3M7NG

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 75
structure length 254
sequence length 254
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m7nG01
1UDSA 2C39A 4OO1B 2JEAB 5K36C 3U1KA 3H1CA 3HKMA 4BA1B 5K36E 3L7ZA 4IFDA 4OO1C 5K36F 2C37A 2PO1B 5K36D 2JE6A 4OO1A 5C0XC 1E3PA 3M7ND 1UDQA 2JEBB 2WNRA 2NN6B 3GLLA 3CDJA 2PO2B 5C0XA 4BA1A 4OO1D 3DD6A 3M7NG 5C0XF 4IFDC 1R6MA 5C0XD 5JEAC 3B4TA 2NN6C 2PO0A 3GMEA 4IFDE 2BR2B 5JEAA 2WP8B 2JEBA 4AIMA 2NN6A 4IFDF 2PO2A 2JEAA 4AM3A 4IFDD 4AIDA 5JEAF 4OO1E 5JEAD 4OO1F 3KRNA 5C0XE 3CDIA 2BA1D 2BR2A 2PNZB 2PO1A 2BA0D 1UDNA 5K36B 3L7ZB 2BA1G 4NBQA 2BA0G 2C37B 5JEAE 1OYPA 2C38B 2JE6B 2NN6E 4BA2B 2NN6F 3M85D 2NN6D 2PNZA 2C39B 1OYSA 2WNRB 1E3HA 5C0XB 5K36A 1OYRA 3M85G 3GCMA 2WP8A 1UDOA 2C38A 1R6LA 4BA2A 2PO0B 4IFDB 5JEAB
chains in the Genus database with same CATH superfamily
4JI0I 1J5EE 2C39A 1K47A 4JI5I 5K36C 4N3OA 2UXDE 5IT9Q 1N36I 2ZM6E 3LTOA 2X36A 4DPYA 1N0VC 4X65E 2IERA 2C37A 1XMQI 2PO1B 2V34A 4UTGA 2V2VA 5DROA 4DXLA 2O3ZA 1XXEA 4GKKI 1UDQA 2HHHE 1H73A 3ZKDA 2PO2B 3P76A 4PRXA 4USMA 5IWAI 3DD6A 2O1UA 3M7NG 4M1KA 2Z5EA 4DPUA 4JI4E 2UUBI 2BM0A 4IFDC 5ELWA 5GMDA 5DNLA 4YY3I 2IOPA 4DV2E 1Z0EA 1HR0I 1HNXE 1Z0CA 3K1JA 4FW7A 5BR8E 4LOMA 4URLA 2UU9I 4NXME 1RREA 3U1YA 4MU0A 4AIMA 2VF3A 5A2QQ 4B3MI 2PO2A 4AM3A 5JEAF 2O1WA 3PRYA 5JEAD 4B3TI 1XNRE 5LL6R 4DR5E 3T1YI 5EKWA 2UXBI 4DR2E 3CDIA 4AQYI 4FW6A 4B3SI 4JI8E 1MU5A 4LF9E 3QT5A 3GONA 1IBKE 4LF5I 1DARA 5EL9A 1Z0GA 4MU1A 4LFCI 2BA0G 5JEAE 1A6FA 2BV3A 1IBLI 1HNXI 2C38B 1OJ4A 1PKPA 3OTOI 4DV7I 4DU8A 4BA2B 4MU4A 4DR6I 3LNUA 4U3DA 1PVGA 4DV6E 5L3JA 4FW9A 4WUDA 4FWHA 3M85G 3J7AM 3GCMA 1Z59A 1MX0A 4IZJB 1H7SA 4JI0E 2C38A 5DNXA 3CWVA 1Z0VA 4BA2A 4JI5E 1HNWE 1N36E 1Z0TA 3K17A 2R42A 4EMDA 4KHPI 1NHHA 1RHYA 4JG4A 2GQ0A 2A2DA 3WU3A 4XTJA 4LF7I 3ZZTA 4ISAA 2X7IA 2HK2A 4PRVA 1XMQE 4IZJA 2ZITA 4JI3I 4ZVIA 5FLXC 4UT4A 1N33I 2IESA 4OKGA 1MG7A 5A2QC 3J81C 4FN5A 2PNLA 1KIJA 5IWAE 4HACB 4PU9A 1EI1A 2UUBE 3GLLA 3QT6A 4DV0I 1XMOI 4DR4I 4MYTA 4YY3E 2JT2A 4OO1D 1HR0E 1HNWI 2WW4A 3J80C 2UU9E 1R6MA 1ZM3A 5JEAC 4LFBE 2XEXA 4FW4A 4B3ME 2HKJA 3B4TA 2PO0A 4FW3A 3GMEA 4KQVA 3Q1QA 1YHCA 1VI7A 4HACA 2UUCI 4GKJE 5JEAA 2J65A 2O1TA 2WP8B 4IZJD 4B3TE 4QNJA 2DEIA 2GO3A 3V2UC 3T1YE 4AIDA 4OO1E 2UXBE 3B8HA 1ZM2A 4WUCA 4AQYE 4B3SE 2E5LI 1KKHA 3H4LA 4X62I 1Z0BA 4JI2I 2CZ9A 4DUZI 2GS8A 4LF5E 2BA1D 2V2ZA 4LFCE 3WU4A 2PO1A 2F4VI 4DV3I 1IBLE 3JAMC 3Q6MA 3OTOE 4DV7E 1KVKA 3L7ZB 5FLXQ 4DR6E 4NBQA 2CG9A 4LFBI 3P06A 4JI6I 3WU6A 3J81Q 1FWKA 2JE6B 2NN6E 1FNMA 4GKJI 3P3CA 1Z5BA 4LPFA 3J7AG 1OYSA 2WNRB 5C0XB 4LCGA 1OYRA 2Z5CB 2UUAI 1YH8A 4JV5I 3WU5A 2PNMA 1Y60A 3J80Q 3ZKBA 4X64I 3V5RA 1EA6A 2E1RA 4DV4I 3D4JA 4KHPE 2IOQA 5DRQA 4LF7E 1UDSA 2LJPA 4IS9A 1NHJA 4DPXA 1ZM4A 4DR3I 4JI3E 4OO1B 4LFAI 2JEAB 3U1KA 4DPTA 1N33E 1N0UA 4DR1I 1FKAE 3HKMA 1USUA 5K36E 1Z0WA 1NZ0A 4OO1C 4DPWA 4JI7I 3P3GA 4DUYI 4P52A 1D6TA 4DV0E 1XMOE 4DR4E 4OO1A 1IBMI 1NHIA 1E3PA 1XNQI 2EFGA 3JAMQ 3B78A 2NN6B 4K0KI 1B62A 1RR9A 4JYAI 2GO4A 4FWGA 5LMUI 2HK3A 3T1HI 4NXNI 3QT7A 5C0XF 2UUCE 4YHHI 5C0XD 5FWKA 3PYEA 4X66I 2VQEI 2NN6C 4IFDE 1Y4SA 2F1DA 2E5LE 4LF4I 1Y6ZA 2NN6A 4X62E 4JI2E 3ZM7A 4DUZE 4DV1I 4DR7I 5LMNI 4OO1F 1H74A 3KRNA 2F4VE 4DV3E 5C0XE 5GMEA 4OX9I 3P3EA 4J3DA 4LCHA 3PS1A 5K36B 4JI6E 1N34E 3PS2A 1Z5AA 2VQFI 4RPFA 2BA1G 2UXCI 2C37B 5DRRA 4MYUA 1OYPA 4QNKA 2UUAE 4JV5E 2NN6F 4LF6I 2R3VA 4MDTA 2NN6D 4R1FA 1E3HA 4X64E 3HJCA 4LF8E 5K36A 4DV4E 2HFSA 4JI1I 4B3RI 2WP8A 1WUUA 4U3BA 1I94I 1N32I 1FJGI 4OZEA 4DR3E 4LFAE 4IFDB 4DV5I 3HULA 4DR1E 1N34I 2AE8A 2ZBKB 2AJ4A 4MQYA 1U2RA 3H1CA 1ELOA 1XHKA 3ZZ0A 1HNZI 4JI7E 1J5EI 4DUYE 4BA1B 2VESA 1H7UA 3L7ZA 2UXDI 1IBME 1XNQE 2BM1A 2ZM6I 4IFDA 1Y4UA 5K36F 1FWLA 2V2QA 4USKA 3K85A 1B63A 4LF8I 5K36D 2JE6A 2O1VA 4K0KE 4JYAE 5C0XC 1S4EA 3M7ND 1P42A 4X65I 1H72C 4I3HA 3M6AA 4Z7CA 5LMUE 3T1HE 4NXNE 2JEBB 1Z5CA 2WNRA 3NZKA 4YHHE 3CDJA 5C0XA 2Z5CA 4BA1A 4X66E 2VQEE 2A2CA 1ZXNA 2HHHI 3UHMA 3PYGA 3PYFA 2V8PA 1FI4A 4LF4E 1ZXMA 4JI4I 4DV1E 4DU7A 4DR7E 2BR2B 1VISA 5LMNE 2Q2EB 2JEBA 4IZKB 4DV2I 4IFDF 5IT9C 2Z5BB 5BR8I 1HK7A 2JEAA 4IFDD 4NXMI 4WUBA 5DRPA 4OX9E 1PIEA 2NPFA 4ED4A 2VQFE 1BKNA 4HY1A 4P7AA 2UXCE 1XNRI 3QT8A 2BR2A 2PNZB 4DR5I 3Q6NA 2BA0D 1UDNA 4IZKA 4DR2I 1USVA 2Z5BA 2CVEA 2J7KA 1Y5YA 3B82A 4HXZA 1S16A 4JI8I 4LF6E 4FW5A 4LF9I 4GQUA 4FWDA 1IBKI 3F0NA 3PS3A 1UEKA 4Z7YA 4JI1E 3M85D 4B3RE 2PNZA 2C39B 2OI2A 4MU3A 1I94E 1N32E 1FJGE 2DEJA 2HKEA 2CGEA 4DV6I 2HFUA 4LCFA 3ZZUA 4DV5E 4GKKE 1KTVA 3PYDA 3LPSA 1UDOA 1QZRA 1R6LA 2PO0B 1HNZE 1ZM9A 5JEAB 4HYMA
chains in the Genus database with same CATH topology
1UDSA 2C39A 4OO1B 2JEAB 5K36C 3U1KA 3H1CA 3HKMA 4BA1B 5K36E 3L7ZA 4IFDA 4OO1C 5K36F 2C37A 2PO1B 5K36D 2JE6A 4OO1A 5C0XC 1E3PA 3M7ND 1UDQA 2JEBB 2WNRA 2NN6B 3GLLA 3CDJA 2PO2B 5C0XA 4BA1A 4OO1D 3DD6A 3M7NG 5C0XF 4IFDC 1R6MA 5C0XD 5JEAC 3B4TA 2NN6C 2PO0A 3GMEA 4IFDE 2BR2B 5JEAA 2WP8B 2JEBA 4AIMA 2NN6A 4IFDF 2PO2A 2JEAA 4AM3A 4IFDD 4AIDA 5JEAF 4OO1E 5JEAD 4OO1F 3KRNA 5C0XE 3CDIA 2BA1D 2BR2A 2PNZB 2PO1A 2BA0D 1UDNA 5K36B 3L7ZB 2BA1G 4NBQA 2BA0G 2C37B 5JEAE 1OYPA 2C38B 2JE6B 2NN6E 4BA2B 2NN6F 3M85D 2NN6D 2PNZA 2C39B 1OYSA 2WNRB 1E3HA 5C0XB 5K36A 1OYRA 3M85G 3GCMA 2WP8A 1UDOA 2C38A 1R6LA 4BA2A 2PO0B 4IFDB 5JEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDS A;  2C39 A;  4OO1 B;  2JEA B;  5K36 C;  3U1K A;  3H1C A;  3HKM A;  4BA1 B;  5K36 E;  3L7Z A;  4IFD A;  4OO1 C;  5K36 F;  2C37 A;  2PO1 B;  5K36 D;  2JE6 A;  4OO1 A;  5C0X C;  1E3P A;  3M7N D;  1UDQ A;  2JEB B;  2WNR A;  2NN6 B;  3GLL A;  3CDJ A;  2PO2 B;  5C0X A;  4BA1 A;  4OO1 D;  3DD6 A;  3M7N G;  5C0X F;  4IFD C;  1R6M A;  5C0X D;  5JEA C;  3B4T A;  2NN6 C;  2PO0 A;  3GME A;  4IFD E;  2BR2 B;  5JEA A;  2WP8 B;  2JEB A;  4AIM A;  2NN6 A;  4IFD F;  2PO2 A;  2JEA A;  4AM3 A;  4IFD D;  4AID A;  5JEA F;  4OO1 E;  5JEA D;  4OO1 F;  3KRN A;  5C0X E;  3CDI A;  2BA1 D;  2BR2 A;  2PNZ B;  2PO1 A;  2BA0 D;  1UDN A;  5K36 B;  3L7Z B;  2BA1 G;  4NBQ A;  2BA0 G;  2C37 B;  5JEA E;  1OYP A;  2C38 B;  2JE6 B;  2NN6 E;  4BA2 B;  2NN6 F;  3M85 D;  2NN6 D;  2PNZ A;  2C39 B;  1OYS A;  2WNR B;  1E3H A;  5C0X B;  5K36 A;  1OYR A;  3M85 G;  3GCM A;  2WP8 A;  1UDO A;  2C38 A;  1R6L A;  4BA2 A;  2PO0 B;  4IFD B;  5JEA B; 
#chains in the Genus database with same CATH topology
 4JI0 I;  1J5E E;  2C39 A;  1K47 A;  4JI5 I;  5K36 C;  4N3O A;  2UXD E;  5IT9 Q;  1N36 I;  2ZM6 E;  3LTO A;  2X36 A;  4DPY A;  1N0V C;  4X65 E;  2IER A;  2C37 A;  1XMQ I;  2PO1 B;  2V34 A;  4UTG A;  2V2V A;  5DRO A;  4DXL A;  2O3Z A;  1XXE A;  4GKK I;  1UDQ A;  2HHH E;  1H73 A;  3ZKD A;  2PO2 B;  3P76 A;  4PRX A;  4USM A;  5IWA I;  3DD6 A;  2O1U A;  3M7N G;  4M1K A;  2Z5E A;  4DPU A;  4JI4 E;  2UUB I;  2BM0 A;  4IFD C;  5ELW A;  5GMD A;  5DNL A;  4YY3 I;  2IOP A;  4DV2 E;  1Z0E A;  1HR0 I;  1HNX E;  1Z0C A;  3K1J A;  4FW7 A;  5BR8 E;  4LOM A;  4URL A;  2UU9 I;  4NXM E;  1RRE A;  3U1Y A;  4MU0 A;  4AIM A;  2VF3 A;  5A2Q Q;  4B3M I;  2PO2 A;  4AM3 A;  5JEA F;  2O1W A;  3PRY A;  5JEA D;  4B3T I;  1XNR E;  5LL6 R;  4DR5 E;  3T1Y I;  5EKW A;  2UXB I;  4DR2 E;  3CDI A;  4AQY I;  4FW6 A;  4B3S I;  4JI8 E;  1MU5 A;  4LF9 E;  3QT5 A;  3GON A;  1IBK E;  4LF5 I;  1DAR A;  5EL9 A;  1Z0G A;  4MU1 A;  4LFC I;  2BA0 G;  5JEA E;  1A6F A;  2BV3 A;  1IBL I;  1HNX I;  2C38 B;  1OJ4 A;  1PKP A;  3OTO I;  4DV7 I;  4DU8 A;  4BA2 B;  4MU4 A;  4DR6 I;  3LNU A;  4U3D A;  1PVG A;  4DV6 E;  5L3J A;  4FW9 A;  4WUD A;  4FWH A;  3M85 G;  3J7A M;  3GCM A;  1Z59 A;  1MX0 A;  4IZJ B;  1H7S A;  4JI0 E;  2C38 A;  5DNX A;  3CWV A;  1Z0V A;  4BA2 A;  4JI5 E;  1HNW E;  1N36 E;  1Z0T A;  3K17 A;  2R42 A;  4EMD A;  4KHP I;  1NHH A;  1RHY A;  4JG4 A;  2GQ0 A;  2A2D A;  3WU3 A;  4XTJ A;  4LF7 I;  3ZZT A;  4ISA A;  2X7I A;  2HK2 A;  4PRV A;  1XMQ E;  4IZJ A;  2ZIT A;  4JI3 I;  4ZVI A;  5FLX C;  4UT4 A;  1N33 I;  2IES A;  4OKG A;  1MG7 A;  5A2Q C;  3J81 C;  4FN5 A;  2PNL A;  1KIJ A;  5IWA E;  4HAC B;  4PU9 A;  1EI1 A;  2UUB E;  3GLL A;  3QT6 A;  4DV0 I;  1XMO I;  4DR4 I;  4MYT A;  4YY3 E;  2JT2 A;  4OO1 D;  1HR0 E;  1HNW I;  2WW4 A;  3J80 C;  2UU9 E;  1R6M A;  1ZM3 A;  5JEA C;  4LFB E;  2XEX A;  4FW4 A;  4B3M E;  2HKJ A;  3B4T A;  2PO0 A;  4FW3 A;  3GME A;  4KQV A;  3Q1Q A;  1YHC A;  1VI7 A;  4HAC A;  2UUC I;  4GKJ E;  5JEA A;  2J65 A;  2O1T A;  2WP8 B;  4IZJ D;  4B3T E;  4QNJ A;  2DEI A;  2GO3 A;  3V2U C;  3T1Y E;  4AID A;  4OO1 E;  2UXB E;  3B8H A;  1ZM2 A;  4WUC A;  4AQY E;  4B3S E;  2E5L I;  1KKH A;  3H4L A;  4X62 I;  1Z0B A;  4JI2 I;  2CZ9 A;  4DUZ I;  2GS8 A;  4LF5 E;  2BA1 D;  2V2Z A;  4LFC E;  3WU4 A;  2PO1 A;  2F4V I;  4DV3 I;  1IBL E;  3JAM C;  3Q6M A;  3OTO E;  4DV7 E;  1KVK A;  3L7Z B;  5FLX Q;  4DR6 E;  4NBQ A;  2CG9 A;  4LFB I;  3P06 A;  4JI6 I;  3WU6 A;  3J81 Q;  1FWK A;  2JE6 B;  2NN6 E;  1FNM A;  4GKJ I;  3P3C A;  1Z5B A;  4LPF A;  3J7A G;  1OYS A;  2WNR B;  5C0X B;  4LCG A;  1OYR A;  2Z5C B;  2UUA I;  1YH8 A;  4JV5 I;  3WU5 A;  2PNM A;  1Y60 A;  3J80 Q;  3ZKB A;  4X64 I;  3V5R A;  1EA6 A;  2E1R A;  4DV4 I;  3D4J A;  4KHP E;  2IOQ A;  5DRQ A;  4LF7 E;  1UDS A;  2LJP A;  4IS9 A;  1NHJ A;  4DPX A;  1ZM4 A;  4DR3 I;  4JI3 E;  4OO1 B;  4LFA I;  2JEA B;  3U1K A;  4DPT A;  1N33 E;  1N0U A;  4DR1 I;  1FKA E;  3HKM A;  1USU A;  5K36 E;  1Z0W A;  1NZ0 A;  4OO1 C;  4DPW A;  4JI7 I;  3P3G A;  4DUY I;  4P52 A;  1D6T A;  4DV0 E;  1XMO E;  4DR4 E;  4OO1 A;  1IBM I;  1NHI A;  1E3P A;  1XNQ I;  2EFG A;  3JAM Q;  3B78 A;  2NN6 B;  4K0K I;  1B62 A;  1RR9 A;  4JYA I;  2GO4 A;  4FWG A;  5LMU I;  2HK3 A;  3T1H I;  4NXN I;  3QT7 A;  5C0X F;  2UUC E;  4YHH I;  5C0X D;  5FWK A;  3PYE A;  4X66 I;  2VQE I;  2NN6 C;  4IFD E;  1Y4S A;  2F1D A;  2E5L E;  4LF4 I;  1Y6Z A;  2NN6 A;  4X62 E;  4JI2 E;  3ZM7 A;  4DUZ E;  4DV1 I;  4DR7 I;  5LMN I;  4OO1 F;  1H74 A;  3KRN A;  2F4V E;  4DV3 E;  5C0X E;  5GME A;  4OX9 I;  3P3E A;  4J3D A;  4LCH A;  3PS1 A;  5K36 B;  4JI6 E;  1N34 E;  3PS2 A;  1Z5A A;  2VQF I;  4RPF A;  2BA1 G;  2UXC I;  2C37 B;  5DRR A;  4MYU A;  1OYP A;  4QNK A;  2UUA E;  4JV5 E;  2NN6 F;  4LF6 I;  2R3V A;  4MDT A;  2NN6 D;  4R1F A;  1E3H A;  4X64 E;  3HJC A;  4LF8 E;  5K36 A;  4DV4 E;  2HFS A;  4JI1 I;  4B3R I;  2WP8 A;  1WUU A;  4U3B A;  1I94 I;  1N32 I;  1FJG I;  4OZE A;  4DR3 E;  4LFA E;  4IFD B;  4DV5 I;  3HUL A;  4DR1 E;  1N34 I;  2AE8 A;  2ZBK B;  2AJ4 A;  4MQY A;  1U2R A;  3H1C A;  1ELO A;  1XHK A;  3ZZ0 A;  1HNZ I;  4JI7 E;  1J5E I;  4DUY E;  4BA1 B;  2VES A;  1H7U A;  3L7Z A;  2UXD I;  1IBM E;  1XNQ E;  2BM1 A;  2ZM6 I;  4IFD A;  1Y4U A;  5K36 F;  1FWL A;  2V2Q A;  4USK A;  3K85 A;  1B63 A;  4LF8 I;  5K36 D;  2JE6 A;  2O1V A;  4K0K E;  4JYA E;  5C0X C;  1S4E A;  3M7N D;  1P42 A;  4X65 I;  1H72 C;  4I3H A;  3M6A A;  4Z7C A;  5LMU E;  3T1H E;  4NXN E;  2JEB B;  1Z5C A;  2WNR A;  3NZK A;  4YHH E;  3CDJ A;  5C0X A;  2Z5C A;  4BA1 A;  4X66 E;  2VQE E;  2A2C A;  1ZXN A;  2HHH I;  3UHM A;  3PYG A;  3PYF A;  2V8P A;  1FI4 A;  4LF4 E;  1ZXM A;  4JI4 I;  4DV1 E;  4DU7 A;  4DR7 E;  2BR2 B;  1VIS A;  5LMN E;  2Q2E B;  2JEB A;  4IZK B;  4DV2 I;  4IFD F;  5IT9 C;  2Z5B B;  5BR8 I;  1HK7 A;  2JEA A;  4IFD D;  4NXM I;  4WUB A;  5DRP A;  4OX9 E;  1PIE A;  2NPF A;  4ED4 A;  2VQF E;  1BKN A;  4HY1 A;  4P7A A;  2UXC E;  1XNR I;  3QT8 A;  2BR2 A;  2PNZ B;  4DR5 I;  3Q6N A;  2BA0 D;  1UDN A;  4IZK A;  4DR2 I;  1USV A;  2Z5B A;  2CVE A;  2J7K A;  1Y5Y A;  3B82 A;  4HXZ A;  1S16 A;  4JI8 I;  4LF6 E;  4FW5 A;  4LF9 I;  4GQU A;  4FWD A;  1IBK I;  3F0N A;  3PS3 A;  1UEK A;  4Z7Y A;  4JI1 E;  3M85 D;  4B3R E;  2PNZ A;  2C39 B;  2OI2 A;  4MU3 A;  1I94 E;  1N32 E;  1FJG E;  2DEJ A;  2HKE A;  2CGE A;  4DV6 I;  2HFU A;  4LCF A;  3ZZU A;  4DV5 E;  4GKK E;  1KTV A;  3PYD A;  3LPS A;  1UDO A;  1QZR A;  1R6L A;  2PO0 B;  1HNZ E;  1ZM9 A;  5JEA B;  4HYM A; 
#chains in the Genus database with same CATH homology
 1UDS A;  2C39 A;  4OO1 B;  2JEA B;  5K36 C;  3U1K A;  3H1C A;  3HKM A;  4BA1 B;  5K36 E;  3L7Z A;  4IFD A;  4OO1 C;  5K36 F;  2C37 A;  2PO1 B;  5K36 D;  2JE6 A;  4OO1 A;  5C0X C;  1E3P A;  3M7N D;  1UDQ A;  2JEB B;  2WNR A;  2NN6 B;  3GLL A;  3CDJ A;  2PO2 B;  5C0X A;  4BA1 A;  4OO1 D;  3DD6 A;  3M7N G;  5C0X F;  4IFD C;  1R6M A;  5C0X D;  5JEA C;  3B4T A;  2NN6 C;  2PO0 A;  3GME A;  4IFD E;  2BR2 B;  5JEA A;  2WP8 B;  2JEB A;  4AIM A;  2NN6 A;  4IFD F;  2PO2 A;  2JEA A;  4AM3 A;  4IFD D;  4AID A;  5JEA F;  4OO1 E;  5JEA D;  4OO1 F;  3KRN A;  5C0X E;  3CDI A;  2BA1 D;  2BR2 A;  2PNZ B;  2PO1 A;  2BA0 D;  1UDN A;  5K36 B;  3L7Z B;  2BA1 G;  4NBQ A;  2BA0 G;  2C37 B;  5JEA E;  1OYP A;  2C38 B;  2JE6 B;  2NN6 E;  4BA2 B;  2NN6 F;  3M85 D;  2NN6 D;  2PNZ A;  2C39 B;  1OYS A;  2WNR B;  1E3H A;  5C0X B;  5K36 A;  1OYR A;  3M85 G;  3GCM A;  2WP8 A;  1UDO A;  2C38 A;  1R6L A;  4BA2 A;  2PO0 B;  4IFD B;  5JEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...