4DUZE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzE02
2LTSA 4FWHA 4DXLA 4Z7YA 4LF4E 4B3TE 4DPYA 3B8HA 1S4EA 1KVKA 1MU5A 4X8WA 3D4JA 4UT4A 4LF4I 2V2QA 1ZM2A 2V34A 1ZBTA 1FNMA 4GKKE 5GMEA 4LF9I 4DV4I 3J7AM 2R42A 4DUZE 2LJPA 3ZM7A 2UXBE 2BM1A 1I94I 4GKKI 2CZ9A 4P52A 4X65E 2L3JA 3QT5A 4LFBE 2Q2EB 4WUCA 3HTXA 1XMOI 4LF6I 3ZKDA 3LLHA 2LUQA 1Z59A 2X36A 1WUUA 1X47A 4B3SE 2UXDE 4JYAE 3VYYA 2V8PA 3T1YI 1J5EE 3PYDA 4LFCE 4KHPI 3T1HE 4B3SI 1HNXE 1N0UA 2L2KB 1HR0E 2R3VA 4B3RE 1IBLE 4JYAI 4AQYE 4JI0E 1DARA 2BM0A 1J5EI 2HFUA 1N0VC 2HKEA 1U2RA 4PRVA 1UEKA 1FI4A 4HY1A 4JI2I 5LMNI 4PU9A 1DI2A 1HR0I 4DR6E 1IBLI 5IWAE 4M1KA 1B62A 2LJHA 2ZM6I 4DPTA 3B82A 3ZZ0A 2GS8A 4URLA 4DV1E 4B3MI 4ZVIA 1Z0TA 3F0NA 5IWAI 4DU8A 4X64I 4DR5E 3VYXA 1EI1A 2UU9I 4DV1I 4USKA 2UUBE 2RSMA 4LF8E 3HULA 1H7SA 2YT4A 1HNZE 1RR9A 4DV5E 3CWVA 4DR5I 1FWLA 4HACA 2ZITA 1NZ0A 4JI3I 2UUBI 4LF8I 4DKKA 1PKPA 1QZRA 2DMYA 1HNZI 4DV5I 2NA2A 1MX0A 4DR3I 1Z0GA 3LPSA 4LFAE 3M6AA 4WUDA 4DV3I 1FJGE 1ZXNA 3PYGA 4X62I 4GKJE 1K47A 3ZZUA 4LF9E 4JI8I 4LFAI 1XNRI 4DV4E 4WFTA 1H73A 3JAMC 1FJGI 4X66E 2B3TB 3OTOE 4DV7E 4GKJI 1QU6A 3ZKBA 3WU6A 1I94E 1PVGA 1H72C 1Z5AA 2UUAE 2EFGA 4DR2I 1S16A 4X66I 3OTOI 4DV7I 3C4BA 2LRSA 1XMOE 4LF6E 1OJ4A 2X7IA 1T4NA 2V2VA 5A2QC 2B7TA 2UUAI 4HXZA 4FWGA 4JI6I 3ADJA 2DB2A 3PYEA 1RQ0A 3T1YE 2J7KA 4R1FA 1T4OA 1Z0BA 2EZ6A 4KHPE 5LMUE 2JVAA 1N32E 4OX9E 4DR4I 3LNUA 2B7VA 2RS6A 2KHXA 5LMUI 2UXCE 1UHZA 4JI1E 4JI2E 5LMNE 4DUYE 2HKJA 1N32I 3V2UC 4OX9I 3V5RA 1NHIA 3B78A 2NUFA 4JG4A 2ZM6E 2L2MA 3ADGA 3WU4A 4JV5I 3WU3A 2UXCI 4JI1I 1EKZA 4B3ME 4Z7CA 4DUYI 3H4LA 1Z0CA 1KKHA 4X64E 1X48A 3WU5A 4OOGC 2UU9E 3PYFA 1YYKA 4ED4A 2UUCE 1T4LB 2BV3A 3ADIA 1HNWE 1XNQE 3JAMQ 3J7AG 2HFSA 5IT9C 4YHHE 4JI3E 2IHR1 2CPNA 2F4VE 4NXNE 1KTVA 2UUCI 3P1XA 1PIEA 1YYOA 2AJ4A 2HK2A 1HNWI 1XNQI 1H74A 4DR3E 2N3HA 1D6TA 4JI7I 4FN5A 4YHHI 1YYWA 2A2DA 4K0KI 1IBMI 1B63A 4M30A 2F4VI 4NXNI 4DV3E 4JI5I 2RTXA 4X62E 4LF5E 5A2QQ 4I3HA 2NUGA 4JI8E 1ZM3A 3J81Q 1XNRE 1X49A 5BR8E 1YZ9A 2HHHE 2V2ZA 1N33I 3J7Yp 4UTGA 4LF5I 1RREA 1O0WA 1N34E 5BR8I 2HHHI 2LTRA 4DR2E 3GONA 2WW4A 4NXME 1EA6A 1KIJA 2E5LE 3ADLA 3Q1QA 2L3CA 1N34I 4JI6E 4HYMA 1XMQE 2LUPB 2E1RA 4MYTA 4NXMI 2E5LI 3J80Q 3LTOA 4DPXA 4B3TI 1BKNA 3ZZTA 2JY9A 1XMQI 3J81C 4RPFA 1N36E 2DEJA 2DIXA 3QT7A 4DR4E 2N3GA 4DV2E 4KQVA 2VQFE 4MYUA 5CFFE 2ZBKB 4FWDA 4M2ZA 1N36I 1Z0VA 2OI2A 1Z0EA 1XHKA 4WUBA 5IT9Q 1FKAE 2LBSB 4DUZI 4DV2I 4DV6E 4JV5E 2VQFI 1Z5CA 3K17A 1Z5BA 2UXBI 2VQEE 5LL6R 1GQEA 4XTJA 1Z0WA 3QT6A 5FLXQ 4X65I 3J80C 4LFBI 4DV6I 4DR1E 4HACB 2VQEI 4DPUA 4DV0E 1H7UA 4DR1I 4LF7E 1NHJA 4DU7A 2NUEA 4DR7E 2UXDI 4P7AA 1ZM9A 3C4TA 1UILA 4LFCI 1WHQA 2RS7A 1A6FA 4DV0I 1RC7A 4EMDA 3T1HI 4USMA 4LF7I 4PRXA 1HNXI 2L33A 4JI7E 4B3RI 4DR7I 4K0KE 4AQYI 2XEXA 4JI0I 1IBME 4JI5E 4DPWA 1NHHA 4WYQB 2VF3A 5GMDA 1VISA 5FLXC 4DR6I 1ZM4A 1STUA 1N33E 3QT8A 1IBKE 4JI4E 2DEIA 1ZXMA 4YY3E 1ELOA 2L2NA 5L3JA 2NPFA 1IBKI 1J26A 3K1JA 4JI4I 2A2CA 2MDRA 2HK3A 4FW9A 4YY3I 1MG7A 1WHNA 1FWKA
chains in the Genus database with same CATH superfamily
2LTSA 4FWHA 1ZAAC 2EM9A 2EN1A 4ZYEA 1WHNA 4DXLA 2EPOA 4DMIA 4LF4E 4Z7YA 4B3TE 4DPYA 4R2AA 1USVA 2YTGA 4J8ZA 4BA1A 2LT7A 3B8HA 1S4EA 1KVKA 3FIGA 1MU5A 2VRDA 4F9CB 2Z5BB 1TF6A 3HKMA 4MQYA 4X8WA 4R2SA 3D4JA 2YSOA 1UDQA 4LCFA 4UT4A 4LF4I 2ELYA 2V2QA 5DNLA 2EPNA 3F6GA 3MHSC 3IWDA 2EOEA 1KJKA 2N8XA 1NEIA 3F6HA 3AUZA 1ZM2A 2V34A 2EPAA 4HTGA 1ZBTA 1FNMA 2JR1A 4GKKE 5GMEA 2EOOA 4LF9I 4FW3A 3M85D 2EM7A 2EPKX 1UDSA 2Z5CA 4DV4I 1X6HA 2JWOA 3J7AM 2R42A 4DUZE 5AC4A 3DJWA 1IMUA 2LJPA 3ZM7A 2UXBE 2BM1A 1I94I 1X6EA 4GKKI 3L00A 2CZ9A 2PO0A 2EOYA 2GO4A 2LCEA 1X3CA 2BA0D 2IERA 2J65A 4P52A 4LCGA 4X65E 1BBOA 2L3JA 3QT5A 4IZKA 4LFBE 5C0XB 2YRKA 4X9JA 1JK2A 2Q2EB 3HTXA 4WUCA 4ISAA 2KONA 2EMXA 1XMOI 4LF6I 3ZKDA 2I9IA 4BHCA 5DRQA 3LLHA 1E3HA 2D9HA 2LUQA 2EN8A 1Z59A 2YPNA 1GTKA 2GLIA 2X36A 4AIMA 5LLQA 2PO2B 1WUUA 1X47A 3KWRA 4B3SE 2WNRA 5A6JA 2EPRA 4WX9A 4FW5A 1MEYC 4JYAE 3VYYA 1A1HA 2UXDE 2V8PA 3T1YI 1J5EE 2KOUA 3PYDA 2EQ0A 4LFCE 2JE6B 2PRTA 4KHPI 3T1HE 3EPHA 2Z5BA 4B3SI 2CVEA 1HNXE 2K7IA 1N0UA 4NHRA 2L2KB 3PS1A 1HR0E 2R3VA 4B3RE 1IBLE 4JYAI 4AQYE 2DRPA 4JI0E 4IFDC 1DARA 2BM0A 3K85A 5C0XD 1J5EI 3DD6A 2A25A 2HFUA 1N0VC 2HKEA 1U2RA 4FW6A 4PRVA 1UEKA 1FI4A 3P3GA 1P42A 4HY1A 4OO1B 2EN7A 2GHFA 1WXRA 5LMNI 4JI2I 4IFDA 2WBSA 1DI2A 1NCSA 4R2DA 3EPKA 2BA1D 4IZJD 4PU9A 4DR6E 1HR0I 1IBLI 3QG5C 5IWAE 4M1KA 1B62A 4TUGA 4FK5C 2LJHA 4L5NC 1N3GA 1ZR9A 2EM5A 2ZM6I 4DPTA 2DLKA 2CG9A 2LMZA 3ECRA 4NZVA 2WZOA 3B82A 5KL2A 3ZZ0A 2JXPA 2GS8A 1EH8A 2ENAA 4URLA 2V86A 4DV1E 2JEAB 5C0XC 4B3MI 2YTNA 1PDAA 1Y5YA 4ZVIA 1Z0TA 2MDGA 3F0NA 5IWAI 4WXCA 1YPNA 2C39B 3MHHC 4DU8A 4X64I 2EPZA 5C0XA 4DR5E 4F9AB 4LCHA 3VYXA 1EI1A 2M9AA 4MDTA 2V8QB 2UU9I 4DV1I 4USKA 2UUBE 1XXEA 2RSMA 3KRNA 2EWLA 4LF8E 3Q6NA 4IFDF 2YWQA 4IS1C 3HULA 5K36D 2ODRD 4WSPA 1H7SA 1HK7A 1AH5A 2YT4A 1HNZE 5DROA 3B4TA 4OO1D 1RR9A 4DV5E 3CWVA 1SFEA 4DR5I 2PO2A 1FWLA 4HACA 2MKNA 2EM0A 2JYAA 2LO3A 2LV2A 3K6QA 1NZ0A 2NN6F 2ZITA 4WPYA 4JI3I 2UUBI 4LF8I 4DKKA 1PKPA 2WP8B 2Q8UA 1QZRA 2PNLA 2DMYA 2JE6A 1HNZI 2LVHA 4R2RA 4R03A 5JEAB 5C0XE 4DV5I 2NA2A 1MX0A 4DR3I 1Z0GA 3LPSA 2EOZA 2EM2A 4LFAE 2JOXA 2WBTA 3M6AA 1IQOA 2EPUA 2YU5A 4WUDA 4DV3I 1FJGE 1ZXNA 3CDIA 3PYGA 5AASA 3KZZA 2EMHA 1G2DC 4X62I 4GKJE 1K47A 2I13A 4KZSA 2EN6A 4LPFA 3ZZUA 2CSHA 4R2EA 4KWYA 2EPLX 4LF9E 1RMDA 2EMFA 1A1IA 3KZYA 4JI8I 4LFAI 2V89A 2YTDA 2M7QA 4DV4E 1XNRI 4TUIA 2EMYA 4WFTA 3JAMC 1H73A 1YHCA 4BA1B 5AE3A 2EOXA 2BR2B 1FJGI 4ZYHA 2B3TB 4X66E 3OTOE 4DV7E 3DF6A 4GKJI 1QU6A 3ZKBA 3WU6A 1I94E 1P47A 3P06A 1PVGA 4FW7A 2JEAA 3JU0A 4BC9A 1H72C 1Z5AA 3VK6A 2UUAE 4F6NA 2E1MA 2EFGA 5JEAD 4DR2I 4LU9A 3U1YA 2EPCA 1S16A 3EQ1A 4X66I 3OTOI 4DV7I 3C4BA 2LRSA 5AC5A 4OO1E 2WW4A 5KL3A 4P7DA 1XMOE 4LF6E 1OJ4A 2X7IA 1T4NA 5A2QC 2V2VA 1ZU1A 1L4SA 2B7TA 2EQ3A 2UUAI 1T38A 3M99B 2EPMX 4F54A 5A6AA 4HXZA 3BIDA 3L7ZB 4FWGA 4JI6I 4OKGA 2YTQA 3ADJA 2DB2A 2EMZA 3ZOQB 1YFHA 4IJDA 3PYEA 1PJQA 2CT1A 2O1TA 1RQ0A 1USUA 3T1YE 2J7KA 4R1FA 2EL5A 1BBGA 2EOJA 1YUIA 3VHTB 1T4OA 4IZJB 1Z0BA 2ENHA 4ZYDA 2V87A 2WP8A 2EZ6A 3H09A 4F6MA 4KHPE 5LMUE 2JVAA 4M0VA 5JEAA 4GEQB 1N32E 2M4IA 4OX9E 1DGCA 2EP3A 5T6JA 2BBGA 5A6KA 4DR4I 2YZTA 3LNUA 2B7VA 2RS6A 2GPIA 2KHXA 1A1KA 1MGTA 3JTZA 5LMUI 1AAYA 2MC5A 2UXCE 4MU1A 1UHZA 4JI1E 2F1DA 4JI2E 5LMNE 4GQUA 4N3OA 4DUYE 2HKJA 1N32I 3V2UC 4OX9I 3V5RA 2EM4A 2YRHA 5IV8B 3P76A 2LJUA 5AE2A 1NHIA 2NUFA 1Y4SA 3B78A 2VE7C 1UDOA 4JG4A 2ZM6E 2EQ1A 2L2MA 2BR2A 4R2QA 3ADGA 3WU4A 4MU3A 5K36B 4MU4A 4JV5I 5JEAE 2EMAA 3WU3A 2UXCI 4LOMA 1UBDC 4JI1I 2O1VA 1EKZA 3IWBA 4B3ME 3EPLA 4Z7CA 4DUYI 3H4LA 3BBGA 1Z0CA 4I8OA 2YTOA 1KKHA 3BF2A 2F8BA 4X64E 2JEBB 5ELWA 1X48A 5A6BD 3WU5A 2EMWA 2EN3A 4OOGC 2UU9E 3PYFA 2DGCA 1Y4UA 1YYKA 2O1WA 4ED4A 4BCAA 2AE8A 2MKDA 2GO3A 2UUCE 4R2PA 2DMIA 1T4LB 2CTDA 2PNMA 2BV3A 3ADIA 1HNWE 1XNQE 4HEIA 3JAMQ 3J7AG 5IT9C 2HFSA 2EMKA 3THOB 2B9DA 4YHHE 3BGHA 4JI3E 2Z5EA 1BB8A 2IHR1 4GZNC 1YSAC 2CPNA 1GZ6A 2L8TA 2MC6A 3GLLA 2F4VE 4NXNE 1KTVA 4IZJA 2UUCI 3P1XA 4MLQA 1PIEA 2VESA 4FW4A 2EMIA 1YYOA 2AJ4A 2HK2A 1HNWI 2EJ4A 1XNQI 1H74A 4DR3E 2LE2A 2N3HA 1D6TA 5A6BA 3GMEA 4JI7I 4FN5A 3P3CA 2RPCA 4YHHI 3PS3A 1TN9A 4BHBA 1YYWA 2YTIA 2A2DA 4AM3A 4K0KI 2EPPA 1IBMI 2M1SA 1B63A 4M30A 5KL6A 4NXNI 2F4VI 4DV3E 4JI5I 3C6MA 2RTXA 4X62E 4LF5E 5A2QQ 1F2IG 4I3HA 2V88A 2ENCA 5K36C 2NUGA 5C0XF 2ODRC 4JI8E 1ZM3A 3J81Q 1XNRE 3PRYA 1X49A 5BR8E 1YZ9A 2HHHE 2C37B 4OO1C 3HPSA 1UDNA 1TF3A 2V2ZA 1N33I 4O4KA 2EMLA 1LLMC 2V85A 3J7Yp 4UTGA 4LF5I 1RREA 5K36A 5DNXA 4N4RB 1R6LA 2PO1B 1IQSA 1O0WA 1SR9A 2ELZA 2BA0G 4OO1A 4Q28A 1N34E 3UHMA 1EH6A 4BMJA 4O24A 1A1LA 2EMCA 2JT2A 5FWKA 5BR8I 2HHHI 2IOPA 2LTRA 4DR2E 3HPZA 2JEBA 3TQMA 3GONA 2YTPA 2WNRB 1EH7A 3LMLA 3OMLA 4NXME 1EA6A 1KIJA 3EPJA 2E5LE 3ADLA 1OYRA 1OYPA 4QNKA 2EPXA 3Q1QA 2H36X 2L3CA 1N34I 2R1FA 4BS9A 1B69A 1QNTA 2L6MA 2EN4A 2C38B 3H1CA 5KL5A 4R8OA 4JI6E 2C39A 4HYMA 1XMQE 2LUPB 1E3PA 5K36E 1UN6B 3IWCA 2E1RA 4MYTA 4NXMI 1YUJA 2E5LI 3J80Q 4R2CA 5K36F 3LTOA 2EOFA 1X5WA 1DQ3A 4DPXA 4B3TI 4OO1F 1BKNA 3ZZTA 2JY9A 2YU8A 1XMQI 3GCMA 3J81C 5TSEA 5ADZA 4NBQA 4IFDB 4RPFA 3HJCA 1N36E 1G2FC 2DEJA 4LTYA 5JEAC 2DIXA 4MLVA 4O5GA 3QT7A 4DR4E 4BC7A 2PNZB 2RQLA 2NN6B 2N3GA 2EOQA 3NZKA 1WJPA 2JOBA 4DV2E 3HQ1A 2BA1G 4KQVA 2VQFE 5DRPA 4MYUA 5CFFE 2ZBKB 2JP9A 5DRRA 2DSYA 2IOQA 4FWDA 1JK1A 4M2ZA 4O43A 1N36I 4BA2B 2EOMA 2YTJA 2YTFA 4ZYGA 4F9BB 1Z0VA 2K4VA 1T39A 4RH8A 4M9VC 1A1FA 1XHKA 1Z0EA 2C37A 2OI2A 4WUBA 5DNYA 5IT9Q 1FKAE 2LBSB 4DUZI 5A69A 4DV2I 4DV6E 1A1GA 4JV5E 2VQFI 1Z5CA 2EN2A 3K17A 1ZBQA 1Z5BA 2UXBI 2PO1A 2EM8A 2VQEE 5LL6R 2EOHA 1GQEA 2EL6A 4XTJA 1Z0WA 4U3DA 2YSPA 4P78A 2R76A 2EOIA 2EM6A 2EE8A 3U1KA 3QT6A 2WCC3 3UK3C 5FLXQ 4X65I 3J80C 4IFDD 4LFBI 4DV6I 4DR1E 4HACB 2HC5A 1PJSA 2DLQA 3P3EA 5IXMB 2VQEI 3C6KA 2EOSA 4DPUA 2NN6D 5JEAF 5F3WA 4IS9A 3AV0A 2ADRA 2C38A 3RMPA 4DV0E 2HJJA 1H7UA 3Q6MA 4DR1I 4LF7E 1NHJA 4DU7A 3M7NG 4MU0A 3PS2A 4U3BA 2NUEA 4DR7E 2UXDI 2O1UA 2EMBA 4P7AA 1ZM9A 2YRMA 3C4TA 1UILA 3MSWA 4OZEA 4LFCI 1VI7A 2WBUA 4BBYA 1WHQA 2RS7A 1A6FA 3L7ZA 4DV0I 1RC7A 2FTXB 4EMDA 3T1HI 4USMA 2NN6C 4RHBB 4LF7I 4PRXA 1HNXI 2L33A 4JI7E 4Q35B 1KYQA 2BB8A 4B3RI 4DR7I 2EMGA 4K0KE 2FV4B 2XEXA 1Y60A 3CDJA 1IBME 5EKWA 1Y6ZA 4JI0I 4AQYI 2PNZA 1RHYA 2NN6A 2GQ0A 4JI5E 4DPWA 2FGGA 5AE1A 1NHHA 1OYSA 5KL4A 2CGEA 4WYQB 4WSGA 2VF3A 2EM3A 2G7HA 5GMDA 4WXDA 1WRJA 2IESA 1VISA 5FLXC 4BA2A 4DR6I 2Z5CB 4J3DA 1ZM4A 1PJTA 2O3ZA 1STUA 3HXLA 1N33E 3QT8A 1A1JA 1IBKE 4JI4E 2DEIA 1R6MA 5EL9A 1ZXMA 3M85G 4IFDE 4YY3E 2HGHA 2EL4A 1Z1BA 2PO0B 1ELOA 2L2NA 5L3JA 1X6FA 2NPFA 1YH8A 1J26A 2E72A 2NN6E 3K1JA 4IZKB 1IBKI 2J7JA 3THNA 5KL7A 4JI4I 4AIDA 2VF1A 4F2JC 2YTEA 2JPAA 2MDRA 2A2CA 2RSIA 2HK3A 4FW9A 4YY3I 2EORA 4L8NA 1MG7A 2V83A 3M7ND 4QNJA 2L92A 1FWKA 2NABA
chains in the Genus database with same CATH topology
2LTSA 4FWHA 1WHNA 4DXLA 4DMIA 4LF4E 4Z7YA 4B3TE 4DPYA 1USVA 4J8ZA 3B8HA 1S4EA 1KVKA 3FIGA 1MU5A 4F9CB 2Z5BB 4X8WA 3D4JA 4UT4A 4LF4I 2V2QA 3F6GA 3IWDA 3F6HA 3AUZA 1ZM2A 2V34A 1ZBTA 1FNMA 2JR1A 4GKKE 5GMEA 4LF9I 2Z5CA 4DV4I 2JWOA 3J7AM 2R42A 4DUZE 3DJWA 2LJPA 3ZM7A 2UXBE 2BM1A 1I94I 4GKKI 2CZ9A 4P52A 4X65E 2L3JA 3QT5A 4IZKA 4LFBE 2Q2EB 4WUCA 3HTXA 2KONA 1XMOI 4LF6I 3ZKDA 3LLHA 2LUQA 1Z59A 2X36A 1WUUA 1X47A 3KWRA 4B3SE 2UXDE 4JYAE 3VYYA 2V8PA 3T1YI 1J5EE 2KOUA 3PYDA 4LFCE 4KHPI 3T1HE 2Z5BA 4B3SI 1HNXE 1N0UA 2L2KB 1HR0E 2R3VA 4B3RE 1IBLE 4JYAI 4AQYE 4JI0E 1DARA 2BM0A 3K85A 1J5EI 2HFUA 1N0VC 2HKEA 1U2RA 4PRVA 1UEKA 1FI4A 4HY1A 1WXRA 5LMNI 4JI2I 4PU9A 1DI2A 4IZJD 1HR0I 4DR6E 1IBLI 5IWAE 4M1KA 1B62A 4TUGA 2LJHA 4L5NC 2ZM6I 4DPTA 2CG9A 2LMZA 3B82A 2WZOA 3ZZ0A 2GS8A 4URLA 2V86A 4DV1E 4B3MI 4ZVIA 1Z0TA 3F0NA 5IWAI 4DU8A 4X64I 4DR5E 4F9AB 3VYXA 1EI1A 2V8QB 2UU9I 4DV1I 4USKA 2UUBE 2RSMA 2EWLA 4LF8E 3Q6NA 3HULA 2ODRD 4WSPA 1H7SA 1HK7A 2YT4A 1HNZE 1RR9A 4DV5E 3CWVA 4DR5I 1FWLA 4HACA 2ZITA 3K6QA 1NZ0A 4JI3I 4WPYA 2UUBI 4LF8I 4DKKA 1PKPA 1QZRA 2PNLA 2DMYA 1HNZI 4R03A 4DV5I 2NA2A 1MX0A 4DR3I 1Z0GA 3LPSA 4LFAE 2JOXA 3M6AA 4WUDA 4DV3I 1FJGE 1ZXNA 3PYGA 5AASA 4X62I 4GKJE 1K47A 4KZSA 3ZZUA 4LF9E 4JI8I 4LFAI 2V89A 2M7QA 4DV4E 1XNRI 4TUIA 4WFTA 3JAMC 1H73A 5AE3A 1FJGI 4X66E 2B3TB 3OTOE 4DV7E 3DF6A 4GKJI 1QU6A 3ZKBA 3WU6A 1I94E 3P06A 1PVGA 3JU0A 4BC9A 1H72C 1Z5AA 3VK6A 2UUAE 2E1MA 2EFGA 4DR2I 4LU9A 1S16A 4X66I 3OTOI 4DV7I 3C4BA 2LRSA 4P7DA 1XMOE 4LF6E 1OJ4A 2X7IA 1T4NA 5A2QC 2V2VA 2B7TA 2UUAI 4HXZA 4F54A 4FWGA 4JI6I 3ADJA 2DB2A 3ZOQB 3PYEA 2O1TA 1RQ0A 1USUA 3T1YE 2J7KA 4R1FA 1T4OA 4IZJB 1Z0BA 2V87A 2EZ6A 3H09A 4KHPE 5LMUE 2JVAA 4M0VA 4GEQB 1N32E 2M4IA 4OX9E 5T6JA 4DR4I 2YZTA 3LNUA 2B7VA 2RS6A 2KHXA 3JTZA 5LMUI 2UXCE 2MC5A 1UHZA 4JI1E 4JI2E 5LMNE 4N3OA 4DUYE 2HKJA 1N32I 3V2UC 4OX9I 3V5RA 5AE2A 1NHIA 1Y4SA 2NUFA 3B78A 4JG4A 2VE7C 2ZM6E 2L2MA 3ADGA 3WU4A 4JV5I 3WU3A 2UXCI 4JI1I 2O1VA 1EKZA 3IWBA 4B3ME 4Z7CA 4DUYI 3H4LA 1Z0CA 4I8OA 1KKHA 2F8BA 4X64E 1X48A 3WU5A 4OOGC 2UU9E 3PYFA 1Y4UA 1YYKA 2O1WA 4ED4A 4BCAA 2UUCE 1T4LB 2PNMA 2BV3A 3ADIA 1HNWE 1XNQE 3JAMQ 3J7AG 5IT9C 2HFSA 2B9DA 4YHHE 4JI3E 2IHR1 2CPNA 1GZ6A 2L8TA 2MC6A 2F4VE 4NXNE 1KTVA 4IZJA 2UUCI 3P1XA 1PIEA 1YYOA 2AJ4A 2HK2A 1HNWI 1XNQI 1H74A 4DR3E 2LE2A 2N3HA 1D6TA 4JI7I 4FN5A 4YHHI 1YYWA 2A2DA 4K0KI 1IBMI 2M1SA 1B63A 4M30A 2F4VI 4NXNI 4DV3E 4JI5I 2RTXA 4X62E 4LF5E 5A2QQ 4I3HA 2V88A 2NUGA 2ODRC 4JI8E 1ZM3A 3J81Q 1XNRE 3PRYA 1X49A 5BR8E 1YZ9A 2HHHE 3HPSA 2V2ZA 1N33I 2V85A 3J7Yp 4UTGA 4LF5I 1RREA 1O0WA 1SR9A 4Q28A 1N34E 4BMJA 5FWKA 5BR8I 2HHHI 2IOPA 2LTRA 4DR2E 3HPZA 3GONA 3LMLA 2WW4A 3OMLA 4NXME 1EA6A 1KIJA 2E5LE 3ADLA 3Q1QA 2H36X 2L3CA 1N34I 4BS9A 2L6MA 4R8OA 4JI6E 4HYMA 1XMQE 2LUPB 2E1RA 3IWCA 4MYTA 4NXMI 2E5LI 3J80Q 3LTOA 4DPXA 4B3TI 1DQ3A 1BKNA 3ZZTA 2JY9A 1XMQI 3J81C 5ADZA 4RPFA 3HJCA 1N36E 2DEJA 4LTYA 2DIXA 3QT7A 4DR4E 4BC7A 2N3GA 2JOBA 4DV2E 3HQ1A 4KQVA 2VQFE 4MYUA 5CFFE 2ZBKB 2DSYA 2IOQA 4FWDA 4M2ZA 1N36I 4F9BB 1Z0VA 2K4VA 2OI2A 1Z0EA 1XHKA 4WUBA 5IT9Q 5DNYA 1FKAE 2LBSB 4DUZI 4DV2I 4DV6E 4JV5E 2VQFI 1Z5CA 3K17A 1ZBQA 1Z5BA 2UXBI 2VQEE 5LL6R 1GQEA 4XTJA 1Z0WA 4P78A 3QT6A 5FLXQ 4X65I 3J80C 4LFBI 4DV6I 4DR1E 4HACB 2VQEI 4DPUA 5F3WA 3AV0A 3RMPA 4DV0E 1H7UA 3Q6MA 4DR1I 4LF7E 1NHJA 4DU7A 2NUEA 4DR7E 2UXDI 2O1UA 4P7AA 1ZM9A 3C4TA 3MSWA 1UILA 4LFCI 4BBYA 1WHQA 2RS7A 1A6FA 4DV0I 1RC7A 2FTXB 4EMDA 3T1HI 4USMA 4LF7I 4PRXA 1HNXI 2L33A 4JI7E 4B3RI 4DR7I 4K0KE 2FV4B 2XEXA 4JI0I 4AQYI 1IBME 1Y6ZA 2GQ0A 4JI5E 4DPWA 2FGGA 5AE1A 1NHHA 2CGEA 4WYQB 2VF3A 2G7HA 5GMDA 1VISA 5FLXC 4DR6I 2Z5CB 1ZM4A 1STUA 3HXLA 1N33E 3QT8A 1IBKE 4JI4E 2DEIA 1ZXMA 4YY3E 1ELOA 2L2NA 5L3JA 2NPFA 1IBKI 1J26A 3K1JA 4IZKB 4JI4I 2VF1A 2A2CA 2MDRA 2HK3A 4FW9A 4YY3I 4L8NA 1MG7A 2V83A 2L92A 1FWKA 2Z5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTS A;  4FWH A;  4DXL A;  4Z7Y A;  4LF4 E;  4B3T E;  4DPY A;  3B8H A;  1S4E A;  1KVK A;  1MU5 A;  4X8W A;  3D4J A;  4UT4 A;  4LF4 I;  2V2Q A;  1ZM2 A;  2V34 A;  1ZBT A;  1FNM A;  4GKK E;  5GME A;  4LF9 I;  4DV4 I;  3J7A M;  2R42 A;  4DUZ E;  2LJP A;  3ZM7 A;  2UXB E;  2BM1 A;  1I94 I;  4GKK I;  2CZ9 A;  4P52 A;  4X65 E;  2L3J A;  3QT5 A;  4LFB E;  2Q2E B;  4WUC A;  3HTX A;  1XMO I;  4LF6 I;  3ZKD A;  3LLH A;  2LUQ A;  1Z59 A;  2X36 A;  1WUU A;  1X47 A;  4B3S E;  2UXD E;  4JYA E;  3VYY A;  2V8P A;  3T1Y I;  1J5E E;  3PYD A;  4LFC E;  4KHP I;  3T1H E;  4B3S I;  1HNX E;  1N0U A;  2L2K B;  1HR0 E;  2R3V A;  4B3R E;  1IBL E;  4JYA I;  4AQY E;  4JI0 E;  1DAR A;  2BM0 A;  1J5E I;  2HFU A;  1N0V C;  2HKE A;  1U2R A;  4PRV A;  1UEK A;  1FI4 A;  4HY1 A;  4JI2 I;  5LMN I;  4PU9 A;  1DI2 A;  1HR0 I;  4DR6 E;  1IBL I;  5IWA E;  4M1K A;  1B62 A;  2LJH A;  2ZM6 I;  4DPT A;  3B82 A;  3ZZ0 A;  2GS8 A;  4URL A;  4DV1 E;  4B3M I;  4ZVI A;  1Z0T A;  3F0N A;  5IWA I;  4DU8 A;  4X64 I;  4DR5 E;  3VYX A;  1EI1 A;  2UU9 I;  4DV1 I;  4USK A;  2UUB E;  2RSM A;  4LF8 E;  3HUL A;  1H7S A;  2YT4 A;  1HNZ E;  1RR9 A;  4DV5 E;  3CWV A;  4DR5 I;  1FWL A;  4HAC A;  2ZIT A;  1NZ0 A;  4JI3 I;  2UUB I;  4LF8 I;  4DKK A;  1PKP A;  1QZR A;  2DMY A;  1HNZ I;  4DV5 I;  2NA2 A;  1MX0 A;  4DR3 I;  1Z0G A;  3LPS A;  4LFA E;  3M6A A;  4WUD A;  4DV3 I;  1FJG E;  1ZXN A;  3PYG A;  4X62 I;  4GKJ E;  1K47 A;  3ZZU A;  4LF9 E;  4JI8 I;  4LFA I;  1XNR I;  4DV4 E;  4WFT A;  1H73 A;  3JAM C;  1FJG I;  4X66 E;  2B3T B;  3OTO E;  4DV7 E;  4GKJ I;  1QU6 A;  3ZKB A;  3WU6 A;  1I94 E;  1PVG A;  1H72 C;  1Z5A A;  2UUA E;  2EFG A;  4DR2 I;  1S16 A;  4X66 I;  3OTO I;  4DV7 I;  3C4B A;  2LRS A;  1XMO E;  4LF6 E;  1OJ4 A;  2X7I A;  1T4N A;  2V2V A;  5A2Q C;  2B7T A;  2UUA I;  4HXZ A;  4FWG A;  4JI6 I;  3ADJ A;  2DB2 A;  3PYE A;  1RQ0 A;  3T1Y E;  2J7K A;  4R1F A;  1T4O A;  1Z0B A;  2EZ6 A;  4KHP E;  5LMU E;  2JVA A;  1N32 E;  4OX9 E;  4DR4 I;  3LNU A;  2B7V A;  2RS6 A;  2KHX A;  5LMU I;  2UXC E;  1UHZ A;  4JI1 E;  4JI2 E;  5LMN E;  4DUY E;  2HKJ A;  1N32 I;  3V2U C;  4OX9 I;  3V5R A;  1NHI A;  3B78 A;  2NUF A;  4JG4 A;  2ZM6 E;  2L2M A;  3ADG A;  3WU4 A;  4JV5 I;  3WU3 A;  2UXC I;  4JI1 I;  1EKZ A;  4B3M E;  4Z7C A;  4DUY I;  3H4L A;  1Z0C A;  1KKH A;  4X64 E;  1X48 A;  3WU5 A;  4OOG C;  2UU9 E;  3PYF A;  1YYK A;  4ED4 A;  2UUC E;  1T4L B;  2BV3 A;  3ADI A;  1HNW E;  1XNQ E;  3JAM Q;  3J7A G;  2HFS A;  5IT9 C;  4YHH E;  4JI3 E;  2IHR 1;  2CPN A;  2F4V E;  4NXN E;  1KTV A;  2UUC I;  3P1X A;  1PIE A;  1YYO A;  2AJ4 A;  2HK2 A;  1HNW I;  1XNQ I;  1H74 A;  4DR3 E;  2N3H A;  1D6T A;  4JI7 I;  4FN5 A;  4YHH I;  1YYW A;  2A2D A;  4K0K I;  1IBM I;  1B63 A;  4M30 A;  2F4V I;  4NXN I;  4DV3 E;  4JI5 I;  2RTX A;  4X62 E;  4LF5 E;  5A2Q Q;  4I3H A;  2NUG A;  4JI8 E;  1ZM3 A;  3J81 Q;  1XNR E;  1X49 A;  5BR8 E;  1YZ9 A;  2HHH E;  2V2Z A;  1N33 I;  3J7Y p;  4UTG A;  4LF5 I;  1RRE A;  1O0W A;  1N34 E;  5BR8 I;  2HHH I;  2LTR A;  4DR2 E;  3GON A;  2WW4 A;  4NXM E;  1EA6 A;  1KIJ A;  2E5L E;  3ADL A;  3Q1Q A;  2L3C A;  1N34 I;  4JI6 E;  4HYM A;  1XMQ E;  2LUP B;  2E1R A;  4MYT A;  4NXM I;  2E5L I;  3J80 Q;  3LTO A;  4DPX A;  4B3T I;  1BKN A;  3ZZT A;  2JY9 A;  1XMQ I;  3J81 C;  4RPF A;  1N36 E;  2DEJ A;  2DIX A;  3QT7 A;  4DR4 E;  2N3G A;  4DV2 E;  4KQV A;  2VQF E;  4MYU A;  5CFF E;  2ZBK B;  4FWD A;  4M2Z A;  1N36 I;  1Z0V A;  2OI2 A;  1Z0E A;  1XHK A;  4WUB A;  5IT9 Q;  1FKA E;  2LBS B;  4DUZ I;  4DV2 I;  4DV6 E;  4JV5 E;  2VQF I;  1Z5C A;  3K17 A;  1Z5B A;  2UXB I;  2VQE E;  5LL6 R;  1GQE A;  4XTJ A;  1Z0W A;  3QT6 A;  5FLX Q;  4X65 I;  3J80 C;  4LFB I;  4DV6 I;  4DR1 E;  4HAC B;  2VQE I;  4DPU A;  4DV0 E;  1H7U A;  4DR1 I;  4LF7 E;  1NHJ A;  4DU7 A;  2NUE A;  4DR7 E;  2UXD I;  4P7A A;  1ZM9 A;  3C4T A;  1UIL A;  4LFC I;  1WHQ A;  2RS7 A;  1A6F A;  4DV0 I;  1RC7 A;  4EMD A;  3T1H I;  4USM A;  4LF7 I;  4PRX A;  1HNX I;  2L33 A;  4JI7 E;  4B3R I;  4DR7 I;  4K0K E;  4AQY I;  2XEX A;  4JI0 I;  1IBM E;  4JI5 E;  4DPW A;  1NHH A;  4WYQ B;  2VF3 A;  5GMD A;  1VIS A;  5FLX C;  4DR6 I;  1ZM4 A;  1STU A;  1N33 E;  3QT8 A;  1IBK E;  4JI4 E;  2DEI A;  1ZXM A;  4YY3 E;  1ELO A;  2L2N A;  5L3J A;  2NPF A;  1IBK I;  1J26 A;  3K1J A;  4JI4 I;  2A2C A;  2MDR A;  2HK3 A;  4FW9 A;  4YY3 I;  1MG7 A;  1WHN A;  1FWK A; 
#chains in the Genus database with same CATH topology
 2LTS A;  4FWH A;  1ZAA C;  2EM9 A;  2EN1 A;  4ZYE A;  1WHN A;  4DXL A;  2EPO A;  4DMI A;  4LF4 E;  4Z7Y A;  4B3T E;  4DPY A;  4R2A A;  1USV A;  2YTG A;  4J8Z A;  4BA1 A;  2LT7 A;  3B8H A;  1S4E A;  1KVK A;  3FIG A;  1MU5 A;  2VRD A;  4F9C B;  2Z5B B;  1TF6 A;  3HKM A;  4MQY A;  4X8W A;  4R2S A;  3D4J A;  2YSO A;  1UDQ A;  4LCF A;  4UT4 A;  4LF4 I;  2ELY A;  2V2Q A;  5DNL A;  2EPN A;  3F6G A;  3MHS C;  3IWD A;  2EOE A;  1KJK A;  2N8X A;  1NEI A;  3F6H A;  3AUZ A;  1ZM2 A;  2V34 A;  2EPA A;  4HTG A;  1ZBT A;  1FNM A;  2JR1 A;  4GKK E;  5GME A;  2EOO A;  4LF9 I;  4FW3 A;  3M85 D;  2EM7 A;  2EPK X;  1UDS A;  2Z5C A;  4DV4 I;  1X6H A;  2JWO A;  3J7A M;  2R42 A;  4DUZ E;  5AC4 A;  3DJW A;  1IMU A;  2LJP A;  3ZM7 A;  2UXB E;  2BM1 A;  1I94 I;  1X6E A;  4GKK I;  3L00 A;  2CZ9 A;  2PO0 A;  2EOY A;  2GO4 A;  2LCE A;  1X3C A;  2BA0 D;  2IER A;  2J65 A;  4P52 A;  4LCG A;  4X65 E;  1BBO A;  2L3J A;  3QT5 A;  4IZK A;  4LFB E;  5C0X B;  2YRK A;  4X9J A;  1JK2 A;  2Q2E B;  3HTX A;  4WUC A;  4ISA A;  2KON A;  2EMX A;  1XMO I;  4LF6 I;  3ZKD A;  2I9I A;  4BHC A;  5DRQ A;  3LLH A;  1E3H A;  2D9H A;  2LUQ A;  2EN8 A;  1Z59 A;  2YPN A;  1GTK A;  2GLI A;  2X36 A;  4AIM A;  5LLQ A;  2PO2 B;  1WUU A;  1X47 A;  3KWR A;  4B3S E;  2WNR A;  5A6J A;  2EPR A;  4WX9 A;  4FW5 A;  1MEY C;  4JYA E;  3VYY A;  1A1H A;  2UXD E;  2V8P A;  3T1Y I;  1J5E E;  2KOU A;  3PYD A;  2EQ0 A;  4LFC E;  2JE6 B;  2PRT A;  4KHP I;  3T1H E;  3EPH A;  2Z5B A;  4B3S I;  2CVE A;  1HNX E;  2K7I A;  1N0U A;  4NHR A;  2L2K B;  3PS1 A;  1HR0 E;  2R3V A;  4B3R E;  1IBL E;  4JYA I;  4AQY E;  2DRP A;  4JI0 E;  4IFD C;  1DAR A;  2BM0 A;  3K85 A;  5C0X D;  1J5E I;  3DD6 A;  2A25 A;  2HFU A;  1N0V C;  2HKE A;  1U2R A;  4FW6 A;  4PRV A;  1UEK A;  1FI4 A;  3P3G A;  1P42 A;  4HY1 A;  4OO1 B;  2EN7 A;  2GHF A;  1WXR A;  5LMN I;  4JI2 I;  4IFD A;  2WBS A;  1DI2 A;  1NCS A;  4R2D A;  3EPK A;  2BA1 D;  4IZJ D;  4PU9 A;  4DR6 E;  1HR0 I;  1IBL I;  3QG5 C;  5IWA E;  4M1K A;  1B62 A;  4TUG A;  4FK5 C;  2LJH A;  4L5N C;  1N3G A;  1ZR9 A;  2EM5 A;  2ZM6 I;  4DPT A;  2DLK A;  2CG9 A;  2LMZ A;  3ECR A;  4NZV A;  2WZO A;  3B82 A;  5KL2 A;  3ZZ0 A;  2JXP A;  2GS8 A;  1EH8 A;  2ENA A;  4URL A;  2V86 A;  4DV1 E;  2JEA B;  5C0X C;  4B3M I;  2YTN A;  1PDA A;  1Y5Y A;  4ZVI A;  1Z0T A;  2MDG A;  3F0N A;  5IWA I;  4WXC A;  1YPN A;  2C39 B;  3MHH C;  4DU8 A;  4X64 I;  2EPZ A;  5C0X A;  4DR5 E;  4F9A B;  4LCH A;  3VYX A;  1EI1 A;  2M9A A;  4MDT A;  2V8Q B;  2UU9 I;  4DV1 I;  4USK A;  2UUB E;  1XXE A;  2RSM A;  3KRN A;  2EWL A;  4LF8 E;  3Q6N A;  4IFD F;  2YWQ A;  4IS1 C;  3HUL A;  5K36 D;  2ODR D;  4WSP A;  1H7S A;  1HK7 A;  1AH5 A;  2YT4 A;  1HNZ E;  5DRO A;  3B4T A;  4OO1 D;  1RR9 A;  4DV5 E;  3CWV A;  1SFE A;  4DR5 I;  2PO2 A;  1FWL A;  4HAC A;  2MKN A;  2EM0 A;  2JYA A;  2LO3 A;  2LV2 A;  3K6Q A;  1NZ0 A;  2NN6 F;  2ZIT A;  4WPY A;  4JI3 I;  2UUB I;  4LF8 I;  4DKK A;  1PKP A;  2WP8 B;  2Q8U A;  1QZR A;  2PNL A;  2DMY A;  2JE6 A;  1HNZ I;  2LVH A;  4R2R A;  4R03 A;  5JEA B;  5C0X E;  4DV5 I;  2NA2 A;  1MX0 A;  4DR3 I;  1Z0G A;  3LPS A;  2EOZ A;  2EM2 A;  4LFA E;  2JOX A;  2WBT A;  3M6A A;  1IQO A;  2EPU A;  2YU5 A;  4WUD A;  4DV3 I;  1FJG E;  1ZXN A;  3CDI A;  3PYG A;  5AAS A;  3KZZ A;  2EMH A;  1G2D C;  4X62 I;  4GKJ E;  1K47 A;  2I13 A;  4KZS A;  2EN6 A;  4LPF A;  3ZZU A;  2CSH A;  4R2E A;  4KWY A;  2EPL X;  4LF9 E;  1RMD A;  2EMF A;  1A1I A;  3KZY A;  4JI8 I;  4LFA I;  2V89 A;  2YTD A;  2M7Q A;  4DV4 E;  1XNR I;  4TUI A;  2EMY A;  4WFT A;  3JAM C;  1H73 A;  1YHC A;  4BA1 B;  5AE3 A;  2EOX A;  2BR2 B;  1FJG I;  4ZYH A;  2B3T B;  4X66 E;  3OTO E;  4DV7 E;  3DF6 A;  4GKJ I;  1QU6 A;  3ZKB A;  3WU6 A;  1I94 E;  1P47 A;  3P06 A;  1PVG A;  4FW7 A;  2JEA A;  3JU0 A;  4BC9 A;  1H72 C;  1Z5A A;  3VK6 A;  2UUA E;  4F6N A;  2E1M A;  2EFG A;  5JEA D;  4DR2 I;  4LU9 A;  3U1Y A;  2EPC A;  1S16 A;  3EQ1 A;  4X66 I;  3OTO I;  4DV7 I;  3C4B A;  2LRS A;  5AC5 A;  4OO1 E;  2WW4 A;  5KL3 A;  4P7D A;  1XMO E;  4LF6 E;  1OJ4 A;  2X7I A;  1T4N A;  5A2Q C;  2V2V A;  1ZU1 A;  1L4S A;  2B7T A;  2EQ3 A;  2UUA I;  1T38 A;  3M99 B;  2EPM X;  4F54 A;  5A6A A;  4HXZ A;  3BID A;  3L7Z B;  4FWG A;  4JI6 I;  4OKG A;  2YTQ A;  3ADJ A;  2DB2 A;  2EMZ A;  3ZOQ B;  1YFH A;  4IJD A;  3PYE A;  1PJQ A;  2CT1 A;  2O1T A;  1RQ0 A;  1USU A;  3T1Y E;  2J7K A;  4R1F A;  2EL5 A;  1BBG A;  2EOJ A;  1YUI A;  3VHT B;  1T4O A;  4IZJ B;  1Z0B A;  2ENH A;  4ZYD A;  2V87 A;  2WP8 A;  2EZ6 A;  3H09 A;  4F6M A;  4KHP E;  5LMU E;  2JVA A;  4M0V A;  5JEA A;  4GEQ B;  1N32 E;  2M4I A;  4OX9 E;  1DGC A;  2EP3 A;  5T6J A;  2BBG A;  5A6K A;  4DR4 I;  2YZT A;  3LNU A;  2B7V A;  2RS6 A;  2GPI A;  2KHX A;  1A1K A;  1MGT A;  3JTZ A;  5LMU I;  1AAY A;  2MC5 A;  2UXC E;  4MU1 A;  1UHZ A;  4JI1 E;  2F1D A;  4JI2 E;  5LMN E;  4GQU A;  4N3O A;  4DUY E;  2HKJ A;  1N32 I;  3V2U C;  4OX9 I;  3V5R A;  2EM4 A;  2YRH A;  5IV8 B;  3P76 A;  2LJU A;  5AE2 A;  1NHI A;  2NUF A;  1Y4S A;  3B78 A;  2VE7 C;  1UDO A;  4JG4 A;  2ZM6 E;  2EQ1 A;  2L2M A;  2BR2 A;  4R2Q A;  3ADG A;  3WU4 A;  4MU3 A;  5K36 B;  4MU4 A;  4JV5 I;  5JEA E;  2EMA A;  3WU3 A;  2UXC I;  4LOM A;  1UBD C;  4JI1 I;  2O1V A;  1EKZ A;  3IWB A;  4B3M E;  3EPL A;  4Z7C A;  4DUY I;  3H4L A;  3BBG A;  1Z0C A;  4I8O A;  2YTO A;  1KKH A;  3BF2 A;  2F8B A;  4X64 E;  2JEB B;  5ELW A;  1X48 A;  5A6B D;  3WU5 A;  2EMW A;  2EN3 A;  4OOG C;  2UU9 E;  3PYF A;  2DGC A;  1Y4U A;  1YYK A;  2O1W A;  4ED4 A;  4BCA A;  2AE8 A;  2MKD A;  2GO3 A;  2UUC E;  4R2P A;  2DMI A;  1T4L B;  2CTD A;  2PNM A;  2BV3 A;  3ADI A;  1HNW E;  1XNQ E;  4HEI A;  3JAM Q;  3J7A G;  5IT9 C;  2HFS A;  2EMK A;  3THO B;  2B9D A;  4YHH E;  3BGH A;  4JI3 E;  2Z5E A;  1BB8 A;  2IHR 1;  4GZN C;  1YSA C;  2CPN A;  1GZ6 A;  2L8T A;  2MC6 A;  3GLL A;  2F4V E;  4NXN E;  1KTV A;  4IZJ A;  2UUC I;  3P1X A;  4MLQ A;  1PIE A;  2VES A;  4FW4 A;  2EMI A;  1YYO A;  2AJ4 A;  2HK2 A;  1HNW I;  2EJ4 A;  1XNQ I;  1H74 A;  4DR3 E;  2LE2 A;  2N3H A;  1D6T A;  5A6B A;  3GME A;  4JI7 I;  4FN5 A;  3P3C A;  2RPC A;  4YHH I;  3PS3 A;  1TN9 A;  4BHB A;  1YYW A;  2YTI A;  2A2D A;  4AM3 A;  4K0K I;  2EPP A;  1IBM I;  2M1S A;  1B63 A;  4M30 A;  5KL6 A;  4NXN I;  2F4V I;  4DV3 E;  4JI5 I;  3C6M A;  2RTX A;  4X62 E;  4LF5 E;  5A2Q Q;  1F2I G;  4I3H A;  2V88 A;  2ENC A;  5K36 C;  2NUG A;  5C0X F;  2ODR C;  4JI8 E;  1ZM3 A;  3J81 Q;  1XNR E;  3PRY A;  1X49 A;  5BR8 E;  1YZ9 A;  2HHH E;  2C37 B;  4OO1 C;  3HPS A;  1UDN A;  1TF3 A;  2V2Z A;  1N33 I;  4O4K A;  2EML A;  1LLM C;  2V85 A;  3J7Y p;  4UTG A;  4LF5 I;  1RRE A;  5K36 A;  5DNX A;  4N4R B;  1R6L A;  2PO1 B;  1IQS A;  1O0W A;  1SR9 A;  2ELZ A;  2BA0 G;  4OO1 A;  4Q28 A;  1N34 E;  3UHM A;  1EH6 A;  4BMJ A;  4O24 A;  1A1L A;  2EMC A;  2JT2 A;  5FWK A;  5BR8 I;  2HHH I;  2IOP A;  2LTR A;  4DR2 E;  3HPZ A;  2JEB A;  3TQM A;  3GON A;  2YTP A;  2WNR B;  1EH7 A;  3LML A;  3OML A;  4NXM E;  1EA6 A;  1KIJ A;  3EPJ A;  2E5L E;  3ADL A;  1OYR A;  1OYP A;  4QNK A;  2EPX A;  3Q1Q A;  2H36 X;  2L3C A;  1N34 I;  2R1F A;  4BS9 A;  1B69 A;  1QNT A;  2L6M A;  2EN4 A;  2C38 B;  3H1C A;  5KL5 A;  4R8O A;  4JI6 E;  2C39 A;  4HYM A;  1XMQ E;  2LUP B;  1E3P A;  5K36 E;  1UN6 B;  3IWC A;  2E1R A;  4MYT A;  4NXM I;  1YUJ A;  2E5L I;  3J80 Q;  4R2C A;  5K36 F;  3LTO A;  2EOF A;  1X5W A;  1DQ3 A;  4DPX A;  4B3T I;  4OO1 F;  1BKN A;  3ZZT A;  2JY9 A;  2YU8 A;  1XMQ I;  3GCM A;  3J81 C;  5TSE A;  5ADZ A;  4NBQ A;  4IFD B;  4RPF A;  3HJC A;  1N36 E;  1G2F C;  2DEJ A;  4LTY A;  5JEA C;  2DIX A;  4MLV A;  4O5G A;  3QT7 A;  4DR4 E;  4BC7 A;  2PNZ B;  2RQL A;  2NN6 B;  2N3G A;  2EOQ A;  3NZK A;  1WJP A;  2JOB A;  4DV2 E;  3HQ1 A;  2BA1 G;  4KQV A;  2VQF E;  5DRP A;  4MYU A;  5CFF E;  2ZBK B;  2JP9 A;  5DRR A;  2DSY A;  2IOQ A;  4FWD A;  1JK1 A;  4M2Z A;  4O43 A;  1N36 I;  4BA2 B;  2EOM A;  2YTJ A;  2YTF A;  4ZYG A;  4F9B B;  1Z0V A;  2K4V A;  1T39 A;  4RH8 A;  4M9V C;  1A1F A;  1XHK A;  1Z0E A;  2C37 A;  2OI2 A;  4WUB A;  5DNY A;  5IT9 Q;  1FKA E;  2LBS B;  4DUZ I;  5A69 A;  4DV2 I;  4DV6 E;  1A1G A;  4JV5 E;  2VQF I;  1Z5C A;  2EN2 A;  3K17 A;  1ZBQ A;  1Z5B A;  2UXB I;  2PO1 A;  2EM8 A;  2VQE E;  5LL6 R;  2EOH A;  1GQE A;  2EL6 A;  4XTJ A;  1Z0W A;  4U3D A;  2YSP A;  4P78 A;  2R76 A;  2EOI A;  2EM6 A;  2EE8 A;  3U1K A;  3QT6 A;  2WCC 3;  3UK3 C;  5FLX Q;  4X65 I;  3J80 C;  4IFD D;  4LFB I;  4DV6 I;  4DR1 E;  4HAC B;  2HC5 A;  1PJS A;  2DLQ A;  3P3E A;  5IXM B;  2VQE I;  3C6K A;  2EOS A;  4DPU A;  2NN6 D;  5JEA F;  5F3W A;  4IS9 A;  3AV0 A;  2ADR A;  2C38 A;  3RMP A;  4DV0 E;  2HJJ A;  1H7U A;  3Q6M A;  4DR1 I;  4LF7 E;  1NHJ A;  4DU7 A;  3M7N G;  4MU0 A;  3PS2 A;  4U3B A;  2NUE A;  4DR7 E;  2UXD I;  2O1U A;  2EMB A;  4P7A A;  1ZM9 A;  2YRM A;  3C4T A;  1UIL A;  3MSW A;  4OZE A;  4LFC I;  1VI7 A;  2WBU A;  4BBY A;  1WHQ A;  2RS7 A;  1A6F A;  3L7Z A;  4DV0 I;  1RC7 A;  2FTX B;  4EMD A;  3T1H I;  4USM A;  2NN6 C;  4RHB B;  4LF7 I;  4PRX A;  1HNX I;  2L33 A;  4JI7 E;  4Q35 B;  1KYQ A;  2BB8 A;  4B3R I;  4DR7 I;  2EMG A;  4K0K E;  2FV4 B;  2XEX A;  1Y60 A;  3CDJ A;  1IBM E;  5EKW A;  1Y6Z A;  4JI0 I;  4AQY I;  2PNZ A;  1RHY A;  2NN6 A;  2GQ0 A;  4JI5 E;  4DPW A;  2FGG A;  5AE1 A;  1NHH A;  1OYS A;  5KL4 A;  2CGE A;  4WYQ B;  4WSG A;  2VF3 A;  2EM3 A;  2G7H A;  5GMD A;  4WXD A;  1WRJ A;  2IES A;  1VIS A;  5FLX C;  4BA2 A;  4DR6 I;  2Z5C B;  4J3D A;  1ZM4 A;  1PJT A;  2O3Z A;  1STU A;  3HXL A;  1N33 E;  3QT8 A;  1A1J A;  1IBK E;  4JI4 E;  2DEI A;  1R6M A;  5EL9 A;  1ZXM A;  3M85 G;  4IFD E;  4YY3 E;  2HGH A;  2EL4 A;  1Z1B A;  2PO0 B;  1ELO A;  2L2N A;  5L3J A;  1X6F A;  2NPF A;  1YH8 A;  1J26 A;  2E72 A;  2NN6 E;  3K1J A;  4IZK B;  1IBK I;  2J7J A;  3THN A;  5KL7 A;  4JI4 I;  4AID A;  2VF1 A;  4F2J C;  2YTE A;  2JPA A;  2MDR A;  2A2C A;  2RSI A;  2HK3 A;  4FW9 A;  4YY3 I;  2EOR A;  4L8N A;  1MG7 A;  2V83 A;  3M7N D;  4QNJ A;  2L92 A;  1FWK A;  2NAB A; 
#chains in the Genus database with same CATH homology
 2LTS A;  4FWH A;  1WHN A;  4DXL A;  4DMI A;  4LF4 E;  4Z7Y A;  4B3T E;  4DPY A;  1USV A;  4J8Z A;  3B8H A;  1S4E A;  1KVK A;  3FIG A;  1MU5 A;  4F9C B;  2Z5B B;  4X8W A;  3D4J A;  4UT4 A;  4LF4 I;  2V2Q A;  3F6G A;  3IWD A;  3F6H A;  3AUZ A;  1ZM2 A;  2V34 A;  1ZBT A;  1FNM A;  2JR1 A;  4GKK E;  5GME A;  4LF9 I;  2Z5C A;  4DV4 I;  2JWO A;  3J7A M;  2R42 A;  4DUZ E;  3DJW A;  2LJP A;  3ZM7 A;  2UXB E;  2BM1 A;  1I94 I;  4GKK I;  2CZ9 A;  4P52 A;  4X65 E;  2L3J A;  3QT5 A;  4IZK A;  4LFB E;  2Q2E B;  4WUC A;  3HTX A;  2KON A;  1XMO I;  4LF6 I;  3ZKD A;  3LLH A;  2LUQ A;  1Z59 A;  2X36 A;  1WUU A;  1X47 A;  3KWR A;  4B3S E;  2UXD E;  4JYA E;  3VYY A;  2V8P A;  3T1Y I;  1J5E E;  2KOU A;  3PYD A;  4LFC E;  4KHP I;  3T1H E;  2Z5B A;  4B3S I;  1HNX E;  1N0U A;  2L2K B;  1HR0 E;  2R3V A;  4B3R E;  1IBL E;  4JYA I;  4AQY E;  4JI0 E;  1DAR A;  2BM0 A;  3K85 A;  1J5E I;  2HFU A;  1N0V C;  2HKE A;  1U2R A;  4PRV A;  1UEK A;  1FI4 A;  4HY1 A;  1WXR A;  5LMN I;  4JI2 I;  4PU9 A;  1DI2 A;  4IZJ D;  1HR0 I;  4DR6 E;  1IBL I;  5IWA E;  4M1K A;  1B62 A;  4TUG A;  2LJH A;  4L5N C;  2ZM6 I;  4DPT A;  2CG9 A;  2LMZ A;  3B82 A;  2WZO A;  3ZZ0 A;  2GS8 A;  4URL A;  2V86 A;  4DV1 E;  4B3M I;  4ZVI A;  1Z0T A;  3F0N A;  5IWA I;  4DU8 A;  4X64 I;  4DR5 E;  4F9A B;  3VYX A;  1EI1 A;  2V8Q B;  2UU9 I;  4DV1 I;  4USK A;  2UUB E;  2RSM A;  2EWL A;  4LF8 E;  3Q6N A;  3HUL A;  2ODR D;  4WSP A;  1H7S A;  1HK7 A;  2YT4 A;  1HNZ E;  1RR9 A;  4DV5 E;  3CWV A;  4DR5 I;  1FWL A;  4HAC A;  2ZIT A;  3K6Q A;  1NZ0 A;  4JI3 I;  4WPY A;  2UUB I;  4LF8 I;  4DKK A;  1PKP A;  1QZR A;  2PNL A;  2DMY A;  1HNZ I;  4R03 A;  4DV5 I;  2NA2 A;  1MX0 A;  4DR3 I;  1Z0G A;  3LPS A;  4LFA E;  2JOX A;  3M6A A;  4WUD A;  4DV3 I;  1FJG E;  1ZXN A;  3PYG A;  5AAS A;  4X62 I;  4GKJ E;  1K47 A;  4KZS A;  3ZZU A;  4LF9 E;  4JI8 I;  4LFA I;  2V89 A;  2M7Q A;  4DV4 E;  1XNR I;  4TUI A;  4WFT A;  3JAM C;  1H73 A;  5AE3 A;  1FJG I;  4X66 E;  2B3T B;  3OTO E;  4DV7 E;  3DF6 A;  4GKJ I;  1QU6 A;  3ZKB A;  3WU6 A;  1I94 E;  3P06 A;  1PVG A;  3JU0 A;  4BC9 A;  1H72 C;  1Z5A A;  3VK6 A;  2UUA E;  2E1M A;  2EFG A;  4DR2 I;  4LU9 A;  1S16 A;  4X66 I;  3OTO I;  4DV7 I;  3C4B A;  2LRS A;  4P7D A;  1XMO E;  4LF6 E;  1OJ4 A;  2X7I A;  1T4N A;  5A2Q C;  2V2V A;  2B7T A;  2UUA I;  4HXZ A;  4F54 A;  4FWG A;  4JI6 I;  3ADJ A;  2DB2 A;  3ZOQ B;  3PYE A;  2O1T A;  1RQ0 A;  1USU A;  3T1Y E;  2J7K A;  4R1F A;  1T4O A;  4IZJ B;  1Z0B A;  2V87 A;  2EZ6 A;  3H09 A;  4KHP E;  5LMU E;  2JVA A;  4M0V A;  4GEQ B;  1N32 E;  2M4I A;  4OX9 E;  5T6J A;  4DR4 I;  2YZT A;  3LNU A;  2B7V A;  2RS6 A;  2KHX A;  3JTZ A;  5LMU I;  2UXC E;  2MC5 A;  1UHZ A;  4JI1 E;  4JI2 E;  5LMN E;  4N3O A;  4DUY E;  2HKJ A;  1N32 I;  3V2U C;  4OX9 I;  3V5R A;  5AE2 A;  1NHI A;  1Y4S A;  2NUF A;  3B78 A;  4JG4 A;  2VE7 C;  2ZM6 E;  2L2M A;  3ADG A;  3WU4 A;  4JV5 I;  3WU3 A;  2UXC I;  4JI1 I;  2O1V A;  1EKZ A;  3IWB A;  4B3M E;  4Z7C A;  4DUY I;  3H4L A;  1Z0C A;  4I8O A;  1KKH A;  2F8B A;  4X64 E;  1X48 A;  3WU5 A;  4OOG C;  2UU9 E;  3PYF A;  1Y4U A;  1YYK A;  2O1W A;  4ED4 A;  4BCA A;  2UUC E;  1T4L B;  2PNM A;  2BV3 A;  3ADI A;  1HNW E;  1XNQ E;  3JAM Q;  3J7A G;  5IT9 C;  2HFS A;  2B9D A;  4YHH E;  4JI3 E;  2IHR 1;  2CPN A;  1GZ6 A;  2L8T A;  2MC6 A;  2F4V E;  4NXN E;  1KTV A;  4IZJ A;  2UUC I;  3P1X A;  1PIE A;  1YYO A;  2AJ4 A;  2HK2 A;  1HNW I;  1XNQ I;  1H74 A;  4DR3 E;  2LE2 A;  2N3H A;  1D6T A;  4JI7 I;  4FN5 A;  4YHH I;  1YYW A;  2A2D A;  4K0K I;  1IBM I;  2M1S A;  1B63 A;  4M30 A;  2F4V I;  4NXN I;  4DV3 E;  4JI5 I;  2RTX A;  4X62 E;  4LF5 E;  5A2Q Q;  4I3H A;  2V88 A;  2NUG A;  2ODR C;  4JI8 E;  1ZM3 A;  3J81 Q;  1XNR E;  3PRY A;  1X49 A;  5BR8 E;  1YZ9 A;  2HHH E;  3HPS A;  2V2Z A;  1N33 I;  2V85 A;  3J7Y p;  4UTG A;  4LF5 I;  1RRE A;  1O0W A;  1SR9 A;  4Q28 A;  1N34 E;  4BMJ A;  5FWK A;  5BR8 I;  2HHH I;  2IOP A;  2LTR A;  4DR2 E;  3HPZ A;  3GON A;  3LML A;  2WW4 A;  3OML A;  4NXM E;  1EA6 A;  1KIJ A;  2E5L E;  3ADL A;  3Q1Q A;  2H36 X;  2L3C A;  1N34 I;  4BS9 A;  2L6M A;  4R8O A;  4JI6 E;  4HYM A;  1XMQ E;  2LUP B;  2E1R A;  3IWC A;  4MYT A;  4NXM I;  2E5L I;  3J80 Q;  3LTO A;  4DPX A;  4B3T I;  1DQ3 A;  1BKN A;  3ZZT A;  2JY9 A;  1XMQ I;  3J81 C;  5ADZ A;  4RPF A;  3HJC A;  1N36 E;  2DEJ A;  4LTY A;  2DIX A;  3QT7 A;  4DR4 E;  4BC7 A;  2N3G A;  2JOB A;  4DV2 E;  3HQ1 A;  4KQV A;  2VQF E;  4MYU A;  5CFF E;  2ZBK B;  2DSY A;  2IOQ A;  4FWD A;  4M2Z A;  1N36 I;  4F9B B;  1Z0V A;  2K4V A;  2OI2 A;  1Z0E A;  1XHK A;  4WUB A;  5IT9 Q;  5DNY A;  1FKA E;  2LBS B;  4DUZ I;  4DV2 I;  4DV6 E;  4JV5 E;  2VQF I;  1Z5C A;  3K17 A;  1ZBQ A;  1Z5B A;  2UXB I;  2VQE E;  5LL6 R;  1GQE A;  4XTJ A;  1Z0W A;  4P78 A;  3QT6 A;  5FLX Q;  4X65 I;  3J80 C;  4LFB I;  4DV6 I;  4DR1 E;  4HAC B;  2VQE I;  4DPU A;  5F3W A;  3AV0 A;  3RMP A;  4DV0 E;  1H7U A;  3Q6M A;  4DR1 I;  4LF7 E;  1NHJ A;  4DU7 A;  2NUE A;  4DR7 E;  2UXD I;  2O1U A;  4P7A A;  1ZM9 A;  3C4T A;  3MSW A;  1UIL A;  4LFC I;  4BBY A;  1WHQ A;  2RS7 A;  1A6F A;  4DV0 I;  1RC7 A;  2FTX B;  4EMD A;  3T1H I;  4USM A;  4LF7 I;  4PRX A;  1HNX I;  2L33 A;  4JI7 E;  4B3R I;  4DR7 I;  4K0K E;  2FV4 B;  2XEX A;  4JI0 I;  4AQY I;  1IBM E;  1Y6Z A;  2GQ0 A;  4JI5 E;  4DPW A;  2FGG A;  5AE1 A;  1NHH A;  2CGE A;  4WYQ B;  2VF3 A;  2G7H A;  5GMD A;  1VIS A;  5FLX C;  4DR6 I;  2Z5C B;  1ZM4 A;  1STU A;  3HXL A;  1N33 E;  3QT8 A;  1IBK E;  4JI4 E;  2DEI A;  1ZXM A;  4YY3 E;  1ELO A;  2L2N A;  5L3J A;  2NPF A;  1IBK I;  1J26 A;  3K1J A;  4IZK B;  4JI4 I;  2VF1 A;  2A2C A;  2MDR A;  2HK3 A;  4FW9 A;  4YY3 I;  4L8N A;  1MG7 A;  2V83 A;  2L92 A;  1FWK A;  2Z5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...