4DR3E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3E02
4GKKI 4DR4I 2E5LE 2DMYA 2RS6A 2RSMA 5BR8I 4DPUA 3JAMQ 4X66I 4JG4A 4DUZI 2ZITA 1FJGI 3LLHA 1B62A 4DR3E 4P52A 4JI2I 4DUYI 1H72C 2KHXA 4JI6E 1XNQE 3PYDA 1EI1A 2DEJA 3B78A 1XMQI 4NXNE 4DV5I 4YY3I 2LTRA 4WUBA 2L3CA 1WUUA 4JI8I 1IBKI 2HFUA 1T4OA 4DR5I 4EMDA 1U2RA 3J81Q 1UILA 3P1XA 3WU3A 4DV4I 1DARA 4B3RE 1J5EE 2MDRA 3ADJA 1MX0A 4X8WA 1MU5A 1N34E 4UT4A 4LF6E 4DR7I 3OTOE 1PVGA 2A2CA 4GKKE 4HYMA 4DR4E 4DV6E 5BR8E 1J26A 4X66E 4DUZE 2A2DA 2N3GA 1Z5BA 3PYFA 3JAMC 1FJGE 2UUCI 4UTGA 3VYYA 4HACB 4JI2E 1K47A 3LNUA 3C4TA 4PRXA 4DR6E 1Z0CA 1XMQE 4M2ZA 4DV5E 4YY3E 1H7UA 1HR0I 3ZKBA 2LBSB 4JI8E 2L2NA 4B3MI 3CWVA 4DR5E 5GMDA 1KIJA 2J7KA 4X64E 3QT8A 1H74A 1H7SA 4URLA 3J81C 4DV4E 1FNMA 2V8PA 1EA6A 4LF9I 2NA2A 2F4VI 1RR9A 3ADGA 1Z0BA 5FLXC 3ADIA 1RREA 2DB2A 4LFBI 1S16A 3D4JA 2X36A 1ZXNA 4K0KE 1N34I 1Z0WA 1ZM9A 4LF4I 3K17A 4DR1I 3T1HI 1XNRI 3B8HA 4DV1I 3J7AM 4DV6I 1B63A 2JY9A 1FWKA 2UUCE 1D6TA 4WUDA 2LUPB 2B3TB 5CFFE 1FKAE 3K1JA 4HY1A 2BV3A 4DR6I 3B82A 3HULA 3LTOA 4DV0I 1HR0E 4JI0I 1WHQA 3WU6A 2LUQA 1XMOI 1N0UA 4B3ME 3LPSA 1PKPA 2B7TA 4M30A 4M1KA 4X64I 4LF9E 2ZBKB 3ZKDA 1N32I 1UHZA 1XHKA 1HNXI 2F4VE 1ZM4A 2NPFA 4LF5I 5IT9Q 5FLXQ 4LFBE 1QZRA 4DPYA 1EKZA 2V2QA 4LF4E 4AQYE 2XEXA 4DR1E 4K0KI 3T1HE 1XNRE 1VISA 3J80C 2B7VA 4DV1E 3ZM7A 1ZM3A 1YYWA 4WYQB 3PYGA 1OJ4A 4RPFA 1YYKA 2ZM6I 4DU8A 1FI4A 1X49A 2E1RA 4HXZA 1A6FA 2UUBI 4PU9A 4DV0E 4JI0E 4DPXA 1GQEA 3HTXA 1XMOE 4FW9A 2HHHI 5A2QC 4JI3I 1KKHA 4X62I 4JI7E 2JVAA 4DV7I 3T1YI 1QU6A 4Z7YA 1FWLA 5L3JA 2X7IA 3PYEA 1N32E 3WU5A 1HNXE 4DXLA 4X65E 4USMA 2VQEI 1HNZE 3ZZTA 1IBLI 4LF5E 3J7AG 3QT5A 5IT9C 3F0NA 1Z59A 1Z0GA 2UXBE 2UU9I 3Q1QA 3V2UC 2NUGA 1KVKA 3ZZUA 1O0WA 4ZVIA 3J80Q 1N33I 3M6AA 3QT6A 4B3TI 4AQYI 1NHIA 2HK2A 2NUFA 2EFGA 4USKA 5GMEA 2ZM6E 3C4BA 2LRSA 4LF7I 1PIEA 1NHHA 2BM1A 1N36I 4Z7CA 2UUBE 4DV2I 3H4LA 2VQFI 4LF8I 4OX9I 2DIXA 1HNWI 4FWDA 2IHR1 2R3VA 2HHHE 5A2QQ 4JI3E 4X62E 2HK3A 4DV7E 4ED4A 2EZ6A 2YT4A 1X47A 3T1YE 4JI5I 2UXCI 2BM0A 1KTVA 4JI4I 4WUCA 1N0VC 4JI7I 4DPWA 2LJPA 4MYTA 2LJHA 2DEIA 1ZXMA 4NXMI 2HKJA 2VQEE 3WU4A 4KHPI 1IBLE 4B3SI 2VF3A 4X65I 1H73A 2WW4A 5LMNI 4YHHI 2Q2EB 1HNZI 4MYUA 1UEKA 3VYXA 2RTXA 1RQ0A 2R42A 2UU9E 1DI2A 4LFAI 3GONA 4JI1E 4WFTA 1N33E 2UXBI 5LMUE 4B3TE 3J7Yp 4PRVA 2V34A 1Z0TA 2UUAI 1ZM2A 4DR2E 3ZZ0A 2RS7A 4JYAI 4LF7E 2N3HA 2NUEA 4R1FA 2V2ZA 1N36E 2GS8A 3QT7A 1STUA 4DPTA 4HACA 4DV2E 2UXDI 2VQFE 4LF8E 4OX9E 4DV3I 1IBME 4OOGC 2HKEA 4JV5I 5IWAE 1HNWE 2CZ9A 3ADLA 4LFCI 2L2MA 4GKJI 1I94I 1Z0EA 5LL6R 4JI5E 2UXCE 2E5LI 2OI2A 1X48A 2LTSA 4JI4E 4DU7A 4DUYE 2HFSA 4NXME 4KQVA 4KHPE 2L3JA 2L2KB 2AJ4A 4DR3I 1Z5CA 4B3SE 4JI6I 1XNQI 5LMNE 4YHHE 1T4LB 1NZ0A 1MG7A 1IBKE 4NXNI 4LFAE 2V2VA 1YZ9A 4FWGA 1YYOA 4JI1I 5LMUI 1NHJA 2CPNA 2UUAE 4XTJA 1T4NA 4JYAE 4B3RI 3V5RA 1J5EI 1Z5AA 4DR2I 1Z0VA 1ZBTA 1ELOA 1WHNA 4FN5A 2UXDE 4DV3E 1S4EA 4DR7E 4FWHA 4JV5E 1RC7A 4LFCE 4LF6I 2L33A 1IBMI 4GKJE 4P7AA 1I94E 4I3HA 5IWAI 3OTOI 1BKNA 4DKKA
chains in the Genus database with same CATH superfamily
2YTNA 2JEAB 4GKKI 3GLLA 4DR4I 1IQSA 2PRTA 2E5LE 2R1FA 2DMYA 1E3HA 3EPKA 2PNZA 2RS6A 3V2UC 1OYSA 2RSMA 1KJKA 5BR8I 4DPUA 3JAMQ 2O3ZA 4X66I 1YPNA 4JG4A 4MQYA 5DROA 1EH6A 5KL6A 4DUZI 2MKNA 1TF6A 3DJWA 2ZITA 2EM2A 1FJGI 2EOXA 3KWRA 5C0XB 3M85D 4L8NA 2JWOA 3LLHA 4R2DA 1B62A 4MU1A 4DR3E 4P52A 5DRRA 4JI2I 4DUYI 1H72C 2KHXA 4BC7A 4JI6E 2ELYA 4NZVA 1XNQE 1USUA 2EMZA 3PYDA 2V8QB 1EI1A 5AC4A 3KZYA 2FGGA 4WPYA 2DEJA 3B78A 2EMWA 4IS9A 2C38A 3Q6MA 1B69A 1XMQI 2EN4A 4NXNE 4DV5I 4YY3I 2EJ4A 2EOFA 2LTRA 4WUBA 3M99B 2L3CA 1WUUA 4F54A 4JI8I 3UK3C 3H1CA 1IBKI 1BBOA 4R8OA 4F6MA 1UEKA 3MHHC 1T4OA 2EMBA 2HFUA 3PS3A 4DR5I 3KZZA 2PO2B 4EMDA 1U2RA 4AIMA 1UILA 3P1XA 3WU3A 3J81Q 4FW6A 3M85G 5K36A 5A69A 4R2RA 5DNLA 4DV4I 3FIGA 1DARA 4M0VA 4OO1E 2EMHA 4B3RE 3HKMA 1J5EE 2RSIA 1A1JA 2LMZA 2MDRA 3ADJA 1ZR9A 1MX0A 1HK7A 5KL3A 2L92A 4R2EA 4X8WA 3LMLA 1YSAC 1MU5A 4IFDA 1N34E 4UT4A 4LF6E 4DR7I 3H09A 2EL4A 2EMFA 3OTOE 2EQ3A 1PVGA 2A2CA 4GKKE 4HYMA 4F6NA 4OO1A 5DNYA 2LCEA 4DR4E 4J3DA 2GO3A 2CG9A 2NN6F 4DV6E 1GZ6A 4LCHA 3KRNA 2YTPA 2DLQA 5BR8E 1J26A 5DRPA 4X66E 4DUZE 2DMIA 4NBQA 2A2DA 3M7ND 2N3GA 1Z5BA 3PYFA 3JAMC 3HXLA 1FJGE 2IESA 1A1HA 2UUCI 2YU5A 4UTGA 3VYYA 4HACB 4J8ZA 4JI2E 2YZTA 1K47A 3LNUA 2EM0A 3CDJA 3C4TA 4PRXA 2AE8A 4DR6E 5C0XF 2YTGA 2EN7A 4WSGA 2WNRB 1Z0CA 3HPZA 4F2JC 2C37B 2F8BA 2ELZA 4BS9A 1XMQE 4R2CA 4M2ZA 4DV5E 4YY3E 1H7UA 1L4SA 5F3WA 3ZKBA 4ZYHA 2LBSB 1HR0I 4JI8E 5A6AA 2EOHA 2LJUA 2L2NA 5K36E 4B3MI 3CWVA 4DR5E 5GMDA 1T39A 2O1VA 3M7NG 1KIJA 3PS1A 2V86A 2JE6A 2PNLA 5JEAB 2WP8B 2J7KA 2PO1B 3IWDA 4X64E 3QT8A 1H74A 1DQ3A 1H7SA 2EMCA 3J81C 4DV4E 4IZJD 4URLA 4IZJB 1FNMA 2V8PA 3U1YA 2K7IA 1EA6A 2M4IA 2EM4A 4LF9I 2RQLA 5AE1A 2C39B 2DRPA 4IFDE 2NA2A 5A6JA 1A1LA 4OO1C 2YTJA 2ENAA 2JOXA 2JR1A 2BBGA 2F4VI 2K4VA 2LE2A 4HTGA 3ADGA 1RR9A 2EMYA 5FLXC 1Z0BA 2WBSA 3ADIA 1QNTA 1RREA 1PJTA 2DB2A 4IJDA 1S16A 2EOEA 4MLVA 3D4JA 4LFBI 2X36A 3U1KA 1ZXNA 4K0KE 1SFEA 1N34I 3OMLA 5DNXA 1Z0WA 1YUIA 4F9AB 4ZYDA 2EORA 1ZM9A 4Q35B 3L00A 2JEBB 2R76A 2NN6A 1G2DC 1MEYC 1X5WA 3K17A 4LF4I 3L7ZA 4DPTA 4DR1I 2JEAA 3T1HI 2MDGA 2EMKA 2MC6A 4RHBB 2V89A 3K6QA 1JK1A 1XNRI 4WXCA 3B8HA 2NABA 2BR2B 4DV1I 4DV6I 3J7AM 1B63A 1UDNA 2JY9A 2EOOA 1FWKA 2UUCE 1D6TA 2V87A 1A1FA 4WUDA 2BB8A 3BGHA 2EQ1A 2YRMA 2LUPB 5C0XA 3NZKA 2B3TB 1PJQA 2M9AA 2V88A 4BHCA 5CFFE 2EOQA 1FKAE 3K1JA 4HY1A 2BV3A 2EPXA 4MU3A 4DR6I 3B82A 4BA2A 3HULA 3LTOA 4DV0I 1X3CA 2EOYA 1HR0E 1WHQA 3DD6A 4JI0I 1R6MA 3WU6A 2LUQA 3JTZA 1XMOI 1N0UA 4B3ME 1YHCA 2EMIA 3LPSA 2O1TA 1PKPA 4MU0A 3QG5C 2EP3A 1RMDA 3P3EA 5K36C 2B7TA 1WJPA 1NEIA 1MGTA 4M30A 2PO2A 3PS2A 1Y5YA 2Z5BA 2EN2A 2VF1A 2O1WA 2CTDA 5JEAF 1A1KA 4M1KA 4X64I 4FW7A 3BF2A 4LF9E 2ZBKB 3ZKDA 2EM8A 5KL7A 1N32I 1UHZA 1XHKA 2N8XA 2LV2A 4F9BB 1HNXI 2RPCA 2F4VE 5IXMB 2MC5A 1ZM4A 5KL5A 4QNKA 5A6BA 1RHYA 4WX9A 2EM9A 4R2SA 4IFDC 2NPFA 3DF6A 4LF5I 5IT9Q 1LLMC 2PO0B 5FLXQ 4BA1A 4LFBE 2NN6E 2EPAA 1Y60A 4O5GA 1QZRA 2WZOA 3IWCA 2WBTA 4TUGA 1ZAAC 4DPYA 5K36D 1EKZA 1WRJA 2V2QA 4LF4E 4AQYE 2XEXA 4DR1E 4K0KI 4DMIA 3T1HE 2DSYA 4WSPA 1XNRE 1VISA 3JU0A 3J80C 2B7VA 1Y6ZA 2YTOA 1AAYA 4DV1E 4ISAA 1SR9A 3ZM7A 1ZM3A 5ADZA 4O24A 2YU8A 1YYWA 4WYQB 2EOZA 2HGHA 2YRHA 1IQOA 5C0XE 3PYGA 3MHSC 1N3GA 4RH8A 4FW5A 5AC5A 1OJ4A 2ENHA 1G2FC 1TF3A 2L6MA 4FK5C 2EOJA 1YYKA 4RPFA 4IFDD 2ZM6I 4DU8A 1FI4A 1X49A 5EL9A 1USVA 2BA1D 2E1RA 2EN1A 4HXZA 2JP9A 2A25A 3GCMA 1A6FA 2UUBI 2WNRA 4PU9A 2EPPA 4NHRA 4DV0E 3THNA 4JI0E 1BBGA 2C37A 1UN6B 1GQEA 3C6MA 2ENCA 1XMOE 3HTXA 2VESA 4DPXA 2EPKX 4FW9A 2HHHI 5A2QC 2EM6A 2V83A 3Q6NA 2CSHA 3RMPA 1YFHA 1KKHA 4JI3I 4X62I 4JI7E 4HEIA 2JVAA 4DV7I 3P06A 2B9DA 3T1YI 1QU6A 4Z7YA 4R2AA 1FWLA 5L3JA 5JEAA 1PJSA 4AIDA 2PO1A 2EPLX 2E72A 2X7IA 2Q8UA 4KWYA 2HJJA 3PYEA 3EQ1A 2BA1G 1AH5A 1N32E 3WU5A 2JXPA 4IZJA 2CT1A 2VE7C 1HNXE 2GO4A 1EH7A 4DXLA 4ZYGA 4X65E 1PDAA 4USMA 1YH8A 2C39A 2VQEI 2YRKA 1HNZE 2LO3A 4FW4A 3ZZTA 1IBLI 4LF5E 2YSPA 3J7AG 1VI7A 5A6KA 3ECRA 1A1GA 3QT5A 5EKWA 5IT9C 3F0NA 2J7JA 1Z59A 4IZKB 2FTXB 1Z0GA 4MU4A 3AV0A 2UXBE 2NN6C 1P47A 3VK6A 2UU9I 3Q1QA 2D9HA 4MLQA 2LT7A 2JPAA 2NUGA 2EM5A 1KVKA 2Z5CB 3K85A 1O0WA 3ZZUA 2CVEA 2BA0D 3F6GA 4ZVIA 5AE2A 2JEBA 3J80Q 5LLQA 1N33I 3M6AA 3QT6A 4B3TI 4AQYI 2JYAA 1UDQA 1NHIA 2HK2A 4LCFA 2H36X 1Y4SA 2NUFA 2EFGA 2BR2A 4USKA 2YTDA 1ZBQA 5GMEA 3CDIA 2M1SA 2ZM6E 2ADRA 3C4BA 4WXDA 5C0XC 4OO1D 2LRSA 4LF7I 4U3DA 4OO1B 1PIEA 1X6EA 1NHHA 2BM1A 1N36I 4Z7CA 2IOQA 1P42A 2UUBE 4DV2I 3H4LA 1R6LA 2VQFI 4LF8I 1WXRA 2G7HA 2DIXA 4M9VC 2J65A 2NN6D 4OX9I 2YTQA 1HNWI 4FWDA 2BA0G 2IHR1 2R3VA 3C6KA 2HHHE 4ZYEA 4P78A 4GEQB 2YTEA 5A2QQ 2JT2A 2WBUA 4F9CB 4JI3E 2PNZB 1KYQA 5JEAE 4X62E 5T6JA 2EL6A 2HK3A 4DV7E 2EPZA 4ED4A 2EZ6A 2YT4A 5TSEA 1X47A 3T1YE 4JI5I 3IWBA 2UXCI 2BM0A 1KTVA 4JI4I 4WUCA 1N0VC 3BBGA 5C0XD 4JI7I 5KL4A 3MSWA 5ELWA 4DPWA 4QNJA 2ODRC 4U3BA 2LJPA 2KOUA 4MYTA 2LJHA 4O4KA 2DEIA 3PRYA 3HJCA 1ZXMA 4NXMI 1T38A 2WCC3 4BA2B 2JOBA 2VQEE 2HKJA 3WU4A 4KHPI 4KZSA 1OYPA 4IS1C 1IBLE 1IMUA 5KL2A 4B3SI 2KONA 2V85A 2MKDA 2C38B 2VF3A 4X65I 1H73A 4Q28A 2WW4A 5LMNI 4YHHI 4AM3A 2Q2EB 1HNZI 2EPNA 2PO0A 4MYUA 2EPMX 3THOB 4BCAA 2GPIA 1RQ0A 2RTXA 2GLIA 1EH8A 3VYXA 2YTIA 2UU9E 2R42A 3AUZA 1DI2A 3P3GA 4LFAI 2Z5BB 3GONA 4JI1E 4WFTA 1N33E 2CGEA 4FW3A 5LMUE 2EPCA 2UXBI 1XXEA 1TN9A 4B3TE 2EMLA 5K36B 3J7Yp 1A1IA 4PRVA 2EMAA 2ODRD 2GQ0A 2V34A 1Z0TA 5IV8B 2EPOA 1UDOA 5A6BD 4R2QA 1ZM2A 2UUAI 2DGCA 4DR2E 3ZZ0A 1OYRA 2RS7A 4JYAI 4LF7E 2N3HA 4P7DA 4MDTA 2NUEA 4R1FA 4BA1B 2V2ZA 1N36E 2GS8A 3VHTB 3QT7A 4IFDB 1STUA 2DLKA 3P76A 3F6HA 4DV2E 2EPRA 2EM3A 2VQFE 4LF8E 4OX9E 4HACA 1IBME 4OOGC 1BB8A 2HKEA 4DV3I 4OO1F 4JV5I 4BC9A 5IWAE 2LVHA 1HNWE 3ADLA 2CZ9A 4LFCI 4N4RB 1F2IG 2L2MA 5DRQA 3EPLA 4GKJI 1X6HA 1I94I 2YWQA 1Z0EA 2EMGA 3TQMA 5LL6R 4LOMA 4JI5E 2UXCE 2E5LI 1GTKA 4R03A 2OI2A 2Z5EA 2EOMA 1X48A 2LTSA 2YSOA 4JI4E 3GMEA 5JEAC 3UHMA 1JK2A 1YUJA 4DU7A 1Y4UA 1X6FA 3EPHA 4DUYE 4BBYA 2WP8A 2HFSA 2EOSA 4R2PA 4NXME 2VRDA 4KQVA 4KHPE 5FWKA 2L3JA 2L2KB 2AJ4A 4DR3I 1Z5CA 2YTFA 4B3SE 4JI6I 1XNQI 3BIDA 5LMNE 1E3PA 4YHHE 1T4LB 4N3OA 4GZNC 1NZ0A 2EOIA 4O43A 2IOPA 1Z1BA 1MG7A 1ZU1A 2YPNA 1IBKE 4OKGA 4GQUA 2IERA 4NXNI 4LTYA 3P3CA 1UBDC 2EE8A 2HC5A 4LFAE 3HPSA 3B4TA 2PNMA 4IZKA 2O1UA 2V2VA 2EQ0A 2JE6B 5JEAD 2E1MA 1YZ9A 2EWLA 4FWGA 2Z5CA 4LU9A 1YYOA 4TUIA 4JI1I 3HQ1A 5LMUI 5K36F 1NHJA 2EN3A 4OZEA 2CPNA 2UUAE 4XTJA 2FV4B 2I13A 2EPUA 4LPFA 1T4NA 4JYAE 2EM7A 4B3RI 3V5RA 3ZOQB 1J5EI 2EL5A 1DGCA 4BMJA 1UDSA 1Z5AA 1Z0VA 4DR2I 1ZBTA 1ELOA 1WHNA 5AASA 2F1DA 4FN5A 2UXDE 4DV3E 4L5NC 1S4EA 4I8OA 4DR7E 4FWHA 2EN8A 2I9IA 2GHFA 1NCSA 4JV5E 5AE3A 1RC7A 4LCGA 4LFCE 4IFDF 2UXDI 2M7QA 3EPJA 2L8TA 4LF6I 2L33A 4BHBA 4X9JA 1IBMI 4GKJE 4P7AA 2EMXA 1I94E 4I3HA 2NN6B 5IWAI 2EN6A 3OTOI 1BKNA 4DKKA 3L7ZB
chains in the Genus database with same CATH topology
4GKKI 4DR4I 2E5LE 2DMYA 2RS6A 2RSMA 5BR8I 4DPUA 3JAMQ 4X66I 4JG4A 4DUZI 3DJWA 2ZITA 1FJGI 3KWRA 4L8NA 2JWOA 3LLHA 1B62A 4DR3E 4P52A 4JI2I 4DUYI 1H72C 2KHXA 4BC7A 4JI6E 1XNQE 1USUA 3PYDA 2V8QB 1EI1A 2FGGA 4WPYA 2DEJA 3B78A 3Q6MA 1XMQI 4NXNE 4DV5I 4YY3I 2LTRA 4WUBA 2L3CA 1WUUA 4F54A 4JI8I 1IBKI 4R8OA 2HFUA 1T4OA 4DR5I 4EMDA 1U2RA 3J81Q 1UILA 3P1XA 3WU3A 4DV4I 3FIGA 1DARA 4M0VA 4B3RE 1J5EE 2LMZA 2MDRA 3ADJA 1MX0A 1HK7A 2L92A 4X8WA 3LMLA 1MU5A 1N34E 4UT4A 4LF6E 4DR7I 3H09A 3OTOE 1PVGA 2A2CA 4GKKE 4HYMA 5DNYA 4DR4E 2CG9A 4DV6E 1GZ6A 5BR8E 1J26A 4X66E 4DUZE 2A2DA 2N3GA 1Z5BA 3PYFA 3JAMC 3HXLA 1FJGE 2UUCI 4UTGA 3VYYA 4HACB 4J8ZA 4JI2E 2YZTA 1K47A 3LNUA 3C4TA 4PRXA 4DR6E 1Z0CA 3HPZA 2F8BA 4BS9A 1XMQE 4M2ZA 4DV5E 1H7UA 4YY3E 5F3WA 3ZKBA 1HR0I 2LBSB 4JI8E 2L2NA 4B3MI 3CWVA 4DR5E 5GMDA 2O1VA 1KIJA 2V86A 2PNLA 2J7KA 3IWDA 4X64E 3QT8A 1H74A 1DQ3A 1H7SA 3J81C 4IZJD 4DV4E 4URLA 4IZJB 1FNMA 2V8PA 1EA6A 2M4IA 4LF9I 5AE1A 2NA2A 2JR1A 2JOXA 2F4VI 2K4VA 2LE2A 1RR9A 3ADGA 5FLXC 1Z0BA 3ADIA 1RREA 2DB2A 4LFBI 1S16A 3D4JA 2X36A 1ZXNA 4K0KE 1N34I 3OMLA 1Z0WA 1ZM9A 4F9AB 4LF4I 3K17A 4DR1I 3T1HI 2MC6A 1XNRI 2V89A 3K6QA 3B8HA 4DV1I 3J7AM 4DV6I 1B63A 2JY9A 1FWKA 2UUCE 1D6TA 2V87A 4WUDA 2LUPB 2B3TB 5CFFE 1FKAE 2V88A 3K1JA 4HY1A 2BV3A 4DR6I 3B82A 3HULA 3LTOA 4DV0I 1HR0E 4JI0I 1WHQA 3WU6A 2LUQA 3JTZA 1XMOI 1N0UA 4B3ME 3LPSA 2O1TA 1PKPA 2B7TA 4M30A 2Z5BA 2VF1A 2O1WA 4M1KA 4X64I 4LF9E 2ZBKB 3ZKDA 1N32I 1UHZA 1XHKA 4F9BB 1HNXI 2F4VE 2MC5A 1ZM4A 2NPFA 3DF6A 4LF5I 5IT9Q 5FLXQ 4LFBE 1QZRA 2WZOA 3IWCA 4TUGA 4DPYA 1EKZA 2V2QA 4LF4E 4AQYE 2XEXA 4DR1E 4K0KI 4DMIA 3T1HE 2DSYA 4WSPA 1XNRE 1VISA 3JU0A 3J80C 2B7VA 1Y6ZA 4DV1E 1SR9A 3ZM7A 1ZM3A 5ADZA 1YYWA 4WYQB 3PYGA 1OJ4A 4RPFA 2L6MA 1YYKA 2ZM6I 4DU8A 1FI4A 1X49A 1USVA 2E1RA 4HXZA 1A6FA 2UUBI 4PU9A 4DV0E 4JI0E 4DPXA 1GQEA 3HTXA 1XMOE 4FW9A 2HHHI 5A2QC 2V83A 3Q6NA 3RMPA 4JI3I 1KKHA 4X62I 4JI7E 2JVAA 4DV7I 3P06A 2B9DA 3T1YI 1QU6A 4Z7YA 1FWLA 5L3JA 2X7IA 3PYEA 1N32E 3WU5A 4IZJA 2VE7C 1HNXE 4DXLA 4X65E 4USMA 2VQEI 1HNZE 3ZZTA 1IBLI 4LF5E 3J7AG 3QT5A 5IT9C 3F0NA 4IZKB 1Z59A 2FTXB 1Z0GA 3AV0A 2UXBE 3VK6A 2UU9I 3Q1QA 3V2UC 2NUGA 1KVKA 2Z5CB 3K85A 3ZZUA 1O0WA 3F6GA 4ZVIA 5AE2A 3J80Q 1N33I 3M6AA 3QT6A 4B3TI 4AQYI 1NHIA 2HK2A 2H36X 1Y4SA 2NUFA 2EFGA 4USKA 1ZBQA 5GMEA 2M1SA 2ZM6E 3C4BA 2LRSA 4LF7I 1PIEA 1NHHA 2BM1A 1N36I 4Z7CA 2IOQA 2UUBE 4DV2I 3H4LA 2VQFI 4LF8I 1WXRA 2G7HA 2DIXA 4OX9I 1HNWI 4FWDA 2IHR1 2R3VA 2HHHE 4P78A 4GEQB 5A2QQ 4JI3E 4F9CB 4X62E 5T6JA 2HK3A 4DV7E 4ED4A 2EZ6A 2YT4A 1X47A 3T1YE 4JI5I 3IWBA 2UXCI 2BM0A 1KTVA 4JI4I 4WUCA 1N0VC 4JI7I 3MSWA 4DPWA 2ODRC 2LJPA 2KOUA 4MYTA 2LJHA 3PRYA 2DEIA 3HJCA 1ZXMA 4NXMI 2JOBA 2VQEE 2HKJA 3WU4A 4KHPI 4KZSA 1IBLE 4B3SI 2KONA 2V85A 2VF3A 4X65I 1H73A 4Q28A 2WW4A 5LMNI 4YHHI 2Q2EB 1HNZI 4MYUA 4BCAA 3VYXA 1UEKA 2RTXA 1RQ0A 2R42A 2UU9E 3AUZA 1DI2A 4LFAI 2Z5BB 3GONA 4JI1E 4WFTA 1N33E 2CGEA 2UXBI 5LMUE 4B3TE 3J7Yp 4PRVA 2ODRD 2GQ0A 2V34A 1Z0TA 2UUAI 1ZM2A 4DR2E 3ZZ0A 2RS7A 4JYAI 4LF7E 2N3HA 4P7DA 2NUEA 4R1FA 2V2ZA 1N36E 2GS8A 3QT7A 1STUA 4DPTA 4HACA 3F6HA 4DV2E 2UXDI 2VQFE 4LF8E 4OX9E 4DV3I 1IBME 4OOGC 2HKEA 4JV5I 4BC9A 5IWAE 1HNWE 2CZ9A 3ADLA 4LFCI 2L2MA 4GKJI 1I94I 1Z0EA 5LL6R 4JI5E 2UXCE 2E5LI 4R03A 2OI2A 2Z5EA 1X48A 2LTSA 4JI4E 4DU7A 1Y4UA 4DUYE 4BBYA 2HFSA 4NXME 4KQVA 5FWKA 4KHPE 2L3JA 2L2KB 2AJ4A 4DR3I 1Z5CA 4B3SE 4JI6I 1XNQI 5LMNE 4YHHE 1T4LB 4N3OA 1NZ0A 2IOPA 1MG7A 1IBKE 4NXNI 4LTYA 4LFAE 4IZKA 3HPSA 2PNMA 2O1UA 2V2VA 2E1MA 1YZ9A 2EWLA 4FWGA 2Z5CA 4LU9A 1YYOA 4TUIA 4JI1I 3HQ1A 5LMUI 1NHJA 2CPNA 2UUAE 4XTJA 2FV4B 1T4NA 4JYAE 4B3RI 3V5RA 3ZOQB 1J5EI 4BMJA 1Z5AA 4DR2I 1Z0VA 1ZBTA 1ELOA 1WHNA 5AASA 4FN5A 2UXDE 4DV3E 4L5NC 1S4EA 4I8OA 4DR7E 4FWHA 4JV5E 5AE3A 1RC7A 4LFCE 2M7QA 2L8TA 4LF6I 2L33A 1IBMI 4GKJE 4P7AA 1I94E 4I3HA 5IWAI 3OTOI 1BKNA 4DKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK I;  4DR4 I;  2E5L E;  2DMY A;  2RS6 A;  2RSM A;  5BR8 I;  4DPU A;  3JAM Q;  4X66 I;  4JG4 A;  4DUZ I;  2ZIT A;  1FJG I;  3LLH A;  1B62 A;  4DR3 E;  4P52 A;  4JI2 I;  4DUY I;  1H72 C;  2KHX A;  4JI6 E;  1XNQ E;  3PYD A;  1EI1 A;  2DEJ A;  3B78 A;  1XMQ I;  4NXN E;  4DV5 I;  4YY3 I;  2LTR A;  4WUB A;  2L3C A;  1WUU A;  4JI8 I;  1IBK I;  2HFU A;  1T4O A;  4DR5 I;  4EMD A;  1U2R A;  3J81 Q;  1UIL A;  3P1X A;  3WU3 A;  4DV4 I;  1DAR A;  4B3R E;  1J5E E;  2MDR A;  3ADJ A;  1MX0 A;  4X8W A;  1MU5 A;  1N34 E;  4UT4 A;  4LF6 E;  4DR7 I;  3OTO E;  1PVG A;  2A2C A;  4GKK E;  4HYM A;  4DR4 E;  4DV6 E;  5BR8 E;  1J26 A;  4X66 E;  4DUZ E;  2A2D A;  2N3G A;  1Z5B A;  3PYF A;  3JAM C;  1FJG E;  2UUC I;  4UTG A;  3VYY A;  4HAC B;  4JI2 E;  1K47 A;  3LNU A;  3C4T A;  4PRX A;  4DR6 E;  1Z0C A;  1XMQ E;  4M2Z A;  4DV5 E;  4YY3 E;  1H7U A;  1HR0 I;  3ZKB A;  2LBS B;  4JI8 E;  2L2N A;  4B3M I;  3CWV A;  4DR5 E;  5GMD A;  1KIJ A;  2J7K A;  4X64 E;  3QT8 A;  1H74 A;  1H7S A;  4URL A;  3J81 C;  4DV4 E;  1FNM A;  2V8P A;  1EA6 A;  4LF9 I;  2NA2 A;  2F4V I;  1RR9 A;  3ADG A;  1Z0B A;  5FLX C;  3ADI A;  1RRE A;  2DB2 A;  4LFB I;  1S16 A;  3D4J A;  2X36 A;  1ZXN A;  4K0K E;  1N34 I;  1Z0W A;  1ZM9 A;  4LF4 I;  3K17 A;  4DR1 I;  3T1H I;  1XNR I;  3B8H A;  4DV1 I;  3J7A M;  4DV6 I;  1B63 A;  2JY9 A;  1FWK A;  2UUC E;  1D6T A;  4WUD A;  2LUP B;  2B3T B;  5CFF E;  1FKA E;  3K1J A;  4HY1 A;  2BV3 A;  4DR6 I;  3B82 A;  3HUL A;  3LTO A;  4DV0 I;  1HR0 E;  4JI0 I;  1WHQ A;  3WU6 A;  2LUQ A;  1XMO I;  1N0U A;  4B3M E;  3LPS A;  1PKP A;  2B7T A;  4M30 A;  4M1K A;  4X64 I;  4LF9 E;  2ZBK B;  3ZKD A;  1N32 I;  1UHZ A;  1XHK A;  1HNX I;  2F4V E;  1ZM4 A;  2NPF A;  4LF5 I;  5IT9 Q;  5FLX Q;  4LFB E;  1QZR A;  4DPY A;  1EKZ A;  2V2Q A;  4LF4 E;  4AQY E;  2XEX A;  4DR1 E;  4K0K I;  3T1H E;  1XNR E;  1VIS A;  3J80 C;  2B7V A;  4DV1 E;  3ZM7 A;  1ZM3 A;  1YYW A;  4WYQ B;  3PYG A;  1OJ4 A;  4RPF A;  1YYK A;  2ZM6 I;  4DU8 A;  1FI4 A;  1X49 A;  2E1R A;  4HXZ A;  1A6F A;  2UUB I;  4PU9 A;  4DV0 E;  4JI0 E;  4DPX A;  1GQE A;  3HTX A;  1XMO E;  4FW9 A;  2HHH I;  5A2Q C;  4JI3 I;  1KKH A;  4X62 I;  4JI7 E;  2JVA A;  4DV7 I;  3T1Y I;  1QU6 A;  4Z7Y A;  1FWL A;  5L3J A;  2X7I A;  3PYE A;  1N32 E;  3WU5 A;  1HNX E;  4DXL A;  4X65 E;  4USM A;  2VQE I;  1HNZ E;  3ZZT A;  1IBL I;  4LF5 E;  3J7A G;  3QT5 A;  5IT9 C;  3F0N A;  1Z59 A;  1Z0G A;  2UXB E;  2UU9 I;  3Q1Q A;  3V2U C;  2NUG A;  1KVK A;  3ZZU A;  1O0W A;  4ZVI A;  3J80 Q;  1N33 I;  3M6A A;  3QT6 A;  4B3T I;  4AQY I;  1NHI A;  2HK2 A;  2NUF A;  2EFG A;  4USK A;  5GME A;  2ZM6 E;  3C4B A;  2LRS A;  4LF7 I;  1PIE A;  1NHH A;  2BM1 A;  1N36 I;  4Z7C A;  2UUB E;  4DV2 I;  3H4L A;  2VQF I;  4LF8 I;  4OX9 I;  2DIX A;  1HNW I;  4FWD A;  2IHR 1;  2R3V A;  2HHH E;  5A2Q Q;  4JI3 E;  4X62 E;  2HK3 A;  4DV7 E;  4ED4 A;  2EZ6 A;  2YT4 A;  1X47 A;  3T1Y E;  4JI5 I;  2UXC I;  2BM0 A;  1KTV A;  4JI4 I;  4WUC A;  1N0V C;  4JI7 I;  4DPW A;  2LJP A;  4MYT A;  2LJH A;  2DEI A;  1ZXM A;  4NXM I;  2HKJ A;  2VQE E;  3WU4 A;  4KHP I;  1IBL E;  4B3S I;  2VF3 A;  4X65 I;  1H73 A;  2WW4 A;  5LMN I;  4YHH I;  2Q2E B;  1HNZ I;  4MYU A;  1UEK A;  3VYX A;  2RTX A;  1RQ0 A;  2R42 A;  2UU9 E;  1DI2 A;  4LFA I;  3GON A;  4JI1 E;  4WFT A;  1N33 E;  2UXB I;  5LMU E;  4B3T E;  3J7Y p;  4PRV A;  2V34 A;  1Z0T A;  2UUA I;  1ZM2 A;  4DR2 E;  3ZZ0 A;  2RS7 A;  4JYA I;  4LF7 E;  2N3H A;  2NUE A;  4R1F A;  2V2Z A;  1N36 E;  2GS8 A;  3QT7 A;  1STU A;  4DPT A;  4HAC A;  4DV2 E;  2UXD I;  2VQF E;  4LF8 E;  4OX9 E;  4DV3 I;  1IBM E;  4OOG C;  2HKE A;  4JV5 I;  5IWA E;  1HNW E;  2CZ9 A;  3ADL A;  4LFC I;  2L2M A;  4GKJ I;  1I94 I;  1Z0E A;  5LL6 R;  4JI5 E;  2UXC E;  2E5L I;  2OI2 A;  1X48 A;  2LTS A;  4JI4 E;  4DU7 A;  4DUY E;  2HFS A;  4NXM E;  4KQV A;  4KHP E;  2L3J A;  2L2K B;  2AJ4 A;  4DR3 I;  1Z5C A;  4B3S E;  4JI6 I;  1XNQ I;  5LMN E;  4YHH E;  1T4L B;  1NZ0 A;  1MG7 A;  1IBK E;  4NXN I;  4LFA E;  2V2V A;  1YZ9 A;  4FWG A;  1YYO A;  4JI1 I;  5LMU I;  1NHJ A;  2CPN A;  2UUA E;  4XTJ A;  1T4N A;  4JYA E;  4B3R I;  3V5R A;  1J5E I;  1Z5A A;  4DR2 I;  1Z0V A;  1ZBT A;  1ELO A;  1WHN A;  4FN5 A;  2UXD E;  4DV3 E;  1S4E A;  4DR7 E;  4FWH A;  4JV5 E;  1RC7 A;  4LFC E;  4LF6 I;  2L33 A;  1IBM I;  4GKJ E;  4P7A A;  1I94 E;  4I3H A;  5IWA I;  3OTO I;  1BKN A;  4DKK A; 
#chains in the Genus database with same CATH topology
 2YTN A;  2JEA B;  4GKK I;  3GLL A;  4DR4 I;  1IQS A;  2PRT A;  2E5L E;  2R1F A;  2DMY A;  1E3H A;  3EPK A;  2PNZ A;  2RS6 A;  3V2U C;  1OYS A;  2RSM A;  1KJK A;  5BR8 I;  4DPU A;  3JAM Q;  2O3Z A;  4X66 I;  1YPN A;  4JG4 A;  4MQY A;  5DRO A;  1EH6 A;  5KL6 A;  4DUZ I;  2MKN A;  1TF6 A;  3DJW A;  2ZIT A;  2EM2 A;  1FJG I;  2EOX A;  3KWR A;  5C0X B;  3M85 D;  4L8N A;  2JWO A;  3LLH A;  4R2D A;  1B62 A;  4MU1 A;  4DR3 E;  4P52 A;  5DRR A;  4JI2 I;  4DUY I;  1H72 C;  2KHX A;  4BC7 A;  4JI6 E;  2ELY A;  4NZV A;  1XNQ E;  1USU A;  2EMZ A;  3PYD A;  2V8Q B;  1EI1 A;  5AC4 A;  3KZY A;  2FGG A;  4WPY A;  2DEJ A;  3B78 A;  2EMW A;  4IS9 A;  2C38 A;  3Q6M A;  1B69 A;  1XMQ I;  2EN4 A;  4NXN E;  4DV5 I;  4YY3 I;  2EJ4 A;  2EOF A;  2LTR A;  4WUB A;  3M99 B;  2L3C A;  1WUU A;  4F54 A;  4JI8 I;  3UK3 C;  3H1C A;  1IBK I;  1BBO A;  4R8O A;  4F6M A;  1UEK A;  3MHH C;  1T4O A;  2EMB A;  2HFU A;  3PS3 A;  4DR5 I;  3KZZ A;  2PO2 B;  4EMD A;  1U2R A;  4AIM A;  1UIL A;  3P1X A;  3WU3 A;  3J81 Q;  4FW6 A;  3M85 G;  5K36 A;  5A69 A;  4R2R A;  5DNL A;  4DV4 I;  3FIG A;  1DAR A;  4M0V A;  4OO1 E;  2EMH A;  4B3R E;  3HKM A;  1J5E E;  2RSI A;  1A1J A;  2LMZ A;  2MDR A;  3ADJ A;  1ZR9 A;  1MX0 A;  1HK7 A;  5KL3 A;  2L92 A;  4R2E A;  4X8W A;  3LML A;  1YSA C;  1MU5 A;  4IFD A;  1N34 E;  4UT4 A;  4LF6 E;  4DR7 I;  3H09 A;  2EL4 A;  2EMF A;  3OTO E;  2EQ3 A;  1PVG A;  2A2C A;  4GKK E;  4HYM A;  4F6N A;  4OO1 A;  5DNY A;  2LCE A;  4DR4 E;  4J3D A;  2GO3 A;  2CG9 A;  2NN6 F;  4DV6 E;  1GZ6 A;  4LCH A;  3KRN A;  2YTP A;  2DLQ A;  5BR8 E;  1J26 A;  5DRP A;  4X66 E;  4DUZ E;  2DMI A;  4NBQ A;  2A2D A;  3M7N D;  2N3G A;  1Z5B A;  3PYF A;  3JAM C;  3HXL A;  1FJG E;  2IES A;  1A1H A;  2UUC I;  2YU5 A;  4UTG A;  3VYY A;  4HAC B;  4J8Z A;  4JI2 E;  2YZT A;  1K47 A;  3LNU A;  2EM0 A;  3CDJ A;  3C4T A;  4PRX A;  2AE8 A;  4DR6 E;  5C0X F;  2YTG A;  2EN7 A;  4WSG A;  2WNR B;  1Z0C A;  3HPZ A;  4F2J C;  2C37 B;  2F8B A;  2ELZ A;  4BS9 A;  1XMQ E;  4R2C A;  4M2Z A;  4DV5 E;  4YY3 E;  1H7U A;  1L4S A;  5F3W A;  3ZKB A;  4ZYH A;  2LBS B;  1HR0 I;  4JI8 E;  5A6A A;  2EOH A;  2LJU A;  2L2N A;  5K36 E;  4B3M I;  3CWV A;  4DR5 E;  5GMD A;  1T39 A;  2O1V A;  3M7N G;  1KIJ A;  3PS1 A;  2V86 A;  2JE6 A;  2PNL A;  5JEA B;  2WP8 B;  2J7K A;  2PO1 B;  3IWD A;  4X64 E;  3QT8 A;  1H74 A;  1DQ3 A;  1H7S A;  2EMC A;  3J81 C;  4DV4 E;  4IZJ D;  4URL A;  4IZJ B;  1FNM A;  2V8P A;  3U1Y A;  2K7I A;  1EA6 A;  2M4I A;  2EM4 A;  4LF9 I;  2RQL A;  5AE1 A;  2C39 B;  2DRP A;  4IFD E;  2NA2 A;  5A6J A;  1A1L A;  4OO1 C;  2YTJ A;  2ENA A;  2JOX A;  2JR1 A;  2BBG A;  2F4V I;  2K4V A;  2LE2 A;  4HTG A;  3ADG A;  1RR9 A;  2EMY A;  5FLX C;  1Z0B A;  2WBS A;  3ADI A;  1QNT A;  1RRE A;  1PJT A;  2DB2 A;  4IJD A;  1S16 A;  2EOE A;  4MLV A;  3D4J A;  4LFB I;  2X36 A;  3U1K A;  1ZXN A;  4K0K E;  1SFE A;  1N34 I;  3OML A;  5DNX A;  1Z0W A;  1YUI A;  4F9A B;  4ZYD A;  2EOR A;  1ZM9 A;  4Q35 B;  3L00 A;  2JEB B;  2R76 A;  2NN6 A;  1G2D C;  1MEY C;  1X5W A;  3K17 A;  4LF4 I;  3L7Z A;  4DPT A;  4DR1 I;  2JEA A;  3T1H I;  2MDG A;  2EMK A;  2MC6 A;  4RHB B;  2V89 A;  3K6Q A;  1JK1 A;  1XNR I;  4WXC A;  3B8H A;  2NAB A;  2BR2 B;  4DV1 I;  4DV6 I;  3J7A M;  1B63 A;  1UDN A;  2JY9 A;  2EOO A;  1FWK A;  2UUC E;  1D6T A;  2V87 A;  1A1F A;  4WUD A;  2BB8 A;  3BGH A;  2EQ1 A;  2YRM A;  2LUP B;  5C0X A;  3NZK A;  2B3T B;  1PJQ A;  2M9A A;  2V88 A;  4BHC A;  5CFF E;  2EOQ A;  1FKA E;  3K1J A;  4HY1 A;  2BV3 A;  2EPX A;  4MU3 A;  4DR6 I;  3B82 A;  4BA2 A;  3HUL A;  3LTO A;  4DV0 I;  1X3C A;  2EOY A;  1HR0 E;  1WHQ A;  3DD6 A;  4JI0 I;  1R6M A;  3WU6 A;  2LUQ A;  3JTZ A;  1XMO I;  1N0U A;  4B3M E;  1YHC A;  2EMI A;  3LPS A;  2O1T A;  1PKP A;  4MU0 A;  3QG5 C;  2EP3 A;  1RMD A;  3P3E A;  5K36 C;  2B7T A;  1WJP A;  1NEI A;  1MGT A;  4M30 A;  2PO2 A;  3PS2 A;  1Y5Y A;  2Z5B A;  2EN2 A;  2VF1 A;  2O1W A;  2CTD A;  5JEA F;  1A1K A;  4M1K A;  4X64 I;  4FW7 A;  3BF2 A;  4LF9 E;  2ZBK B;  3ZKD A;  2EM8 A;  5KL7 A;  1N32 I;  1UHZ A;  1XHK A;  2N8X A;  2LV2 A;  4F9B B;  1HNX I;  2RPC A;  2F4V E;  5IXM B;  2MC5 A;  1ZM4 A;  5KL5 A;  4QNK A;  5A6B A;  1RHY A;  4WX9 A;  2EM9 A;  4R2S A;  4IFD C;  2NPF A;  3DF6 A;  4LF5 I;  5IT9 Q;  1LLM C;  2PO0 B;  5FLX Q;  4BA1 A;  4LFB E;  2NN6 E;  2EPA A;  1Y60 A;  4O5G A;  1QZR A;  2WZO A;  3IWC A;  2WBT A;  4TUG A;  1ZAA C;  4DPY A;  5K36 D;  1EKZ A;  1WRJ A;  2V2Q A;  4LF4 E;  4AQY E;  2XEX A;  4DR1 E;  4K0K I;  4DMI A;  3T1H E;  2DSY A;  4WSP A;  1XNR E;  1VIS A;  3JU0 A;  3J80 C;  2B7V A;  1Y6Z A;  2YTO A;  1AAY A;  4DV1 E;  4ISA A;  1SR9 A;  3ZM7 A;  1ZM3 A;  5ADZ A;  4O24 A;  2YU8 A;  1YYW A;  4WYQ B;  2EOZ A;  2HGH A;  2YRH A;  1IQO A;  5C0X E;  3PYG A;  3MHS C;  1N3G A;  4RH8 A;  4FW5 A;  5AC5 A;  1OJ4 A;  2ENH A;  1G2F C;  1TF3 A;  2L6M A;  4FK5 C;  2EOJ A;  1YYK A;  4RPF A;  4IFD D;  2ZM6 I;  4DU8 A;  1FI4 A;  1X49 A;  5EL9 A;  1USV A;  2BA1 D;  2E1R A;  2EN1 A;  4HXZ A;  2JP9 A;  2A25 A;  3GCM A;  1A6F A;  2UUB I;  2WNR A;  4PU9 A;  2EPP A;  4NHR A;  4DV0 E;  3THN A;  4JI0 E;  1BBG A;  2C37 A;  1UN6 B;  1GQE A;  3C6M A;  2ENC A;  1XMO E;  3HTX A;  2VES A;  4DPX A;  2EPK X;  4FW9 A;  2HHH I;  5A2Q C;  2EM6 A;  2V83 A;  3Q6N A;  2CSH A;  3RMP A;  1YFH A;  1KKH A;  4JI3 I;  4X62 I;  4JI7 E;  4HEI A;  2JVA A;  4DV7 I;  3P06 A;  2B9D A;  3T1Y I;  1QU6 A;  4Z7Y A;  4R2A A;  1FWL A;  5L3J A;  5JEA A;  1PJS A;  4AID A;  2PO1 A;  2EPL X;  2E72 A;  2X7I A;  2Q8U A;  4KWY A;  2HJJ A;  3PYE A;  3EQ1 A;  2BA1 G;  1AH5 A;  1N32 E;  3WU5 A;  2JXP A;  4IZJ A;  2CT1 A;  2VE7 C;  1HNX E;  2GO4 A;  1EH7 A;  4DXL A;  4ZYG A;  4X65 E;  1PDA A;  4USM A;  1YH8 A;  2C39 A;  2VQE I;  2YRK A;  1HNZ E;  2LO3 A;  4FW4 A;  3ZZT A;  1IBL I;  4LF5 E;  2YSP A;  3J7A G;  1VI7 A;  5A6K A;  3ECR A;  1A1G A;  3QT5 A;  5EKW A;  5IT9 C;  3F0N A;  2J7J A;  1Z59 A;  4IZK B;  2FTX B;  1Z0G A;  4MU4 A;  3AV0 A;  2UXB E;  2NN6 C;  1P47 A;  3VK6 A;  2UU9 I;  3Q1Q A;  2D9H A;  4MLQ A;  2LT7 A;  2JPA A;  2NUG A;  2EM5 A;  1KVK A;  2Z5C B;  3K85 A;  1O0W A;  3ZZU A;  2CVE A;  2BA0 D;  3F6G A;  4ZVI A;  5AE2 A;  2JEB A;  3J80 Q;  5LLQ A;  1N33 I;  3M6A A;  3QT6 A;  4B3T I;  4AQY I;  2JYA A;  1UDQ A;  1NHI A;  2HK2 A;  4LCF A;  2H36 X;  1Y4S A;  2NUF A;  2EFG A;  2BR2 A;  4USK A;  2YTD A;  1ZBQ A;  5GME A;  3CDI A;  2M1S A;  2ZM6 E;  2ADR A;  3C4B A;  4WXD A;  5C0X C;  4OO1 D;  2LRS A;  4LF7 I;  4U3D A;  4OO1 B;  1PIE A;  1X6E A;  1NHH A;  2BM1 A;  1N36 I;  4Z7C A;  2IOQ A;  1P42 A;  2UUB E;  4DV2 I;  3H4L A;  1R6L A;  2VQF I;  4LF8 I;  1WXR A;  2G7H A;  2DIX A;  4M9V C;  2J65 A;  2NN6 D;  4OX9 I;  2YTQ A;  1HNW I;  4FWD A;  2BA0 G;  2IHR 1;  2R3V A;  3C6K A;  2HHH E;  4ZYE A;  4P78 A;  4GEQ B;  2YTE A;  5A2Q Q;  2JT2 A;  2WBU A;  4F9C B;  4JI3 E;  2PNZ B;  1KYQ A;  5JEA E;  4X62 E;  5T6J A;  2EL6 A;  2HK3 A;  4DV7 E;  2EPZ A;  4ED4 A;  2EZ6 A;  2YT4 A;  5TSE A;  1X47 A;  3T1Y E;  4JI5 I;  3IWB A;  2UXC I;  2BM0 A;  1KTV A;  4JI4 I;  4WUC A;  1N0V C;  3BBG A;  5C0X D;  4JI7 I;  5KL4 A;  3MSW A;  5ELW A;  4DPW A;  4QNJ A;  2ODR C;  4U3B A;  2LJP A;  2KOU A;  4MYT A;  2LJH A;  4O4K A;  2DEI A;  3PRY A;  3HJC A;  1ZXM A;  4NXM I;  1T38 A;  2WCC 3;  4BA2 B;  2JOB A;  2VQE E;  2HKJ A;  3WU4 A;  4KHP I;  4KZS A;  1OYP A;  4IS1 C;  1IBL E;  1IMU A;  5KL2 A;  4B3S I;  2KON A;  2V85 A;  2MKD A;  2C38 B;  2VF3 A;  4X65 I;  1H73 A;  4Q28 A;  2WW4 A;  5LMN I;  4YHH I;  4AM3 A;  2Q2E B;  1HNZ I;  2EPN A;  2PO0 A;  4MYU A;  2EPM X;  3THO B;  4BCA A;  2GPI A;  1RQ0 A;  2RTX A;  2GLI A;  1EH8 A;  3VYX A;  2YTI A;  2UU9 E;  2R42 A;  3AUZ A;  1DI2 A;  3P3G A;  4LFA I;  2Z5B B;  3GON A;  4JI1 E;  4WFT A;  1N33 E;  2CGE A;  4FW3 A;  5LMU E;  2EPC A;  2UXB I;  1XXE A;  1TN9 A;  4B3T E;  2EML A;  5K36 B;  3J7Y p;  1A1I A;  4PRV A;  2EMA A;  2ODR D;  2GQ0 A;  2V34 A;  1Z0T A;  5IV8 B;  2EPO A;  1UDO A;  5A6B D;  4R2Q A;  1ZM2 A;  2UUA I;  2DGC A;  4DR2 E;  3ZZ0 A;  1OYR A;  2RS7 A;  4JYA I;  4LF7 E;  2N3H A;  4P7D A;  4MDT A;  2NUE A;  4R1F A;  4BA1 B;  2V2Z A;  1N36 E;  2GS8 A;  3VHT B;  3QT7 A;  4IFD B;  1STU A;  2DLK A;  3P76 A;  3F6H A;  4DV2 E;  2EPR A;  2EM3 A;  2VQF E;  4LF8 E;  4OX9 E;  4HAC A;  1IBM E;  4OOG C;  1BB8 A;  2HKE A;  4DV3 I;  4OO1 F;  4JV5 I;  4BC9 A;  5IWA E;  2LVH A;  1HNW E;  3ADL A;  2CZ9 A;  4LFC I;  4N4R B;  1F2I G;  2L2M A;  5DRQ A;  3EPL A;  4GKJ I;  1X6H A;  1I94 I;  2YWQ A;  1Z0E A;  2EMG A;  3TQM A;  5LL6 R;  4LOM A;  4JI5 E;  2UXC E;  2E5L I;  1GTK A;  4R03 A;  2OI2 A;  2Z5E A;  2EOM A;  1X48 A;  2LTS A;  2YSO A;  4JI4 E;  3GME A;  5JEA C;  3UHM A;  1JK2 A;  1YUJ A;  4DU7 A;  1Y4U A;  1X6F A;  3EPH A;  4DUY E;  4BBY A;  2WP8 A;  2HFS A;  2EOS A;  4R2P A;  4NXM E;  2VRD A;  4KQV A;  4KHP E;  5FWK A;  2L3J A;  2L2K B;  2AJ4 A;  4DR3 I;  1Z5C A;  2YTF A;  4B3S E;  4JI6 I;  1XNQ I;  3BID A;  5LMN E;  1E3P A;  4YHH E;  1T4L B;  4N3O A;  4GZN C;  1NZ0 A;  2EOI A;  4O43 A;  2IOP A;  1Z1B A;  1MG7 A;  1ZU1 A;  2YPN A;  1IBK E;  4OKG A;  4GQU A;  2IER A;  4NXN I;  4LTY A;  3P3C A;  1UBD C;  2EE8 A;  2HC5 A;  4LFA E;  3HPS A;  3B4T A;  2PNM A;  4IZK A;  2O1U A;  2V2V A;  2EQ0 A;  2JE6 B;  5JEA D;  2E1M A;  1YZ9 A;  2EWL A;  4FWG A;  2Z5C A;  4LU9 A;  1YYO A;  4TUI A;  4JI1 I;  3HQ1 A;  5LMU I;  5K36 F;  1NHJ A;  2EN3 A;  4OZE A;  2CPN A;  2UUA E;  4XTJ A;  2FV4 B;  2I13 A;  2EPU A;  4LPF A;  1T4N A;  4JYA E;  2EM7 A;  4B3R I;  3V5R A;  3ZOQ B;  1J5E I;  2EL5 A;  1DGC A;  4BMJ A;  1UDS A;  1Z5A A;  1Z0V A;  4DR2 I;  1ZBT A;  1ELO A;  1WHN A;  5AAS A;  2F1D A;  4FN5 A;  2UXD E;  4DV3 E;  4L5N C;  1S4E A;  4I8O A;  4DR7 E;  4FWH A;  2EN8 A;  2I9I A;  2GHF A;  1NCS A;  4JV5 E;  5AE3 A;  1RC7 A;  4LCG A;  4LFC E;  4IFD F;  2UXD I;  2M7Q A;  3EPJ A;  2L8T A;  4LF6 I;  2L33 A;  4BHB A;  4X9J A;  1IBM I;  4GKJ E;  4P7A A;  2EMX A;  1I94 E;  4I3H A;  2NN6 B;  5IWA I;  2EN6 A;  3OTO I;  1BKN A;  4DKK A;  3L7Z B; 
#chains in the Genus database with same CATH homology
 4GKK I;  4DR4 I;  2E5L E;  2DMY A;  2RS6 A;  2RSM A;  5BR8 I;  4DPU A;  3JAM Q;  4X66 I;  4JG4 A;  4DUZ I;  3DJW A;  2ZIT A;  1FJG I;  3KWR A;  4L8N A;  2JWO A;  3LLH A;  1B62 A;  4DR3 E;  4P52 A;  4JI2 I;  4DUY I;  1H72 C;  2KHX A;  4BC7 A;  4JI6 E;  1XNQ E;  1USU A;  3PYD A;  2V8Q B;  1EI1 A;  2FGG A;  4WPY A;  2DEJ A;  3B78 A;  3Q6M A;  1XMQ I;  4NXN E;  4DV5 I;  4YY3 I;  2LTR A;  4WUB A;  2L3C A;  1WUU A;  4F54 A;  4JI8 I;  1IBK I;  4R8O A;  2HFU A;  1T4O A;  4DR5 I;  4EMD A;  1U2R A;  3J81 Q;  1UIL A;  3P1X A;  3WU3 A;  4DV4 I;  3FIG A;  1DAR A;  4M0V A;  4B3R E;  1J5E E;  2LMZ A;  2MDR A;  3ADJ A;  1MX0 A;  1HK7 A;  2L92 A;  4X8W A;  3LML A;  1MU5 A;  1N34 E;  4UT4 A;  4LF6 E;  4DR7 I;  3H09 A;  3OTO E;  1PVG A;  2A2C A;  4GKK E;  4HYM A;  5DNY A;  4DR4 E;  2CG9 A;  4DV6 E;  1GZ6 A;  5BR8 E;  1J26 A;  4X66 E;  4DUZ E;  2A2D A;  2N3G A;  1Z5B A;  3PYF A;  3JAM C;  3HXL A;  1FJG E;  2UUC I;  4UTG A;  3VYY A;  4HAC B;  4J8Z A;  4JI2 E;  2YZT A;  1K47 A;  3LNU A;  3C4T A;  4PRX A;  4DR6 E;  1Z0C A;  3HPZ A;  2F8B A;  4BS9 A;  1XMQ E;  4M2Z A;  4DV5 E;  1H7U A;  4YY3 E;  5F3W A;  3ZKB A;  1HR0 I;  2LBS B;  4JI8 E;  2L2N A;  4B3M I;  3CWV A;  4DR5 E;  5GMD A;  2O1V A;  1KIJ A;  2V86 A;  2PNL A;  2J7K A;  3IWD A;  4X64 E;  3QT8 A;  1H74 A;  1DQ3 A;  1H7S A;  3J81 C;  4IZJ D;  4DV4 E;  4URL A;  4IZJ B;  1FNM A;  2V8P A;  1EA6 A;  2M4I A;  4LF9 I;  5AE1 A;  2NA2 A;  2JR1 A;  2JOX A;  2F4V I;  2K4V A;  2LE2 A;  1RR9 A;  3ADG A;  5FLX C;  1Z0B A;  3ADI A;  1RRE A;  2DB2 A;  4LFB I;  1S16 A;  3D4J A;  2X36 A;  1ZXN A;  4K0K E;  1N34 I;  3OML A;  1Z0W A;  1ZM9 A;  4F9A B;  4LF4 I;  3K17 A;  4DR1 I;  3T1H I;  2MC6 A;  1XNR I;  2V89 A;  3K6Q A;  3B8H A;  4DV1 I;  3J7A M;  4DV6 I;  1B63 A;  2JY9 A;  1FWK A;  2UUC E;  1D6T A;  2V87 A;  4WUD A;  2LUP B;  2B3T B;  5CFF E;  1FKA E;  2V88 A;  3K1J A;  4HY1 A;  2BV3 A;  4DR6 I;  3B82 A;  3HUL A;  3LTO A;  4DV0 I;  1HR0 E;  4JI0 I;  1WHQ A;  3WU6 A;  2LUQ A;  3JTZ A;  1XMO I;  1N0U A;  4B3M E;  3LPS A;  2O1T A;  1PKP A;  2B7T A;  4M30 A;  2Z5B A;  2VF1 A;  2O1W A;  4M1K A;  4X64 I;  4LF9 E;  2ZBK B;  3ZKD A;  1N32 I;  1UHZ A;  1XHK A;  4F9B B;  1HNX I;  2F4V E;  2MC5 A;  1ZM4 A;  2NPF A;  3DF6 A;  4LF5 I;  5IT9 Q;  5FLX Q;  4LFB E;  1QZR A;  2WZO A;  3IWC A;  4TUG A;  4DPY A;  1EKZ A;  2V2Q A;  4LF4 E;  4AQY E;  2XEX A;  4DR1 E;  4K0K I;  4DMI A;  3T1H E;  2DSY A;  4WSP A;  1XNR E;  1VIS A;  3JU0 A;  3J80 C;  2B7V A;  1Y6Z A;  4DV1 E;  1SR9 A;  3ZM7 A;  1ZM3 A;  5ADZ A;  1YYW A;  4WYQ B;  3PYG A;  1OJ4 A;  4RPF A;  2L6M A;  1YYK A;  2ZM6 I;  4DU8 A;  1FI4 A;  1X49 A;  1USV A;  2E1R A;  4HXZ A;  1A6F A;  2UUB I;  4PU9 A;  4DV0 E;  4JI0 E;  4DPX A;  1GQE A;  3HTX A;  1XMO E;  4FW9 A;  2HHH I;  5A2Q C;  2V83 A;  3Q6N A;  3RMP A;  4JI3 I;  1KKH A;  4X62 I;  4JI7 E;  2JVA A;  4DV7 I;  3P06 A;  2B9D A;  3T1Y I;  1QU6 A;  4Z7Y A;  1FWL A;  5L3J A;  2X7I A;  3PYE A;  1N32 E;  3WU5 A;  4IZJ A;  2VE7 C;  1HNX E;  4DXL A;  4X65 E;  4USM A;  2VQE I;  1HNZ E;  3ZZT A;  1IBL I;  4LF5 E;  3J7A G;  3QT5 A;  5IT9 C;  3F0N A;  4IZK B;  1Z59 A;  2FTX B;  1Z0G A;  3AV0 A;  2UXB E;  3VK6 A;  2UU9 I;  3Q1Q A;  3V2U C;  2NUG A;  1KVK A;  2Z5C B;  3K85 A;  3ZZU A;  1O0W A;  3F6G A;  4ZVI A;  5AE2 A;  3J80 Q;  1N33 I;  3M6A A;  3QT6 A;  4B3T I;  4AQY I;  1NHI A;  2HK2 A;  2H36 X;  1Y4S A;  2NUF A;  2EFG A;  4USK A;  1ZBQ A;  5GME A;  2M1S A;  2ZM6 E;  3C4B A;  2LRS A;  4LF7 I;  1PIE A;  1NHH A;  2BM1 A;  1N36 I;  4Z7C A;  2IOQ A;  2UUB E;  4DV2 I;  3H4L A;  2VQF I;  4LF8 I;  1WXR A;  2G7H A;  2DIX A;  4OX9 I;  1HNW I;  4FWD A;  2IHR 1;  2R3V A;  2HHH E;  4P78 A;  4GEQ B;  5A2Q Q;  4JI3 E;  4F9C B;  4X62 E;  5T6J A;  2HK3 A;  4DV7 E;  4ED4 A;  2EZ6 A;  2YT4 A;  1X47 A;  3T1Y E;  4JI5 I;  3IWB A;  2UXC I;  2BM0 A;  1KTV A;  4JI4 I;  4WUC A;  1N0V C;  4JI7 I;  3MSW A;  4DPW A;  2ODR C;  2LJP A;  2KOU A;  4MYT A;  2LJH A;  3PRY A;  2DEI A;  3HJC A;  1ZXM A;  4NXM I;  2JOB A;  2VQE E;  2HKJ A;  3WU4 A;  4KHP I;  4KZS A;  1IBL E;  4B3S I;  2KON A;  2V85 A;  2VF3 A;  4X65 I;  1H73 A;  4Q28 A;  2WW4 A;  5LMN I;  4YHH I;  2Q2E B;  1HNZ I;  4MYU A;  4BCA A;  3VYX A;  1UEK A;  2RTX A;  1RQ0 A;  2R42 A;  2UU9 E;  3AUZ A;  1DI2 A;  4LFA I;  2Z5B B;  3GON A;  4JI1 E;  4WFT A;  1N33 E;  2CGE A;  2UXB I;  5LMU E;  4B3T E;  3J7Y p;  4PRV A;  2ODR D;  2GQ0 A;  2V34 A;  1Z0T A;  2UUA I;  1ZM2 A;  4DR2 E;  3ZZ0 A;  2RS7 A;  4JYA I;  4LF7 E;  2N3H A;  4P7D A;  2NUE A;  4R1F A;  2V2Z A;  1N36 E;  2GS8 A;  3QT7 A;  1STU A;  4DPT A;  4HAC A;  3F6H A;  4DV2 E;  2UXD I;  2VQF E;  4LF8 E;  4OX9 E;  4DV3 I;  1IBM E;  4OOG C;  2HKE A;  4JV5 I;  4BC9 A;  5IWA E;  1HNW E;  2CZ9 A;  3ADL A;  4LFC I;  2L2M A;  4GKJ I;  1I94 I;  1Z0E A;  5LL6 R;  4JI5 E;  2UXC E;  2E5L I;  4R03 A;  2OI2 A;  2Z5E A;  1X48 A;  2LTS A;  4JI4 E;  4DU7 A;  1Y4U A;  4DUY E;  4BBY A;  2HFS A;  4NXM E;  4KQV A;  5FWK A;  4KHP E;  2L3J A;  2L2K B;  2AJ4 A;  4DR3 I;  1Z5C A;  4B3S E;  4JI6 I;  1XNQ I;  5LMN E;  4YHH E;  1T4L B;  4N3O A;  1NZ0 A;  2IOP A;  1MG7 A;  1IBK E;  4NXN I;  4LTY A;  4LFA E;  4IZK A;  3HPS A;  2PNM A;  2O1U A;  2V2V A;  2E1M A;  1YZ9 A;  2EWL A;  4FWG A;  2Z5C A;  4LU9 A;  1YYO A;  4TUI A;  4JI1 I;  3HQ1 A;  5LMU I;  1NHJ A;  2CPN A;  2UUA E;  4XTJ A;  2FV4 B;  1T4N A;  4JYA E;  4B3R I;  3V5R A;  3ZOQ B;  1J5E I;  4BMJ A;  1Z5A A;  4DR2 I;  1Z0V A;  1ZBT A;  1ELO A;  1WHN A;  5AAS A;  4FN5 A;  2UXD E;  4DV3 E;  4L5N C;  1S4E A;  4I8O A;  4DR7 E;  4FWH A;  4JV5 E;  5AE3 A;  1RC7 A;  4LFC E;  2M7Q A;  2L8T A;  4LF6 I;  2L33 A;  1IBM I;  4GKJ E;  4P7A A;  1I94 E;  4I3H A;  5IWA I;  3OTO I;  1BKN A;  4DKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...