4DR3E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3E02
4DR3I 2Q2EB 3QT8A 5IWAI 4DV4I 1WHNA 4I3HA 1H74A 4LFAI 4K0KI 2VQFI 3QT7A 2UUCI 3J81C 2UU9E 2HK3A 4LF5E 3T1YE 3F0NA 4JI3E 4X65I 2L3CA 3D4JA 3LPSA 1DI2A 3ZZTA 4EMDA 1RREA 3ZKBA 1XNQI 4B3MI 3PYDA 5LMNI 5IT9C 2DMYA 4DV7I 4DKKA 4LF9I 2NUGA 4DR4I 4M2ZA 4DUZI 2N3HA 2YT4A 3C4TA 2NUFA 2LBSB 2JVAA 1X49A 1N33E 4ED4A 3LTOA 1XNRE 1XMQE 4MYTA 2UXBI 4B3TI 1N32E 2EZ6A 4LF6E 4DV3E 4B3RE 2HFSA 1Z0GA 1YYKA 1Z5AA 2AJ4A 4NXME 1N0UA 2DEIA 4HACA 1IBKE 1VISA 1T4OA 4GKJI 1HNWE 2UUAE 4PRXA 4UTGA 4URLA 1GQEA 4DR1I 4LF7E 3VYYA 2BM0A 1S4EA 4JYAI 1Z5CA 2A2DA 3J7AM 1YZ9A 1N36I 2UXCE 4DV0E 1HNZI 2X7IA 4DR7E 1FJGI 4MYUA 4JI1I 4YHHI 1RC7A 1IBKI 2L2KB 4USKA 5L3JA 1FKAE 3PYFA 1ZXMA 4M30A 3P1XA 3OTOE 1I94E 4LFBE 3WU5A 1OJ4A 4DU8A 2ZM6E 4HACB 1FJGE 4DR7I 4FWGA 4DR2I 3M6AA 1HR0I 2RSMA 1N34E 1Z5BA 1N0VC 2A2CA 5LMNE 5IT9Q 1RQ0A 2DEJA 1HR0E 1PIEA 4LF8I 4JV5E 4DR1E 2V8PA 1J5EE 1ZM3A 1X48A 1ZXNA 3ADIA 4DV1E 1WUUA 1MU5A 2UXDI 4WYQB 2L3JA 4P52A 2UUCE 4DUYE 4HYMA 1EI1A 2UXBE 5LL6R 2RTXA 1N33I 4DV2I 3CWVA 4X62E 5LMUE 4FWHA 4DUZE 3PYGA 4USMA 4M1KA 4WUDA 3ADLA 3K17A 2ZITA 4JI5I 1FNMA 4B3SE 1QZRA 1UILA 2B7TA 1IBLE 4X62I 4ZVIA 1IBMI 2LJPA 3OTOI 1I94I 2NPFA 3J80C 1T4LB 1B63A 4LF5I 2UXDE 1KKHA 3GONA 4LF6I 4LF4I 3B82A 4DV1I 2HHHE 1ZBTA 2LUPB 4X8WA 4YHHE 1IBME 4AQYI 5CFFE 2V34A 2V2QA 4DV4E 5A2QC 1B62A 2IHR1 4Z7CA 1QU6A 4DPYA 2RS7A 4JI7I 4HXZA 2HKEA 1Z59A 4X64I 1EA6A 1FWKA 3JAMQ 4OX9I 4DR2E 1K47A 2ZM6I 1X47A 4WUCA 4DPWA 3ADJA 2V2ZA 2LTRA 2HHHI 4DR5I 1PVGA 4DUYI 5FLXC 4DXLA 4DV6I 3WU6A 1Z0CA 5A2QQ 4KHPI 4KHPE 1WHQA 1YYOA 4DPUA 1STUA 4DV6E 2DB2A 5BR8E 3QT6A 2BV3A 1XNRI 4LFAE 4K0KE 4WFTA 1UHZA 1KIJA 4WUBA 2J7KA 1NHIA 4X64E 1A6FA 3ZZ0A 1FWLA 4PU9A 1N36E 1Z0WA 3ZM7A 1Z0VA 3LLHA 4DV7E 4JG4A 1Z0TA 1XMOI 4JYAE 1XNQE 4R1FA 5LMUI 4DV2E 4DV5I 2JY9A 1HNWI 1PKPA 1KTVA 4LF4E 3K1JA 3T1HE 3JAMC 2VQEE 4JI2I 2CPNA 4B3TE 4YY3E 1H7UA 1HNXI 4DR6I 3WU3A 1Z0BA 2VF3A 1IBLI 2EFGA 4LF8E 4DV0I 2DIXA 3B78A 2B7VA 1YYWA 4LF9E 4JI5E 4LFCE 2V2VA 3PYEA 4LF7I 2LRSA 1EKZA 2B3TB 2R3VA 4GKJE 4KQVA 4LFBI 4JI0I 2NUEA 1H7SA 4JI4I 2HFUA 2LTSA 1MX0A 3V5RA 2UU9I 4JI6I 4DV3I 4B3RI 3HULA 5FLXQ 1T4NA 1XHKA 2R42A 2OI2A 4LFCI 4JI1E 5GMEA 2MDRA 1J5EI 1HNZE 4RPFA 4JV5I 3B8HA 1H73A 2L2NA 2L33A 1ZM9A 2UXCI 2N3GA 2BM1A 2HKJA 4JI8E 2RS6A 4B3ME 1H72C 3HTXA 1N34I 4JI2E 2E5LI 3Q1QA 4JI4E 4JI0E 4NXNE 2UUAI 4GKKE 1NZ0A 1MG7A 2KHXA 4NXNI 2LUQA 1NHHA 1UEKA 2X36A 1D6TA 1N32I 4HY1A 2L2MA 4DU7A 3ZZUA 1BKNA 2F4VI 5IWAE 1S16A 3J7Yp 2F4VE 2CZ9A 4DR4E 3C4BA 1ZM4A 5BR8I 3ZKDA 4YY3I 3V2UC 2VQEI 3WU4A 3LNUA 3T1HI 1RR9A 4UT4A 3J80Q 2UUBI 4DR5E 1ELOA 4GKKI 1J26A 2ZBKB 4NXMI 3T1YI 4OX9E 3VYXA 2E5LE 1FI4A 1U2RA 4JI8I 4FW9A 1XMQI 4FWDA 3H4LA 3ADGA 4DR3E 3J81Q 1NHJA 1Z0EA 4AQYE 1HNXE 4DR6E 2LJHA 2E1RA 1O0WA 4JI6E 2NA2A 2GS8A 4X66E 1ZM2A 2UUBE 4X65E 1KVKA 4JI3I 4DPTA 4DV5E 4DPXA 4X66I 4OOGC 5GMDA 3J7AG 4P7AA 1DARA 4B3SI 1XMOE 3QT5A 2VQFE 2HK2A 4JI7E 2WW4A 4XTJA 2XEXA 4Z7YA 4PRVA 4FN5A
chains in the Genus database with same CATH superfamily
4DR3I 2Q2EB 4BA2B 3QT8A 1QNTA 2M1SA 2BA0G 3HPZA 5IWAI 4DV4I 1WHNA 4I3HA 1A1LA 1H74A 4LFAI 4K0KI 2C38A 5KL3A 2EM5A 4J8ZA 2ADRA 2VQFI 1IQSA 1VI7A 5DRPA 2EPPA 4O43A 3QT7A 3AUZA 2PNZB 2YRKA 4BBYA 2JEBA 2YTEA 2UUCI 2EOMA 3J81C 2UU9E 2HK3A 4LF5E 2EPUA 4BHCA 2EPCA 3DD6A 3L7ZB 5K36E 3T1YE 3F0NA 1Y4UA 4JI3E 4R2RA 4X65I 2C38B 2L3CA 2EPXA 3D4JA 3LPSA 2JXPA 1DI2A 2EQ3A 2EOHA 2PNZA 3ZZTA 2O1WA 4LOMA 4EMDA 1PJSA 4J3DA 1PDAA 4IS9A 2V88A 3M7NG 1RMDA 4QNKA 5A69A 4R8OA 1RREA 1A1GA 3ZKBA 5JEAC 4TUIA 1XNQI 4B3MI 1EH8A 3PYDA 5LMNI 5IT9C 2DMYA 2BA1G 4GEQB 2V8QB 4DV7I 5KL6A 1R6MA 4DKKA 4LF9I 5DRQA 2NUGA 4DR4I 4M2ZA 1USUA 4R2CA 1R6LA 4DUZI 2N3HA 2YT4A 3C4TA 2NUFA 2LBSB 2JVAA 1YH8A 1LLMC 2EMYA 2Z5CA 3CDJA 1X49A 1N33E 1X6EA 4ED4A 4X9JA 3LTOA 2VRDA 2YTJA 1XNRE 2K7IA 2L8TA 1XMQE 4MYTA 2UXBI 1YUIA 4B3TI 1N32E 2EZ6A 2WP8B 4LF6E 3M7ND 4IFDC 1Z1BA 2LMZA 2JWOA 4DV3E 1YUJA 4B3RE 5T6JA 1Z0GA 1YYKA 1Z5AA 2AJ4A 2HFSA 2Z5BA 5K36C 4LTYA 5C0XC 4NXME 1N0UA 5JEAA 2DEIA 4I8OA 2PO1B 2BB8A 4HACA 1IBKE 1VISA 1T4OA 4GKJI 4P78A 3EQ1A 1GTKA 1HNWE 2UUAE 4PRXA 2EOZA 2F8BA 2LT7A 4UTGA 4URLA 2JEAB 1GQEA 4DR1I 4LF7E 5DROA 3VYYA 2BM0A 4R2QA 2WNRB 1E3PA 4MDTA 2YU5A 4F6MA 4L8NA 2RPCA 1S4EA 4JYAI 2EQ1A 3KZZA 1Z5CA 2EMHA 2A2DA 1BB8A 3J7AM 2EMFA 3THOB 2BR2B 2O3ZA 2EMIA 3KWRA 1YZ9A 4MU1A 1N36I 2UXCE 4R2PA 3UHMA 4DV0E 1G2FC 2YRMA 2PO2A 2IERA 1BBOA 1HNZI 2X7IA 4DR7E 2WP8A 2EPZA 1FJGI 4MYUA 4JI1I 2PO0B 4YHHI 1ZR9A 3ZOQB 1RC7A 1IBKI 1UDNA 2L2KB 2GHFA 2Z5CB 4USKA 5L3JA 1FKAE 2BBGA 3PYFA 3UK3C 2WBUA 1ZXMA 4RHBB 2C39A 1SFEA 4M30A 2EL6A 3L00A 2EPMX 3P1XA 4IFDE 3OTOE 1I94E 2Z5BB 4LFBE 4LPFA 2JYAA 3WU5A 4ZYGA 2EOQA 1OJ4A 4DU8A 3PRYA 4P7DA 2ZM6E 2EM9A 2HJJA 1FJGE 3C6MA 4HACB 4IZKA 4DR7I 2EOJA 4FWGA 4DR2I 2YU8A 5TSEA 1PJTA 3M6AA 5JEAB 5C0XE 1YSAC 1HR0I 2RSMA 1N34E 1Z5BA 4IZJB 5DNYA 1N0VC 2LE2A 2YWQA 2M4IA 3EPJA 5AC4A 4Q35B 3VHTB 3BF2A 2GO3A 2A2CA 5LMNE 2EOEA 2M7QA 2GLIA 2CVEA 5IT9Q 1RQ0A 2DEJA 2EL5A 1HR0E 1PIEA 4IZKB 4LF8I 2EN4A 2EN8A 4DR1E 2EM2A 4JV5E 2V8PA 2RQLA 1J5EE 2V87A 1ZM3A 2VESA 1X48A 1N3GA 4N4RB 2MC6A 1ZXNA 4OO1D 3ADIA 4DV1E 5A6KA 1WUUA 4OO1C 4IJDA 1SR9A 5K36B 5C0XB 1MU5A 2EN2A 2UXDI 1X6FA 4WYQB 2L3JA 4P52A 1X6HA 2UUCE 2NN6F 3F6GA 4WSPA 4DUYE 4HYMA 4BS9A 4AIDA 1EI1A 5AASA 1Y4SA 2UXBE 5LL6R 1IMUA 2JOBA 2JEBB 2YPNA 3IWCA 4LCHA 2RTXA 2FGGA 5DRRA 4IZJA 4WSGA 2LVHA 4U3DA 1N33I 2EE8A 1RHYA 3CWVA 5C0XA 1NEIA 4DV2I 4X62E 5LMUE 4FWHA 3K6QA 1DQ3A 4DUZE 4GQUA 3PYGA 2JOXA 4USMA 4FW5A 2MC5A 2EN6A 4M1KA 4WUDA 3ADLA 2VF1A 3P76A 2CT1A 3K17A 1OYPA 2ZITA 4JI5I 1FNMA 4B3SE 1X5WA 1QZRA 1UILA 2B7TA 4FW7A 2GQ0A 5IV8B 1IBLE 4X62I 2EM7A 2EOOA 4OKGA 4ZYEA 3EPLA 2EP3A 1PJQA 4ZVIA 4ZYHA 5ELWA 1IBMI 2IOQA 4KZSA 3TQMA 2LJPA 2EN3A 2V85A 3P3GA 3OTOI 1I94I 4Q28A 2JPAA 3HPSA 2NPFA 1Y5YA 3J80C 1T4LB 5KL5A 2EM0A 1B63A 3B4TA 4IFDA 4LF5I 2UXDE 1KKHA 2AE8A 2CGEA 3MSWA 3GONA 4WX9A 2I9IA 4LF6I 2DGCA 3K85A 3B82A 4LF4I 4HEIA 2L6MA 2HHHE 1TF6A 1ZBTA 2JR1A 2LUPB 2M9AA 4X8WA 4DV1I 4YHHE 3M85G 1IBME 4MLVA 2EPKX 5CFFE 1F2IG 2V34A 2V2QA 4AQYI 4DV4E 5A2QC 2EM4A 1A1JA 1B62A 2CSHA 2IHR1 4Z7CA 1QU6A 4ISAA 2FTXB 2L92A 3JTZA 2RS7A 4DPYA 4LCGA 4JI7I 2GPIA 4HXZA 2HKEA 4KWYA 2NN6A 2PNMA 3DJWA 4FK5C 2PO0A 2V89A 3IWBA 5IXMB 5JEAE 3QG5C 2EJ4A 2YTIA 1Z59A 3HKMA 4BA1B 4X64I 2E72A 3H09A 2YTOA 1EA6A 5C0XD 3HQ1A 1FWKA 3JAMQ 4DR2E 4OX9I 3U1YA 1K47A 2ZM6I 1X47A 4IS1C 4WUCA 4DPWA 3ADJA 2EPAA 2V2ZA 2LTRA 2HHHI 4DR5I 1PVGA 4O5GA 4DUYI 5FLXC 5KL7A 4DXLA 5JEAF 4DV6I 3WU6A 1Z0CA 5A2QQ 4GZNC 5FWKA 4KHPI 2F1DA 4KHPE 1WHQA 2FV4B 2WZOA 5KL4A 1YYOA 4DPUA 3GCMA 1STUA 5AE3A 4DV6E 2O1UA 2DB2A 4MLQA 2ENCA 4OO1A 5BR8E 2DMIA 2Q8UA 1YFHA 2JE6A 3H1CA 2BV3A 3QT6A 2EN7A 2BA0D 4LFAE 4K0KE 1XNRI 4WFTA 1UHZA 1KIJA 4WUBA 4NHRA 2PO1A 2C39B 2J7KA 1NHIA 4AIMA 4X64E 2EMGA 1A6FA 3ZZ0A 2JEAA 3BIDA 1FWLA 4PU9A 4R2DA 1N36E 1Z0WA 4IFDF 4MU4A 3ZM7A 1T38A 1Z0VA 4U3BA 2KONA 3LLHA 1P47A 4DV7E 5K36F 4ZYDA 2EMAA 4JG4A 1Z0TA 1XMOI 2LV2A 4JYAE 2BR2A 3OMLA 1XNQE 1WJPA 4R1FA 3NZKA 3DF6A 1A1KA 5LMUI 2EMCA 2ELZA 4DV2E 3C6KA 4DV5I 3MHSC 2WBSA 2JY9A 5KL2A 3VK6A 1HNWI 2O1VA 1PKPA 2DLQA 5F3WA 2CTDA 1ZAAC 2EPRA 1A1HA 1KTVA 4LF4E 4BC7A 3F6HA 3K1JA 3T1HE 3KRNA 3CDIA 2EPNA 3JAMC 2VQEE 4JI2I 2EN1A 2PRTA 1OYRA 2CPNA 4B3TE 4YY3E 2E1MA 2G7HA 4R03A 1H7UA 4AM3A 2WBTA 1HNXI 4DR6I 2YTQA 3WU3A 4QNJA 4LCFA 1Z0BA 4M9VC 5K36D 2VF3A 1IBLI 2EFGA 4LF8E 4DV0I 4IFDD 2DIXA 4M0VA 2B7VA 2K4VA 3FIGA 2NN6E 2BA1D 3B78A 1YYWA 4LF9E 4JI5E 3BBGA 1NCSA 4LFCE 1OYSA 5DNXA 4R2AA 4MQYA 2V2VA 3MHHC 3GMEA 2N8XA 3P06A 3M85D 2J7JA 3PYEA 5EL9A 4WPYA 1YPNA 4LF7I 2LRSA 3KZYA 1JK2A 1EKZA 2YTGA 2B3TB 4O24A 2R3VA 4GKJE 4KQVA 2EMWA 3EPHA 1L4SA 1USVA 4LFBI 1MGTA 5JEAD 3PS1A 1KJKA 4N3OA 4JI0I 3BGHA 2NUEA 1H7SA 1UDSA 2Z5EA 4JI4I 5ADZA 1ZU1A 2LTSA 1MX0A 2HFUA 3Q6NA 3GLLA 2MKNA 3V5RA 4DV3I 2UU9I 3HULA 5FLXQ 4JI6I 1WXRA 2EORA 4B3RI 4BCAA 4NZVA 1T4NA 1XHKA 4OO1E 3IWDA 2R42A 2OI2A 2D9HA 4LFCI 5C0XF 3Q6MA 4JI1E 2JT2A 4F9BB 5GMEA 1KYQA 1TN9A 2MDRA 4NBQA 1J5EI 1HNZE 4RPFA 2EM3A 2EMZA 4JV5I 2VE7C 4R2EA 1DGCA 3B8HA 1H73A 2L2NA 2ELYA 2L33A 2LJUA 1UDQA 2PO2B 2EM8A 3L7ZA 4LU9A 1ZM9A 3HJCA 2UXCI 2N3GA 2BM1A 4F6NA 2HKJA 4JI8E 2RS6A 4B3ME 1H72C 2NN6C 3HTXA 4BMJA 2JP9A 1N34I 4F9CB 4JI2E 2DSYA 2C37A 2E5LI 2CG9A 3Q1QA 4JI4E 4JI0E 2R76A 2JE6B 2HGHA 4OZEA 4NXNE 4FW3A 2UUAI 4GKKE 1NZ0A 1MG7A 2KHXA 3M99B 1UBDC 2LCEA 2R1FA 2V86A 4NXNI 2YZTA 2LUQA 3EPKA 2EWLA 1B69A 1EH7A 1UDOA 3JU0A 2H36X 1AH5A 2B9DA 1NHHA 1UEKA 2IOPA 2X36A 1D6TA 1N32I 1UN6B 2V83A 4HY1A 2L2MA 2EOSA 4BC9A 5AC5A 2EOIA 3RMPA 2EOYA 1G2DC 1BKNA 3P3CA 3ZZUA 2F4VI 5IWAE 2ODRC 4F54A 4O4KA 1S16A 2HC5A 3J7Yp 2EOXA 2YTFA 2F4VE 2CZ9A 1ZBQA 4DR4E 1JK1A 5EKWA 5AE1A 4MU0A 3C4BA 1ZM4A 5DNLA 5BR8I 1A1FA 3ZKDA 1E3HA 4YY3I 5A6BA 2YTPA 3AV0A 3V2UC 4R2SA 3THNA 2VQEI 3WU4A 1TF3A 3LNUA 1T39A 2YTDA 3T1HI 5AE2A 1RR9A 5A6JA 2NN6D 4UT4A 2LO3A 2C37B 3J80Q 4RH8A 2GO4A 2UUBI 4DR5E 3HXLA 2EPLX 1ELOA 2YSOA 2YSPA 2YTNA 1J26A 2ZBKB 4GKKI 4DU7A 4NXMI 2I13A 3T1YI 4OX9E 2MDGA 4F2JC 1P42A 3VYXA 2E5LE 1FI4A 2ENAA 4OO1F 4L5NC 1U2RA 2J65A 4JI8I 2DRPA 4BA1A 4FW9A 2EM6A 4BHBA 1XMQI 4FWDA 3H4LA 1AAYA 4F9AB 4BA2A 4HTGA 2EPOA 3ADGA 2EMKA 3PS3A 1Y60A 4DR3E 3J81Q 2IESA 2KOUA 1NHJA 1Z0EA 5K36A 2EL4A 2YRHA 4AQYE 2DLKA 2RSIA 2MKDA 4WXDA 1HNXE 4DR6E 3LMLA 2LJHA 2E1RA 2NN6B 1BBGA 1MEYC 3P3EA 3PS2A 2ENHA 1EH6A 2EOFA 1O0WA 4OO1B 4JI6E 2NA2A 2GS8A 4IFDB 2ODRD 3ECRA 5A6AA 4X66E 2PNLA 1ZM2A 1Y6ZA 1X3CA 2EMXA 2NABA 4FW4A 2A25A 1WRJA 2UUBE 4X65E 1KVKA 4JI3I 1A1IA 4DPTA 4DV5E 4TUGA 4DPXA 2EMLA 4X66I 2WNRA 4OOGC 2O1TA 5LLQA 3J7AG 5GMDA 4FW6A 2EMBA 2EQ0A 4IZJD 5A6BD 1IQOA 1DARA 4P7AA 4B3SI 1GZ6A 1XMOE 1XXEA 1HK7A 3QT5A 3U1KA 2VQFE 4WXCA 2HK2A 4JI7E 4DMIA 2WW4A 4MU3A 4XTJA 2XEXA 4Z7YA 4PRVA 2WCC3 1YHCA 4FN5A
chains in the Genus database with same CATH topology
4DR3I 2Q2EB 3QT8A 5IWAI 2M1SA 4DV4I 3HPZA 1WHNA 4I3HA 1H74A 4LFAI 4K0KI 4J8ZA 2VQFI 3QT7A 3AUZA 4BBYA 2UUCI 3J81C 2UU9E 2HK3A 4LF5E 3T1YE 3F0NA 1Y4UA 4JI3E 4X65I 2L3CA 3D4JA 3LPSA 1DI2A 3ZZTA 4EMDA 2O1WA 2V88A 1RREA 4R8OA 3ZKBA 4TUIA 1XNQI 4B3MI 3PYDA 5LMNI 5IT9C 2DMYA 4GEQB 2V8QB 4DV7I 4DKKA 4LF9I 2NUGA 4DR4I 4M2ZA 1USUA 4DUZI 2N3HA 2YT4A 3C4TA 2NUFA 2LBSB 2JVAA 2Z5CA 1X49A 1N33E 4ED4A 3LTOA 1XNRE 2L8TA 1XMQE 4MYTA 2UXBI 4B3TI 1N32E 2EZ6A 4LF6E 2LMZA 2JWOA 4DV3E 4B3RE 2HFSA 5T6JA 1Z0GA 1YYKA 1Z5AA 2AJ4A 2Z5BA 4LTYA 4NXME 1N0UA 2DEIA 4I8OA 4HACA 1IBKE 1VISA 1T4OA 4GKJI 4P78A 1HNWE 2UUAE 4PRXA 2F8BA 4UTGA 4URLA 1GQEA 4DR1I 4LF7E 3VYYA 2BM0A 4L8NA 1S4EA 4JYAI 1Z5CA 2A2DA 3J7AM 3KWRA 1YZ9A 1N36I 2UXCE 4DV0E 1HNZI 2X7IA 4DR7E 1FJGI 4MYUA 4JI1I 4YHHI 3ZOQB 1RC7A 1IBKI 2L2KB 2Z5CB 4USKA 5L3JA 1FKAE 3PYFA 1ZXMA 4M30A 3P1XA 3OTOE 1I94E 2Z5BB 4LFBE 3WU5A 1OJ4A 4DU8A 3PRYA 4P7DA 2ZM6E 1FJGE 4HACB 4DR7I 4IZKA 4FWGA 4DR2I 3M6AA 1HR0I 2RSMA 1N34E 1Z5BA 4IZJB 5DNYA 1N0VC 2LE2A 2M4IA 2A2CA 5LMNE 2M7QA 5IT9Q 1RQ0A 2DEJA 1HR0E 1PIEA 4IZKB 4LF8I 4JV5E 4DR1E 2V8PA 1J5EE 2V87A 1ZM3A 1X48A 2MC6A 1ZXNA 3ADIA 4DV1E 1WUUA 1SR9A 1MU5A 2UXDI 4WYQB 2L3JA 4P52A 2UUCE 3F6GA 4WSPA 4DUYE 4HYMA 4BS9A 1EI1A 5AASA 1Y4SA 2UXBE 5LL6R 2JOBA 3IWCA 2RTXA 2FGGA 4IZJA 1N33I 4DV2I 3CWVA 4X62E 5LMUE 4FWHA 3K6QA 1DQ3A 4DUZE 3PYGA 2JOXA 4USMA 2MC5A 4M1KA 4WUDA 3ADLA 2VF1A 3K17A 2ZITA 4JI5I 1FNMA 4B3SE 1QZRA 1UILA 2B7TA 2GQ0A 1IBLE 4X62I 4ZVIA 1IBMI 2IOQA 4KZSA 2LJPA 2V85A 3OTOI 1I94I 4Q28A 3HPSA 2NPFA 3J80C 1T4LB 1B63A 4LF5I 2UXDE 1KKHA 2CGEA 3MSWA 3GONA 4LF6I 4LF4I 3K85A 3B82A 4DV1I 2L6MA 2HHHE 1ZBTA 2JR1A 2LUPB 4X8WA 4YHHE 1IBME 4AQYI 5CFFE 2V34A 2V2QA 4DV4E 5A2QC 1B62A 2IHR1 4Z7CA 1QU6A 2FTXB 2L92A 3JTZA 2RS7A 4DPYA 4JI7I 4HXZA 2HKEA 2PNMA 3DJWA 2V89A 3IWBA 1Z59A 4X64I 3H09A 1EA6A 3HQ1A 1FWKA 3JAMQ 4DR2E 4OX9I 1K47A 2ZM6I 1X47A 4WUCA 4DPWA 3ADJA 2V2ZA 2LTRA 2HHHI 4DR5I 1PVGA 4DUYI 5FLXC 4DXLA 4DV6I 3WU6A 1Z0CA 5A2QQ 5FWKA 4KHPI 4KHPE 1WHQA 2FV4B 2WZOA 1YYOA 4DPUA 1STUA 5AE3A 4DV6E 2O1UA 2DB2A 5BR8E 3QT6A 2BV3A 1XNRI 4LFAE 4K0KE 4WFTA 1UHZA 1KIJA 4WUBA 2J7KA 1NHIA 4X64E 1A6FA 3ZZ0A 1FWLA 4PU9A 1N36E 1Z0WA 3ZM7A 1Z0VA 2KONA 3LLHA 4DV7E 4JG4A 1Z0TA 1XMOI 4JYAE 3OMLA 1XNQE 4R1FA 3DF6A 5LMUI 4DV2E 4DV5I 2JY9A 3VK6A 1HNWI 2O1VA 1PKPA 5F3WA 1KTVA 4LF4E 4BC7A 3F6HA 3K1JA 3T1HE 3JAMC 2VQEE 4JI2I 2CPNA 4B3TE 4YY3E 1H7UA 2E1MA 2G7HA 4R03A 1HNXI 4DR6I 3WU3A 1Z0BA 2VF3A 1IBLI 2EFGA 4LF8E 4DV0I 2DIXA 4M0VA 2B7VA 2K4VA 3FIGA 3B78A 1YYWA 4LF9E 4JI5E 4LFCE 2V2VA 3P06A 3PYEA 4WPYA 4LF7I 2LRSA 1EKZA 2B3TB 2R3VA 4GKJE 4KQVA 4LFBI 1USVA 4N3OA 4JI0I 2NUEA 1H7SA 2Z5EA 4JI4I 5ADZA 2HFUA 2LTSA 1MX0A 3Q6NA 3V5RA 2UU9I 4JI6I 4DV3I 4B3RI 3HULA 5FLXQ 1WXRA 4BCAA 1T4NA 1XHKA 3IWDA 2R42A 2OI2A 4LFCI 3Q6MA 4JI1E 4F9BB 5GMEA 2MDRA 1J5EI 1HNZE 4RPFA 4JV5I 2VE7C 3B8HA 1H73A 2L2NA 2L33A 4LU9A 1ZM9A 3HJCA 2UXCI 2N3GA 2BM1A 2HKJA 4JI8E 2RS6A 4B3ME 1H72C 3HTXA 4BMJA 1N34I 4JI2E 4F9CB 2DSYA 2E5LI 3Q1QA 2CG9A 4JI4E 4JI0E 4NXNE 2UUAI 4GKKE 1NZ0A 1MG7A 2KHXA 2V86A 4NXNI 2YZTA 2LUQA 2EWLA 3JU0A 2H36X 2B9DA 1NHHA 1UEKA 2IOPA 2X36A 1D6TA 1N32I 2V83A 4HY1A 2L2MA 4DU7A 4BC9A 3RMPA 3ZZUA 1BKNA 2F4VI 5IWAE 2ODRC 4F54A 1S16A 3J7Yp 2F4VE 2CZ9A 1ZBQA 4DR4E 5AE1A 3C4BA 1ZM4A 5BR8I 3ZKDA 4YY3I 3AV0A 3V2UC 2VQEI 3WU4A 3LNUA 3T1HI 5AE2A 1RR9A 4UT4A 3J80Q 2UUBI 4DR5E 3HXLA 1ELOA 4GKKI 1J26A 2ZBKB 4NXMI 3T1YI 4OX9E 3VYXA 2E5LE 1FI4A 4L5NC 1U2RA 4JI8I 4FW9A 1XMQI 4FWDA 3H4LA 4F9AB 3ADGA 4DR3E 3J81Q 2KOUA 1NHJA 1Z0EA 4AQYE 1HNXE 4DR6E 3LMLA 2LJHA 2E1RA 1O0WA 4JI6E 2NA2A 2GS8A 2ODRD 4X66E 2PNLA 1ZM2A 1Y6ZA 2UUBE 4X65E 1KVKA 4JI3I 4DPTA 4DV5E 4TUGA 4DPXA 4X66I 4OOGC 2O1TA 5GMDA 3J7AG 4IZJD 4P7AA 1DARA 4B3SI 1GZ6A 1XMOE 1HK7A 3QT5A 2VQFE 2HK2A 4JI7E 4DMIA 2WW4A 4XTJA 2XEXA 4Z7YA 4PRVA 4FN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 I;  2Q2E B;  3QT8 A;  5IWA I;  4DV4 I;  1WHN A;  4I3H A;  1H74 A;  4LFA I;  4K0K I;  2VQF I;  3QT7 A;  2UUC I;  3J81 C;  2UU9 E;  2HK3 A;  4LF5 E;  3T1Y E;  3F0N A;  4JI3 E;  4X65 I;  2L3C A;  3D4J A;  3LPS A;  1DI2 A;  3ZZT A;  4EMD A;  1RRE A;  3ZKB A;  1XNQ I;  4B3M I;  3PYD A;  5LMN I;  5IT9 C;  2DMY A;  4DV7 I;  4DKK A;  4LF9 I;  2NUG A;  4DR4 I;  4M2Z A;  4DUZ I;  2N3H A;  2YT4 A;  3C4T A;  2NUF A;  2LBS B;  2JVA A;  1X49 A;  1N33 E;  4ED4 A;  3LTO A;  1XNR E;  1XMQ E;  4MYT A;  2UXB I;  4B3T I;  1N32 E;  2EZ6 A;  4LF6 E;  4DV3 E;  4B3R E;  2HFS A;  1Z0G A;  1YYK A;  1Z5A A;  2AJ4 A;  4NXM E;  1N0U A;  2DEI A;  4HAC A;  1IBK E;  1VIS A;  1T4O A;  4GKJ I;  1HNW E;  2UUA E;  4PRX A;  4UTG A;  4URL A;  1GQE A;  4DR1 I;  4LF7 E;  3VYY A;  2BM0 A;  1S4E A;  4JYA I;  1Z5C A;  2A2D A;  3J7A M;  1YZ9 A;  1N36 I;  2UXC E;  4DV0 E;  1HNZ I;  2X7I A;  4DR7 E;  1FJG I;  4MYU A;  4JI1 I;  4YHH I;  1RC7 A;  1IBK I;  2L2K B;  4USK A;  5L3J A;  1FKA E;  3PYF A;  1ZXM A;  4M30 A;  3P1X A;  3OTO E;  1I94 E;  4LFB E;  3WU5 A;  1OJ4 A;  4DU8 A;  2ZM6 E;  4HAC B;  1FJG E;  4DR7 I;  4FWG A;  4DR2 I;  3M6A A;  1HR0 I;  2RSM A;  1N34 E;  1Z5B A;  1N0V C;  2A2C A;  5LMN E;  5IT9 Q;  1RQ0 A;  2DEJ A;  1HR0 E;  1PIE A;  4LF8 I;  4JV5 E;  4DR1 E;  2V8P A;  1J5E E;  1ZM3 A;  1X48 A;  1ZXN A;  3ADI A;  4DV1 E;  1WUU A;  1MU5 A;  2UXD I;  4WYQ B;  2L3J A;  4P52 A;  2UUC E;  4DUY E;  4HYM A;  1EI1 A;  2UXB E;  5LL6 R;  2RTX A;  1N33 I;  4DV2 I;  3CWV A;  4X62 E;  5LMU E;  4FWH A;  4DUZ E;  3PYG A;  4USM A;  4M1K A;  4WUD A;  3ADL A;  3K17 A;  2ZIT A;  4JI5 I;  1FNM A;  4B3S E;  1QZR A;  1UIL A;  2B7T A;  1IBL E;  4X62 I;  4ZVI A;  1IBM I;  2LJP A;  3OTO I;  1I94 I;  2NPF A;  3J80 C;  1T4L B;  1B63 A;  4LF5 I;  2UXD E;  1KKH A;  3GON A;  4LF6 I;  4LF4 I;  3B82 A;  4DV1 I;  2HHH E;  1ZBT A;  2LUP B;  4X8W A;  4YHH E;  1IBM E;  4AQY I;  5CFF E;  2V34 A;  2V2Q A;  4DV4 E;  5A2Q C;  1B62 A;  2IHR 1;  4Z7C A;  1QU6 A;  4DPY A;  2RS7 A;  4JI7 I;  4HXZ A;  2HKE A;  1Z59 A;  4X64 I;  1EA6 A;  1FWK A;  3JAM Q;  4OX9 I;  4DR2 E;  1K47 A;  2ZM6 I;  1X47 A;  4WUC A;  4DPW A;  3ADJ A;  2V2Z A;  2LTR A;  2HHH I;  4DR5 I;  1PVG A;  4DUY I;  5FLX C;  4DXL A;  4DV6 I;  3WU6 A;  1Z0C A;  5A2Q Q;  4KHP I;  4KHP E;  1WHQ A;  1YYO A;  4DPU A;  1STU A;  4DV6 E;  2DB2 A;  5BR8 E;  3QT6 A;  2BV3 A;  1XNR I;  4LFA E;  4K0K E;  4WFT A;  1UHZ A;  1KIJ A;  4WUB A;  2J7K A;  1NHI A;  4X64 E;  1A6F A;  3ZZ0 A;  1FWL A;  4PU9 A;  1N36 E;  1Z0W A;  3ZM7 A;  1Z0V A;  3LLH A;  4DV7 E;  4JG4 A;  1Z0T A;  1XMO I;  4JYA E;  1XNQ E;  4R1F A;  5LMU I;  4DV2 E;  4DV5 I;  2JY9 A;  1HNW I;  1PKP A;  1KTV A;  4LF4 E;  3K1J A;  3T1H E;  3JAM C;  2VQE E;  4JI2 I;  2CPN A;  4B3T E;  4YY3 E;  1H7U A;  1HNX I;  4DR6 I;  3WU3 A;  1Z0B A;  2VF3 A;  1IBL I;  2EFG A;  4LF8 E;  4DV0 I;  2DIX A;  3B78 A;  2B7V A;  1YYW A;  4LF9 E;  4JI5 E;  4LFC E;  2V2V A;  3PYE A;  4LF7 I;  2LRS A;  1EKZ A;  2B3T B;  2R3V A;  4GKJ E;  4KQV A;  4LFB I;  4JI0 I;  2NUE A;  1H7S A;  4JI4 I;  2HFU A;  2LTS A;  1MX0 A;  3V5R A;  2UU9 I;  4JI6 I;  4DV3 I;  4B3R I;  3HUL A;  5FLX Q;  1T4N A;  1XHK A;  2R42 A;  2OI2 A;  4LFC I;  4JI1 E;  5GME A;  2MDR A;  1J5E I;  1HNZ E;  4RPF A;  4JV5 I;  3B8H A;  1H73 A;  2L2N A;  2L33 A;  1ZM9 A;  2UXC I;  2N3G A;  2BM1 A;  2HKJ A;  4JI8 E;  2RS6 A;  4B3M E;  1H72 C;  3HTX A;  1N34 I;  4JI2 E;  2E5L I;  3Q1Q A;  4JI4 E;  4JI0 E;  4NXN E;  2UUA I;  4GKK E;  1NZ0 A;  1MG7 A;  2KHX A;  4NXN I;  2LUQ A;  1NHH A;  1UEK A;  2X36 A;  1D6T A;  1N32 I;  4HY1 A;  2L2M A;  4DU7 A;  3ZZU A;  1BKN A;  2F4V I;  5IWA E;  1S16 A;  3J7Y p;  2F4V E;  2CZ9 A;  4DR4 E;  3C4B A;  1ZM4 A;  5BR8 I;  3ZKD A;  4YY3 I;  3V2U C;  2VQE I;  3WU4 A;  3LNU A;  3T1H I;  1RR9 A;  4UT4 A;  3J80 Q;  2UUB I;  4DR5 E;  1ELO A;  4GKK I;  1J26 A;  2ZBK B;  4NXM I;  3T1Y I;  4OX9 E;  3VYX A;  2E5L E;  1FI4 A;  1U2R A;  4JI8 I;  4FW9 A;  1XMQ I;  4FWD A;  3H4L A;  3ADG A;  4DR3 E;  3J81 Q;  1NHJ A;  1Z0E A;  4AQY E;  1HNX E;  4DR6 E;  2LJH A;  2E1R A;  1O0W A;  4JI6 E;  2NA2 A;  2GS8 A;  4X66 E;  1ZM2 A;  2UUB E;  4X65 E;  1KVK A;  4JI3 I;  4DPT A;  4DV5 E;  4DPX A;  4X66 I;  4OOG C;  5GMD A;  3J7A G;  4P7A A;  1DAR A;  4B3S I;  1XMO E;  3QT5 A;  2VQF E;  2HK2 A;  4JI7 E;  2WW4 A;  4XTJ A;  2XEX A;  4Z7Y A;  4PRV A;  4FN5 A; 
#chains in the Genus database with same CATH topology
 4DR3 I;  2Q2E B;  4BA2 B;  3QT8 A;  1QNT A;  2M1S A;  2BA0 G;  3HPZ A;  5IWA I;  4DV4 I;  1WHN A;  4I3H A;  1A1L A;  1H74 A;  4LFA I;  4K0K I;  2C38 A;  5KL3 A;  2EM5 A;  4J8Z A;  2ADR A;  2VQF I;  1IQS A;  1VI7 A;  5DRP A;  2EPP A;  4O43 A;  3QT7 A;  3AUZ A;  2PNZ B;  2YRK A;  4BBY A;  2JEB A;  2YTE A;  2UUC I;  2EOM A;  3J81 C;  2UU9 E;  2HK3 A;  4LF5 E;  2EPU A;  4BHC A;  2EPC A;  3DD6 A;  3L7Z B;  5K36 E;  3T1Y E;  3F0N A;  1Y4U A;  4JI3 E;  4R2R A;  4X65 I;  2C38 B;  2L3C A;  2EPX A;  3D4J A;  3LPS A;  2JXP A;  1DI2 A;  2EQ3 A;  2EOH A;  2PNZ A;  3ZZT A;  2O1W A;  4LOM A;  4EMD A;  1PJS A;  4J3D A;  1PDA A;  4IS9 A;  2V88 A;  3M7N G;  1RMD A;  4QNK A;  5A69 A;  4R8O A;  1RRE A;  1A1G A;  3ZKB A;  5JEA C;  4TUI A;  1XNQ I;  4B3M I;  1EH8 A;  3PYD A;  5LMN I;  5IT9 C;  2DMY A;  2BA1 G;  4GEQ B;  2V8Q B;  4DV7 I;  5KL6 A;  1R6M A;  4DKK A;  4LF9 I;  5DRQ A;  2NUG A;  4DR4 I;  4M2Z A;  1USU A;  4R2C A;  1R6L A;  4DUZ I;  2N3H A;  2YT4 A;  3C4T A;  2NUF A;  2LBS B;  2JVA A;  1YH8 A;  1LLM C;  2EMY A;  2Z5C A;  3CDJ A;  1X49 A;  1N33 E;  1X6E A;  4ED4 A;  4X9J A;  3LTO A;  2VRD A;  2YTJ A;  1XNR E;  2K7I A;  2L8T A;  1XMQ E;  4MYT A;  2UXB I;  1YUI A;  4B3T I;  1N32 E;  2EZ6 A;  2WP8 B;  4LF6 E;  3M7N D;  4IFD C;  1Z1B A;  2LMZ A;  2JWO A;  4DV3 E;  1YUJ A;  4B3R E;  5T6J A;  1Z0G A;  1YYK A;  1Z5A A;  2AJ4 A;  2HFS A;  2Z5B A;  5K36 C;  4LTY A;  5C0X C;  4NXM E;  1N0U A;  5JEA A;  2DEI A;  4I8O A;  2PO1 B;  2BB8 A;  4HAC A;  1IBK E;  1VIS A;  1T4O A;  4GKJ I;  4P78 A;  3EQ1 A;  1GTK A;  1HNW E;  2UUA E;  4PRX A;  2EOZ A;  2F8B A;  2LT7 A;  4UTG A;  4URL A;  2JEA B;  1GQE A;  4DR1 I;  4LF7 E;  5DRO A;  3VYY A;  2BM0 A;  4R2Q A;  2WNR B;  1E3P A;  4MDT A;  2YU5 A;  4F6M A;  4L8N A;  2RPC A;  1S4E A;  4JYA I;  2EQ1 A;  3KZZ A;  1Z5C A;  2EMH A;  2A2D A;  1BB8 A;  3J7A M;  2EMF A;  3THO B;  2BR2 B;  2O3Z A;  2EMI A;  3KWR A;  1YZ9 A;  4MU1 A;  1N36 I;  2UXC E;  4R2P A;  3UHM A;  4DV0 E;  1G2F C;  2YRM A;  2PO2 A;  2IER A;  1BBO A;  1HNZ I;  2X7I A;  4DR7 E;  2WP8 A;  2EPZ A;  1FJG I;  4MYU A;  4JI1 I;  2PO0 B;  4YHH I;  1ZR9 A;  3ZOQ B;  1RC7 A;  1IBK I;  1UDN A;  2L2K B;  2GHF A;  2Z5C B;  4USK A;  5L3J A;  1FKA E;  2BBG A;  3PYF A;  3UK3 C;  2WBU A;  1ZXM A;  4RHB B;  2C39 A;  1SFE A;  4M30 A;  2EL6 A;  3L00 A;  2EPM X;  3P1X A;  4IFD E;  3OTO E;  1I94 E;  2Z5B B;  4LFB E;  4LPF A;  2JYA A;  3WU5 A;  4ZYG A;  2EOQ A;  1OJ4 A;  4DU8 A;  3PRY A;  4P7D A;  2ZM6 E;  2EM9 A;  2HJJ A;  1FJG E;  3C6M A;  4HAC B;  4IZK A;  4DR7 I;  2EOJ A;  4FWG A;  4DR2 I;  2YU8 A;  5TSE A;  1PJT A;  3M6A A;  5JEA B;  5C0X E;  1YSA C;  1HR0 I;  2RSM A;  1N34 E;  1Z5B A;  4IZJ B;  5DNY A;  1N0V C;  2LE2 A;  2YWQ A;  2M4I A;  3EPJ A;  5AC4 A;  4Q35 B;  3VHT B;  3BF2 A;  2GO3 A;  2A2C A;  5LMN E;  2EOE A;  2M7Q A;  2GLI A;  2CVE A;  5IT9 Q;  1RQ0 A;  2DEJ A;  2EL5 A;  1HR0 E;  1PIE A;  4IZK B;  4LF8 I;  2EN4 A;  2EN8 A;  4DR1 E;  2EM2 A;  4JV5 E;  2V8P A;  2RQL A;  1J5E E;  2V87 A;  1ZM3 A;  2VES A;  1X48 A;  1N3G A;  4N4R B;  2MC6 A;  1ZXN A;  4OO1 D;  3ADI A;  4DV1 E;  5A6K A;  1WUU A;  4OO1 C;  4IJD A;  1SR9 A;  5K36 B;  5C0X B;  1MU5 A;  2EN2 A;  2UXD I;  1X6F A;  4WYQ B;  2L3J A;  4P52 A;  1X6H A;  2UUC E;  2NN6 F;  3F6G A;  4WSP A;  4DUY E;  4HYM A;  4BS9 A;  4AID A;  1EI1 A;  5AAS A;  1Y4S A;  2UXB E;  5LL6 R;  1IMU A;  2JOB A;  2JEB B;  2YPN A;  3IWC A;  4LCH A;  2RTX A;  2FGG A;  5DRR A;  4IZJ A;  4WSG A;  2LVH A;  4U3D A;  1N33 I;  2EE8 A;  1RHY A;  3CWV A;  5C0X A;  1NEI A;  4DV2 I;  4X62 E;  5LMU E;  4FWH A;  3K6Q A;  1DQ3 A;  4DUZ E;  4GQU A;  3PYG A;  2JOX A;  4USM A;  4FW5 A;  2MC5 A;  2EN6 A;  4M1K A;  4WUD A;  3ADL A;  2VF1 A;  3P76 A;  2CT1 A;  3K17 A;  1OYP A;  2ZIT A;  4JI5 I;  1FNM A;  4B3S E;  1X5W A;  1QZR A;  1UIL A;  2B7T A;  4FW7 A;  2GQ0 A;  5IV8 B;  1IBL E;  4X62 I;  2EM7 A;  2EOO A;  4OKG A;  4ZYE A;  3EPL A;  2EP3 A;  1PJQ A;  4ZVI A;  4ZYH A;  5ELW A;  1IBM I;  2IOQ A;  4KZS A;  3TQM A;  2LJP A;  2EN3 A;  2V85 A;  3P3G A;  3OTO I;  1I94 I;  4Q28 A;  2JPA A;  3HPS A;  2NPF A;  1Y5Y A;  3J80 C;  1T4L B;  5KL5 A;  2EM0 A;  1B63 A;  3B4T A;  4IFD A;  4LF5 I;  2UXD E;  1KKH A;  2AE8 A;  2CGE A;  3MSW A;  3GON A;  4WX9 A;  2I9I A;  4LF6 I;  2DGC A;  3K85 A;  3B82 A;  4LF4 I;  4HEI A;  2L6M A;  2HHH E;  1TF6 A;  1ZBT A;  2JR1 A;  2LUP B;  2M9A A;  4X8W A;  4DV1 I;  4YHH E;  3M85 G;  1IBM E;  4MLV A;  2EPK X;  5CFF E;  1F2I G;  2V34 A;  2V2Q A;  4AQY I;  4DV4 E;  5A2Q C;  2EM4 A;  1A1J A;  1B62 A;  2CSH A;  2IHR 1;  4Z7C A;  1QU6 A;  4ISA A;  2FTX B;  2L92 A;  3JTZ A;  2RS7 A;  4DPY A;  4LCG A;  4JI7 I;  2GPI A;  4HXZ A;  2HKE A;  4KWY A;  2NN6 A;  2PNM A;  3DJW A;  4FK5 C;  2PO0 A;  2V89 A;  3IWB A;  5IXM B;  5JEA E;  3QG5 C;  2EJ4 A;  2YTI A;  1Z59 A;  3HKM A;  4BA1 B;  4X64 I;  2E72 A;  3H09 A;  2YTO A;  1EA6 A;  5C0X D;  3HQ1 A;  1FWK A;  3JAM Q;  4DR2 E;  4OX9 I;  3U1Y A;  1K47 A;  2ZM6 I;  1X47 A;  4IS1 C;  4WUC A;  4DPW A;  3ADJ A;  2EPA A;  2V2Z A;  2LTR A;  2HHH I;  4DR5 I;  1PVG A;  4O5G A;  4DUY I;  5FLX C;  5KL7 A;  4DXL A;  5JEA F;  4DV6 I;  3WU6 A;  1Z0C A;  5A2Q Q;  4GZN C;  5FWK A;  4KHP I;  2F1D A;  4KHP E;  1WHQ A;  2FV4 B;  2WZO A;  5KL4 A;  1YYO A;  4DPU A;  3GCM A;  1STU A;  5AE3 A;  4DV6 E;  2O1U A;  2DB2 A;  4MLQ A;  2ENC A;  4OO1 A;  5BR8 E;  2DMI A;  2Q8U A;  1YFH A;  2JE6 A;  3H1C A;  2BV3 A;  3QT6 A;  2EN7 A;  2BA0 D;  4LFA E;  4K0K E;  1XNR I;  4WFT A;  1UHZ A;  1KIJ A;  4WUB A;  4NHR A;  2PO1 A;  2C39 B;  2J7K A;  1NHI A;  4AIM A;  4X64 E;  2EMG A;  1A6F A;  3ZZ0 A;  2JEA A;  3BID A;  1FWL A;  4PU9 A;  4R2D A;  1N36 E;  1Z0W A;  4IFD F;  4MU4 A;  3ZM7 A;  1T38 A;  1Z0V A;  4U3B A;  2KON A;  3LLH A;  1P47 A;  4DV7 E;  5K36 F;  4ZYD A;  2EMA A;  4JG4 A;  1Z0T A;  1XMO I;  2LV2 A;  4JYA E;  2BR2 A;  3OML A;  1XNQ E;  1WJP A;  4R1F A;  3NZK A;  3DF6 A;  1A1K A;  5LMU I;  2EMC A;  2ELZ A;  4DV2 E;  3C6K A;  4DV5 I;  3MHS C;  2WBS A;  2JY9 A;  5KL2 A;  3VK6 A;  1HNW I;  2O1V A;  1PKP A;  2DLQ A;  5F3W A;  2CTD A;  1ZAA C;  2EPR A;  1A1H A;  1KTV A;  4LF4 E;  4BC7 A;  3F6H A;  3K1J A;  3T1H E;  3KRN A;  3CDI A;  2EPN A;  3JAM C;  2VQE E;  4JI2 I;  2EN1 A;  2PRT A;  1OYR A;  2CPN A;  4B3T E;  4YY3 E;  2E1M A;  2G7H A;  4R03 A;  1H7U A;  4AM3 A;  2WBT A;  1HNX I;  4DR6 I;  2YTQ A;  3WU3 A;  4QNJ A;  4LCF A;  1Z0B A;  4M9V C;  5K36 D;  2VF3 A;  1IBL I;  2EFG A;  4LF8 E;  4DV0 I;  4IFD D;  2DIX A;  4M0V A;  2B7V A;  2K4V A;  3FIG A;  2NN6 E;  2BA1 D;  3B78 A;  1YYW A;  4LF9 E;  4JI5 E;  3BBG A;  1NCS A;  4LFC E;  1OYS A;  5DNX A;  4R2A A;  4MQY A;  2V2V A;  3MHH C;  3GME A;  2N8X A;  3P06 A;  3M85 D;  2J7J A;  3PYE A;  5EL9 A;  4WPY A;  1YPN A;  4LF7 I;  2LRS A;  3KZY A;  1JK2 A;  1EKZ A;  2YTG A;  2B3T B;  4O24 A;  2R3V A;  4GKJ E;  4KQV A;  2EMW A;  3EPH A;  1L4S A;  1USV A;  4LFB I;  1MGT A;  5JEA D;  3PS1 A;  1KJK A;  4N3O A;  4JI0 I;  3BGH A;  2NUE A;  1H7S A;  1UDS A;  2Z5E A;  4JI4 I;  5ADZ A;  1ZU1 A;  2LTS A;  1MX0 A;  2HFU A;  3Q6N A;  3GLL A;  2MKN A;  3V5R A;  4DV3 I;  2UU9 I;  3HUL A;  5FLX Q;  4JI6 I;  1WXR A;  2EOR A;  4B3R I;  4BCA A;  4NZV A;  1T4N A;  1XHK A;  4OO1 E;  3IWD A;  2R42 A;  2OI2 A;  2D9H A;  4LFC I;  5C0X F;  3Q6M A;  4JI1 E;  2JT2 A;  4F9B B;  5GME A;  1KYQ A;  1TN9 A;  2MDR A;  4NBQ A;  1J5E I;  1HNZ E;  4RPF A;  2EM3 A;  2EMZ A;  4JV5 I;  2VE7 C;  4R2E A;  1DGC A;  3B8H A;  1H73 A;  2L2N A;  2ELY A;  2L33 A;  2LJU A;  1UDQ A;  2PO2 B;  2EM8 A;  3L7Z A;  4LU9 A;  1ZM9 A;  3HJC A;  2UXC I;  2N3G A;  2BM1 A;  4F6N A;  2HKJ A;  4JI8 E;  2RS6 A;  4B3M E;  1H72 C;  2NN6 C;  3HTX A;  4BMJ A;  2JP9 A;  1N34 I;  4F9C B;  4JI2 E;  2DSY A;  2C37 A;  2E5L I;  2CG9 A;  3Q1Q A;  4JI4 E;  4JI0 E;  2R76 A;  2JE6 B;  2HGH A;  4OZE A;  4NXN E;  4FW3 A;  2UUA I;  4GKK E;  1NZ0 A;  1MG7 A;  2KHX A;  3M99 B;  1UBD C;  2LCE A;  2R1F A;  2V86 A;  4NXN I;  2YZT A;  2LUQ A;  3EPK A;  2EWL A;  1B69 A;  1EH7 A;  1UDO A;  3JU0 A;  2H36 X;  1AH5 A;  2B9D A;  1NHH A;  1UEK A;  2IOP A;  2X36 A;  1D6T A;  1N32 I;  1UN6 B;  2V83 A;  4HY1 A;  2L2M A;  2EOS A;  4BC9 A;  5AC5 A;  2EOI A;  3RMP A;  2EOY A;  1G2D C;  1BKN A;  3P3C A;  3ZZU A;  2F4V I;  5IWA E;  2ODR C;  4F54 A;  4O4K A;  1S16 A;  2HC5 A;  3J7Y p;  2EOX A;  2YTF A;  2F4V E;  2CZ9 A;  1ZBQ A;  4DR4 E;  1JK1 A;  5EKW A;  5AE1 A;  4MU0 A;  3C4B A;  1ZM4 A;  5DNL A;  5BR8 I;  1A1F A;  3ZKD A;  1E3H A;  4YY3 I;  5A6B A;  2YTP A;  3AV0 A;  3V2U C;  4R2S A;  3THN A;  2VQE I;  3WU4 A;  1TF3 A;  3LNU A;  1T39 A;  2YTD A;  3T1H I;  5AE2 A;  1RR9 A;  5A6J A;  2NN6 D;  4UT4 A;  2LO3 A;  2C37 B;  3J80 Q;  4RH8 A;  2GO4 A;  2UUB I;  4DR5 E;  3HXL A;  2EPL X;  1ELO A;  2YSO A;  2YSP A;  2YTN A;  1J26 A;  2ZBK B;  4GKK I;  4DU7 A;  4NXM I;  2I13 A;  3T1Y I;  4OX9 E;  2MDG A;  4F2J C;  1P42 A;  3VYX A;  2E5L E;  1FI4 A;  2ENA A;  4OO1 F;  4L5N C;  1U2R A;  2J65 A;  4JI8 I;  2DRP A;  4BA1 A;  4FW9 A;  2EM6 A;  4BHB A;  1XMQ I;  4FWD A;  3H4L A;  1AAY A;  4F9A B;  4BA2 A;  4HTG A;  2EPO A;  3ADG A;  2EMK A;  3PS3 A;  1Y60 A;  4DR3 E;  3J81 Q;  2IES A;  2KOU A;  1NHJ A;  1Z0E A;  5K36 A;  2EL4 A;  2YRH A;  4AQY E;  2DLK A;  2RSI A;  2MKD A;  4WXD A;  1HNX E;  4DR6 E;  3LML A;  2LJH A;  2E1R A;  2NN6 B;  1BBG A;  1MEY C;  3P3E A;  3PS2 A;  2ENH A;  1EH6 A;  2EOF A;  1O0W A;  4OO1 B;  4JI6 E;  2NA2 A;  2GS8 A;  4IFD B;  2ODR D;  3ECR A;  5A6A A;  4X66 E;  2PNL A;  1ZM2 A;  1Y6Z A;  1X3C A;  2EMX A;  2NAB A;  4FW4 A;  2A25 A;  1WRJ A;  2UUB E;  4X65 E;  1KVK A;  4JI3 I;  1A1I A;  4DPT A;  4DV5 E;  4TUG A;  4DPX A;  2EML A;  4X66 I;  2WNR A;  4OOG C;  2O1T A;  5LLQ A;  3J7A G;  5GMD A;  4FW6 A;  2EMB A;  2EQ0 A;  4IZJ D;  5A6B D;  1IQO A;  1DAR A;  4P7A A;  4B3S I;  1GZ6 A;  1XMO E;  1XXE A;  1HK7 A;  3QT5 A;  3U1K A;  2VQF E;  4WXC A;  2HK2 A;  4JI7 E;  4DMI A;  2WW4 A;  4MU3 A;  4XTJ A;  2XEX A;  4Z7Y A;  4PRV A;  2WCC 3;  1YHC A;  4FN5 A; 
#chains in the Genus database with same CATH homology
 4DR3 I;  2Q2E B;  3QT8 A;  5IWA I;  2M1S A;  4DV4 I;  3HPZ A;  1WHN A;  4I3H A;  1H74 A;  4LFA I;  4K0K I;  4J8Z A;  2VQF I;  3QT7 A;  3AUZ A;  4BBY A;  2UUC I;  3J81 C;  2UU9 E;  2HK3 A;  4LF5 E;  3T1Y E;  3F0N A;  1Y4U A;  4JI3 E;  4X65 I;  2L3C A;  3D4J A;  3LPS A;  1DI2 A;  3ZZT A;  4EMD A;  2O1W A;  2V88 A;  1RRE A;  4R8O A;  3ZKB A;  4TUI A;  1XNQ I;  4B3M I;  3PYD A;  5LMN I;  5IT9 C;  2DMY A;  4GEQ B;  2V8Q B;  4DV7 I;  4DKK A;  4LF9 I;  2NUG A;  4DR4 I;  4M2Z A;  1USU A;  4DUZ I;  2N3H A;  2YT4 A;  3C4T A;  2NUF A;  2LBS B;  2JVA A;  2Z5C A;  1X49 A;  1N33 E;  4ED4 A;  3LTO A;  1XNR E;  2L8T A;  1XMQ E;  4MYT A;  2UXB I;  4B3T I;  1N32 E;  2EZ6 A;  4LF6 E;  2LMZ A;  2JWO A;  4DV3 E;  4B3R E;  2HFS A;  5T6J A;  1Z0G A;  1YYK A;  1Z5A A;  2AJ4 A;  2Z5B A;  4LTY A;  4NXM E;  1N0U A;  2DEI A;  4I8O A;  4HAC A;  1IBK E;  1VIS A;  1T4O A;  4GKJ I;  4P78 A;  1HNW E;  2UUA E;  4PRX A;  2F8B A;  4UTG A;  4URL A;  1GQE A;  4DR1 I;  4LF7 E;  3VYY A;  2BM0 A;  4L8N A;  1S4E A;  4JYA I;  1Z5C A;  2A2D A;  3J7A M;  3KWR A;  1YZ9 A;  1N36 I;  2UXC E;  4DV0 E;  1HNZ I;  2X7I A;  4DR7 E;  1FJG I;  4MYU A;  4JI1 I;  4YHH I;  3ZOQ B;  1RC7 A;  1IBK I;  2L2K B;  2Z5C B;  4USK A;  5L3J A;  1FKA E;  3PYF A;  1ZXM A;  4M30 A;  3P1X A;  3OTO E;  1I94 E;  2Z5B B;  4LFB E;  3WU5 A;  1OJ4 A;  4DU8 A;  3PRY A;  4P7D A;  2ZM6 E;  1FJG E;  4HAC B;  4DR7 I;  4IZK A;  4FWG A;  4DR2 I;  3M6A A;  1HR0 I;  2RSM A;  1N34 E;  1Z5B A;  4IZJ B;  5DNY A;  1N0V C;  2LE2 A;  2M4I A;  2A2C A;  5LMN E;  2M7Q A;  5IT9 Q;  1RQ0 A;  2DEJ A;  1HR0 E;  1PIE A;  4IZK B;  4LF8 I;  4JV5 E;  4DR1 E;  2V8P A;  1J5E E;  2V87 A;  1ZM3 A;  1X48 A;  2MC6 A;  1ZXN A;  3ADI A;  4DV1 E;  1WUU A;  1SR9 A;  1MU5 A;  2UXD I;  4WYQ B;  2L3J A;  4P52 A;  2UUC E;  3F6G A;  4WSP A;  4DUY E;  4HYM A;  4BS9 A;  1EI1 A;  5AAS A;  1Y4S A;  2UXB E;  5LL6 R;  2JOB A;  3IWC A;  2RTX A;  2FGG A;  4IZJ A;  1N33 I;  4DV2 I;  3CWV A;  4X62 E;  5LMU E;  4FWH A;  3K6Q A;  1DQ3 A;  4DUZ E;  3PYG A;  2JOX A;  4USM A;  2MC5 A;  4M1K A;  4WUD A;  3ADL A;  2VF1 A;  3K17 A;  2ZIT A;  4JI5 I;  1FNM A;  4B3S E;  1QZR A;  1UIL A;  2B7T A;  2GQ0 A;  1IBL E;  4X62 I;  4ZVI A;  1IBM I;  2IOQ A;  4KZS A;  2LJP A;  2V85 A;  3OTO I;  1I94 I;  4Q28 A;  3HPS A;  2NPF A;  3J80 C;  1T4L B;  1B63 A;  4LF5 I;  2UXD E;  1KKH A;  2CGE A;  3MSW A;  3GON A;  4LF6 I;  4LF4 I;  3K85 A;  3B82 A;  4DV1 I;  2L6M A;  2HHH E;  1ZBT A;  2JR1 A;  2LUP B;  4X8W A;  4YHH E;  1IBM E;  4AQY I;  5CFF E;  2V34 A;  2V2Q A;  4DV4 E;  5A2Q C;  1B62 A;  2IHR 1;  4Z7C A;  1QU6 A;  2FTX B;  2L92 A;  3JTZ A;  2RS7 A;  4DPY A;  4JI7 I;  4HXZ A;  2HKE A;  2PNM A;  3DJW A;  2V89 A;  3IWB A;  1Z59 A;  4X64 I;  3H09 A;  1EA6 A;  3HQ1 A;  1FWK A;  3JAM Q;  4DR2 E;  4OX9 I;  1K47 A;  2ZM6 I;  1X47 A;  4WUC A;  4DPW A;  3ADJ A;  2V2Z A;  2LTR A;  2HHH I;  4DR5 I;  1PVG A;  4DUY I;  5FLX C;  4DXL A;  4DV6 I;  3WU6 A;  1Z0C A;  5A2Q Q;  5FWK A;  4KHP I;  4KHP E;  1WHQ A;  2FV4 B;  2WZO A;  1YYO A;  4DPU A;  1STU A;  5AE3 A;  4DV6 E;  2O1U A;  2DB2 A;  5BR8 E;  3QT6 A;  2BV3 A;  1XNR I;  4LFA E;  4K0K E;  4WFT A;  1UHZ A;  1KIJ A;  4WUB A;  2J7K A;  1NHI A;  4X64 E;  1A6F A;  3ZZ0 A;  1FWL A;  4PU9 A;  1N36 E;  1Z0W A;  3ZM7 A;  1Z0V A;  2KON A;  3LLH A;  4DV7 E;  4JG4 A;  1Z0T A;  1XMO I;  4JYA E;  3OML A;  1XNQ E;  4R1F A;  3DF6 A;  5LMU I;  4DV2 E;  4DV5 I;  2JY9 A;  3VK6 A;  1HNW I;  2O1V A;  1PKP A;  5F3W A;  1KTV A;  4LF4 E;  4BC7 A;  3F6H A;  3K1J A;  3T1H E;  3JAM C;  2VQE E;  4JI2 I;  2CPN A;  4B3T E;  4YY3 E;  1H7U A;  2E1M A;  2G7H A;  4R03 A;  1HNX I;  4DR6 I;  3WU3 A;  1Z0B A;  2VF3 A;  1IBL I;  2EFG A;  4LF8 E;  4DV0 I;  2DIX A;  4M0V A;  2B7V A;  2K4V A;  3FIG A;  3B78 A;  1YYW A;  4LF9 E;  4JI5 E;  4LFC E;  2V2V A;  3P06 A;  3PYE A;  4WPY A;  4LF7 I;  2LRS A;  1EKZ A;  2B3T B;  2R3V A;  4GKJ E;  4KQV A;  4LFB I;  1USV A;  4N3O A;  4JI0 I;  2NUE A;  1H7S A;  2Z5E A;  4JI4 I;  5ADZ A;  2HFU A;  2LTS A;  1MX0 A;  3Q6N A;  3V5R A;  2UU9 I;  4JI6 I;  4DV3 I;  4B3R I;  3HUL A;  5FLX Q;  1WXR A;  4BCA A;  1T4N A;  1XHK A;  3IWD A;  2R42 A;  2OI2 A;  4LFC I;  3Q6M A;  4JI1 E;  4F9B B;  5GME A;  2MDR A;  1J5E I;  1HNZ E;  4RPF A;  4JV5 I;  2VE7 C;  3B8H A;  1H73 A;  2L2N A;  2L33 A;  4LU9 A;  1ZM9 A;  3HJC A;  2UXC I;  2N3G A;  2BM1 A;  2HKJ A;  4JI8 E;  2RS6 A;  4B3M E;  1H72 C;  3HTX A;  4BMJ A;  1N34 I;  4JI2 E;  4F9C B;  2DSY A;  2E5L I;  3Q1Q A;  2CG9 A;  4JI4 E;  4JI0 E;  4NXN E;  2UUA I;  4GKK E;  1NZ0 A;  1MG7 A;  2KHX A;  2V86 A;  4NXN I;  2YZT A;  2LUQ A;  2EWL A;  3JU0 A;  2H36 X;  2B9D A;  1NHH A;  1UEK A;  2IOP A;  2X36 A;  1D6T A;  1N32 I;  2V83 A;  4HY1 A;  2L2M A;  4DU7 A;  4BC9 A;  3RMP A;  3ZZU A;  1BKN A;  2F4V I;  5IWA E;  2ODR C;  4F54 A;  1S16 A;  3J7Y p;  2F4V E;  2CZ9 A;  1ZBQ A;  4DR4 E;  5AE1 A;  3C4B A;  1ZM4 A;  5BR8 I;  3ZKD A;  4YY3 I;  3AV0 A;  3V2U C;  2VQE I;  3WU4 A;  3LNU A;  3T1H I;  5AE2 A;  1RR9 A;  4UT4 A;  3J80 Q;  2UUB I;  4DR5 E;  3HXL A;  1ELO A;  4GKK I;  1J26 A;  2ZBK B;  4NXM I;  3T1Y I;  4OX9 E;  3VYX A;  2E5L E;  1FI4 A;  4L5N C;  1U2R A;  4JI8 I;  4FW9 A;  1XMQ I;  4FWD A;  3H4L A;  4F9A B;  3ADG A;  4DR3 E;  3J81 Q;  2KOU A;  1NHJ A;  1Z0E A;  4AQY E;  1HNX E;  4DR6 E;  3LML A;  2LJH A;  2E1R A;  1O0W A;  4JI6 E;  2NA2 A;  2GS8 A;  2ODR D;  4X66 E;  2PNL A;  1ZM2 A;  1Y6Z A;  2UUB E;  4X65 E;  1KVK A;  4JI3 I;  4DPT A;  4DV5 E;  4TUG A;  4DPX A;  4X66 I;  4OOG C;  2O1T A;  5GMD A;  3J7A G;  4IZJ D;  4P7A A;  1DAR A;  4B3S I;  1GZ6 A;  1XMO E;  1HK7 A;  3QT5 A;  2VQF E;  2HK2 A;  4JI7 E;  4DMI A;  2WW4 A;  4XTJ A;  2XEX A;  4Z7Y A;  4PRV A;  4FN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...