3M7NG

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
DILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 75
structure length 254
sequence length 254
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m7nG01
3DD6A 2BA1D 4NBQA 5K36F 4AM3A 4BA2A 1R6MA 2JEAA 3GCMA 4IFDD 5JEAF 2BR2B 4AIDA 4AIMA 2PO0A 4IFDA 3GLLA 2BA0G 3HKMA 4BA2B 5C0XC 5C0XE 2JEAB 4BA1A 3GMEA 2JE6A 1OYRA 2PO0B 4IFDB 1UDNA 4IFDF 3H1CA 1R6LA 2C39A 1OYPA 3CDIA 4OO1D 4BA1B 2JE6B 3CDJA 3M85G 2C38B 2JEBB 4OO1A 5C0XD 4OO1C 4OO1E 5C0XA 2C39B 2C37A 1E3HA 1UDSA 2PO1A 2BA1G 4OO1B 2C38A 2JEBA 3L7ZA 2NN6C 2NN6E 3M7NG 5C0XB 5K36D 2C37B 2PO1B 3M85D 5JEAD 5K36C 2WP8A 3L7ZB 5K36E 2BA0D 5JEAC 2PNZA 5JEAE 2NN6D 2WNRA 5K36B 1UDQA 2NN6A 2WP8B 3B4TA 4OO1F 2PO2B 3M7ND 5JEAB 1OYSA 3KRNA 2PNZB 5C0XF 3U1KA 2WNRB 1UDOA 4IFDC 5K36A 2NN6B 4IFDE 1E3PA 2NN6F 2PO2A 5JEAA 2BR2A
chains in the Genus database with same CATH superfamily
1PVGA 1B63A 3PS3A 4YY3E 1NZ0A 4LFCI 1XNQI 3Q6MA 5LMUE 4NBQA 2O1WA 2O1UA 3D4JA 2BM1A 3V5RA 4U3DA 3Q1QA 5GMEA 4LF5E 2X36A 2PO0A 4MU0A 4LF9I 4IFDA 4P7AA 2CZ9A 4DUYE 3ZKDA 3GLLA 2J7KA 1FJGE 2GQ0A 3HKMA 1Z5CA 2V2ZA 5C0XC 3HULA 4FWGA 2JEAB 3GMEA 1Z5AA 2IESA 4DR2I 4B3TI 1MX0A 1VISA 4DR3E 2CG9A 1N33E 2LJPA 1R6LA 2C39A 2HKJA 4GKJI 4DR5E 4UTGA 4GQUA 2JT2A 4BA1B 1IBME 3WU4A 2Z5BB 4DR1E 4OO1C 3U1YA 1D6TA 2X7IA 3K85A 3PRYA 4DV7E 1ZXNA 1Z0TA 2BA1G 3V2UC 3L7ZA 3ZZ0A 2NN6E 3M7NG 3J7AM 5C0XB 4JYAE 3PYFA 2C37B 2IERA 4IZJB 4WUBA 2PO1B 2UXBI 1K47A 1HNWI 4JI0I 1HNWE 1Y6ZA 4JI0E 3OTOE 2V34A 2BM0A 2HFSA 5K36E 3ZZUA 1ZM3A 5A2QQ 4DR7I 2BA0D 1Z0EA 4UT4A 4DV6I 5JEAC 2A2CA 4B3MI 2NN6D 3PYGA 4B3RI 4IZJA 4NXNE 2HK2A 4I3HA 2UUBE 2UUCE 3B78A 3B8HA 3JAMQ 2Z5CB 1N32E 1VI7A 5IT9Q 4OO1F 1NHIA 2HFUA 1RREA 1OYSA 4LF6E 1ZM2A 4DR6I 2F1DA 1YH8A 3CWVA 1KIJA 4FWHA 2ZITA 4Z7CA 4DR6E 4IFDC 2VQEI 4K0KI 2VESA 2ZM6E 1RR9A 4K0KE 1QZRA 4JI7E 5LL6R 3DD6A 1Y5YA 1HR0I 1NHJA 4AQYE 4KHPI 1N0VC 4BA2A 1R6MA 4FW3A 4JI8I 5JEAF 4DV1I 4AIDA 4GKKI 4LOMA 4GKKE 2VQFI 4DV3I 2F4VI 2VQFE 1FWKA 3JAMC 4MDTA 1HNZI 2UUAE 4LF8I 1P42A 5IT9C 4IZKA 3NZKA 2JE6A 5DRPA 1XMQE 2E5LE 2PO0B 4DU8A 1Z0WA 3LPSA 3LTOA 4IFDB 5LMUI 2AJ4A 4JI6E 4IFDF 1PKPA 4YHHE 4HXZA 1OJ4A 4JI5E 4DV0E 4OO1D 4LF5I 4PU9A 2O1TA 3WU6A 1RHYA 4DUYI 1IBKE 1FJGI 4HACA 1H74A 2C39B 1E3HA 1BKNA 4NXME 4DPTA 5BR8E 4LF4E 2OI2A 4LF7E 3ZKBA 3P76A 1MU5A 3WU5A 4DV5E 4DR3I 4JI3I 3PS1A 1N33I 5IWAE 4JI3E 4DR5I 3K17A 3ZZTA 4LCFA 3GONA 1XNRE 4FW5A 5DRQA 1IBMI 4JI4I 1ELOA 5JEAD 4DR1I 4JI4E 2WP8A 3L7ZB 2R3VA 1N36E 1U2RA 4DV7I 1A6FA 2CGEA 2O1VA 2HHHE 4MU4A 1Z59A 3HJCA 3Q6NA 5K36B 4KQVA 5DROA 2V2QA 4DPYA 1UDQA 2NN6A 4FW6A 2UXDE 1UEKA 2Q2EB 4JYAI 3M7ND 3M6AA 1I94E 1N0UA 4X64E 5C0XF 3U1KA 3PYEA 1H73A 3P3CA 4OKGA 4N3OA 3OTOI 3WU3A 5K36A 4J3DA 2IOPA 4LFAE 2XEXA 4PRVA 4JG4A 1H7UA 2AE8A 4NXNI 3QT8A 2BR2A 4DR4E 2UUBI 4X65E 2UUCI 1N32I 4Z7YA 4WUCA 3PS2A 1WUUA 4AM3A 1Z0VA 4JV5E 4LF6I 3GCMA 4MU3A 4P52A 4DU7A 4AIMA 4EMDA 4FW7A 1PIEA 4LFBE 2CVEA 1FWLA 4X62E 5EKWA 4YY3I 2BA0G 2ZM6I 4DUZE 4QNKA 1XXEA 4BA2B 4JI1E 4USMA 1FNMA 1IBLI 4JI7I 5L3JA 5C0XE 1IBLE 1OYRA 1HK7A 4AQYI 3J81C 1YHCA 1UDNA 4FW4A 3H1CA 2R42A 4R1FA 1OYPA 3CDIA 3J7AG 1N34E 1HNXE 4IZKB 2A2DA 2ZBKB 4DPWA 2PNLA 5ELWA 2JE6B 3M85G 2JEBB 4OO1A 5FLXC 5C0XD 3PYDA 1MG7A 4M1KA 4OO1E 1KTVA 2UUAI 1EA6A 1Z0BA 3QT5A 1XMQI 2E5LI 2Z5EA 1H72C 4DXLA 4JI6I 2JEBA 4YHHI 2NN6C 4JI5I 4HACB 4DV0I 4MYUA 4DPXA 1S4EA 4RPFA 3T1HE 2WW4A 3B82A 1IBKI 4MQYA 4B3SE 5K36C 2NPFA 2E1RA 1Z0GA 2UU9E 1FI4A 4NXMI 4LF4I 5BR8I 1S16A 4IS9A 2PNZA 1KVKA 5JEAE 4LF7I 1USUA 1XMOE 4DV5I 2WNRA 3J80C 4DV4I 5IWAI 2WP8B 4LFCE 1XNQE 3B4TA 4DV4E 2PO2B 4U3BA 3KRNA 1XNRI 3QT7A 1Z0CA 2GO4A 4MU1A 3P06A 4FW9A 4LF9E 1UDOA 4DV2I 2J65A 2PNMA 2NN6B 4IFDE 1N36I 1E3PA 1B62A 5FWKA 1ZXMA 2NN6F 4DV2E 4ZVIA 2PO2A 4LPFA 2HHHI 4ED4A 2VF3A 3ZM7A 2BV3A 3T1YI 2BA1D 1XHKA 2UXDI 4DR2E 3T1YE 4HY1A 4FN5A 4B3TE 5K36F 4HYMA 1I94I 4IFDD 2JEAA 4X64I 4GKJE 2DEIA 1H7SA 2BR2B 1Y4SA 5DNLA 3J81Q 5LMNI 5LMNE 4LFAI 1EI1A 4JI2I 2V2VA 2DEJA 4JI2E 5DNXA 4DR4I 4WUDA 4BA1A 4X65I 5FLXQ 1ZM9A 2Z5BA 2EFGA 2IOQA 4JV5I 4DPUA 1NHHA 3CDJA 2UXBE 2C38B 2GS8A 4LFBI 4X62I 1J5EI 4DUZI 4JI1I 1USVA 1J5EE 4USKA 4ISAA 5C0XA 4DR7E 2C37A 4OX9I 4DV6E 1UDSA 2PO1A 4B3ME 5EL9A 4B3RE 4OX9E 3F0NA 2C38A 4QNJA 4OO1B 4X66I 4FWDA 4OZEA 2UXCI 1N34I 1HNXI 3K1JA 1XMOI 5K36D 3H4LA 4X66E 1Y60A 2UXCE 3QT6A 5GMDA 1Z5BA 2HK3A 1ZM4A 3M85D 3J80Q 2Z5CA 2V8PA 1Y4UA 2HKEA 4IZJD 2VQEE 4URLA 1DARA 4PRXA 3UHMA 3LNUA 2GO3A 4LCHA 1HR0E 4KHPE 5DRRA 4XTJA 5JEAB 3P3EA 5A2QC 3T1HI 2PNZB 4JI8E 4DV1E 1FKAE 4B3SI 4MYTA 2WNRB 2UU9I 4LCGA 4DV3E 2F4VE 1KKHA 5JEAA 1HNZE 4LF8E 2O3ZA 3P3GA
chains in the Genus database with same CATH topology
3DD6A 2BA1D 4NBQA 5K36F 4AM3A 4BA2A 1R6MA 2JEAA 3GCMA 4IFDD 5JEAF 2BR2B 4AIDA 4AIMA 2PO0A 4IFDA 3GLLA 2BA0G 3HKMA 4BA2B 5C0XC 5C0XE 2JEAB 4BA1A 3GMEA 2JE6A 1OYRA 2PO0B 4IFDB 1UDNA 4IFDF 3H1CA 1R6LA 2C39A 1OYPA 3CDIA 4OO1D 4BA1B 2JE6B 3CDJA 3M85G 2C38B 2JEBB 4OO1A 5C0XD 4OO1C 4OO1E 5C0XA 2C39B 2C37A 1E3HA 1UDSA 2PO1A 2BA1G 4OO1B 2C38A 2JEBA 3L7ZA 2NN6C 2NN6E 3M7NG 5C0XB 5K36D 2C37B 2PO1B 3M85D 5JEAD 5K36C 2WP8A 3L7ZB 5K36E 2BA0D 5JEAC 2PNZA 5JEAE 2NN6D 2WNRA 5K36B 1UDQA 2NN6A 2WP8B 3B4TA 4OO1F 2PO2B 3M7ND 5JEAB 1OYSA 3KRNA 2PNZB 5C0XF 3U1KA 2WNRB 1UDOA 4IFDC 5K36A 2NN6B 4IFDE 1E3PA 2NN6F 2PO2A 5JEAA 2BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD6 A;  2BA1 D;  4NBQ A;  5K36 F;  4AM3 A;  4BA2 A;  1R6M A;  2JEA A;  3GCM A;  4IFD D;  5JEA F;  2BR2 B;  4AID A;  4AIM A;  2PO0 A;  4IFD A;  3GLL A;  2BA0 G;  3HKM A;  4BA2 B;  5C0X C;  5C0X E;  2JEA B;  4BA1 A;  3GME A;  2JE6 A;  1OYR A;  2PO0 B;  4IFD B;  1UDN A;  4IFD F;  3H1C A;  1R6L A;  2C39 A;  1OYP A;  3CDI A;  4OO1 D;  4BA1 B;  2JE6 B;  3CDJ A;  3M85 G;  2C38 B;  2JEB B;  4OO1 A;  5C0X D;  4OO1 C;  4OO1 E;  5C0X A;  2C39 B;  2C37 A;  1E3H A;  1UDS A;  2PO1 A;  2BA1 G;  4OO1 B;  2C38 A;  2JEB A;  3L7Z A;  2NN6 C;  2NN6 E;  3M7N G;  5C0X B;  5K36 D;  2C37 B;  2PO1 B;  3M85 D;  5JEA D;  5K36 C;  2WP8 A;  3L7Z B;  5K36 E;  2BA0 D;  5JEA C;  2PNZ A;  5JEA E;  2NN6 D;  2WNR A;  5K36 B;  1UDQ A;  2NN6 A;  2WP8 B;  3B4T A;  4OO1 F;  2PO2 B;  3M7N D;  5JEA B;  1OYS A;  3KRN A;  2PNZ B;  5C0X F;  3U1K A;  2WNR B;  1UDO A;  4IFD C;  5K36 A;  2NN6 B;  4IFD E;  1E3P A;  2NN6 F;  2PO2 A;  5JEA A;  2BR2 A; 
#chains in the Genus database with same CATH topology
 1PVG A;  1B63 A;  3PS3 A;  4YY3 E;  1NZ0 A;  4LFC I;  1XNQ I;  3Q6M A;  5LMU E;  4NBQ A;  2O1W A;  2O1U A;  3D4J A;  2BM1 A;  3V5R A;  4U3D A;  3Q1Q A;  5GME A;  4LF5 E;  2X36 A;  2PO0 A;  4MU0 A;  4LF9 I;  4IFD A;  4P7A A;  2CZ9 A;  4DUY E;  3ZKD A;  3GLL A;  2J7K A;  1FJG E;  2GQ0 A;  3HKM A;  1Z5C A;  2V2Z A;  5C0X C;  3HUL A;  4FWG A;  2JEA B;  3GME A;  1Z5A A;  2IES A;  4DR2 I;  4B3T I;  1MX0 A;  1VIS A;  4DR3 E;  2CG9 A;  1N33 E;  2LJP A;  1R6L A;  2C39 A;  2HKJ A;  4GKJ I;  4DR5 E;  4UTG A;  4GQU A;  2JT2 A;  4BA1 B;  1IBM E;  3WU4 A;  2Z5B B;  4DR1 E;  4OO1 C;  3U1Y A;  1D6T A;  2X7I A;  3K85 A;  3PRY A;  4DV7 E;  1ZXN A;  1Z0T A;  2BA1 G;  3V2U C;  3L7Z A;  3ZZ0 A;  2NN6 E;  3M7N G;  3J7A M;  5C0X B;  4JYA E;  3PYF A;  2C37 B;  2IER A;  4IZJ B;  4WUB A;  2PO1 B;  2UXB I;  1K47 A;  1HNW I;  4JI0 I;  1HNW E;  1Y6Z A;  4JI0 E;  3OTO E;  2V34 A;  2BM0 A;  2HFS A;  5K36 E;  3ZZU A;  1ZM3 A;  5A2Q Q;  4DR7 I;  2BA0 D;  1Z0E A;  4UT4 A;  4DV6 I;  5JEA C;  2A2C A;  4B3M I;  2NN6 D;  3PYG A;  4B3R I;  4IZJ A;  4NXN E;  2HK2 A;  4I3H A;  2UUB E;  2UUC E;  3B78 A;  3B8H A;  3JAM Q;  2Z5C B;  1N32 E;  1VI7 A;  5IT9 Q;  4OO1 F;  1NHI A;  2HFU A;  1RRE A;  1OYS A;  4LF6 E;  1ZM2 A;  4DR6 I;  2F1D A;  1YH8 A;  3CWV A;  1KIJ A;  4FWH A;  2ZIT A;  4Z7C A;  4DR6 E;  4IFD C;  2VQE I;  4K0K I;  2VES A;  2ZM6 E;  1RR9 A;  4K0K E;  1QZR A;  4JI7 E;  5LL6 R;  3DD6 A;  1Y5Y A;  1HR0 I;  1NHJ A;  4AQY E;  4KHP I;  1N0V C;  4BA2 A;  1R6M A;  4FW3 A;  4JI8 I;  5JEA F;  4DV1 I;  4AID A;  4GKK I;  4LOM A;  4GKK E;  2VQF I;  4DV3 I;  2F4V I;  2VQF E;  1FWK A;  3JAM C;  4MDT A;  1HNZ I;  2UUA E;  4LF8 I;  1P42 A;  5IT9 C;  4IZK A;  3NZK A;  2JE6 A;  5DRP A;  1XMQ E;  2E5L E;  2PO0 B;  4DU8 A;  1Z0W A;  3LPS A;  3LTO A;  4IFD B;  5LMU I;  2AJ4 A;  4JI6 E;  4IFD F;  1PKP A;  4YHH E;  4HXZ A;  1OJ4 A;  4JI5 E;  4DV0 E;  4OO1 D;  4LF5 I;  4PU9 A;  2O1T A;  3WU6 A;  1RHY A;  4DUY I;  1IBK E;  1FJG I;  4HAC A;  1H74 A;  2C39 B;  1E3H A;  1BKN A;  4NXM E;  4DPT A;  5BR8 E;  4LF4 E;  2OI2 A;  4LF7 E;  3ZKB A;  3P76 A;  1MU5 A;  3WU5 A;  4DV5 E;  4DR3 I;  4JI3 I;  3PS1 A;  1N33 I;  5IWA E;  4JI3 E;  4DR5 I;  3K17 A;  3ZZT A;  4LCF A;  3GON A;  1XNR E;  4FW5 A;  5DRQ A;  1IBM I;  4JI4 I;  1ELO A;  5JEA D;  4DR1 I;  4JI4 E;  2WP8 A;  3L7Z B;  2R3V A;  1N36 E;  1U2R A;  4DV7 I;  1A6F A;  2CGE A;  2O1V A;  2HHH E;  4MU4 A;  1Z59 A;  3HJC A;  3Q6N A;  5K36 B;  4KQV A;  5DRO A;  2V2Q A;  4DPY A;  1UDQ A;  2NN6 A;  4FW6 A;  2UXD E;  1UEK A;  2Q2E B;  4JYA I;  3M7N D;  3M6A A;  1I94 E;  1N0U A;  4X64 E;  5C0X F;  3U1K A;  3PYE A;  1H73 A;  3P3C A;  4OKG A;  4N3O A;  3OTO I;  3WU3 A;  5K36 A;  4J3D A;  2IOP A;  4LFA E;  2XEX A;  4PRV A;  4JG4 A;  1H7U A;  2AE8 A;  4NXN I;  3QT8 A;  2BR2 A;  4DR4 E;  2UUB I;  4X65 E;  2UUC I;  1N32 I;  4Z7Y A;  4WUC A;  3PS2 A;  1WUU A;  4AM3 A;  1Z0V A;  4JV5 E;  4LF6 I;  3GCM A;  4MU3 A;  4P52 A;  4DU7 A;  4AIM A;  4EMD A;  4FW7 A;  1PIE A;  4LFB E;  2CVE A;  1FWL A;  4X62 E;  5EKW A;  4YY3 I;  2BA0 G;  2ZM6 I;  4DUZ E;  4QNK A;  1XXE A;  4BA2 B;  4JI1 E;  4USM A;  1FNM A;  1IBL I;  4JI7 I;  5L3J A;  5C0X E;  1IBL E;  1OYR A;  1HK7 A;  4AQY I;  3J81 C;  1YHC A;  1UDN A;  4FW4 A;  3H1C A;  2R42 A;  4R1F A;  1OYP A;  3CDI A;  3J7A G;  1N34 E;  1HNX E;  4IZK B;  2A2D A;  2ZBK B;  4DPW A;  2PNL A;  5ELW A;  2JE6 B;  3M85 G;  2JEB B;  4OO1 A;  5FLX C;  5C0X D;  3PYD A;  1MG7 A;  4M1K A;  4OO1 E;  1KTV A;  2UUA I;  1EA6 A;  1Z0B A;  3QT5 A;  1XMQ I;  2E5L I;  2Z5E A;  1H72 C;  4DXL A;  4JI6 I;  2JEB A;  4YHH I;  2NN6 C;  4JI5 I;  4HAC B;  4DV0 I;  4MYU A;  4DPX A;  1S4E A;  4RPF A;  3T1H E;  2WW4 A;  3B82 A;  1IBK I;  4MQY A;  4B3S E;  5K36 C;  2NPF A;  2E1R A;  1Z0G A;  2UU9 E;  1FI4 A;  4NXM I;  4LF4 I;  5BR8 I;  1S16 A;  4IS9 A;  2PNZ A;  1KVK A;  5JEA E;  4LF7 I;  1USU A;  1XMO E;  4DV5 I;  2WNR A;  3J80 C;  4DV4 I;  5IWA I;  2WP8 B;  4LFC E;  1XNQ E;  3B4T A;  4DV4 E;  2PO2 B;  4U3B A;  3KRN A;  1XNR I;  3QT7 A;  1Z0C A;  2GO4 A;  4MU1 A;  3P06 A;  4FW9 A;  4LF9 E;  1UDO A;  4DV2 I;  2J65 A;  2PNM A;  2NN6 B;  4IFD E;  1N36 I;  1E3P A;  1B62 A;  5FWK A;  1ZXM A;  2NN6 F;  4DV2 E;  4ZVI A;  2PO2 A;  4LPF A;  2HHH I;  4ED4 A;  2VF3 A;  3ZM7 A;  2BV3 A;  3T1Y I;  2BA1 D;  1XHK A;  2UXD I;  4DR2 E;  3T1Y E;  4HY1 A;  4FN5 A;  4B3T E;  5K36 F;  4HYM A;  1I94 I;  4IFD D;  2JEA A;  4X64 I;  4GKJ E;  2DEI A;  1H7S A;  2BR2 B;  1Y4S A;  5DNL A;  3J81 Q;  5LMN I;  5LMN E;  4LFA I;  1EI1 A;  4JI2 I;  2V2V A;  2DEJ A;  4JI2 E;  5DNX A;  4DR4 I;  4WUD A;  4BA1 A;  4X65 I;  5FLX Q;  1ZM9 A;  2Z5B A;  2EFG A;  2IOQ A;  4JV5 I;  4DPU A;  1NHH A;  3CDJ A;  2UXB E;  2C38 B;  2GS8 A;  4LFB I;  4X62 I;  1J5E I;  4DUZ I;  4JI1 I;  1USV A;  1J5E E;  4USK A;  4ISA A;  5C0X A;  4DR7 E;  2C37 A;  4OX9 I;  4DV6 E;  1UDS A;  2PO1 A;  4B3M E;  5EL9 A;  4B3R E;  4OX9 E;  3F0N A;  2C38 A;  4QNJ A;  4OO1 B;  4X66 I;  4FWD A;  4OZE A;  2UXC I;  1N34 I;  1HNX I;  3K1J A;  1XMO I;  5K36 D;  3H4L A;  4X66 E;  1Y60 A;  2UXC E;  3QT6 A;  5GMD A;  1Z5B A;  2HK3 A;  1ZM4 A;  3M85 D;  3J80 Q;  2Z5C A;  2V8P A;  1Y4U A;  2HKE A;  4IZJ D;  2VQE E;  4URL A;  1DAR A;  4PRX A;  3UHM A;  3LNU A;  2GO3 A;  4LCH A;  1HR0 E;  4KHP E;  5DRR A;  4XTJ A;  5JEA B;  3P3E A;  5A2Q C;  3T1H I;  2PNZ B;  4JI8 E;  4DV1 E;  1FKA E;  4B3S I;  4MYT A;  2WNR B;  2UU9 I;  4LCG A;  4DV3 E;  2F4V E;  1KKH A;  5JEA A;  1HNZ E;  4LF8 E;  2O3Z A;  3P3G A; 
#chains in the Genus database with same CATH homology
 3DD6 A;  2BA1 D;  4NBQ A;  5K36 F;  4AM3 A;  4BA2 A;  1R6M A;  2JEA A;  3GCM A;  4IFD D;  5JEA F;  2BR2 B;  4AID A;  4AIM A;  2PO0 A;  4IFD A;  3GLL A;  2BA0 G;  3HKM A;  4BA2 B;  5C0X C;  5C0X E;  2JEA B;  4BA1 A;  3GME A;  2JE6 A;  1OYR A;  2PO0 B;  4IFD B;  1UDN A;  4IFD F;  3H1C A;  1R6L A;  2C39 A;  1OYP A;  3CDI A;  4OO1 D;  4BA1 B;  2JE6 B;  3CDJ A;  3M85 G;  2C38 B;  2JEB B;  4OO1 A;  5C0X D;  4OO1 C;  4OO1 E;  5C0X A;  2C39 B;  2C37 A;  1E3H A;  1UDS A;  2PO1 A;  2BA1 G;  4OO1 B;  2C38 A;  2JEB A;  3L7Z A;  2NN6 C;  2NN6 E;  3M7N G;  5C0X B;  5K36 D;  2C37 B;  2PO1 B;  3M85 D;  5JEA D;  5K36 C;  2WP8 A;  3L7Z B;  5K36 E;  2BA0 D;  5JEA C;  2PNZ A;  5JEA E;  2NN6 D;  2WNR A;  5K36 B;  1UDQ A;  2NN6 A;  2WP8 B;  3B4T A;  4OO1 F;  2PO2 B;  3M7N D;  5JEA B;  1OYS A;  3KRN A;  2PNZ B;  5C0X F;  3U1K A;  2WNR B;  1UDO A;  4IFD C;  5K36 A;  2NN6 B;  4IFD E;  1E3P A;  2NN6 F;  2PO2 A;  5JEA A;  2BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...