKMA 3M85D 2G7HA 4IZJD 5EL9A 2WP8B 4PRXA 4YHHE 1PVGA 4LOMA 2EM4A 2EPLX 3HXLA 3ZKDA 2PNLA 4ISAA 4IFDE 2UU9E 1N0VC 4F9BB 4BC9A 3Q6MA 2LUPB 2V8PA 4LCHA 4BA2B 4WSGA 1B69A 2JOBA 2LMZA 4OO1A 4R2AA 4HTGA 2ELYA 2EM9A 5AC5A 2J65A 2Z5BA 4IZKA 2WNRB 4OX9I 3H09A 2EMAA 2NN6E 1HR0I 4YY3E 4DV0E 1MU5A 3EPKA 2EOHA 3OMLA 2V8QB 1Z0CA 2F1DA 1AH5A 1UDOA 3V5RA 3ECRA 1MX0A 2VRDA 1UILA 2YU5A 3QT6A 4MU3A 2ENHA 3VK6A 2CGEA 3FIGA 2EOEA 2UUAI 4DV0I 4F9AB 5AC4A 2E1MA 2EOQA 1N33E 2EFGA 1WHNA 2UXBI 4TUIA 4FW7A 1R6MA 2EQ1A 3HJCA 1J26A 4LFBE 2WZOA 3ZKBA 2Z5BB 2HGHA 3PYGA 2M1SA 2NN6B 1Y5YA 4FW3A 4XTJA 4DKKA 2N3HA 4U3DA 4OO1B 4OO1F 2DIXA 3WU4A 2UUBI 4LFCE 4NHRA 2DSYA 3L00A 1T4OA 2YRKA 2L8TA 4M0VA 3M7ND 3C6KA 1J5EE 2EPPA 1RHYA 2HFUA 3H4LA 5IT9Q 5DRQA 2WBUA 1NCSA 5JEAF 5C0XE 2WBSA 2LBSB 3BGHA 1GZ6A 4X65E 2GS8A 1N34I 2EPAA 4QNKA 5DRPA 4GQUA 1YYWA 5LL6R 2PO1A 4O24A 3ZZUA 1R6LA 1UDSA 2EOXA 3DJWA 1SR9A 2HK3A 4NXNI 1ZM2A 2LJPA 4DR7E 4LF6I 5KL3A 2YTIA 2CZ9A 2GO4A 4DV5I 1F2IG 1HK7A 4U3BA 4DUZE 3GCMA 2V87A 3IWDA 1DI2A 1H74A 4BMJA 1UBDC 1Z5AA 1QZRA 2YTJA 2DLQA 1YUIA 2BA1G 4X66I 4BHCA 4NXME 4LFAI 3P3GA 5K36B 4JI1E 1XMQE 4FN5A 2CSHA 5LMUE 4BBYA 1OYSA 2BV3A 3BBGA 2KOUA 2NUGA 2PO0B 2EOFA 4QNJA 4TUGA 4WUDA 2K7IA 2V88A 4PU9A 1I94E 2UXDE 5JEAE 3J81Q 4DUYI 2EN2A 2I13A 1A1LA 2LVHA 1U2RA 2KONA 4BA1A 4IFDF 2RS6A 4Z7YA 1TN9A 4LFAE 2EN4A 1ZXNA 4P52A 4ED4A 1VISA 4MYTA 1J5EI 4NXMI 4I3HA 1KVKA 5DROA 2L3CA 4ZYGA 3CWVA 2EZ6A 3KZZA 3B8HA 1UHZA 2VE7C 4DV1E 1IBKI 1NEIA 2IHR1 2EMYA 1MEYC 2HC5A 4GKJE 1FWLA 1USVA 5A2QQ 2EPCA 4B3MI 1YZ9A 4DR2E 2V86A 2YPNA 2V2QA 5AE1A 2A2DA 1PKPA 2HHHI 4LF9I 5K36F 4M9VC 1EA6A 4LU9A 1N32I 4IJDA 1Z0VA 4R2CA 3PYFA 5FLXC 3J81C 1QU6A 3JAMC 4DV3E 1B62A 4L5NC 5IT9C 3L7ZA 4OO1D 2EPXA 2MDGA 1PDAA 4AM3A 1HNWI 2GPIA 2V85A 3J7AG 1IBLE 4FW5A 4FWGA 2O1TA 3NZKA 1B63A 2LTSA 5BR8I 4M1KA 4R1FA 2E1RA 3MSWA 1HNZE 4RPFA 2O1UA 5JEAC 4JYAI 3MHSC 5TSEA 4R2RA 1HNXE 2B9DA 2EMCA 5ADZA 5BR8E 3QT8A 2X7IA 1KYQA 2YWQA 2NN6A 4DR5E 3ADGA 2HK2A 2HKEA 1AAYA 2YU8A 2NA2A 2PO2B 4YHHI 1A6FA 2LJUA 3F6GA 3F6HA 4DPWA 2B7TA 3TQMA 2EMKA 1PJTA 2NN6D 4JI7I 4AIDA 2HHHE 2CPNA 2C38B 2LE2A 4MU1A 4YY3I 5A6AA 3T1YI 2EM0A 1D6TA 2LT7A 1Y4UA 4DR6E 3IWBA 1Z1BA 4JI4I 2EOZA 1KTVA 4IS9A 4LF5I 2V2VA 4B3ME 3ADLA 3EQ1A
chains in the Genus database with same CATH topology
4DMIA 3PYDA 4DV1I 2OI2A 3J80Q 1WXRA 3B82A 3VYYA 4LF8I 3V2UC 4JI7E 2LUQA 2HKJA 1N0UA 3LNUA 2BM1A 3HTXA 2NUEA 2L92A 4WUBA 4IZJB 1YYOA 1NHIA 4HXZA 4DPYA 3ZOQB 2NUFA 4X66E 1WUUA 4GEQB 3K17A 5DNYA 1NHJA 2AJ4A 3C4BA 2LRSA 2VQEI 2UXCE 2VQEE 3WU5A 4JI5I 2F4VE 4K0KI 4BC7A 1Z0BA 1Z0GA 2O1VA 1S4EA 5LMNE 1FNMA 2ZM6I 3Q6NA 2L2KB 4GKKI 4KHPI 4ZVIA 2VQFI 3AUZA 4LF7E 2V2ZA 4BCAA 4DR3I 1FKAE 1NHHA 1Z0EA 3HPZA 1S16A 1IBKE 4R03A 4P7AA 2O1WA 4MYUA 5AASA 3OTOI 4LF4I 2V34A 1BKNA 4UT4A 1N33I 1Z0WA 2FTXB 4LTYA 4DR4I 4URLA 4LF5E 1H7SA 2JR1A 4X64E 4DR6I 1RR9A 3F0NA 2L3JA 1Y4SA 4JI8I 1ZM3A 4OX9E 3GONA 1X47A 2JOXA 2E5LI 1WHQA 4X64I 2R3VA 2KHXA 1XNRE 4DR1I 2FV4B 4DXLA 4DR5I 3ZM7A 4DV6I 3IWCA 4KQVA 3B78A 4DPTA 4LF6E 4R8OA 1GQEA 3HPSA 1HNXI 2DB2A 2HFSA 4JYAE 2L2NA 1IBLI 1STUA 5IWAE 2IOQA 5GMEA 4DR3E 4HYMA 4LF7I 2VF1A 3ZZ0A 4WUCA 1X49A 1PIEA 4LF9E 5GMDA 4LFBI 4DPUA 1OJ4A 4WSPA 2Q2EB 2UXBE 3WU6A 4J8ZA 2XEXA 4N3OA 4DR2I 1X48A 4JI3E 2UUAE 2JVAA 2N3GA 2MC6A 2RSMA 5AE2A 4DV4E 2DEJA 4B3RE 4JI6I 4WFTA 3JAMQ 3JU0A 4JI8E 2FGGA 1ZBQA 2WW4A 2CG9A 1ZBTA 3K1JA 4DPXA 4F9CB 4JI2E 4GKJI 4WPYA 1ZM4A 4Z7CA 1FJGE 4LF8E 4HY1A 1IBME 4B3SI 2LTRA 1XMOE 3K85A 4B3SE 4L8NA 2R42A 4EMDA 3OTOE 4PRVA 3LMLA 2L6MA 3ZZTA 4DUZI 4JI0E 3RMPA 1I94I 1UEKA 5L3JA 2VF3A 4DR7I 2NPFA 4WYQB 4USMA 2ODRD 4JI4E 5LMUI 1XMQI 4KHPE 3M6AA 2MC5A 2UUCI 3AV0A 4HACB 4X8WA 1Z0TA 4DV7E 4DV2I 2GQ0A 4F54A 4LFCI 5FLXQ 4JI3I 1RQ0A 3DF6A 2K4VA 1HNZI 5T6JA 2RTXA 2RS7A 5A2QC 1FWKA 3PYEA 2X36A 4IZKB 2UUBE 2J7KA 5F3WA 1ZXMA 4DV3I 4DV4I 3WU3A 1USUA 2M7QA 2YZTA 1RREA 2F8BA 2Z5CB 3VYXA 1Y6ZA 1EI1A 4IZJA 4DU7A 2IOPA 2B3TB 4B3TI 2V83A 4DV6E 4AQYI 2YT4A 4DR1E 1XNRI 2L2MA 2ODRC 4P78A 2E5LE 4Q28A 3JTZA 1FI4A 3T1YE 1DARA 5IWAI 1Z59A 2MDRA 4DUYE 4OOGC 1NZ0A 1KIJA 4HACA 4M30A 1RC7A 3P1XA 1Z5BA 3PRYA 4FW9A 3J7AM 2B7VA 4P7DA 2V89A 4FWHA 4KZSA 3J7Yp 4LF4E 1DQ3A 3P06A 1N36E 2Z5CA 2EWLA 4DV5E 2UUCE 3LLHA 4BS9A 1XHKA 1O0WA 1HNWE 4NXNE 3C4TA 1XNQI 4JV5I 4JG4A 3J80C 2BM0A 1EKZA 1N34E 4AQYE 4DR4E 3KWRA 1N32E 1ZM9A 4JI0I 1T4NA 2LJHA 4B3TE 2ZM6E 4DU8A 3ADIA 4K0KE 2F4VI 1XMOI 4M2ZA 1ELOA 1IBMI 4JI5E 3ADJA 1H73A 2ZITA 1FJGI 2UXCI 3T1HE 1T4LB 2A2CA 2L33A 5AE3A 3QT7A 3T1HI 4JI2I 1H72C 3QT5A 2VQFE 4I8OA 4X62E 4GKKE 3K6QA 2JWOA 4X62I 2UXDI 1H7UA 4JI6E 4B3RI 2H36X 2PNMA 5LMNI 2DEIA 1XNQE 4JV5E 3D4JA 4JI1I 2JY9A 3LPSA 1MG7A 1HR0E 1N36I 3LTOA 1YYKA 3HULA 4UTGA 1K47A 4DV2E 2Z5EA 2ZBKB 5CFFE 4DV7I 3Q1QA 1Z5CA 2UU9I 3HQ1A 2M4IA 4FWDA 2DMYA 4USKA 5FWKA 1KKHA 4X65I 2G7HA 4IZJD 4PRXA 4YHHE 1PVGA 3HXLA 3ZKDA 2PNLA 2UU9E 1N0VC 4F9BB 4BC9A 3Q6MA 2LUPB 2V8PA 2JOBA 2LMZA 2Z5BA 4IZKA 4OX9I 3H09A 1HR0I 4YY3E 4DV0E 1MU5A 3OMLA 2V8QB 1Z0CA 3V5RA 1MX0A 1UILA 3QT6A 3VK6A 2CGEA 3FIGA 2UUAI 4DV0I 4F9AB 2E1MA 1N33E 2EFGA 1WHNA 2UXBI 4TUIA 3HJCA 1J26A 4LFBE 2WZOA 3ZKBA 2Z5BB 3PYGA 2M1SA 4XTJA 4DKKA 2N3HA 2DIXA 3WU4A 2UUBI 4LFCE 2DSYA 1T4OA 2L8TA 4M0VA 1J5EE 5IT9Q 3H4LA 2HFUA 2LBSB 1GZ6A 4X65E 2GS8A 1N34I 1YYWA 5LL6R 3ZZUA 3DJWA 1SR9A 2HK3A 4NXNI 1ZM2A 2LJPA 4DR7E 4LF6I 2CZ9A 4DV5I 1HK7A 4DUZE 2V87A 3IWDA 1H74A 1DI2A 4BMJA 1Z5AA 1QZRA 4X66I 4NXME 4LFAI 4JI1E 1XMQE 4FN5A 5LMUE 4BBYA 2BV3A 2KOUA 2NUGA 4TUGA 4WUDA 2V88A 4PU9A 1I94E 2UXDE 3J81Q 4DUYI 1U2RA 2KONA 2RS6A 4Z7YA 1ZXNA 4LFAE 4ED4A 4P52A 1J5EI 4NXMI 1VISA 4MYTA 4I3HA 1KVKA 2L3CA 3CWVA 2EZ6A 3B8HA 1UHZA 2VE7C 4DV1E 1IBKI 2IHR1 4GKJE 1USVA 4B3MI 1FWLA 5A2QQ 1YZ9A 4DR2E 2V86A 2V2QA 5AE1A 2A2DA 1PKPA 2HHHI 4LF9I 1EA6A 1N32I 4LU9A 1Z0VA 3PYFA 5FLXC 3J81C 1QU6A 3JAMC 4DV3E 1B62A 4L5NC 5IT9C 1HNWI 2V85A 3J7AG 1IBLE 4FWGA 2O1TA 1B63A 2LTSA 5BR8I 4M1KA 4R1FA 2E1RA 3MSWA 1HNZE 4RPFA 2O1UA 4JYAI 1HNXE 2B9DA 5ADZA 5BR8E 3QT8A 2X7IA 4DR5E 3ADGA 2HK2A 2HKEA 2NA2A 4YHHI 1A6FA 3F6GA 3F6HA 4DPWA 2B7TA 4JI7I 2HHHE 2CPNA 3T1YI 2LE2A 4YY3I 1D6TA 1Y4UA 4DR6E 3IWBA 4JI4I 1KTVA 4LF5I 2V2VA 4B3ME 3ADLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYD A;  4DV1 I;  2OI2 A;  3J80 Q;  3B82 A;  3VYY A;  4LF8 I;  3V2U C;  4JI7 E;  2LUQ A;  2HKJ A;  1N0U A;  3LNU A;  2BM1 A;  3HTX A;  2NUE A;  4WUB A;  1YYO A;  1NHI A;  4HXZ A;  4DPY A;  2NUF A;  4X66 E;  1WUU A;  3K17 A;  1NHJ A;  2AJ4 A;  3C4B A;  2LRS A;  2VQE I;  2UXC E;  2VQE E;  3WU5 A;  4JI5 I;  2F4V E;  4K0K I;  1Z0B A;  1Z0G A;  1S4E A;  5LMN E;  1FNM A;  2ZM6 I;  2L2K B;  4GKK I;  4KHP I;  4ZVI A;  2VQF I;  4LF7 E;  2V2Z A;  4DR3 I;  1FKA E;  1NHH A;  1Z0E A;  1S16 A;  1IBK E;  4P7A A;  4MYU A;  3OTO I;  4LF4 I;  2V34 A;  1BKN A;  4UT4 A;  1N33 I;  1Z0W A;  4DR4 I;  4URL A;  4LF5 E;  1H7S A;  4X64 E;  4DR6 I;  1RR9 A;  3F0N A;  2L3J A;  4JI8 I;  1ZM3 A;  4OX9 E;  3GON A;  1X47 A;  2E5L I;  1WHQ A;  4X64 I;  2R3V A;  2KHX A;  1XNR E;  4DR1 I;  4DXL A;  4DR5 I;  3ZM7 A;  4DV6 I;  4KQV A;  3B78 A;  4DPT A;  4LF6 E;  1GQE A;  1HNX I;  2DB2 A;  2HFS A;  4JYA E;  2L2N A;  1IBL I;  1STU A;  5IWA E;  5GME A;  4DR3 E;  4HYM A;  4LF7 I;  3ZZ0 A;  4WUC A;  1X49 A;  1PIE A;  4LF9 E;  5GMD A;  4LFB I;  4DPU A;  1OJ4 A;  2Q2E B;  2UXB E;  3WU6 A;  2XEX A;  4DR2 I;  1X48 A;  4JI3 E;  2UUA E;  2JVA A;  2N3G A;  2RSM A;  4DV4 E;  2DEJ A;  4B3R E;  4JI6 I;  4WFT A;  3JAM Q;  4JI8 E;  2WW4 A;  1ZBT A;  3K1J A;  4DPX A;  4JI2 E;  4GKJ I;  1ZM4 A;  4Z7C A;  1FJG E;  4LF8 E;  4HY1 A;  1IBM E;  4B3S I;  2LTR A;  1XMO E;  4B3S E;  2R42 A;  4EMD A;  3OTO E;  4PRV A;  3ZZT A;  4DUZ I;  4JI0 E;  1I94 I;  1UEK A;  5L3J A;  2VF3 A;  4DR7 I;  2NPF A;  4WYQ B;  4USM A;  5LMU I;  4JI4 E;  1XMQ I;  4KHP E;  3M6A A;  2UUC I;  4HAC B;  4X8W A;  1Z0T A;  4DV7 E;  4DV2 I;  4LFC I;  5FLX Q;  4JI3 I;  1RQ0 A;  1HNZ I;  2RTX A;  2RS7 A;  5A2Q C;  1FWK A;  3PYE A;  2X36 A;  2UUB E;  2J7K A;  4DV3 I;  1ZXM A;  4DV4 I;  3WU3 A;  1RRE A;  3VYX A;  1EI1 A;  4DU7 A;  2B3T B;  4B3T I;  4DV6 E;  4AQY I;  2YT4 A;  4DR1 E;  1XNR I;  2L2M A;  2E5L E;  1FI4 A;  3T1Y E;  1DAR A;  5IWA I;  1Z59 A;  2MDR A;  4DUY E;  4OOG C;  1NZ0 A;  1KIJ A;  4HAC A;  4M30 A;  1RC7 A;  3P1X A;  1Z5B A;  4FW9 A;  3J7A M;  2B7V A;  4FWH A;  3J7Y p;  4LF4 E;  1N36 E;  4DV5 E;  2UUC E;  3LLH A;  1XHK A;  1O0W A;  1HNW E;  4NXN E;  3C4T A;  1XNQ I;  4JV5 I;  4JG4 A;  3J80 C;  2BM0 A;  1EKZ A;  1N34 E;  4AQY E;  4DR4 E;  1N32 E;  1ZM9 A;  4JI0 I;  1T4N A;  2LJH A;  4B3T E;  2ZM6 E;  4DU8 A;  3ADI A;  4K0K E;  2F4V I;  1XMO I;  4M2Z A;  1ELO A;  1IBM I;  4JI5 E;  3ADJ A;  1H73 A;  2ZIT A;  1FJG I;  2UXC I;  3T1H E;  1T4L B;  2A2C A;  2L33 A;  3QT7 A;  3T1H I;  4JI2 I;  1H72 C;  3QT5 A;  2VQF E;  4X62 E;  4GKK E;  4X62 I;  2UXD I;  1H7U A;  4JI6 E;  4B3R I;  5LMN I;  2DEI A;  1XNQ E;  4JV5 E;  4JI1 I;  3D4J A;  2JY9 A;  3LPS A;  1MG7 A;  1HR0 E;  1N36 I;  3LTO A;  1YYK A;  3HUL A;  4UTG A;  1K47 A;  4DV2 E;  2ZBK B;  4DV7 I;  5CFF E;  3Q1Q A;  1Z5C A;  2UU9 I;  4FWD A;  2DMY A;  4USK A;  1KKH A;  4X65 I;  4PRX A;  4YHH E;  1PVG A;  3ZKD A;  2UU9 E;  1N0V C;  2LUP B;  2V8P A;  4OX9 I;  1HR0 I;  4YY3 E;  4DV0 E;  1MU5 A;  1Z0C A;  3V5R A;  1MX0 A;  1UIL A;  3QT6 A;  2UUA I;  4DV0 I;  1N33 E;  2EFG A;  1WHN A;  2UXB I;  1J26 A;  4LFB E;  3ZKB A;  3PYG A;  4XTJ A;  4DKK A;  2N3H A;  2DIX A;  3WU4 A;  2UUB I;  4LFC E;  1T4O A;  1J5E E;  5IT9 Q;  3H4L A;  2HFU A;  2LBS B;  4X65 E;  2GS8 A;  1N34 I;  1YYW A;  5LL6 R;  3ZZU A;  2HK3 A;  4LF6 I;  4NXN I;  1ZM2 A;  2LJP A;  4DR7 E;  2CZ9 A;  4DV5 I;  4DUZ E;  1DI2 A;  1H74 A;  1Z5A A;  1QZR A;  4X66 I;  4NXM E;  4LFA I;  4JI1 E;  1XMQ E;  4FN5 A;  5LMU E;  2BV3 A;  2NUG A;  4WUD A;  4PU9 A;  1I94 E;  2UXD E;  3J81 Q;  4DUY I;  1U2R A;  2RS6 A;  4Z7Y A;  1ZXN A;  4LFA E;  4ED4 A;  4P52 A;  1J5E I;  4NXM I;  1VIS A;  4MYT A;  4I3H A;  1KVK A;  2L3C A;  3CWV A;  2EZ6 A;  3B8H A;  1UHZ A;  4DV1 E;  1IBK I;  2IHR 1;  4GKJ E;  4B3M I;  1FWL A;  5A2Q Q;  1YZ9 A;  4DR2 E;  2V2Q A;  2A2D A;  1PKP A;  2HHH I;  4LF9 I;  1EA6 A;  1N32 I;  1Z0V A;  3PYF A;  5FLX C;  4DV3 E;  1QU6 A;  1B62 A;  3JAM C;  3J81 C;  5IT9 C;  1HNW I;  3J7A G;  1IBL E;  4FWG A;  1B63 A;  2LTS A;  5BR8 I;  4M1K A;  4R1F A;  2E1R A;  1HNZ E;  4RPF A;  4JYA I;  1HNX E;  5BR8 E;  3QT8 A;  2X7I A;  4DR5 E;  3ADG A;  2HK2 A;  2HKE A;  2NA2 A;  4YHH I;  1A6F A;  4DPW A;  2B7T A;  4JI7 I;  2HHH E;  2CPN A;  3T1Y I;  4YY3 I;  1D6T A;  4DR6 E;  4JI4 I;  1KTV A;  4LF5 I;  2V2V A;  4B3M E;  3ADL A; 
#chains in the Genus database with same CATH topology
 4DMI A;  3M99 B;  3PYD A;  2YTO A;  4DV1 I;  2OI2 A;  3J80 Q;  2C38 A;  5KL2 A;  1WXR A;  3B82 A;  3VYY A;  1ZR9 A;  2DLK A;  5K36 E;  4LF8 I;  2EQ3 A;  3U1K A;  4BA2 A;  4IFD C;  2YRM A;  3V2U C;  4JI7 E;  1A1K A;  2LUQ A;  2HKJ A;  1N0U A;  3LNU A;  2BM1 A;  5K36 A;  3HTX A;  1Y60 A;  2NUE A;  2L92 A;  4WUB A;  4IZJ B;  1YYO A;  1KJK A;  1NHI A;  4HXZ A;  4DPY A;  4MU4 A;  5C0X D;  2EE8 A;  1P42 A;  1A1J A;  3ZOQ B;  1YPN A;  2PRT A;  2EMH A;  4X66 E;  1JK1 A;  4GEQ B;  2NUF A;  1L4S A;  5DNY A;  1WUU A;  1NHJ A;  3K17 A;  5C0X C;  4R2D A;  3L7Z B;  2AJ4 A;  3C4B A;  2LRS A;  2EMB A;  4ZYH A;  2VQE I;  2UXC E;  2DMI A;  5LLQ A;  2VQE E;  1YUJ A;  3WU5 A;  1EH7 A;  4JI5 I;  2F4V E;  4K0K I;  4BC7 A;  1Z0B A;  1Z0G A;  2O1V A;  1S4E A;  5LMN E;  1SFE A;  4O5G A;  1FNM A;  2ZM6 I;  2BBG A;  1T39 A;  1TF3 A;  1A1F A;  3Q6N A;  2JEB B;  2EN8 A;  2EL6 A;  5EKW A;  4RH8 A;  2L2K B;  4GKK I;  4Q35 B;  4KHP I;  4OKG A;  4ZVI A;  2VQF I;  3AUZ A;  4LF7 E;  2EPK X;  2EMZ A;  4BCA A;  2V2Z A;  4DR3 I;  1FKA E;  1NHH A;  1Z0E A;  3HPZ A;  1S16 A;  1IBK E;  2C39 B;  4R03 A;  4P7A A;  2O1W A;  4MYU A;  2IES A;  4NZV A;  5AAS A;  3OTO I;  4LF4 I;  5DRR A;  2EM3 A;  2EP3 A;  2EOO A;  4F2J C;  3GLL A;  4R2S A;  2Q8U A;  2V34 A;  1BKN A;  4UT4 A;  1N33 I;  3EPJ A;  2BB8 A;  1Z0W A;  2FTX B;  4LTY A;  2CVE A;  4EMD A;  4DR4 I;  2N8X A;  2YTF A;  4X9J A;  4URL A;  4LF5 E;  1H7S A;  2JR1 A;  5KL6 A;  4X64 E;  1LLM C;  5ELW A;  4F6M A;  4DR6 I;  1RR9 A;  1WJP A;  3F0N A;  2EQ0 A;  2L3J A;  1Y4S A;  2YTQ A;  5KL4 A;  4JI8 I;  1ZM3 A;  4MU0 A;  4IFD B;  3P76 A;  2EPU A;  4J3D A;  4OX9 E;  3GON A;  1X47 A;  2JOX A;  4WX9 A;  2WCC 3;  1P47 A;  2E5L I;  1WHQ A;  4X64 I;  4IFD A;  2R3V A;  4RHB B;  2KHX A;  1XNR E;  4DR1 I;  2FV4 B;  4DXL A;  4DR5 I;  3ZM7 A;  4DV6 I;  3IWC A;  2GO3 A;  4FW6 A;  5JEA A;  4FK5 C;  4KQV A;  3B78 A;  4DPT A;  4LF6 E;  4R8O A;  1GQE A;  3HPS A;  1BB8 A;  1HNX I;  2DB2 A;  2HFS A;  4JYA E;  4KWY A;  1YSA C;  2LV2 A;  2L2N A;  1UDQ A;  2NN6 F;  5JEA D;  2EL5 A;  2EOY A;  3GME A;  1IBL I;  1STU A;  2D9H A;  5IWA E;  2IOQ A;  5GME A;  1G2D C;  4DR3 E;  4HYM A;  2EN1 A;  2EL4 A;  4LF7 I;  2VF1 A;  3ZZ0 A;  2JP9 A;  3PS3 A;  4FW4 A;  4WUC A;  1X49 A;  2EM2 A;  1PIE A;  1X6F A;  4LF9 E;  5GMD A;  2PNZ B;  4LFB I;  2HJJ A;  1VI7 A;  4DPU A;  3THN A;  4WSP A;  1OJ4 A;  2Q2E B;  2EM8 A;  2UXB E;  3WU6 A;  2EJ4 A;  4J8Z A;  5A6B A;  2XEX A;  2DGC A;  4N3O A;  1X48 A;  4DR2 I;  4JI3 E;  2UUA E;  4GZN C;  2EOS A;  2JVA A;  4BHB A;  2YTE A;  2N3G A;  1UDN A;  2MC6 A;  2RSM A;  5AE2 A;  3VHT B;  4DV4 E;  1IMU A;  2DEJ A;  4B3R E;  4JI6 I;  2JEA B;  4WFT A;  3UHM A;  3JAM Q;  5K36 D;  2NAB A;  3JU0 A;  4R2E A;  4JI8 E;  2FGG A;  1ZBQ A;  2WW4 A;  2LCE A;  2CG9 A;  3KZY A;  1ZBT A;  3K1J A;  4DPX A;  5K36 C;  4F9C B;  2C37 A;  4JI2 E;  4ZYE A;  5IXM B;  3PS2 A;  4GKJ I;  4WPY A;  1ZM4 A;  4Z7C A;  3P3C A;  4LCG A;  1FJG E;  4ZYD A;  4LF8 E;  4HY1 A;  2WBT A;  1IBM E;  4B3S I;  2LTR A;  1XMO E;  3K85 A;  4B3S E;  4L8N A;  2J7J A;  2DRP A;  2R42 A;  4IFD D;  2ELZ A;  4WXC A;  1OYP A;  3OTO E;  2JE6 B;  3LML A;  2CT1 A;  4PRV A;  2L6M A;  1EH8 A;  3ZZT A;  4DUZ I;  2EMI A;  1ZU1 A;  3RMP A;  4JI0 E;  1I94 I;  1X6E A;  1UEK A;  3QG5 C;  2VF3 A;  5L3J A;  4DR7 I;  2EMG A;  2C39 A;  2NPF A;  1DGC A;  4WYQ B;  3PS1 A;  2ODR D;  2JYA A;  4JI4 E;  4USM A;  5LMU I;  2AE8 A;  2EMW A;  4KHP E;  2M9A A;  3M6A A;  1XMQ I;  4MLV A;  2MC5 A;  2UUC I;  1IQO A;  3AV0 A;  4HAC B;  4X8W A;  1Z0T A;  2EOI A;  4O43 A;  2JPA A;  1E3P A;  2ADR A;  4DV7 E;  4DV2 I;  1YH8 A;  2GQ0 A;  1X6H A;  2NN6 C;  2EML A;  4F54 A;  2E72 A;  4LFC I;  5FLX Q;  4LPF A;  4JI3 I;  3P3E A;  3C6M A;  4NBQ A;  4OO1 C;  1RQ0 A;  1TF6 A;  3DF6 A;  1YHC A;  5DNX A;  2K4V A;  1HNZ I;  2BA0 D;  5T6J A;  5A6J A;  3M85 G;  2RSI A;  2RS7 A;  2RTX A;  1PJQ A;  5A2Q C;  1FWK A;  2YTD A;  5JEA B;  3PYE A;  2X36 A;  1A1G A;  1BBO A;  4IZK B;  4R2P A;  2UUB E;  2J7K A;  5F3W A;  1ZXM A;  4DV3 I;  4DV4 I;  1X5W A;  3MHH C;  3WU3 A;  2JT2 A;  4OZE A;  2EM6 A;  1USU A;  2M7Q A;  2YZT A;  1MGT A;  1RRE A;  2F8B A;  4LCF A;  2Z5C B;  2RQL A;  2C37 B;  3VYX A;  3EPL A;  2IER A;  1Y6Z A;  1EI1 A;  4IZJ A;  2I9I A;  2WP8 A;  4DU7 A;  5C0X F;  2IOP A;  2B3T B;  4B3T I;  2V83 A;  4DV6 E;  4AQY I;  2YT4 A;  3M7N G;  4O4K A;  4DR1 E;  2L2M A;  3CDI A;  1XNR I;  2ODR C;  1PJS A;  4P78 A;  4F6N A;  2E5L E;  2BA0 G;  4Q28 A;  3JTZ A;  2PNZ A;  4IS1 C;  2EPM X;  2EMX A;  1FI4 A;  3T1Y E;  1DAR A;  5IWA I;  1Z59 A;  2MDR A;  1JK2 A;  4DUY E;  4N4R B;  5KL7 A;  4OOG C;  5A6B D;  5A6K A;  1NZ0 A;  1KIJ A;  4HAC A;  2EN6 A;  4M30 A;  2LO3 A;  2ENA A;  1RC7 A;  2YRH A;  3P1X A;  1Z5B A;  3PRY A;  3DD6 A;  4FW9 A;  2MKD A;  2EN7 A;  3J7A M;  2YTN A;  2BR2 A;  2B7V A;  4P7D A;  2V89 A;  4FWH A;  4KZS A;  4MLQ A;  3J7Y p;  4LF4 E;  3H1C A;  1DQ3 A;  3P06 A;  1N36 E;  2EOR A;  2Z5C A;  2EWL A;  4DV5 E;  5C0X B;  2UUC E;  2EMF A;  3LLH A;  4BS9 A;  1XHK A;  1O0W A;  1GTK A;  1A1H A;  4NXN E;  1HNW E;  3C4T A;  4HEI A;  1XNQ I;  1A1I A;  4JV5 I;  4JG4 A;  5IV8 B;  4R2Q A;  2YSP A;  3J80 C;  2BM0 A;  1RMD A;  1EKZ A;  1N34 E;  4AQY E;  1IQS A;  4DR4 E;  3KWR A;  1N32 E;  1ZM9 A;  4JI0 I;  1T4N A;  2LJH A;  4B3T E;  3EPH A;  2ZM6 E;  1BBG A;  3KRN A;  2EM7 A;  4DU8 A;  3ADI A;  2JXP A;  3THO B;  4K0K E;  3BID A;  4M2Z A;  1ELO A;  2VES A;  4JI5 E;  1XMO I;  3ADJ A;  4AIM A;  1H73 A;  2ZIT A;  1IBM I;  4MQY A;  1FJG I;  2UXC I;  3T1H E;  2RPC A;  1T4L B;  2A2C A;  2L33 A;  5AE3 A;  2MKN A;  5C0X A;  2PO1 B;  3QT7 A;  3T1H I;  2EM5 A;  2EPO A;  4JI2 I;  3BF2 A;  1H72 C;  3QT5 A;  1G2F C;  2VQF E;  4I8O A;  4X62 E;  2A25 A;  2YTG A;  4GKK E;  1E3H A;  3CDJ A;  3K6Q A;  2BA1 D;  2JWO A;  2JEA A;  1N3G A;  4X62 I;  2UXD I;  2EN3 A;  4WXD A;  1UN6 B;  1H7U A;  2YSO A;  4JI6 E;  3UK3 C;  2O3Z A;  4B3R I;  2H36 X;  2PNM A;  1YFH A;  5LMN I;  2DEI A;  1XNQ E;  4JV5 E;  2BR2 B;  3D4J A;  2EOJ A;  2JY9 A;  1OYR A;  4JI1 I;  3LPS A;  2JEB A;  1QNT A;  2CTD A;  1EH6 A;  1MG7 A;  5DNL A;  5KL5 A;  1HR0 E;  4BA1 B;  1N36 I;  2GLI A;  3LTO A;  1WRJ A;  1YYK A;  3HUL A;  4UTG A;  1K47 A;  2R76 A;  4DV2 E;  2Z5E A;  2ZBK B;  5CFF E;  4DV7 I;  2JE6 A;  3Q1Q A;  2PO2 A;  2EOM A;  2GHF A;  2R1F A;  2YTP A;  3U1Y A;  1Z5C A;  1XXE A;  2PO0 A;  2EPR A;  1ZAA C;  5A69 A;  2ENC A;  2EPN A;  3HQ1 A;  2UU9 I;  1X3C A;  2M4I A;  3B4T A;  4FWD A;  4OO1 E;  2DMY A;  4USK A;  1T38 A;  5FWK A;  1KKH A;  2WNR A;  4X65 I;  4MDT A;  2EPZ A;  2F4V I;  3HKM A;  3M85 D;  2G7H A;  4IZJ D;  5EL9 A;  2WP8 B;  4PRX A;  4YHH E;  1PVG A;  4LOM A;  2EM4 A;  2EPL X;  3HXL A;  3ZKD A;  2PNL A;  4ISA A;  4IFD E;  2UU9 E;  1N0V C;  4F9B B;  4BC9 A;  3Q6M A;  2LUP B;  2V8P A;  4LCH A;  4BA2 B;  4WSG A;  1B69 A;  2JOB A;  2LMZ A;  4OO1 A;  4R2A A;  4HTG A;  2ELY A;  2EM9 A;  5AC5 A;  2J65 A;  2Z5B A;  4IZK A;  2WNR B;  4OX9 I;  3H09 A;  2EMA A;  2NN6 E;  1HR0 I;  4YY3 E;  4DV0 E;  1MU5 A;  3EPK A;  2EOH A;  3OML A;  2V8Q B;  1Z0C A;  2F1D A;  1AH5 A;  1UDO A;  3V5R A;  3ECR A;  1MX0 A;  2VRD A;  1UIL A;  2YU5 A;  3QT6 A;  4MU3 A;  2ENH A;  3VK6 A;  2CGE A;  3FIG A;  2EOE A;  2UUA I;  4DV0 I;  4F9A B;  5AC4 A;  2E1M A;  2EOQ A;  1N33 E;  2EFG A;  1WHN A;  2UXB I;  4TUI A;  4FW7 A;  1R6M A;  2EQ1 A;  3HJC A;  1J26 A;  4LFB E;  2WZO A;  3ZKB A;  2Z5B B;  2HGH A;  3PYG A;  2M1S A;  2NN6 B;  1Y5Y A;  4FW3 A;  4XTJ A;  4DKK A;  2N3H A;  4U3D A;  4OO1 B;  4OO1 F;  2DIX A;  3WU4 A;  2UUB I;  4LFC E;  4NHR A;  2DSY A;  3L00 A;  1T4O A;  2YRK A;  2L8T A;  4M0V A;  3M7N D;  3C6K A;  1J5E E;  2EPP A;  1RHY A;  2HFU A;  3H4L A;  5IT9 Q;  5DRQ A;  2WBU A;  1NCS A;  5JEA F;  5C0X E;  2WBS A;  2LBS B;  3BGH A;  1GZ6 A;  4X65 E;  2GS8 A;  1N34 I;  2EPA A;  4QNK A;  5DRP A;  4GQU A;  1YYW A;  5LL6 R;  2PO1 A;  4O24 A;  3ZZU A;  1R6L A;  1UDS A;  2EOX A;  3DJW A;  1SR9 A;  2HK3 A;  4NXN I;  1ZM2 A;  2LJP A;  4DR7 E;  4LF6 I;  5KL3 A;  2YTI A;  2CZ9 A;  2GO4 A;  4DV5 I;  1F2I G;  1HK7 A;  4U3B A;  4DUZ E;  3GCM A;  2V87 A;  3IWD A;  1DI2 A;  1H74 A;  4BMJ A;  1UBD C;  1Z5A A;  1QZR A;  2YTJ A;  2DLQ A;  1YUI A;  2BA1 G;  4X66 I;  4BHC A;  4NXM E;  4LFA I;  3P3G A;  5K36 B;  4JI1 E;  1XMQ E;  4FN5 A;  2CSH A;  5LMU E;  4BBY A;  1OYS A;  2BV3 A;  3BBG A;  2KOU A;  2NUG A;  2PO0 B;  2EOF A;  4QNJ A;  4TUG A;  4WUD A;  2K7I A;  2V88 A;  4PU9 A;  1I94 E;  2UXD E;  5JEA E;  3J81 Q;  4DUY I;  2EN2 A;  2I13 A;  1A1L A;  2LVH A;  1U2R A;  2KON A;  4BA1 A;  4IFD F;  2RS6 A;  4Z7Y A;  1TN9 A;  4LFA E;  2EN4 A;  1ZXN A;  4P52 A;  4ED4 A;  1VIS A;  4MYT A;  1J5E I;  4NXM I;  4I3H A;  1KVK A;  5DRO A;  2L3C A;  4ZYG A;  3CWV A;  2EZ6 A;  3KZZ A;  3B8H A;  1UHZ A;  2VE7 C;  4DV1 E;  1IBK I;  1NEI A;  2IHR 1;  2EMY A;  1MEY C;  2HC5 A;  4GKJ E;  1FWL A;  1USV A;  5A2Q Q;  2EPC A;  4B3M I;  1YZ9 A;  4DR2 E;  2V86 A;  2YPN A;  2V2Q A;  5AE1 A;  2A2D A;  1PKP A;  2HHH I;  4LF9 I;  5K36 F;  4M9V C;  1EA6 A;  4LU9 A;  1N32 I;  4IJD A;  1Z0V A;  4R2C A;  3PYF A;  5FLX C;  3J81 C;  1QU6 A;  3JAM C;  4DV3 E;  1B62 A;  4L5N C;  5IT9 C;  3L7Z A;  4OO1 D;  2EPX A;  2MDG A;  1PDA A;  4AM3 A;  1HNW I;  2GPI A;  2V85 A;  3J7A G;  1IBL E;  4FW5 A;  4FWG A;  2O1T A;  3NZK A;  1B63 A;  2LTS A;  5BR8 I;  4M1K A;  4R1F A;  2E1R A;  3MSW A;  1HNZ E;  4RPF A;  2O1U A;  5JEA C;  4JYA I;  3MHS C;  5TSE A;  4R2R A;  1HNX E;  2B9D A;  2EMC A;  5ADZ A;  5BR8 E;  3QT8 A;  2X7I A;  1KYQ A;  2YWQ A;  2NN6 A;  4DR5 E;  3ADG A;  2HK2 A;  2HKE A;  1AAY A;  2YU8 A;  2NA2 A;  2PO2 B;  4YHH I;  1A6F A;  2LJU A;  3F6G A;  3F6H A;  4DPW A;  2B7T A;  3TQM A;  2EMK A;  1PJT A;  2NN6 D;  4JI7 I;  4AID A;  2HHH E;  2CPN A;  2C38 B;  2LE2 A;  4MU1 A;  4YY3 I;  5A6A A;  3T1Y I;  2EM0 A;  1D6T A;  2LT7 A;  1Y4U A;  4DR6 E;  3IWB A;  1Z1B A;  4JI4 I;  2EOZ A;  1KTV A;  4IS9 A;  4LF5 I;  2V2V A;  4B3M E;  3ADL A;  3EQ1 A; 
#chains in the Genus database with same CATH homology
 4DMI A;  3PYD A;  4DV1 I;  2OI2 A;  3J80 Q;  1WXR A;  3B82 A;  3VYY A;  4LF8 I;  3V2U C;  4JI7 E;  2LUQ A;  2HKJ A;  1N0U A;  3LNU A;  2BM1 A;  3HTX A;  2NUE A;  2L92 A;  4WUB A;  4IZJ B;  1YYO A;  1NHI A;  4HXZ A;  4DPY A;  3ZOQ B;  2NUF A;  4X66 E;  1WUU A;  4GEQ B;  3K17 A;  5DNY A;  1NHJ A;  2AJ4 A;  3C4B A;  2LRS A;  2VQE I;  2UXC E;  2VQE E;  3WU5 A;  4JI5 I;  2F4V E;  4K0K I;  4BC7 A;  1Z0B A;  1Z0G A;  2O1V A;  1S4E A;  5LMN E;  1FNM A;  2ZM6 I;  3Q6N A;  2L2K B;  4GKK I;  4KHP I;  4ZVI A;  2VQF I;  3AUZ A;  4LF7 E;  2V2Z A;  4BCA A;  4DR3 I;  1FKA E;  1NHH A;  1Z0E A;  3HPZ A;  1S16 A;  1IBK E;  4R03 A;  4P7A A;  2O1W A;  4MYU A;  5AAS A;  3OTO I;  4LF4 I;  2V34 A;  1BKN A;  4UT4 A;  1N33 I;  1Z0W A;  2FTX B;  4LTY A;  4DR4 I;  4URL A;  4LF5 E;  1H7S A;  2JR1 A;  4X64 E;  4DR6 I;  1RR9 A;  3F0N A;  2L3J A;  1Y4S A;  4JI8 I;  1ZM3 A;  4OX9 E;  3GON A;  1X47 A;  2JOX A;  2E5L I;  1WHQ A;  4X64 I;  2R3V A;  2KHX A;  1XNR E;  4DR1 I;  2FV4 B;  4DXL A;  4DR5 I;  3ZM7 A;  4DV6 I;  3IWC A;  4KQV A;  3B78 A;  4DPT A;  4LF6 E;  4R8O A;  1GQE A;  3HPS A;  1HNX I;  2DB2 A;  2HFS A;  4JYA E;  2L2N A;  1IBL I;  1STU A;  5IWA E;  2IOQ A;  5GME A;  4DR3 E;  4HYM A;  4LF7 I;  2VF1 A;  3ZZ0 A;  4WUC A;  1X49 A;  1PIE A;  4LF9 E;  5GMD A;  4LFB I;  4DPU A;  1OJ4 A;  4WSP A;  2Q2E B;  2UXB E;  3WU6 A;  4J8Z A;  2XEX A;  4N3O A;  4DR2 I;  1X48 A;  4JI3 E;  2UUA E;  2JVA A;  2N3G A;  2MC6 A;  2RSM A;  5AE2 A;  4DV4 E;  2DEJ A;  4B3R E;  4JI6 I;  4WFT A;  3JAM Q;  3JU0 A;  4JI8 E;  2FGG A;  1ZBQ A;  2WW4 A;  2CG9 A;  1ZBT A;  3K1J A;  4DPX A;  4F9C B;  4JI2 E;  4GKJ I;  4WPY A;  1ZM4 A;  4Z7C A;  1FJG E;  4LF8 E;  4HY1 A;  1IBM E;  4B3S I;  2LTR A;  1XMO E;  3K85 A;  4B3S E;  4L8N A;  2R42 A;  4EMD A;  3OTO E;  4PRV A;  3LML A;  2L6M A;  3ZZT A;  4DUZ I;  4JI0 E;  3RMP A;  1I94 I;  1UEK A;  5L3J A;  2VF3 A;  4DR7 I;  2NPF A;  4WYQ B;  4USM A;  2ODR D;  4JI4 E;  5LMU I;  1XMQ I;  4KHP E;  3M6A A;  2MC5 A;  2UUC I;  3AV0 A;  4HAC B;  4X8W A;  1Z0T A;  4DV7 E;  4DV2 I;  2GQ0 A;  4F54 A;  4LFC I;  5FLX Q;  4JI3 I;  1RQ0 A;  3DF6 A;  2K4V A;  1HNZ I;  5T6J A;  2RTX A;  2RS7 A;  5A2Q C;  1FWK A;  3PYE A;  2X36 A;  4IZK B;  2UUB E;  2J7K A;  5F3W A;  1ZXM A;  4DV3 I;  4DV4 I;  3WU3 A;  1USU A;  2M7Q A;  2YZT A;  1RRE A;  2F8B A;  2Z5C B;  3VYX A;  1Y6Z A;  1EI1 A;  4IZJ A;  4DU7 A;  2IOP A;  2B3T B;  4B3T I;  2V83 A;  4DV6 E;  4AQY I;  2YT4 A;  4DR1 E;  1XNR I;  2L2M A;  2ODR C;  4P78 A;  2E5L E;  4Q28 A;  3JTZ A;  1FI4 A;  3T1Y E;  1DAR A;  5IWA I;  1Z59 A;  2MDR A;  4DUY E;  4OOG C;  1NZ0 A;  1KIJ A;  4HAC A;  4M30 A;  1RC7 A;  3P1X A;  1Z5B A;  3PRY A;  4FW9 A;  3J7A M;  2B7V A;  4P7D A;  2V89 A;  4FWH A;  4KZS A;  3J7Y p;  4LF4 E;  1DQ3 A;  3P06 A;  1N36 E;  2Z5C A;  2EWL A;  4DV5 E;  2UUC E;  3LLH A;  4BS9 A;  1XHK A;  1O0W A;  1HNW E;  4NXN E;  3C4T A;  1XNQ I;  4JV5 I;  4JG4 A;  3J80 C;  2BM0 A;  1EKZ A;  1N34 E;  4AQY E;  4DR4 E;  3KWR A;  1N32 E;  1ZM9 A;  4JI0 I;  1T4N A;  2LJH A;  4B3T E;  2ZM6 E;  4DU8 A;  3ADI A;  4K0K E;  2F4V I;  1XMO I;  4M2Z A;  1ELO A;  1IBM I;  4JI5 E;  3ADJ A;  1H73 A;  2ZIT A;  1FJG I;  2UXC I;  3T1H E;  1T4L B;  2A2C A;  2L33 A;  5AE3 A;  3QT7 A;  3T1H I;  4JI2 I;  1H72 C;  3QT5 A;  2VQF E;  4I8O A;  4X62 E;  4GKK E;  3K6Q A;  2JWO A;  4X62 I;  2UXD I;  1H7U A;  4JI6 E;  4B3R I;  2H36 X;  2PNM A;  5LMN I;  2DEI A;  1XNQ E;  4JV5 E;  3D4J A;  4JI1 I;  2JY9 A;  3LPS A;  1MG7 A;  1HR0 E;  1N36 I;  3LTO A;  1YYK A;  3HUL A;  4UTG A;  1K47 A;  4DV2 E;  2Z5E A;  2ZBK B;  5CFF E;  4DV7 I;  3Q1Q A;  1Z5C A;  2UU9 I;  3HQ1 A;  2M4I A;  4FWD A;  2DMY A;  4USK A;  5FWK A;  1KKH A;  4X65 I;  2G7H A;  4IZJ D;  4PRX A;  4YHH E;  1PVG A;  3HXL A;  3ZKD A;  2PNL A;  2UU9 E;  1N0V C;  4F9B B;  4BC9 A;  3Q6M A;  2LUP B;  2V8P A;  2JOB A;  2LMZ A;  2Z5B A;  4IZK A;  4OX9 I;  3H09 A;  1HR0 I;  4YY3 E;  4DV0 E;  1MU5 A;  3OML A;  2V8Q B;  1Z0C A;  3V5R A;  1MX0 A;  1UIL A;  3QT6 A;  3VK6 A;  2CGE A;  3FIG A;  2UUA I;  4DV0 I;  4F9A B;  2E1M A;  1N33 E;  2EFG A;  1WHN A;  2UXB I;  4TUI A;  3HJC A;  1J26 A;  4LFB E;  2WZO A;  3ZKB A;  2Z5B B;  3PYG A;  2M1S A;  4XTJ A;  4DKK A;  2N3H A;  2DIX A;  3WU4 A;  2UUB I;  4LFC E;  2DSY A;  1T4O A;  2L8T A;  4M0V A;  1J5E E;  5IT9 Q;  3H4L A;  2HFU A;  2LBS B;  1GZ6 A;  4X65 E;  2GS8 A;  1N34 I;  1YYW A;  5LL6 R;  3ZZU A;  3DJW A;  1SR9 A;  2HK3 A;  4NXN I;  1ZM2 A;  2LJP A;  4DR7 E;  4LF6 I;  2CZ9 A;  4DV5 I;  1HK7 A;  4DUZ E;  2V87 A;  3IWD A;  1H74 A;  1DI2 A;  4BMJ A;  1Z5A A;  1QZR A;  4X66 I;  4NXM E;  4LFA I;  4JI1 E;  1XMQ E;  4FN5 A;  5LMU E;  4BBY A;  2BV3 A;  2KOU A;  2NUG A;  4TUG A;  4WUD A;  2V88 A;  4PU9 A;  1I94 E;  2UXD E;  3J81 Q;  4DUY I;  1U2R A;  2KON A;  2RS6 A;  4Z7Y A;  1ZXN A;  4LFA E;  4ED4 A;  4P52 A;  1J5E I;  4NXM I;  1VIS A;  4MYT A;  4I3H A;  1KVK A;  2L3C A;  3CWV A;  2EZ6 A;  3B8H A;  1UHZ A;  2VE7 C;  4DV1 E;  1IBK I;  2IHR 1;  4GKJ E;  1USV A;  4B3M I;  1FWL A;  5A2Q Q;  1YZ9 A;  4DR2 E;  2V86 A;  2V2Q A;  5AE1 A;  2A2D A;  1PKP A;  2HHH I;  4LF9 I;  1EA6 A;  1N32 I;  4LU9 A;  1Z0V A;  3PYF A;  5FLX C;  3J81 C;  1QU6 A;  3JAM C;  4DV3 E;  1B62 A;  4L5N C;  5IT9 C;  1HNW I;  2V85 A;  3J7A G;  1IBL E;  4FWG A;  2O1T A;  1B63 A;  2LTS A;  5BR8 I;  4M1K A;  4R1F A;  2E1R A;  3MSW A;  1HNZ E;  4RPF A;  2O1U A;  4JYA I;  1HNX E;  2B9D A;  5ADZ A;  5BR8 E;  3QT8 A;  2X7I A;  4DR5 E;  3ADG A;  2HK2 A;  2HKE A;  2NA2 A;  4YHH I;  1A6F A;  3F6G A;  3F6H A;  4DPW A;  2B7T A;  4JI7 I;  2HHH E;  2CPN A;  3T1Y I;  2LE2 A;  4YY3 I;  1D6T A;  1Y4U A;  4DR6 E;  3IWB A;  4JI4 I;  1KTV A;  4LF5 I;  2V2V A;  4B3M E;  3ADL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...