4DUZE

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4duzE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4duzE02
4USKA 4KHPI 1DARA 1KVKA 4JI8I 4JI8E 1WUUA 1DI2A 4WFTA 4DR2I 4DR2E 4JI1I 4JI1E 1N32E 1HNZE 1PVGA 1GQEA 4ED4A 2L2MA 3B82A 4JYAI 1Z5CA 4DV5I 3J81C 4LF8I 4LF8E 2BV3A 1FWLA 2YT4A 3V5RA 3C4BA 3ADGA 2E5LI 2E5LE 1ZM4A 2B7TA 3QT8A 4PRVA 4DR4E 4Z7YA 2IHR1 3WU3A 2HFSA 4LFCI 4LF5I 4LF5E 3ZZUA 1A6FA 1UEKA 4Z7CA 4LFBI 4LFBE 1ZM2A 3PYDA 1STUA 3JAMQ 1XMOI 3M6AA 4DPTA 1FWKA 1FKAE 4M2ZA 2EZ6A 3HULA 4JI6E 1XNQI 3F0NA 3J7Yp 4DUYE 4FWHA 2EFGA 4HYMA 2A2DA 1N34I 4JI2I 5LMNI 1UHZA 1Z0TA 2RS7A 1UILA 4K0KI 4X66I 4X66E 2LUQA 1ELOA 3LPSA 4NXMI 4NXME 3ZKBA 5LMUE 4DR6I 2OI2A 3CWVA 4X65E 3LLHA 1Z0GA 4P52A 4URLA 4MYUA 3WU5A 4LF7I 4LF7E 3GONA 2WW4A 3PYEA 4DKKA 1KTVA 3ZM7A 4JI3E 1O0WA 3LNUA 2XEXA 2V2VA 1Z5AA 2LTSA 1H74A 3WU4A 1VISA 4ZVIA 1BKNA 2UXCI 3VYYA 1ZM3A 4FWGA 2LTRA 2BM0A 3PYFA 3ZZ0A 1RR9A 3ADJA 2X36A 2B7VA 5IWAI 5IWAE 2JY9A 2V34A 5IT9C 4JG4A 1ZM9A 1I94I 1I94E 1MX0A 1XMQE 2LRSA 4DV7I 4DV7E 1EKZA 1K47A 1N0UA 3C4TA 4WUCA 1YYWA 4EMDA 4DPWA 4DV0I 4YY3I 4YY3E 1H7SA 2R3VA 4GKJI 4GKJE 4RPFA 4KHPE 4X64I 2VQEI 4X64E 2E1RA 2B3TB 4KQVA 1RQ0A 2GS8A 5A2QQ 2L2NA 4M30A 4DR7I 2UXDI 3ADIA 3ZZTA 4PU9A 3PYGA 3K17A 2F4VI 4JYAE 4DV5E 4WUBA 3J7AG 5FLXQ 1T4OA 2DMYA 2RTXA 4LFCE 1KKHA 4DPYA 4DR1I 2Q2EB 1H73A 4AQYI 4JV5I 4JV5E 2J7KA 2RS6A 4NXNI 4NXNE 1XMOE 1QZRA 4DV1I 1H7UA 4UT4A 1IBKI 1IBKE 2R42A 1XNQE 4JI7I 4JI7E 4FWDA 4DV2I 2DEIA 3LTOA 1N34E 4JI2E 5LMNE 1RREA 2HKEA 5LL6R 4DR5I 4OX9E 4DV3I 4DV3E 4OX9I 3QT5A 2V2QA 4K0KE 2DIXA 1MU5A 1N33I 1N33E 4DR6E 4P7AA 1S4EA 1D6TA 4DXLA 3JAMC 1KIJA 1HR0I 4DR3I 1NZ0A 4PRXA 4X62I 4X62E 2ZM6I 1Z0VA 4JI5I 4JI5E 1U2RA 1HNWI 4DUZI 1FJGI 1T4NA 4DUZE 3J7AM 3D4JA 2UXCE 2UUCI 2UUCE 2MDRA 2N3HA 1ZXNA 2V8PA 1S16A 2UUBI 2UUBE 4JI0I 4JI0E 2VQFI 2VQFE 2HK3A 3ADLA 4B3RI 2V2ZA 1Z0EA 4HACB 2L33A 4GKKI 4GKKE 1Z5BA 4R1FA 1B63A 2L3JA 1N0VC 1IBLI 4OOGC 1FI4A 2NUGA 5BR8I 1X49A 5BR8E 3H4LA 4M1KA 1FNMA 3V2UC 1J5EI 2RSMA 4DV0E 4B3MI 3K1JA 4B3TI 2NPFA 3QT6A 2VQEE 2LBSB 4USMA 3J81Q 3J80Q 4DV4I 4DV4E 3ZKDA 4DR7E 2UXDE 1NHHA 2LJHA 1J26A 1XHKA 2F4VE 2UUAI 2UUAE 1X47A 1ZXMA 1PKPA 3OTOI 3OTOE 2NUFA 1B62A 2N3GA 2L3CA 2X7IA 2HFUA 3QT7A 1N32I 1HNZI 4DU8A 4DR1E 1WHNA 2ZBKB 1NHJA 1X48A 5A2QC 4X8WA 4AQYE 3J80C 5CFFE 2AJ4A 4LFAI 4DV1E 4LFAE 2UXBI 3T1HI 2UXBE 3T1HE 1YZ9A 4DR4I 2CZ9A 1EI1A 1Z0WA 4DV2E 1T4LB 2KHXA 2LJPA 5FLXC 4DR5E 3VYXA 4MYTA 4DPXA 2LUPB 1MG7A 4LF9I 4LF9E 2HK2A 1NHIA 4UTGA 4I3HA 2NUEA 3B8HA 3T1YI 3T1YE 4JI6I 2UU9I 2UU9E 1H72C 4DUYI 2BM1A 1HR0E 2JVAA 4DR3E 4HXZA 1QU6A 2ZM6E 4DU7A 1IBMI 1IBME 4HACA 5LMUI 1RC7A 4X65I 2DB2A 1HNWE 1FJGE 1XNRI 1WHQA 1XNRE 5IT9Q 1Z0CA 4YHHI 4YHHE 3HTXA 1EA6A 4B3SI 4B3SE 4JI4I 4JI4E 1OJ4A 4B3RE 1PIEA 2A2CA 3B78A 4JI3I 2VF3A 2CPNA 4LF6I 4LF6E 4WYQB 4DPUA 1IBLE 4HY1A 2ZITA 1ZBTA 1HNXI 1HNXE 2L2KB 1Z0BA 2NA2A 1J5EE 4B3ME 5GMEA 2HHHI 2HHHE 3Q1QA 4B3TE 2HKJA 1N36I 4LF4I 1N36E 4LF4E 4FN5A 3WU6A 1XMQI 4FW9A 1Z59A 1YYKA 4DV6I 4DV6E 4WUDA 2DEJA 4XTJA 3P1XA 1YYOA 5L3JA 5GMDA
chains in the Genus database with same CATH superfamily
4USKA 4KHPI 4IZKA 2BB8A 1UDSA 1DARA 1KVKA 2BA1G 4JI8E 4JI8I 1WUUA 2JEAA 1DI2A 4U3BA 4WFTA 4DR2I 4DR2E 4N3OA 4JI1I 4JI1E 2FV4B 4MDTA 4KWYA 2LV2A 3DD6A 1UDOA 1N32E 1HNZE 2HJJA 1PVGA 1GQEA 4ED4A 4FW6A 2JOXA 2L2MA 1BBGA 1UN6B 1L4SA 2V83A 5JEAF 3B82A 2EM8A 4JYAI 1Z5CA 2NN6A 2N8XA 3HXLA 4DV5I 2V88A 3J81C 4LF8I 4LF8E 5KL5A 1FWLA 2BV3A 4MU4A 2YT4A 3V5RA 1N3GA 4IZKB 3C4BA 3ADGA 2E5LI 2E5LE 1B69A 1ZM4A 4MQYA 2B7TA 3QT8A 4O24A 4PRVA 4M0VA 2HC5A 4DR4E 2JT2A 4N4RB 4Z7YA 1QNTA 5LLQA 2IHR1 4ISAA 3WU3A 5KL3A 2HFSA 5K36F 4LFCI 1TF3A 5C0XF 4LF5E 3ZZUA 1A6FA 1UEKA 2O1VA 2JWOA 1ZBQA 4LFBE 3BIDA 1ZM2A 2H36X 4Z7CA 2EPMX 4LFBI 1GTKA 1Y60A 3PYDA 1USVA 2R76A 1PJQA 1TN9A 1STUA 1YH8A 4IFDA 3JAMQ 2EPNA 4DMIA 3KWRA 5A6AA 1XMOI 3M6AA 1PJSA 4DPTA 1FWKA 1FKAE 3C6KA 2GLIA 4M2ZA 4R2PA 2EZ6A 3HULA 3MSWA 2JYAA 1DQ3A 4JI6E 4KZSA 1XNQI 3EPKA 3F6HA 2EOQA 3F0NA 3J7Yp 1A1IA 4F9CB 4DUYE 4L8NA 2EFGA 2WP8B 4FWHA 4HYMA 4OKGA 1WRJA 2A2DA 1N34I 4JI2I 5LMNI 2ODRC 4OO1E 1UHZA 1Z0TA 3QG5C 2YSOA 2RS7A 2V8QB 3THNA 4AIMA 2BA1D 2JPAA 1UILA 3U1KA 2O3ZA 3P06A 4IFDB 2JEBB 4K0KI 2DSYA 3EPLA 4X66E 4X66I 2LUQA 2EP3A 1IQSA 4MLVA 3TQMA 1ELOA 3LMLA 4NXME 4P7DA 4F6NA 2YSPA 5IV8B 1P42A 5LMUE 3ZKBA 4DR6I 2OI2A 4ZYDA 3ECRA 4R2AA 4X65E 1SFEA 3LLHA 2EPAA 1Z0GA 3CWVA 3PRYA 4J8ZA 2WNRA 4P52A 4HTGA 2EOZA 3HKMA 4TUGA 4MYUA 3WU5A 4LF7E 2Z5CA 4URLA 4MLQA 1Y4SA 3GONA 4LF7I 2WW4A 4LPFA 3M85G 3PYEA 2YTDA 1UBDC 2JE6A 4MU3A 4DKKA 2EMHA 2PNZB 4GQUA 4WXCA 1KTVA 3ZM7A 5DRRA 4JI3E 1YHCA 1NCSA 1O0WA 3LNUA 3M99B 2XEXA 2ELYA 2V2VA 1Z5AA 2LTSA 2WBTA 2EPUA 1H74A 3WU4A 1VISA 2EPZA 4ZVIA 1BKNA 2UXCI 2WCC3 2MC6A 3VYYA 2K7IA 2I13A 1ZM3A 2Z5CB 4FWGA 4BHBA 2LTRA 1P47A 2ENAA 2BM0A 3PYFA 1X6EA 4MU0A 4QNKA 3ZZ0A 2DMIA 2EMIA 1RR9A 2EOYA 2JE6B 3ADJA 2X36A 2B7VA 5IWAI 5IWAE 3VHTB 5AASA 3JTZA 2JY9A 2GO3A 2EN7A 2NN6D 4P78A 2V34A 1X6FA 2EWLA 5DRQA 5IT9C 4JG4A 2V89A 4FW4A 2YRKA 1ZM9A 4AIDA 1I94I 1I94E 3IWCA 2MDGA 1MX0A 1XMQE 2RQLA 2EN8A 2LRSA 1R6MA 2EL4A 4DV7I 4DV7E 3H09A 2J65A 5K36E 3UHMA 1EKZA 5C0XE 1YUJA 3RMPA 5FWKA 1EH7A 1K47A 1N0UA 3C4TA 4WUCA 2EMXA 1YYWA 2DLQA 4EMDA 1RHYA 4WPYA 4DPWA 4DV0I 4YY3I 4YY3E 1H7SA 2R3VA 2BA0G 4GKJI 4GKJE 4RPFA 4KHPE 5T6JA 4IFDD 4X64I 2VQEI 4X64E 2E1RA 5AC5A 2B3TB 2E72A 4R2RA 4KQVA 3M85D 4IS1C 1KJKA 1RQ0A 2EORA 2GS8A 3F6GA 5A2QQ 5K36C 2L2NA 4M30A 5C0XC 2LJUA 2NN6F 4DR7I 4I8OA 3IWDA 2UXDI 2EQ0A 3ADIA 2EN4A 3ZZTA 2C38A 4PU9A 1MEYC 4F9BB 2O1TA 3K17A 3PYGA 2F4VI 4JYAE 1YPNA 4DV5E 2I9IA 2YRMA 1WXRA 4WUBA 4OO1B 3J7AG 2Q8UA 1Y4UA 4BC9A 3MHSC 5ADZA 5FLXQ 1UDQA 4R8OA 1T4OA 4RHBB 2EPRA 3M7NG 2EPXA 2EOSA 1SR9A 2EMGA 3K6QA 2DMYA 3LPSA 3P76A 2RTXA 4LFCE 2C38B 2M7QA 4R2EA 2WP8A 2M4IA 4IFDF 1KKHA 2LT7A 4DPYA 4DR1I 5EKWA 5ELWA 2EOIA 4GEQB 2Z5EA 2Q2EB 2IOQA 3U1YA 1H73A 2EPKX 2LO3A 4AQYI 4JV5I 4JV5E 2J7KA 2RS6A 4RH8A 2LCEA 2YU5A 4NXNE 2JEBA 4NXNI 1XMOE 1QZRA 4DV1I 2PO1A 1H7UA 4UT4A 1IBKI 4F54A 1IBKE 1BB8A 3HJCA 2EL6A 1PDAA 2EM0A 2BBGA 2R42A 5AE1A 2EM5A 1XNQE 4JI7I 4JI7E 4FWDA 4DV2I 2DEIA 3LTOA 3C6MA 1N34E 4JI2E 5LMNE 1UDNA 2BA0D 2LE2A 1RREA 4X9JA 2HKEA 4QNJA 2EOEA 5LL6R 3BGHA 4OX9E 4IS9A 4DV3E 3HPZA 1YSAC 3P3EA 3JU0A 3QT5A 4DV3I 5K36A 2V2QA 2PNZA 3CDJA 5C0XA 2PO0A 4K0KE 2V86A 2PO1B 3PS2A 2DIXA 1MU5A 2PRTA 1N33I 5A6KA 1N33E 2EM6A 4DR6E 3DJWA 4R2DA 2K4VA 3NZKA 4P7AA 2EM2A 2EPPA 2ODRD 4WX9A 1S4EA 4IZJA 4BS9A 4O43A 1TF6A 5TSEA 3Q6NA 4DXLA 4OO1C 2YU8A 3JAMC 1D6TA 2YWQA 1KIJA 2J7JA 1RMDA 1HR0I 4OZEA 4DR3I 1PJTA 5K36B 5C0XB 2F1DA 2PO0B 3HQ1A 1NZ0A 4NXMI 4O4KA 3BBGA 4PRXA 4R2SA 4X62I 4X62E 1IMUA 2ZM6I 2JXPA 2YTJA 5AE2A 3M7ND 2ADRA 2YTEA 4BMJA 1Z0VA 3P3CA 4OO1D 4JI5I 4JI5E 2R1FA 1G2DC 1U2RA 1VI7A 2UUCI 1HNWI 2CTDA 4IZJB 4DUZI 2NN6E 1T4NA 4DUZE 3J7AM 1FJGI 3D4JA 2VRDA 1NEIA 3UK3C 2UXCE 2DGCA 2UUCE 2MDRA 1T38A 2PNMA 2N3HA 1ZXNA 2O1WA 2V8PA 1S16A 2IERA 5DRPA 5JEAE 2UUBI 4LF5I 2UUBE 4JI0I 4JI0E 2VQFI 2VQFE 1E3HA 2HK3A 2EOMA 4BA1B 1Y6ZA 2RSIA 3ADLA 4B3RI 1X3CA 2EN2A 2JOBA 2LMZA 1Z0EA 2V2ZA 3PS1A 1A1GA 4M9VC 3ZOQB 4HACB 1KYQA 1XXEA 2L33A 4GKKI 4GKKE 1Z5BA 2PO2A 4R1FA 1B63A 2ENHA 2VESA 2L3JA 2EPLX 1N0VC 4ZYHA 1IBLI 4OOGC 2EM9A 2M1SA 4FK5C 1YFHA 2KONA 5F3WA 1FI4A 4MU1A 5A69A 2NUGA 1ZR9A 3CDIA 2WZOA 1ZU1A 5JEAC 5BR8I 1X49A 5BR8E 2NABA 3H4LA 4LCGA 4M1KA 3EPJA 1FNMA 3FIGA 4BC7A 2EPCA 2MC5A 4FW3A 4ZYGA 3V2UC 1J5EI 2RSMA 4DV0E 4B3MI 3K1JA 5EL9A 1A1KA 4OO1A 3OMLA 4B3TI 2NPFA 2PO2B 3L7ZB 3QT6A 2VQEE 2LBSB 2CG9A 3H1CA 4USMA 3J81Q 4Q28A 3J80Q 4DV4I 4DV4E 2AE8A 2Z5BA 3ZKDA 4DR7E 1HK7A 2EE8A 2UXDE 3AV0A 1NHHA 2LJHA 1J26A 3AUZA 2JR1A 3EPHA 1XHKA 2EOOA 2V87A 4NZVA 1OYSA 3EQ1A 2YTFA 2F4VE 2PNLA 2EOJA 2GO4A 2EN3A 2UUAI 2UUAE 1X6HA 1X47A 2ENCA 4Q35B 1JK2A 1ZXMA 2O1UA 5C0XD 5K36D 2YTQA 1PKPA 4F6MA 2CGEA 1LLMC 3B4TA 3OTOI 3OTOE 4F2JC 2NUFA 1B62A 2N3GA 4R2CA 1EH8A 2L3CA 2X7IA 3KZYA 3THOB 2HFUA 2Z5BB 2CT1A 2KOUA 3QT7A 1HNZI 1N32I 4BA2B 4BCAA 2B9DA 5KL2A 4DU8A 4IZJD 4R03A 4DR1E 1WHNA 2ZBKB 1NHJA 4BA2A 5A6JA 2EMKA 1X48A 5A2QC 4X8WA 4AQYE 2YTIA 3J80C 5JEAA 1Z1BA 5CFFE 2AJ4A 4LCFA 2YZTA 4LFAI 2EM7A 4DV1E 4O5GA 2YRHA 4LFAE 4NBQA 1R6LA 2JEAB 5KL7A 4HEIA 2EMWA 2EMFA 2LVHA 2EL5A 3P3GA 2UXBI 3T1HI 2YTNA 3T1HE 1YZ9A 2UXBE 1F2IG 3Q6MA 2JP9A 4DR4I 2CZ9A 3GCMA 1EI1A 1A1LA 1Z0WA 5AE3A 4DV2E 1T4LB 2KHXA 5AC4A 2LJPA 2RPCA 2M9AA 2NN6B 5GMDA 5FLXC 2WBUA 4DR5E 2D9HA 1AH5A 3VYXA 4MYTA 2YPNA 4DPXA 4IJDA 5JEAB 2LUPB 1MG7A 5DROA 4LF9E 4LF9I 2VF1A 2EMAA 2HK2A 2EM3A 1NHIA 1MGTA 4UTGA 5A6BD 4TUIA 4I3HA 2EM4A 1JK1A 1A1HA 2FTXB 1BBOA 2EPOA 3MHHC 2NUEA 3B8HA 3T1YI 4ZYEA 3T1YE 4JI6I 4U3DA 2DLKA 1EH6A 2EOFA 2UU9E 2UU9I 1H72C 4DUYI 4BHCA 2L6MA 4LOMA 3VK6A 2FGGA 3PS3A 4J3DA 4WXDA 5DNXA 2A25A 2BM1A 1HR0E 2JVAA 4DR3E 2GPIA 2IESA 4BA1A 4NHRA 2YTPA 4HXZA 1X5WA 1QU6A 2ZM6E 4DU7A 1IBMI 4R2QA 5KL4A 1IBME 4FW7A 4HACA 2EMCA 1A1JA 5LMUI 5IXMB 1RC7A 5DNLA 1A1FA 2EN1A 1GZ6A 4X65I 2CVEA 2ELZA 3KRNA 2DB2A 4LTYA 1HNWE 2E1MA 1FJGE 1OYRA 2L92A 1XNRI 1WHQA 1XNRE 5IT9Q 1Z0CA 2IOPA 4YHHI 4YHHE 2MKNA 3HTXA 1EA6A 4B3SI 2YTOA 4L5NC 4B3SE 4JI4E 3GLLA 2C39A 3K85A 4JI4I 2BR2A 4FW5A 2EQ3A 3GMEA 4LU9A 1OJ4A 4B3RE 5A6BA 1PIEA 2A2CA 3B78A 1USUA 4JI3I 4AM3A 2VF3A 2CPNA 5KL6A 2EN6A 4LF6I 4LF6E 4WYQB 2DRPA 2EMZA 2MKDA 2WBSA 1T39A 3L7ZA 4DPUA 2GQ0A 2CSHA 2NN6C 1IBLE 4HY1A 2GHFA 4WSPA 2ZITA 3BF2A 2VE7C 2WNRB 5DNYA 1ZBTA 2F8BA 4IFDE 2HGHA 1HNXI 1HNXE 3IWBA 3KZZA 1IQOA 2BR2B 2C39B 4OO1F 2L2KB 4OX9I 1Z0BA 2NA2A 1J5EE 4B3ME 2EOXA 5GMEA 4F9AB 2HHHI 2HHHE 2C37A 2EOHA 3Q1QA 4B3TE 2G7HA 2HKJA 1N36I 5JEAD 1N36E 1G2FC 4LF4E 4FN5A 3WU6A 1DGCA 1XMQI 4LF4I 4FW9A 1Z59A 1YYKA 1OYPA 1Y5YA 2EJ4A 4DV6E 4DV6I 4BBYA 4IFDC 4GZNC 3L00A 4WSGA 1YUIA 4WUDA 2YTGA 2DEJA 2EMYA 2L8TA 2EMBA 4LCHA 4XTJA 1WJPA 2V85A 3P1XA 4DR5I 2EQ1A 1YYOA 1ZAAC 3DF6A 1E3PA 5L3JA 2EMLA 3HPSA 2C37B 1AAYA
chains in the Genus database with same CATH topology
4USKA 4KHPI 4IZKA 1DARA 1KVKA 4JI8I 4JI8E 1WUUA 1DI2A 4WFTA 4DR2I 4DR2E 4N3OA 4JI1I 4JI1E 2FV4B 1N32E 1HNZE 1PVGA 1GQEA 4ED4A 2JOXA 2L2MA 2V83A 3B82A 4JYAI 1Z5CA 3HXLA 4DV5I 2V88A 3J81C 4LF8I 4LF8E 2BV3A 1FWLA 2YT4A 3V5RA 4IZKB 3C4BA 3ADGA 2E5LI 2E5LE 1ZM4A 2B7TA 3QT8A 4PRVA 4M0VA 4DR4E 4Z7YA 2IHR1 3WU3A 2HFSA 4LFCI 4LF5I 4LF5E 3ZZUA 1A6FA 1UEKA 2O1VA 2JWOA 1ZBQA 4LFBE 4Z7CA 1ZM2A 2H36X 4LFBI 3PYDA 1USVA 1STUA 3JAMQ 4DMIA 3KWRA 1XMOI 3M6AA 4DPTA 1FWKA 1FKAE 4M2ZA 2EZ6A 3HULA 3MSWA 1DQ3A 4JI6E 4KZSA 1XNQI 3F6HA 3F0NA 3J7Yp 4F9CB 4DUYE 4L8NA 2EFGA 4FWHA 4HYMA 2A2DA 1N34I 4JI2I 5LMNI 2ODRC 1UHZA 1Z0TA 2RS7A 2V8QB 1UILA 3P06A 4K0KI 2DSYA 4X66I 4X66E 2LUQA 1ELOA 3LPSA 4NXMI 3LMLA 4NXME 4P7DA 3ZKBA 5LMUE 4DR6I 2OI2A 3CWVA 3PRYA 4X65E 3LLHA 1Z0GA 4J8ZA 4P52A 4URLA 4TUGA 4MYUA 3WU5A 4LF7E 2Z5CA 4LF7I 1Y4SA 3GONA 2WW4A 3PYEA 4DKKA 1KTVA 3ZM7A 4JI3E 1O0WA 3LNUA 2XEXA 2V2VA 1Z5AA 2LTSA 1H74A 3WU4A 1VISA 4ZVIA 1BKNA 2UXCI 2MC6A 3VYYA 1ZM3A 2Z5CB 4FWGA 2LTRA 2BM0A 3PYFA 3ZZ0A 1RR9A 3ADJA 2X36A 2B7VA 5IWAI 5IWAE 5AASA 3JTZA 2JY9A 4P78A 2V34A 2EWLA 5IT9C 4JG4A 2V89A 1ZM9A 1I94I 1I94E 3IWCA 1MX0A 1XMQE 2LRSA 4DV7I 4DV7E 3H09A 1EKZA 3RMPA 5FWKA 1K47A 1N0UA 3C4TA 4WUCA 1YYWA 4EMDA 4DPWA 4WPYA 4DV0I 4YY3I 4YY3E 1H7SA 2R3VA 4GKJI 4GKJE 4RPFA 4KHPE 5T6JA 4X64I 2VQEI 4X64E 2E1RA 2B3TB 4KQVA 1RQ0A 2GS8A 5A2QQ 3F6GA 2L2NA 4M30A 4DR7I 4I8OA 3IWDA 2UXDI 3ADIA 3ZZTA 4PU9A 4F9BB 2O1TA 3K17A 3PYGA 2F4VI 4JYAE 4DV5E 1WXRA 4WUBA 3J7AG 1Y4UA 4BC9A 5FLXQ 5ADZA 4R8OA 1T4OA 3K6QA 1SR9A 2DMYA 2RTXA 4LFCE 2M7QA 2M4IA 1KKHA 4DPYA 4DR1I 4GEQB 2Z5EA 2Q2EB 2IOQA 1H73A 4AQYI 4JV5I 4JV5E 2J7KA 2RS6A 4NXNI 4NXNE 1XMOE 1QZRA 4DV1I 1H7UA 4UT4A 1IBKI 4F54A 1IBKE 3HJCA 2R42A 5AE1A 1XNQE 4JI7I 4JI7E 4FWDA 4DV2I 2DEIA 3LTOA 1N34E 4JI2E 5LMNE 2LE2A 1RREA 2HKEA 5LL6R 4DR5I 4OX9E 4DV3I 4DV3E 3HPZA 4OX9I 3JU0A 3QT5A 2V2QA 4K0KE 2V86A 2DIXA 1MU5A 1N33I 1N33E 4DR6E 3DJWA 2K4VA 4P7AA 2ODRD 1S4EA 4IZJA 4BS9A 3Q6NA 1D6TA 4DXLA 3JAMC 1KIJA 1HR0I 4DR3I 3HQ1A 1NZ0A 4PRXA 4X62I 4X62E 2ZM6I 5AE2A 4BMJA 1Z0VA 4JI5I 4JI5E 1U2RA 1HNWI 4IZJB 4DUZI 1FJGI 1T4NA 4DUZE 3J7AM 3D4JA 2UXCE 2UUCI 2UUCE 2PNMA 2MDRA 2N3HA 1ZXNA 2O1WA 2V8PA 1S16A 2UUBI 2UUBE 4JI0I 4JI0E 2VQFI 2VQFE 2HK3A 1Y6ZA 3ADLA 4B3RI 2JOBA 2LMZA 1Z0EA 2V2ZA 3ZOQB 4HACB 2L33A 4GKKI 4GKKE 1Z5BA 4R1FA 1B63A 2L3JA 1N0VC 1IBLI 4OOGC 2M1SA 1FI4A 2KONA 5F3WA 2NUGA 2WZOA 5BR8I 1X49A 5BR8E 3H4LA 4M1KA 1FNMA 3FIGA 4BC7A 2MC5A 3V2UC 1J5EI 2RSMA 4DV0E 4B3MI 3K1JA 3OMLA 4B3TI 2NPFA 3QT6A 2VQEE 2LBSB 2CG9A 4USMA 3J81Q 4Q28A 3J80Q 4DV4I 4DV4E 2Z5BA 3ZKDA 4DR7E 1HK7A 2UXDE 3AV0A 1NHHA 2LJHA 1J26A 3AUZA 2JR1A 1XHKA 2V87A 2F4VE 2PNLA 2UUAI 2UUAE 1X47A 1ZXMA 2O1UA 1PKPA 2CGEA 3OTOI 3OTOE 2NUFA 1B62A 2N3GA 2L3CA 2X7IA 2Z5BB 2HFUA 3QT7A 2KOUA 1N32I 1HNZI 4BCAA 2B9DA 4DU8A 4IZJD 4R03A 4DR1E 1WHNA 2ZBKB 1NHJA 1X48A 5A2QC 4X8WA 4AQYE 3J80C 5CFFE 2AJ4A 2YZTA 4LFAI 4DV1E 4LFAE 2UXBI 3T1HI 2UXBE 3T1HE 1YZ9A 4DR4I 3Q6MA 2CZ9A 1EI1A 1Z0WA 5AE3A 4DV2E 1T4LB 2KHXA 2LJPA 5FLXC 4DR5E 3VYXA 4MYTA 4DPXA 2LUPB 1MG7A 4LF9I 4LF9E 2VF1A 2HK2A 1NHIA 4UTGA 4I3HA 4TUIA 2FTXB 2NUEA 3B8HA 3T1YI 3T1YE 4JI6I 2UU9I 2UU9E 1H72C 4DUYI 2L6MA 3VK6A 2FGGA 2BM1A 1HR0E 2JVAA 4DR3E 4HXZA 1QU6A 2ZM6E 4DU7A 1IBMI 1IBME 4HACA 5LMUI 1RC7A 1GZ6A 4X65I 2DB2A 4LTYA 1HNWE 2E1MA 1FJGE 2L92A 1XNRI 1WHQA 1XNRE 5IT9Q 1Z0CA 2IOPA 4YHHI 4YHHE 3HTXA 1EA6A 4B3SI 4L5NC 4B3SE 3K85A 4JI4E 4JI4I 4LU9A 1OJ4A 4B3RE 1PIEA 2A2CA 3B78A 1USUA 4JI3I 2VF3A 2CPNA 4LF6I 4LF6E 4WYQB 4DPUA 2GQ0A 1IBLE 4HY1A 4WSPA 2ZITA 2VE7C 5DNYA 1ZBTA 2F8BA 1HNXI 1HNXE 3IWBA 2L2KB 1Z0BA 2NA2A 1J5EE 4B3ME 5GMEA 4F9AB 2HHHI 2HHHE 3Q1QA 4B3TE 2G7HA 2HKJA 1N36I 4LF4I 1N36E 4LF4E 4FN5A 3WU6A 1XMQI 4FW9A 1Z59A 1YYKA 4DV6I 4DV6E 4BBYA 4WUDA 2DEJA 2L8TA 4XTJA 2V85A 3P1XA 1YYOA 5L3JA 3DF6A 3HPSA 5GMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USK A;  4KHP I;  1DAR A;  1KVK A;  4JI8 I;  4JI8 E;  1WUU A;  1DI2 A;  4WFT A;  4DR2 I;  4DR2 E;  4JI1 I;  4JI1 E;  1N32 E;  1HNZ E;  1PVG A;  1GQE A;  4ED4 A;  2L2M A;  3B82 A;  4JYA I;  1Z5C A;  4DV5 I;  3J81 C;  4LF8 I;  4LF8 E;  2BV3 A;  1FWL A;  2YT4 A;  3V5R A;  3C4B A;  3ADG A;  2E5L I;  2E5L E;  1ZM4 A;  2B7T A;  3QT8 A;  4PRV A;  4DR4 E;  4Z7Y A;  2IHR 1;  3WU3 A;  2HFS A;  4LFC I;  4LF5 I;  4LF5 E;  3ZZU A;  1A6F A;  1UEK A;  4Z7C A;  4LFB I;  4LFB E;  1ZM2 A;  3PYD A;  1STU A;  3JAM Q;  1XMO I;  3M6A A;  4DPT A;  1FWK A;  1FKA E;  4M2Z A;  2EZ6 A;  3HUL A;  4JI6 E;  1XNQ I;  3F0N A;  3J7Y p;  4DUY E;  4FWH A;  2EFG A;  4HYM A;  2A2D A;  1N34 I;  4JI2 I;  5LMN I;  1UHZ A;  1Z0T A;  2RS7 A;  1UIL A;  4K0K I;  4X66 I;  4X66 E;  2LUQ A;  1ELO A;  3LPS A;  4NXM I;  4NXM E;  3ZKB A;  5LMU E;  4DR6 I;  2OI2 A;  3CWV A;  4X65 E;  3LLH A;  1Z0G A;  4P52 A;  4URL A;  4MYU A;  3WU5 A;  4LF7 I;  4LF7 E;  3GON A;  2WW4 A;  3PYE A;  4DKK A;  1KTV A;  3ZM7 A;  4JI3 E;  1O0W A;  3LNU A;  2XEX A;  2V2V A;  1Z5A A;  2LTS A;  1H74 A;  3WU4 A;  1VIS A;  4ZVI A;  1BKN A;  2UXC I;  3VYY A;  1ZM3 A;  4FWG A;  2LTR A;  2BM0 A;  3PYF A;  3ZZ0 A;  1RR9 A;  3ADJ A;  2X36 A;  2B7V A;  5IWA I;  5IWA E;  2JY9 A;  2V34 A;  5IT9 C;  4JG4 A;  1ZM9 A;  1I94 I;  1I94 E;  1MX0 A;  1XMQ E;  2LRS A;  4DV7 I;  4DV7 E;  1EKZ A;  1K47 A;  1N0U A;  3C4T A;  4WUC A;  1YYW A;  4EMD A;  4DPW A;  4DV0 I;  4YY3 I;  4YY3 E;  1H7S A;  2R3V A;  4GKJ I;  4GKJ E;  4RPF A;  4KHP E;  4X64 I;  2VQE I;  4X64 E;  2E1R A;  2B3T B;  4KQV A;  1RQ0 A;  2GS8 A;  5A2Q Q;  2L2N A;  4M30 A;  4DR7 I;  2UXD I;  3ADI A;  3ZZT A;  4PU9 A;  3PYG A;  3K17 A;  2F4V I;  4JYA E;  4DV5 E;  4WUB A;  3J7A G;  5FLX Q;  1T4O A;  2DMY A;  2RTX A;  4LFC E;  1KKH A;  4DPY A;  4DR1 I;  2Q2E B;  1H73 A;  4AQY I;  4JV5 I;  4JV5 E;  2J7K A;  2RS6 A;  4NXN I;  4NXN E;  1XMO E;  1QZR A;  4DV1 I;  1H7U A;  4UT4 A;  1IBK I;  1IBK E;  2R42 A;  1XNQ E;  4JI7 I;  4JI7 E;  4FWD A;  4DV2 I;  2DEI A;  3LTO A;  1N34 E;  4JI2 E;  5LMN E;  1RRE A;  2HKE A;  5LL6 R;  4DR5 I;  4OX9 E;  4DV3 I;  4DV3 E;  4OX9 I;  3QT5 A;  2V2Q A;  4K0K E;  2DIX A;  1MU5 A;  1N33 I;  1N33 E;  4DR6 E;  4P7A A;  1S4E A;  1D6T A;  4DXL A;  3JAM C;  1KIJ A;  1HR0 I;  4DR3 I;  1NZ0 A;  4PRX A;  4X62 I;  4X62 E;  2ZM6 I;  1Z0V A;  4JI5 I;  4JI5 E;  1U2R A;  1HNW I;  4DUZ I;  1FJG I;  1T4N A;  4DUZ E;  3J7A M;  3D4J A;  2UXC E;  2UUC I;  2UUC E;  2MDR A;  2N3H A;  1ZXN A;  2V8P A;  1S16 A;  2UUB I;  2UUB E;  4JI0 I;  4JI0 E;  2VQF I;  2VQF E;  2HK3 A;  3ADL A;  4B3R I;  2V2Z A;  1Z0E A;  4HAC B;  2L33 A;  4GKK I;  4GKK E;  1Z5B A;  4R1F A;  1B63 A;  2L3J A;  1N0V C;  1IBL I;  4OOG C;  1FI4 A;  2NUG A;  5BR8 I;  1X49 A;  5BR8 E;  3H4L A;  4M1K A;  1FNM A;  3V2U C;  1J5E I;  2RSM A;  4DV0 E;  4B3M I;  3K1J A;  4B3T I;  2NPF A;  3QT6 A;  2VQE E;  2LBS B;  4USM A;  3J81 Q;  3J80 Q;  4DV4 I;  4DV4 E;  3ZKD A;  4DR7 E;  2UXD E;  1NHH A;  2LJH A;  1J26 A;  1XHK A;  2F4V E;  2UUA I;  2UUA E;  1X47 A;  1ZXM A;  1PKP A;  3OTO I;  3OTO E;  2NUF A;  1B62 A;  2N3G A;  2L3C A;  2X7I A;  2HFU A;  3QT7 A;  1N32 I;  1HNZ I;  4DU8 A;  4DR1 E;  1WHN A;  2ZBK B;  1NHJ A;  1X48 A;  5A2Q C;  4X8W A;  4AQY E;  3J80 C;  5CFF E;  2AJ4 A;  4LFA I;  4DV1 E;  4LFA E;  2UXB I;  3T1H I;  2UXB E;  3T1H E;  1YZ9 A;  4DR4 I;  2CZ9 A;  1EI1 A;  1Z0W A;  4DV2 E;  1T4L B;  2KHX A;  2LJP A;  5FLX C;  4DR5 E;  3VYX A;  4MYT A;  4DPX A;  2LUP B;  1MG7 A;  4LF9 I;  4LF9 E;  2HK2 A;  1NHI A;  4UTG A;  4I3H A;  2NUE A;  3B8H A;  3T1Y I;  3T1Y E;  4JI6 I;  2UU9 I;  2UU9 E;  1H72 C;  4DUY I;  2BM1 A;  1HR0 E;  2JVA A;  4DR3 E;  4HXZ A;  1QU6 A;  2ZM6 E;  4DU7 A;  1IBM I;  1IBM E;  4HAC A;  5LMU I;  1RC7 A;  4X65 I;  2DB2 A;  1HNW E;  1FJG E;  1XNR I;  1WHQ A;  1XNR E;  5IT9 Q;  1Z0C A;  4YHH I;  4YHH E;  3HTX A;  1EA6 A;  4B3S I;  4B3S E;  4JI4 I;  4JI4 E;  1OJ4 A;  4B3R E;  1PIE A;  2A2C A;  3B78 A;  4JI3 I;  2VF3 A;  2CPN A;  4LF6 I;  4LF6 E;  4WYQ B;  4DPU A;  1IBL E;  4HY1 A;  2ZIT A;  1ZBT A;  1HNX I;  1HNX E;  2L2K B;  1Z0B A;  2NA2 A;  1J5E E;  4B3M E;  5GME A;  2HHH I;  2HHH E;  3Q1Q A;  4B3T E;  2HKJ A;  1N36 I;  4LF4 I;  1N36 E;  4LF4 E;  4FN5 A;  3WU6 A;  1XMQ I;  4FW9 A;  1Z59 A;  1YYK A;  4DV6 I;  4DV6 E;  4WUD A;  2DEJ A;  4XTJ A;  3P1X A;  1YYO A;  5L3J A;  5GMD A; 
#chains in the Genus database with same CATH topology
 4USK A;  4KHP I;  4IZK A;  2BB8 A;  1UDS A;  1DAR A;  1KVK A;  2BA1 G;  4JI8 E;  4JI8 I;  1WUU A;  2JEA A;  1DI2 A;  4U3B A;  4WFT A;  4DR2 I;  4DR2 E;  4N3O A;  4JI1 I;  4JI1 E;  2FV4 B;  4MDT A;  4KWY A;  2LV2 A;  3DD6 A;  1UDO A;  1N32 E;  1HNZ E;  2HJJ A;  1PVG A;  1GQE A;  4ED4 A;  4FW6 A;  2JOX A;  2L2M A;  1BBG A;  1UN6 B;  1L4S A;  2V83 A;  5JEA F;  3B82 A;  2EM8 A;  4JYA I;  1Z5C A;  2NN6 A;  2N8X A;  3HXL A;  4DV5 I;  2V88 A;  3J81 C;  4LF8 I;  4LF8 E;  5KL5 A;  1FWL A;  2BV3 A;  4MU4 A;  2YT4 A;  3V5R A;  1N3G A;  4IZK B;  3C4B A;  3ADG A;  2E5L I;  2E5L E;  1B69 A;  1ZM4 A;  4MQY A;  2B7T A;  3QT8 A;  4O24 A;  4PRV A;  4M0V A;  2HC5 A;  4DR4 E;  2JT2 A;  4N4R B;  4Z7Y A;  1QNT A;  5LLQ A;  2IHR 1;  4ISA A;  3WU3 A;  5KL3 A;  2HFS A;  5K36 F;  4LFC I;  1TF3 A;  5C0X F;  4LF5 E;  3ZZU A;  1A6F A;  1UEK A;  2O1V A;  2JWO A;  1ZBQ A;  4LFB E;  3BID A;  1ZM2 A;  2H36 X;  4Z7C A;  2EPM X;  4LFB I;  1GTK A;  1Y60 A;  3PYD A;  1USV A;  2R76 A;  1PJQ A;  1TN9 A;  1STU A;  1YH8 A;  4IFD A;  3JAM Q;  2EPN A;  4DMI A;  3KWR A;  5A6A A;  1XMO I;  3M6A A;  1PJS A;  4DPT A;  1FWK A;  1FKA E;  3C6K A;  2GLI A;  4M2Z A;  4R2P A;  2EZ6 A;  3HUL A;  3MSW A;  2JYA A;  1DQ3 A;  4JI6 E;  4KZS A;  1XNQ I;  3EPK A;  3F6H A;  2EOQ A;  3F0N A;  3J7Y p;  1A1I A;  4F9C B;  4DUY E;  4L8N A;  2EFG A;  2WP8 B;  4FWH A;  4HYM A;  4OKG A;  1WRJ A;  2A2D A;  1N34 I;  4JI2 I;  5LMN I;  2ODR C;  4OO1 E;  1UHZ A;  1Z0T A;  3QG5 C;  2YSO A;  2RS7 A;  2V8Q B;  3THN A;  4AIM A;  2BA1 D;  2JPA A;  1UIL A;  3U1K A;  2O3Z A;  3P06 A;  4IFD B;  2JEB B;  4K0K I;  2DSY A;  3EPL A;  4X66 E;  4X66 I;  2LUQ A;  2EP3 A;  1IQS A;  4MLV A;  3TQM A;  1ELO A;  3LML A;  4NXM E;  4P7D A;  4F6N A;  2YSP A;  5IV8 B;  1P42 A;  5LMU E;  3ZKB A;  4DR6 I;  2OI2 A;  4ZYD A;  3ECR A;  4R2A A;  4X65 E;  1SFE A;  3LLH A;  2EPA A;  1Z0G A;  3CWV A;  3PRY A;  4J8Z A;  2WNR A;  4P52 A;  4HTG A;  2EOZ A;  3HKM A;  4TUG A;  4MYU A;  3WU5 A;  4LF7 E;  2Z5C A;  4URL A;  4MLQ A;  1Y4S A;  3GON A;  4LF7 I;  2WW4 A;  4LPF A;  3M85 G;  3PYE A;  2YTD A;  1UBD C;  2JE6 A;  4MU3 A;  4DKK A;  2EMH A;  2PNZ B;  4GQU A;  4WXC A;  1KTV A;  3ZM7 A;  5DRR A;  4JI3 E;  1YHC A;  1NCS A;  1O0W A;  3LNU A;  3M99 B;  2XEX A;  2ELY A;  2V2V A;  1Z5A A;  2LTS A;  2WBT A;  2EPU A;  1H74 A;  3WU4 A;  1VIS A;  2EPZ A;  4ZVI A;  1BKN A;  2UXC I;  2WCC 3;  2MC6 A;  3VYY A;  2K7I A;  2I13 A;  1ZM3 A;  2Z5C B;  4FWG A;  4BHB A;  2LTR A;  1P47 A;  2ENA A;  2BM0 A;  3PYF A;  1X6E A;  4MU0 A;  4QNK A;  3ZZ0 A;  2DMI A;  2EMI A;  1RR9 A;  2EOY A;  2JE6 B;  3ADJ A;  2X36 A;  2B7V A;  5IWA I;  5IWA E;  3VHT B;  5AAS A;  3JTZ A;  2JY9 A;  2GO3 A;  2EN7 A;  2NN6 D;  4P78 A;  2V34 A;  1X6F A;  2EWL A;  5DRQ A;  5IT9 C;  4JG4 A;  2V89 A;  4FW4 A;  2YRK A;  1ZM9 A;  4AID A;  1I94 I;  1I94 E;  3IWC A;  2MDG A;  1MX0 A;  1XMQ E;  2RQL A;  2EN8 A;  2LRS A;  1R6M A;  2EL4 A;  4DV7 I;  4DV7 E;  3H09 A;  2J65 A;  5K36 E;  3UHM A;  1EKZ A;  5C0X E;  1YUJ A;  3RMP A;  5FWK A;  1EH7 A;  1K47 A;  1N0U A;  3C4T A;  4WUC A;  2EMX A;  1YYW A;  2DLQ A;  4EMD A;  1RHY A;  4WPY A;  4DPW A;  4DV0 I;  4YY3 I;  4YY3 E;  1H7S A;  2R3V A;  2BA0 G;  4GKJ I;  4GKJ E;  4RPF A;  4KHP E;  5T6J A;  4IFD D;  4X64 I;  2VQE I;  4X64 E;  2E1R A;  5AC5 A;  2B3T B;  2E72 A;  4R2R A;  4KQV A;  3M85 D;  4IS1 C;  1KJK A;  1RQ0 A;  2EOR A;  2GS8 A;  3F6G A;  5A2Q Q;  5K36 C;  2L2N A;  4M30 A;  5C0X C;  2LJU A;  2NN6 F;  4DR7 I;  4I8O A;  3IWD A;  2UXD I;  2EQ0 A;  3ADI A;  2EN4 A;  3ZZT A;  2C38 A;  4PU9 A;  1MEY C;  4F9B B;  2O1T A;  3K17 A;  3PYG A;  2F4V I;  4JYA E;  1YPN A;  4DV5 E;  2I9I A;  2YRM A;  1WXR A;  4WUB A;  4OO1 B;  3J7A G;  2Q8U A;  1Y4U A;  4BC9 A;  3MHS C;  5ADZ A;  5FLX Q;  1UDQ A;  4R8O A;  1T4O A;  4RHB B;  2EPR A;  3M7N G;  2EPX A;  2EOS A;  1SR9 A;  2EMG A;  3K6Q A;  2DMY A;  3LPS A;  3P76 A;  2RTX A;  4LFC E;  2C38 B;  2M7Q A;  4R2E A;  2WP8 A;  2M4I A;  4IFD F;  1KKH A;  2LT7 A;  4DPY A;  4DR1 I;  5EKW A;  5ELW A;  2EOI A;  4GEQ B;  2Z5E A;  2Q2E B;  2IOQ A;  3U1Y A;  1H73 A;  2EPK X;  2LO3 A;  4AQY I;  4JV5 I;  4JV5 E;  2J7K A;  2RS6 A;  4RH8 A;  2LCE A;  2YU5 A;  4NXN E;  2JEB A;  4NXN I;  1XMO E;  1QZR A;  4DV1 I;  2PO1 A;  1H7U A;  4UT4 A;  1IBK I;  4F54 A;  1IBK E;  1BB8 A;  3HJC A;  2EL6 A;  1PDA A;  2EM0 A;  2BBG A;  2R42 A;  5AE1 A;  2EM5 A;  1XNQ E;  4JI7 I;  4JI7 E;  4FWD A;  4DV2 I;  2DEI A;  3LTO A;  3C6M A;  1N34 E;  4JI2 E;  5LMN E;  1UDN A;  2BA0 D;  2LE2 A;  1RRE A;  4X9J A;  2HKE A;  4QNJ A;  2EOE A;  5LL6 R;  3BGH A;  4OX9 E;  4IS9 A;  4DV3 E;  3HPZ A;  1YSA C;  3P3E A;  3JU0 A;  3QT5 A;  4DV3 I;  5K36 A;  2V2Q A;  2PNZ A;  3CDJ A;  5C0X A;  2PO0 A;  4K0K E;  2V86 A;  2PO1 B;  3PS2 A;  2DIX A;  1MU5 A;  2PRT A;  1N33 I;  5A6K A;  1N33 E;  2EM6 A;  4DR6 E;  3DJW A;  4R2D A;  2K4V A;  3NZK A;  4P7A A;  2EM2 A;  2EPP A;  2ODR D;  4WX9 A;  1S4E A;  4IZJ A;  4BS9 A;  4O43 A;  1TF6 A;  5TSE A;  3Q6N A;  4DXL A;  4OO1 C;  2YU8 A;  3JAM C;  1D6T A;  2YWQ A;  1KIJ A;  2J7J A;  1RMD A;  1HR0 I;  4OZE A;  4DR3 I;  1PJT A;  5K36 B;  5C0X B;  2F1D A;  2PO0 B;  3HQ1 A;  1NZ0 A;  4NXM I;  4O4K A;  3BBG A;  4PRX A;  4R2S A;  4X62 I;  4X62 E;  1IMU A;  2ZM6 I;  2JXP A;  2YTJ A;  5AE2 A;  3M7N D;  2ADR A;  2YTE A;  4BMJ A;  1Z0V A;  3P3C A;  4OO1 D;  4JI5 I;  4JI5 E;  2R1F A;  1G2D C;  1U2R A;  1VI7 A;  2UUC I;  1HNW I;  2CTD A;  4IZJ B;  4DUZ I;  2NN6 E;  1T4N A;  4DUZ E;  3J7A M;  1FJG I;  3D4J A;  2VRD A;  1NEI A;  3UK3 C;  2UXC E;  2DGC A;  2UUC E;  2MDR A;  1T38 A;  2PNM A;  2N3H A;  1ZXN A;  2O1W A;  2V8P A;  1S16 A;  2IER A;  5DRP A;  5JEA E;  2UUB I;  4LF5 I;  2UUB E;  4JI0 I;  4JI0 E;  2VQF I;  2VQF E;  1E3H A;  2HK3 A;  2EOM A;  4BA1 B;  1Y6Z A;  2RSI A;  3ADL A;  4B3R I;  1X3C A;  2EN2 A;  2JOB A;  2LMZ A;  1Z0E A;  2V2Z A;  3PS1 A;  1A1G A;  4M9V C;  3ZOQ B;  4HAC B;  1KYQ A;  1XXE A;  2L33 A;  4GKK I;  4GKK E;  1Z5B A;  2PO2 A;  4R1F A;  1B63 A;  2ENH A;  2VES A;  2L3J A;  2EPL X;  1N0V C;  4ZYH A;  1IBL I;  4OOG C;  2EM9 A;  2M1S A;  4FK5 C;  1YFH A;  2KON A;  5F3W A;  1FI4 A;  4MU1 A;  5A69 A;  2NUG A;  1ZR9 A;  3CDI A;  2WZO A;  1ZU1 A;  5JEA C;  5BR8 I;  1X49 A;  5BR8 E;  2NAB A;  3H4L A;  4LCG A;  4M1K A;  3EPJ A;  1FNM A;  3FIG A;  4BC7 A;  2EPC A;  2MC5 A;  4FW3 A;  4ZYG A;  3V2U C;  1J5E I;  2RSM A;  4DV0 E;  4B3M I;  3K1J A;  5EL9 A;  1A1K A;  4OO1 A;  3OML A;  4B3T I;  2NPF A;  2PO2 B;  3L7Z B;  3QT6 A;  2VQE E;  2LBS B;  2CG9 A;  3H1C A;  4USM A;  3J81 Q;  4Q28 A;  3J80 Q;  4DV4 I;  4DV4 E;  2AE8 A;  2Z5B A;  3ZKD A;  4DR7 E;  1HK7 A;  2EE8 A;  2UXD E;  3AV0 A;  1NHH A;  2LJH A;  1J26 A;  3AUZ A;  2JR1 A;  3EPH A;  1XHK A;  2EOO A;  2V87 A;  4NZV A;  1OYS A;  3EQ1 A;  2YTF A;  2F4V E;  2PNL A;  2EOJ A;  2GO4 A;  2EN3 A;  2UUA I;  2UUA E;  1X6H A;  1X47 A;  2ENC A;  4Q35 B;  1JK2 A;  1ZXM A;  2O1U A;  5C0X D;  5K36 D;  2YTQ A;  1PKP A;  4F6M A;  2CGE A;  1LLM C;  3B4T A;  3OTO I;  3OTO E;  4F2J C;  2NUF A;  1B62 A;  2N3G A;  4R2C A;  1EH8 A;  2L3C A;  2X7I A;  3KZY A;  3THO B;  2HFU A;  2Z5B B;  2CT1 A;  2KOU A;  3QT7 A;  1HNZ I;  1N32 I;  4BA2 B;  4BCA A;  2B9D A;  5KL2 A;  4DU8 A;  4IZJ D;  4R03 A;  4DR1 E;  1WHN A;  2ZBK B;  1NHJ A;  4BA2 A;  5A6J A;  2EMK A;  1X48 A;  5A2Q C;  4X8W A;  4AQY E;  2YTI A;  3J80 C;  5JEA A;  1Z1B A;  5CFF E;  2AJ4 A;  4LCF A;  2YZT A;  4LFA I;  2EM7 A;  4DV1 E;  4O5G A;  2YRH A;  4LFA E;  4NBQ A;  1R6L A;  2JEA B;  5KL7 A;  4HEI A;  2EMW A;  2EMF A;  2LVH A;  2EL5 A;  3P3G A;  2UXB I;  3T1H I;  2YTN A;  3T1H E;  1YZ9 A;  2UXB E;  1F2I G;  3Q6M A;  2JP9 A;  4DR4 I;  2CZ9 A;  3GCM A;  1EI1 A;  1A1L A;  1Z0W A;  5AE3 A;  4DV2 E;  1T4L B;  2KHX A;  5AC4 A;  2LJP A;  2RPC A;  2M9A A;  2NN6 B;  5GMD A;  5FLX C;  2WBU A;  4DR5 E;  2D9H A;  1AH5 A;  3VYX A;  4MYT A;  2YPN A;  4DPX A;  4IJD A;  5JEA B;  2LUP B;  1MG7 A;  5DRO A;  4LF9 E;  4LF9 I;  2VF1 A;  2EMA A;  2HK2 A;  2EM3 A;  1NHI A;  1MGT A;  4UTG A;  5A6B D;  4TUI A;  4I3H A;  2EM4 A;  1JK1 A;  1A1H A;  2FTX B;  1BBO A;  2EPO A;  3MHH C;  2NUE A;  3B8H A;  3T1Y I;  4ZYE A;  3T1Y E;  4JI6 I;  4U3D A;  2DLK A;  1EH6 A;  2EOF A;  2UU9 E;  2UU9 I;  1H72 C;  4DUY I;  4BHC A;  2L6M A;  4LOM A;  3VK6 A;  2FGG A;  3PS3 A;  4J3D A;  4WXD A;  5DNX A;  2A25 A;  2BM1 A;  1HR0 E;  2JVA A;  4DR3 E;  2GPI A;  2IES A;  4BA1 A;  4NHR A;  2YTP A;  4HXZ A;  1X5W A;  1QU6 A;  2ZM6 E;  4DU7 A;  1IBM I;  4R2Q A;  5KL4 A;  1IBM E;  4FW7 A;  4HAC A;  2EMC A;  1A1J A;  5LMU I;  5IXM B;  1RC7 A;  5DNL A;  1A1F A;  2EN1 A;  1GZ6 A;  4X65 I;  2CVE A;  2ELZ A;  3KRN A;  2DB2 A;  4LTY A;  1HNW E;  2E1M A;  1FJG E;  1OYR A;  2L92 A;  1XNR I;  1WHQ A;  1XNR E;  5IT9 Q;  1Z0C A;  2IOP A;  4YHH I;  4YHH E;  2MKN A;  3HTX A;  1EA6 A;  4B3S I;  2YTO A;  4L5N C;  4B3S E;  4JI4 E;  3GLL A;  2C39 A;  3K85 A;  4JI4 I;  2BR2 A;  4FW5 A;  2EQ3 A;  3GME A;  4LU9 A;  1OJ4 A;  4B3R E;  5A6B A;  1PIE A;  2A2C A;  3B78 A;  1USU A;  4JI3 I;  4AM3 A;  2VF3 A;  2CPN A;  5KL6 A;  2EN6 A;  4LF6 I;  4LF6 E;  4WYQ B;  2DRP A;  2EMZ A;  2MKD A;  2WBS A;  1T39 A;  3L7Z A;  4DPU A;  2GQ0 A;  2CSH A;  2NN6 C;  1IBL E;  4HY1 A;  2GHF A;  4WSP A;  2ZIT A;  3BF2 A;  2VE7 C;  2WNR B;  5DNY A;  1ZBT A;  2F8B A;  4IFD E;  2HGH A;  1HNX I;  1HNX E;  3IWB A;  3KZZ A;  1IQO A;  2BR2 B;  2C39 B;  4OO1 F;  2L2K B;  4OX9 I;  1Z0B A;  2NA2 A;  1J5E E;  4B3M E;  2EOX A;  5GME A;  4F9A B;  2HHH I;  2HHH E;  2C37 A;  2EOH A;  3Q1Q A;  4B3T E;  2G7H A;  2HKJ A;  1N36 I;  5JEA D;  1N36 E;  1G2F C;  4LF4 E;  4FN5 A;  3WU6 A;  1DGC A;  1XMQ I;  4LF4 I;  4FW9 A;  1Z59 A;  1YYK A;  1OYP A;  1Y5Y A;  2EJ4 A;  4DV6 E;  4DV6 I;  4BBY A;  4IFD C;  4GZN C;  3L00 A;  4WSG A;  1YUI A;  4WUD A;  2YTG A;  2DEJ A;  2EMY A;  2L8T A;  2EMB A;  4LCH A;  4XTJ A;  1WJP A;  2V85 A;  3P1X A;  4DR5 I;  2EQ1 A;  1YYO A;  1ZAA C;  3DF6 A;  1E3P A;  5L3J A;  2EML A;  3HPS A;  2C37 B;  1AAY A; 
#chains in the Genus database with same CATH homology
 4USK A;  4KHP I;  4IZK A;  1DAR A;  1KVK A;  4JI8 I;  4JI8 E;  1WUU A;  1DI2 A;  4WFT A;  4DR2 I;  4DR2 E;  4N3O A;  4JI1 I;  4JI1 E;  2FV4 B;  1N32 E;  1HNZ E;  1PVG A;  1GQE A;  4ED4 A;  2JOX A;  2L2M A;  2V83 A;  3B82 A;  4JYA I;  1Z5C A;  3HXL A;  4DV5 I;  2V88 A;  3J81 C;  4LF8 I;  4LF8 E;  2BV3 A;  1FWL A;  2YT4 A;  3V5R A;  4IZK B;  3C4B A;  3ADG A;  2E5L I;  2E5L E;  1ZM4 A;  2B7T A;  3QT8 A;  4PRV A;  4M0V A;  4DR4 E;  4Z7Y A;  2IHR 1;  3WU3 A;  2HFS A;  4LFC I;  4LF5 I;  4LF5 E;  3ZZU A;  1A6F A;  1UEK A;  2O1V A;  2JWO A;  1ZBQ A;  4LFB E;  4Z7C A;  1ZM2 A;  2H36 X;  4LFB I;  3PYD A;  1USV A;  1STU A;  3JAM Q;  4DMI A;  3KWR A;  1XMO I;  3M6A A;  4DPT A;  1FWK A;  1FKA E;  4M2Z A;  2EZ6 A;  3HUL A;  3MSW A;  1DQ3 A;  4JI6 E;  4KZS A;  1XNQ I;  3F6H A;  3F0N A;  3J7Y p;  4F9C B;  4DUY E;  4L8N A;  2EFG A;  4FWH A;  4HYM A;  2A2D A;  1N34 I;  4JI2 I;  5LMN I;  2ODR C;  1UHZ A;  1Z0T A;  2RS7 A;  2V8Q B;  1UIL A;  3P06 A;  4K0K I;  2DSY A;  4X66 I;  4X66 E;  2LUQ A;  1ELO A;  3LPS A;  4NXM I;  3LML A;  4NXM E;  4P7D A;  3ZKB A;  5LMU E;  4DR6 I;  2OI2 A;  3CWV A;  3PRY A;  4X65 E;  3LLH A;  1Z0G A;  4J8Z A;  4P52 A;  4URL A;  4TUG A;  4MYU A;  3WU5 A;  4LF7 E;  2Z5C A;  4LF7 I;  1Y4S A;  3GON A;  2WW4 A;  3PYE A;  4DKK A;  1KTV A;  3ZM7 A;  4JI3 E;  1O0W A;  3LNU A;  2XEX A;  2V2V A;  1Z5A A;  2LTS A;  1H74 A;  3WU4 A;  1VIS A;  4ZVI A;  1BKN A;  2UXC I;  2MC6 A;  3VYY A;  1ZM3 A;  2Z5C B;  4FWG A;  2LTR A;  2BM0 A;  3PYF A;  3ZZ0 A;  1RR9 A;  3ADJ A;  2X36 A;  2B7V A;  5IWA I;  5IWA E;  5AAS A;  3JTZ A;  2JY9 A;  4P78 A;  2V34 A;  2EWL A;  5IT9 C;  4JG4 A;  2V89 A;  1ZM9 A;  1I94 I;  1I94 E;  3IWC A;  1MX0 A;  1XMQ E;  2LRS A;  4DV7 I;  4DV7 E;  3H09 A;  1EKZ A;  3RMP A;  5FWK A;  1K47 A;  1N0U A;  3C4T A;  4WUC A;  1YYW A;  4EMD A;  4DPW A;  4WPY A;  4DV0 I;  4YY3 I;  4YY3 E;  1H7S A;  2R3V A;  4GKJ I;  4GKJ E;  4RPF A;  4KHP E;  5T6J A;  4X64 I;  2VQE I;  4X64 E;  2E1R A;  2B3T B;  4KQV A;  1RQ0 A;  2GS8 A;  5A2Q Q;  3F6G A;  2L2N A;  4M30 A;  4DR7 I;  4I8O A;  3IWD A;  2UXD I;  3ADI A;  3ZZT A;  4PU9 A;  4F9B B;  2O1T A;  3K17 A;  3PYG A;  2F4V I;  4JYA E;  4DV5 E;  1WXR A;  4WUB A;  3J7A G;  1Y4U A;  4BC9 A;  5FLX Q;  5ADZ A;  4R8O A;  1T4O A;  3K6Q A;  1SR9 A;  2DMY A;  2RTX A;  4LFC E;  2M7Q A;  2M4I A;  1KKH A;  4DPY A;  4DR1 I;  4GEQ B;  2Z5E A;  2Q2E B;  2IOQ A;  1H73 A;  4AQY I;  4JV5 I;  4JV5 E;  2J7K A;  2RS6 A;  4NXN I;  4NXN E;  1XMO E;  1QZR A;  4DV1 I;  1H7U A;  4UT4 A;  1IBK I;  4F54 A;  1IBK E;  3HJC A;  2R42 A;  5AE1 A;  1XNQ E;  4JI7 I;  4JI7 E;  4FWD A;  4DV2 I;  2DEI A;  3LTO A;  1N34 E;  4JI2 E;  5LMN E;  2LE2 A;  1RRE A;  2HKE A;  5LL6 R;  4DR5 I;  4OX9 E;  4DV3 I;  4DV3 E;  3HPZ A;  4OX9 I;  3JU0 A;  3QT5 A;  2V2Q A;  4K0K E;  2V86 A;  2DIX A;  1MU5 A;  1N33 I;  1N33 E;  4DR6 E;  3DJW A;  2K4V A;  4P7A A;  2ODR D;  1S4E A;  4IZJ A;  4BS9 A;  3Q6N A;  1D6T A;  4DXL A;  3JAM C;  1KIJ A;  1HR0 I;  4DR3 I;  3HQ1 A;  1NZ0 A;  4PRX A;  4X62 I;  4X62 E;  2ZM6 I;  5AE2 A;  4BMJ A;  1Z0V A;  4JI5 I;  4JI5 E;  1U2R A;  1HNW I;  4IZJ B;  4DUZ I;  1FJG I;  1T4N A;  4DUZ E;  3J7A M;  3D4J A;  2UXC E;  2UUC I;  2UUC E;  2PNM A;  2MDR A;  2N3H A;  1ZXN A;  2O1W A;  2V8P A;  1S16 A;  2UUB I;  2UUB E;  4JI0 I;  4JI0 E;  2VQF I;  2VQF E;  2HK3 A;  1Y6Z A;  3ADL A;  4B3R I;  2JOB A;  2LMZ A;  1Z0E A;  2V2Z A;  3ZOQ B;  4HAC B;  2L33 A;  4GKK I;  4GKK E;  1Z5B A;  4R1F A;  1B63 A;  2L3J A;  1N0V C;  1IBL I;  4OOG C;  2M1S A;  1FI4 A;  2KON A;  5F3W A;  2NUG A;  2WZO A;  5BR8 I;  1X49 A;  5BR8 E;  3H4L A;  4M1K A;  1FNM A;  3FIG A;  4BC7 A;  2MC5 A;  3V2U C;  1J5E I;  2RSM A;  4DV0 E;  4B3M I;  3K1J A;  3OML A;  4B3T I;  2NPF A;  3QT6 A;  2VQE E;  2LBS B;  2CG9 A;  4USM A;  3J81 Q;  4Q28 A;  3J80 Q;  4DV4 I;  4DV4 E;  2Z5B A;  3ZKD A;  4DR7 E;  1HK7 A;  2UXD E;  3AV0 A;  1NHH A;  2LJH A;  1J26 A;  3AUZ A;  2JR1 A;  1XHK A;  2V87 A;  2F4V E;  2PNL A;  2UUA I;  2UUA E;  1X47 A;  1ZXM A;  2O1U A;  1PKP A;  2CGE A;  3OTO I;  3OTO E;  2NUF A;  1B62 A;  2N3G A;  2L3C A;  2X7I A;  2Z5B B;  2HFU A;  3QT7 A;  2KOU A;  1N32 I;  1HNZ I;  4BCA A;  2B9D A;  4DU8 A;  4IZJ D;  4R03 A;  4DR1 E;  1WHN A;  2ZBK B;  1NHJ A;  1X48 A;  5A2Q C;  4X8W A;  4AQY E;  3J80 C;  5CFF E;  2AJ4 A;  2YZT A;  4LFA I;  4DV1 E;  4LFA E;  2UXB I;  3T1H I;  2UXB E;  3T1H E;  1YZ9 A;  4DR4 I;  3Q6M A;  2CZ9 A;  1EI1 A;  1Z0W A;  5AE3 A;  4DV2 E;  1T4L B;  2KHX A;  2LJP A;  5FLX C;  4DR5 E;  3VYX A;  4MYT A;  4DPX A;  2LUP B;  1MG7 A;  4LF9 I;  4LF9 E;  2VF1 A;  2HK2 A;  1NHI A;  4UTG A;  4I3H A;  4TUI A;  2FTX B;  2NUE A;  3B8H A;  3T1Y I;  3T1Y E;  4JI6 I;  2UU9 I;  2UU9 E;  1H72 C;  4DUY I;  2L6M A;  3VK6 A;  2FGG A;  2BM1 A;  1HR0 E;  2JVA A;  4DR3 E;  4HXZ A;  1QU6 A;  2ZM6 E;  4DU7 A;  1IBM I;  1IBM E;  4HAC A;  5LMU I;  1RC7 A;  1GZ6 A;  4X65 I;  2DB2 A;  4LTY A;  1HNW E;  2E1M A;  1FJG E;  2L92 A;  1XNR I;  1WHQ A;  1XNR E;  5IT9 Q;  1Z0C A;  2IOP A;  4YHH I;  4YHH E;  3HTX A;  1EA6 A;  4B3S I;  4L5N C;  4B3S E;  3K85 A;  4JI4 E;  4JI4 I;  4LU9 A;  1OJ4 A;  4B3R E;  1PIE A;  2A2C A;  3B78 A;  1USU A;  4JI3 I;  2VF3 A;  2CPN A;  4LF6 I;  4LF6 E;  4WYQ B;  4DPU A;  2GQ0 A;  1IBL E;  4HY1 A;  4WSP A;  2ZIT A;  2VE7 C;  5DNY A;  1ZBT A;  2F8B A;  1HNX I;  1HNX E;  3IWB A;  2L2K B;  1Z0B A;  2NA2 A;  1J5E E;  4B3M E;  5GME A;  4F9A B;  2HHH I;  2HHH E;  3Q1Q A;  4B3T E;  2G7H A;  2HKJ A;  1N36 I;  4LF4 I;  1N36 E;  4LF4 E;  4FN5 A;  3WU6 A;  1XMQ I;  4FW9 A;  1Z59 A;  1YYK A;  4DV6 I;  4DV6 E;  4BBY A;  4WUD A;  2DEJ A;  2L8T A;  4XTJ A;  2V85 A;  3P1X A;  1YYO A;  5L3J A;  3DF6 A;  3HPS A;  5GMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...