3M7NG

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
254
structure length
254
Chain Sequence
b'DILVDIKRDYVLSKLRDNERIDGRGFDEFRKVEIIPNVIEKAEGSALVKLGDTQVVVGVKMQPGEPYPDTPDRGVIIVNAELVPLASPTFEPGPPDENSIELARVVDRGIRESEAVDLSKLVIEEGEKVWIVFVDIHALDDDGNLLDASALAAIAALMNTKVPAERFDLGEDYLLPVRDLPVSVTSLIVGNKYLVDPSREEMSVGDTTLTITTDKDDNVVAMQKSGGYLLDEKLFDELLDVSINCARKLREKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 75
structure length 254
sequence length 254
chains with identical sequence H, I
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01138 RNase_PH 3' exoribonuclease family, domain 1
G PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3m7nG01
1R6MA 2JE6A 4OO1B 3U1KA 2WNRA 5JEAB 2BA1D 3M7ND 4IFDF 5C0XC 5K36E 4OO1A 2BR2B 2C38B 1OYSA 4BA1B 3M85G 1UDOA 1UDQA 5JEAA 3B4TA 2NN6D 1UDSA 1OYRA 3H1CA 2PO2B 5K36F 2C38A 4AM3A 3GMEA 1E3PA 4OO1E 2NN6C 2JEAA 2PO1B 5C0XD 3HKMA 5JEAE 4IFDD 2PO0B 2PO2A 4BA2B 4IFDC 4NBQA 2JEBB 4OO1F 3M7NG 2BA1G 2C39B 4AIDA 2PO1A 2PO0A 2BA0D 5JEAF 5C0XB 4IFDB 5K36D 4BA2A 2JEBA 2BR2A 2C39A 4BA1A 5K36C 2C37B 3KRNA 5C0XA 3GCMA 3CDJA 5K36B 2NN6B 4OO1D 2JE6B 1UDNA 1E3HA 5JEAD 2WP8B 4OO1C 5C0XE 3L7ZB 5K36A 1OYPA 1R6LA 2NN6A 3CDIA 5JEAC 3DD6A 2BA0G 2WP8A 3GLLA 2PNZB 4AIMA 3L7ZA 3M85D 4IFDA 5C0XF 2NN6E 2C37A 2JEAB 2PNZA 2WNRB 4IFDE 2NN6F
chains in the Genus database with same CATH superfamily
2BM1A 4ISAA 3PS1A 3H4LA 2Z5CB 5A2QQ 2F1DA 4DV4I 1IBLE 4IS9A 3U1KA 1B63A 2UUAI 4WUDA 4MQYA 2O1WA 5K36E 4DV3E 4Z7CA 2BR2B 4I3HA 1XNRE 2E5LI 1MG7A 4FW3A 1H7SA 3WU5A 2VQEE 1BKNA 2DEJA 4DV1I 4KQVA 1OYRA 3H1CA 2IERA 2PO2B 5K36F 2V34A 2C38A 1IBLI 2V2VA 4LOMA 3ZZUA 1I94E 5JEAE 1Z5AA 4DUYI 4DV3I 4NBQA 2HK2A 3M7NG 2C39B 2PO1A 1HK7A 4JI0E 2J65A 2PO0A 1ELOA 1MX0A 5JEAF 4LF8I 4ZVIA 4DPTA 1J5EE 4X65E 4IZKB 4DR4E 1OJ4A 4JI4E 4KHPE 4BA1A 1FWKA 5LMUI 5A2QC 3J81C 1I94I 4MYTA 5BR8I 1ZM4A 4DR5E 4FW6A 3K1JA 1UDNA 2VF3A 2WP8B 4JI0I 3NZKA 1XNQE 4DR2E 3PYEA 5FWKA 1J5EI 4X65I 4DU8A 4U3DA 4DR4I 4MU4A 4JI4I 4KHPI 4B3RE 2BA0G 3B8HA 4DR7E 3U1YA 5DNXA 1N36E 3GLLA 4OX9I 1D6TA 4AIMA 1Y4SA 4IFDA 3PYDA 2EFGA 4NXNI 2UU9E 2CGEA 2PNZA 1Y4UA 1H72C 1IBME 1MU5A 2WNRB 2HKEA 4JI6I 1ZM9A 2UUBE 1HNWI 1VI7A 1R6MA 3P3GA 4DR7I 3T1HE 1KTVA 1N36I 2HFUA 1PKPA 5JEAB 2BA1D 2ZM6E 3WU4A 4GKKE 1N34E 4QNKA 4OO1A 1OYSA 4FWDA 2GS8A 4P52A 4BA1B 4NXME 1UDOA 1ZM2A 3QT8A 3V5RA 1UDSA 3P76A 4JI5I 2UUBI 4AQYE 4JG4A 2Q2EB 3GMEA 3JAMQ 4LCHA 3J81Q 4DPUA 4P7AA 1NHIA 1UEKA 4UT4A 3HULA 4IFDD 3Q6NA 1N34I 2VESA 2PNLA 3B82A 4LFBE 4DV5E 4IFDC 1Y6ZA 2JEBB 3J7AM 3LTOA 4B3TI 1KKHA 4IFDB 4LFCE 1XMQE 2O1TA 4J3DA 3CWVA 3K85A 3PYGA 4AQYI 4BA2A 4JV5E 5EL9A 4DV2E 4JI2E 5DRQA 4LF5E 2Z5BA 4YY3E 1ZM3A 3ZM7A 5C0XA 3Q6MA 3PRYA 4HACA 4B3ME 2J7KA 3WU3A 4FWGA 4USMA 4OO1D 4OZEA 2UXBE 4DR3E 1N33E 1XNRI 1E3HA 2IOQA 3F0NA 2VQEI 5LL6R 4OO1C 1Z0CA 4DPYA 4LFCI 2AJ4A 3L7ZB 5K36A 1OYPA 2NN6A 2CVEA 4JV5I 1ZXMA 4X66E 4DV2I 4JI2I 4K0KE 4MYUA 3P06A 4YY3I 3DD6A 5DROA 1H73A 2HKJA 4ED4A 3JAMC 4EMDA 2BV3A 2DEIA 3M85D 2WW4A 4RPFA 1HNZE 4B3MI 4UTGA 1NHJA 2UXBI 4DR3I 2Z5EA 3GONA 3ZKDA 1EI1A 2CZ9A 1USUA 4XTJA 5LMNE 4IFDE 2GQ0A 1YH8A 4PU9A 3OTOE 4X66I 3J80C 3ZZTA 1WUUA 2O1VA 3T1YE 4DU7A 4LF9E 1N0VC 4DR6E 2GO3A 1K47A 4IZJA 4LF4E 2X36A 4HY1A 4IFDF 4LF7E 3WU6A 5C0XC 4FN5A 1EA6A 4DR5I 2Z5BB 2C38B 4WUCA 1Z0EA 1B62A 2PNMA 5DNLA 1Z0TA 2A2CA 2NN6D 2JT2A 1XNQI 4DR2I 3OTOI 1N32E 4AM3A 4U3BA 1E3PA 3T1YI 4DR6I 4OO1E 2NN6C 2JEAA 4B3RI 4LPFA 2PO1B 5IT9C 4DV0E 2PO0B 4X62E 4LF7I 4GKJE 3LPSA 1Z0GA 2HHHE 1FJGE 1PVGA 2PO2A 3P3EA 4X64E 4LFAE 2A2DA 2HFSA 4OO1F 2UU9I 2BA1G 2R3VA 2XEXA 4AIDA 3PS3A 1IBMI 3LNUA 1Z59A 4MU1A 4PRVA 2F4VE 1N32I 3Q1QA 1VISA 4MU3A 1H74A 2C39A 1DARA 4DV6E 3T1HI 2UUAE 4DV0I 4X62I 2ZM6I 4GKKI 2VQFE 1Z5CA 3QT6A 4GKJI 1FJGI 4IZKA 2HHHI 4B3SE 4X64I 4LFAI 4URLA 4NXMI 5EKWA 4DR1E 4FW5A 5C0XE 1R6LA 5IWAE 3J80Q 1XXEA 2V8PA 3CDIA 4FW7A 1N0UA 4DPXA 1S4EA 4LF6E 2WP8A 4DV6I 2PNZB 4PRXA 4FWHA 5C0XF 1IBKE 2VQFI 4JYAE 1Z0BA 1FWLA 2IOPA 4B3SI 2NPFA 4DUYE 2NN6E 4MU0A 4DV5I 4LFBI 3B78A 2C37A 5GMEA 1A6FA 4FW4A 2JEAB 4DR1I 4DPWA 1USVA 5FLXQ 4LF8E 4JI3E 5IWAI 2V2QA 1H7UA 1XMQI 2NN6F 1RHYA 3J7AG 2ZITA 1Y60A 2JE6A 3D4JA 4OO1B 4LF5I 5LMUE 2UUCE 3K17A 4LF6I 5IT9Q 2WNRA 2AE8A 3M7ND 4JI8E 2UXDE 1IBKI 5BR8E 4JYAI 1FNMA 1HNXE 2UXCE 1QZRA 1Z0WA 3M85G 1N33I 1UDQA 5JEAA 1KVKA 4JI7E 4DV7E 3B4TA 4GQUA 1XMOE 4JI3I 5DRPA 1NHHA 3QT5A 2LJPA 2HK3A 4DXLA 4FW9A 4K0KI 2UUCI 4OX9E 1Z5BA 2CG9A 3PS2A 5C0XD 3HKMA 4JI8I 2UXDI 3UHMA 4NXNE 2V2ZA 3P3CA 1HNXI 2UXCI 1HNZI 5L3JA 4BA2B 2Z5CA 1FKAE 1PIEA 4HXZA 4M1KA 4Z7YA 4LCGA 3ZKBA 4JI1E 5GMDA 4DV7I 4JI7I 4JI6E 2BA0D 5C0XB 1XMOI 5LMNI 5K36D 4HACB 1HNWE 5FLXC 2JEBA 2BR2A 4LCFA 1RREA 1U2RA 2R42A 4LF9I 1RR9A 2C37B 3KRNA 4USKA 5K36C 4YHHE 1XHKA 3GCMA 3CDJA 4WUBA 4LF4I 2BM0A 4N3OA 5K36B 2NN6B 2JE6B 4DUZE 1Y5YA 5ELWA 5JEAD 4JI1I 1YHCA 3V2UC 2GO4A 3HJCA 4JI5E 1HR0E 1FI4A 2ZBKB 5JEAC 4DV4E 4YHHI 2X7IA 4R1FA 4IZJD 2O3ZA 2OI2A 3L7ZA 3QT7A 2E1RA 3M6AA 4MDTA 4QNJA 1S16A 2IESA 4DUZI 1KIJA 2E5LE 4B3TE 1P42A 1ZXNA 3PYFA 1Z0VA 2O1UA 4IZJB 3ZZ0A 4HYMA 4DV1E 5DRRA 1HR0I 1NZ0A 2F4VI 4OKGA
chains in the Genus database with same CATH topology
1R6MA 2JE6A 4OO1B 3U1KA 2WNRA 5JEAB 2BA1D 3M7ND 4IFDF 5C0XC 5K36E 4OO1A 2BR2B 2C38B 1OYSA 4BA1B 3M85G 1UDOA 1UDQA 5JEAA 3B4TA 2NN6D 1UDSA 1OYRA 3H1CA 2PO2B 5K36F 2C38A 4AM3A 3GMEA 1E3PA 4OO1E 2NN6C 2JEAA 2PO1B 5C0XD 3HKMA 5JEAE 4IFDD 2PO0B 2PO2A 4BA2B 4IFDC 4NBQA 2JEBB 4OO1F 3M7NG 2BA1G 2C39B 4AIDA 2PO1A 2PO0A 2BA0D 5JEAF 5C0XB 4IFDB 5K36D 4BA2A 2JEBA 2BR2A 2C39A 4BA1A 5K36C 2C37B 3KRNA 5C0XA 3GCMA 3CDJA 5K36B 2NN6B 4OO1D 2JE6B 1UDNA 1E3HA 5JEAD 2WP8B 4OO1C 5C0XE 3L7ZB 5K36A 1OYPA 1R6LA 2NN6A 3CDIA 5JEAC 3DD6A 2BA0G 2WP8A 3GLLA 2PNZB 4AIMA 3L7ZA 3M85D 4IFDA 5C0XF 2NN6E 2C37A 2JEAB 2PNZA 2WNRB 4IFDE 2NN6F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6M A;  2JE6 A;  4OO1 B;  3U1K A;  2WNR A;  5JEA B;  2BA1 D;  3M7N D;  4IFD F;  5C0X C;  5K36 E;  4OO1 A;  2BR2 B;  2C38 B;  1OYS A;  4BA1 B;  3M85 G;  1UDO A;  1UDQ A;  5JEA A;  3B4T A;  2NN6 D;  1UDS A;  1OYR A;  3H1C A;  2PO2 B;  5K36 F;  2C38 A;  4AM3 A;  3GME A;  1E3P A;  4OO1 E;  2NN6 C;  2JEA A;  2PO1 B;  5C0X D;  3HKM A;  5JEA E;  4IFD D;  2PO0 B;  2PO2 A;  4BA2 B;  4IFD C;  4NBQ A;  2JEB B;  4OO1 F;  3M7N G;  2BA1 G;  2C39 B;  4AID A;  2PO1 A;  2PO0 A;  2BA0 D;  5JEA F;  5C0X B;  4IFD B;  5K36 D;  4BA2 A;  2JEB A;  2BR2 A;  2C39 A;  4BA1 A;  5K36 C;  2C37 B;  3KRN A;  5C0X A;  3GCM A;  3CDJ A;  5K36 B;  2NN6 B;  4OO1 D;  2JE6 B;  1UDN A;  1E3H A;  5JEA D;  2WP8 B;  4OO1 C;  5C0X E;  3L7Z B;  5K36 A;  1OYP A;  1R6L A;  2NN6 A;  3CDI A;  5JEA C;  3DD6 A;  2BA0 G;  2WP8 A;  3GLL A;  2PNZ B;  4AIM A;  3L7Z A;  3M85 D;  4IFD A;  5C0X F;  2NN6 E;  2C37 A;  2JEA B;  2PNZ A;  2WNR B;  4IFD E;  2NN6 F; 
#chains in the Genus database with same CATH topology
 2BM1 A;  4ISA A;  3PS1 A;  3H4L A;  2Z5C B;  5A2Q Q;  2F1D A;  4DV4 I;  1IBL E;  4IS9 A;  3U1K A;  1B63 A;  2UUA I;  4WUD A;  4MQY A;  2O1W A;  5K36 E;  4DV3 E;  4Z7C A;  2BR2 B;  4I3H A;  1XNR E;  2E5L I;  1MG7 A;  4FW3 A;  1H7S A;  3WU5 A;  2VQE E;  1BKN A;  2DEJ A;  4DV1 I;  4KQV A;  1OYR A;  3H1C A;  2IER A;  2PO2 B;  5K36 F;  2V34 A;  2C38 A;  1IBL I;  2V2V A;  4LOM A;  3ZZU A;  1I94 E;  5JEA E;  1Z5A A;  4DUY I;  4DV3 I;  4NBQ A;  2HK2 A;  3M7N G;  2C39 B;  2PO1 A;  1HK7 A;  4JI0 E;  2J65 A;  2PO0 A;  1ELO A;  1MX0 A;  5JEA F;  4LF8 I;  4ZVI A;  4DPT A;  1J5E E;  4X65 E;  4IZK B;  4DR4 E;  1OJ4 A;  4JI4 E;  4KHP E;  4BA1 A;  1FWK A;  5LMU I;  5A2Q C;  3J81 C;  1I94 I;  4MYT A;  5BR8 I;  1ZM4 A;  4DR5 E;  4FW6 A;  3K1J A;  1UDN A;  2VF3 A;  2WP8 B;  4JI0 I;  3NZK A;  1XNQ E;  4DR2 E;  3PYE A;  5FWK A;  1J5E I;  4X65 I;  4DU8 A;  4U3D A;  4DR4 I;  4MU4 A;  4JI4 I;  4KHP I;  4B3R E;  2BA0 G;  3B8H A;  4DR7 E;  3U1Y A;  5DNX A;  1N36 E;  3GLL A;  4OX9 I;  1D6T A;  4AIM A;  1Y4S A;  4IFD A;  3PYD A;  2EFG A;  4NXN I;  2UU9 E;  2CGE A;  2PNZ A;  1Y4U A;  1H72 C;  1IBM E;  1MU5 A;  2WNR B;  2HKE A;  4JI6 I;  1ZM9 A;  2UUB E;  1HNW I;  1VI7 A;  1R6M A;  3P3G A;  4DR7 I;  3T1H E;  1KTV A;  1N36 I;  2HFU A;  1PKP A;  5JEA B;  2BA1 D;  2ZM6 E;  3WU4 A;  4GKK E;  1N34 E;  4QNK A;  4OO1 A;  1OYS A;  4FWD A;  2GS8 A;  4P52 A;  4BA1 B;  4NXM E;  1UDO A;  1ZM2 A;  3QT8 A;  3V5R A;  1UDS A;  3P76 A;  4JI5 I;  2UUB I;  4AQY E;  4JG4 A;  2Q2E B;  3GME A;  3JAM Q;  4LCH A;  3J81 Q;  4DPU A;  4P7A A;  1NHI A;  1UEK A;  4UT4 A;  3HUL A;  4IFD D;  3Q6N A;  1N34 I;  2VES A;  2PNL A;  3B82 A;  4LFB E;  4DV5 E;  4IFD C;  1Y6Z A;  2JEB B;  3J7A M;  3LTO A;  4B3T I;  1KKH A;  4IFD B;  4LFC E;  1XMQ E;  2O1T A;  4J3D A;  3CWV A;  3K85 A;  3PYG A;  4AQY I;  4BA2 A;  4JV5 E;  5EL9 A;  4DV2 E;  4JI2 E;  5DRQ A;  4LF5 E;  2Z5B A;  4YY3 E;  1ZM3 A;  3ZM7 A;  5C0X A;  3Q6M A;  3PRY A;  4HAC A;  4B3M E;  2J7K A;  3WU3 A;  4FWG A;  4USM A;  4OO1 D;  4OZE A;  2UXB E;  4DR3 E;  1N33 E;  1XNR I;  1E3H A;  2IOQ A;  3F0N A;  2VQE I;  5LL6 R;  4OO1 C;  1Z0C A;  4DPY A;  4LFC I;  2AJ4 A;  3L7Z B;  5K36 A;  1OYP A;  2NN6 A;  2CVE A;  4JV5 I;  1ZXM A;  4X66 E;  4DV2 I;  4JI2 I;  4K0K E;  4MYU A;  3P06 A;  4YY3 I;  3DD6 A;  5DRO A;  1H73 A;  2HKJ A;  4ED4 A;  3JAM C;  4EMD A;  2BV3 A;  2DEI A;  3M85 D;  2WW4 A;  4RPF A;  1HNZ E;  4B3M I;  4UTG A;  1NHJ A;  2UXB I;  4DR3 I;  2Z5E A;  3GON A;  3ZKD A;  1EI1 A;  2CZ9 A;  1USU A;  4XTJ A;  5LMN E;  4IFD E;  2GQ0 A;  1YH8 A;  4PU9 A;  3OTO E;  4X66 I;  3J80 C;  3ZZT A;  1WUU A;  2O1V A;  3T1Y E;  4DU7 A;  4LF9 E;  1N0V C;  4DR6 E;  2GO3 A;  1K47 A;  4IZJ A;  4LF4 E;  2X36 A;  4HY1 A;  4IFD F;  4LF7 E;  3WU6 A;  5C0X C;  4FN5 A;  1EA6 A;  4DR5 I;  2Z5B B;  2C38 B;  4WUC A;  1Z0E A;  1B62 A;  2PNM A;  5DNL A;  1Z0T A;  2A2C A;  2NN6 D;  2JT2 A;  1XNQ I;  4DR2 I;  3OTO I;  1N32 E;  4AM3 A;  4U3B A;  1E3P A;  3T1Y I;  4DR6 I;  4OO1 E;  2NN6 C;  2JEA A;  4B3R I;  4LPF A;  2PO1 B;  5IT9 C;  4DV0 E;  2PO0 B;  4X62 E;  4LF7 I;  4GKJ E;  3LPS A;  1Z0G A;  2HHH E;  1FJG E;  1PVG A;  2PO2 A;  3P3E A;  4X64 E;  4LFA E;  2A2D A;  2HFS A;  4OO1 F;  2UU9 I;  2BA1 G;  2R3V A;  2XEX A;  4AID A;  3PS3 A;  1IBM I;  3LNU A;  1Z59 A;  4MU1 A;  4PRV A;  2F4V E;  1N32 I;  3Q1Q A;  1VIS A;  4MU3 A;  1H74 A;  2C39 A;  1DAR A;  4DV6 E;  3T1H I;  2UUA E;  4DV0 I;  4X62 I;  2ZM6 I;  4GKK I;  2VQF E;  1Z5C A;  3QT6 A;  4GKJ I;  1FJG I;  4IZK A;  2HHH I;  4B3S E;  4X64 I;  4LFA I;  4URL A;  4NXM I;  5EKW A;  4DR1 E;  4FW5 A;  5C0X E;  1R6L A;  5IWA E;  3J80 Q;  1XXE A;  2V8P A;  3CDI A;  4FW7 A;  1N0U A;  4DPX A;  1S4E A;  4LF6 E;  2WP8 A;  4DV6 I;  2PNZ B;  4PRX A;  4FWH A;  5C0X F;  1IBK E;  2VQF I;  4JYA E;  1Z0B A;  1FWL A;  2IOP A;  4B3S I;  2NPF A;  4DUY E;  2NN6 E;  4MU0 A;  4DV5 I;  4LFB I;  3B78 A;  2C37 A;  5GME A;  1A6F A;  4FW4 A;  2JEA B;  4DR1 I;  4DPW A;  1USV A;  5FLX Q;  4LF8 E;  4JI3 E;  5IWA I;  2V2Q A;  1H7U A;  1XMQ I;  2NN6 F;  1RHY A;  3J7A G;  2ZIT A;  1Y60 A;  2JE6 A;  3D4J A;  4OO1 B;  4LF5 I;  5LMU E;  2UUC E;  3K17 A;  4LF6 I;  5IT9 Q;  2WNR A;  2AE8 A;  3M7N D;  4JI8 E;  2UXD E;  1IBK I;  5BR8 E;  4JYA I;  1FNM A;  1HNX E;  2UXC E;  1QZR A;  1Z0W A;  3M85 G;  1N33 I;  1UDQ A;  5JEA A;  1KVK A;  4JI7 E;  4DV7 E;  3B4T A;  4GQU A;  1XMO E;  4JI3 I;  5DRP A;  1NHH A;  3QT5 A;  2LJP A;  2HK3 A;  4DXL A;  4FW9 A;  4K0K I;  2UUC I;  4OX9 E;  1Z5B A;  2CG9 A;  3PS2 A;  5C0X D;  3HKM A;  4JI8 I;  2UXD I;  3UHM A;  4NXN E;  2V2Z A;  3P3C A;  1HNX I;  2UXC I;  1HNZ I;  5L3J A;  4BA2 B;  2Z5C A;  1FKA E;  1PIE A;  4HXZ A;  4M1K A;  4Z7Y A;  4LCG A;  3ZKB A;  4JI1 E;  5GMD A;  4DV7 I;  4JI7 I;  4JI6 E;  2BA0 D;  5C0X B;  1XMO I;  5LMN I;  5K36 D;  4HAC B;  1HNW E;  5FLX C;  2JEB A;  2BR2 A;  4LCF A;  1RRE A;  1U2R A;  2R42 A;  4LF9 I;  1RR9 A;  2C37 B;  3KRN A;  4USK A;  5K36 C;  4YHH E;  1XHK A;  3GCM A;  3CDJ A;  4WUB A;  4LF4 I;  2BM0 A;  4N3O A;  5K36 B;  2NN6 B;  2JE6 B;  4DUZ E;  1Y5Y A;  5ELW A;  5JEA D;  4JI1 I;  1YHC A;  3V2U C;  2GO4 A;  3HJC A;  4JI5 E;  1HR0 E;  1FI4 A;  2ZBK B;  5JEA C;  4DV4 E;  4YHH I;  2X7I A;  4R1F A;  4IZJ D;  2O3Z A;  2OI2 A;  3L7Z A;  3QT7 A;  2E1R A;  3M6A A;  4MDT A;  4QNJ A;  1S16 A;  2IES A;  4DUZ I;  1KIJ A;  2E5L E;  4B3T E;  1P42 A;  1ZXN A;  3PYF A;  1Z0V A;  2O1U A;  4IZJ B;  3ZZ0 A;  4HYM A;  4DV1 E;  5DRR A;  1HR0 I;  1NZ0 A;  2F4V I;  4OKG A; 
#chains in the Genus database with same CATH homology
 1R6M A;  2JE6 A;  4OO1 B;  3U1K A;  2WNR A;  5JEA B;  2BA1 D;  3M7N D;  4IFD F;  5C0X C;  5K36 E;  4OO1 A;  2BR2 B;  2C38 B;  1OYS A;  4BA1 B;  3M85 G;  1UDO A;  1UDQ A;  5JEA A;  3B4T A;  2NN6 D;  1UDS A;  1OYR A;  3H1C A;  2PO2 B;  5K36 F;  2C38 A;  4AM3 A;  3GME A;  1E3P A;  4OO1 E;  2NN6 C;  2JEA A;  2PO1 B;  5C0X D;  3HKM A;  5JEA E;  4IFD D;  2PO0 B;  2PO2 A;  4BA2 B;  4IFD C;  4NBQ A;  2JEB B;  4OO1 F;  3M7N G;  2BA1 G;  2C39 B;  4AID A;  2PO1 A;  2PO0 A;  2BA0 D;  5JEA F;  5C0X B;  4IFD B;  5K36 D;  4BA2 A;  2JEB A;  2BR2 A;  2C39 A;  4BA1 A;  5K36 C;  2C37 B;  3KRN A;  5C0X A;  3GCM A;  3CDJ A;  5K36 B;  2NN6 B;  4OO1 D;  2JE6 B;  1UDN A;  1E3H A;  5JEA D;  2WP8 B;  4OO1 C;  5C0X E;  3L7Z B;  5K36 A;  1OYP A;  1R6L A;  2NN6 A;  3CDI A;  5JEA C;  3DD6 A;  2BA0 G;  2WP8 A;  3GLL A;  2PNZ B;  4AIM A;  3L7Z A;  3M85 D;  4IFD A;  5C0X F;  2NN6 E;  2C37 A;  2JEA B;  2PNZ A;  2WNR B;  4IFD E;  2NN6 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...