4DR3E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3E02
4DV0I 2UUAE 1YYKA 4DPYA 2X7IA 1EI1A 3T1HE 1KTVA 2E1RA 4DUZI 2N3GA 2UU9I 1N33E 4DV5I 4DR2E 1Z5BA 3J7AG 1DARA 5L3JA 2RTXA 5IT9C 4I3HA 4DV4I 2DIXA 1RC7A 5IT9Q 5FLXC 1MX0A 4MYTA 1I94E 4JV5E 1J5EE 4LF8E 1HNWE 2LBSB 1NHJA 2ZITA 3ADJA 4WFTA 4DV2E 4DR2I 4JYAI 4NXME 3Q1QA 1Z0GA 2Q2EB 4B3TI 2VQFI 4RPFA 3WU6A 4LF6E 1KVKA 4LF5E 1VISA 5LMUI 4X62E 1A6FA 2UUBI 1XMQE 1WHQA 4MYUA 2OI2A 4JI6I 1U2RA 1B63A 1NHIA 4DUYE 4B3MI 2NUGA 5LMNE 4JI8I 4YY3I 4JI5I 1RR9A 4XTJA 1ZM3A 2ZM6E 4GKKE 4KHPI 2UUCI 4FWGA 4DV7I 1K47A 1N34E 1X49A 4B3ME 5FLXQ 2J7KA 2HFSA 3V2UC 2RS7A 5A2QC 3M6AA 4DPXA 2A2DA 4JI4E 2L2KB 1DI2A 2AJ4A 1Z59A 5GMEA 2YT4A 3ADGA 5CFFE 1QZRA 4Z7CA 3C4BA 2DEIA 2L2NA 2DMYA 4YHHE 4X65I 3LNUA 2VF3A 4UT4A 3ZZTA 3P1XA 4EMDA 1N32I 4DR7E 3F0NA 1IBKI 2NA2A 4DUYI 4LFBE 1IBLI 3VYXA 1UHZA 2LJPA 1HNXI 1N36I 4JI2I 1XNRI 3B82A 2V2QA 4LFAE 2HHHE 4JI3E 1Z0CA 3QT6A 4NXNI 1IBMI 4DXLA 2F4VI 1Z0TA 3K17A 4LF9E 4FWDA 4JI2E 5A2QQ 2L3JA 2UXCI 3J7AM 4HY1A 2HHHI 1XNQE 1FWKA 4JI6E 4DV3I 1S4EA 2HK2A 4ZVIA 2RS6A 1NZ0A 2NUEA 4WUCA 4JI7E 4M30A 1HR0E 4DV7E 4HYMA 5GMDA 1T4NA 1N34I 2HK3A 4LFBI 3ZZUA 4OX9E 3QT5A 4DUZE 3J7Yp 2UXDI 3J80C 1O0WA 2UU9E 1N36E 3JAMQ 1STUA 4PU9A 3ADLA 4P7AA 4LFAI 4NXNE 4DPWA 3T1YE 4WYQB 1Z0VA 3H4LA 4HACA 4X66I 4B3SE 4YY3E 2UXDE 3K1JA 1T4OA 1FKAE 4PRVA 3OTOI 1ZBTA 3VYYA 4LF4I 2LTSA 1PKPA 4B3TE 2V2VA 2NUFA 4DPTA 1IBLE 1FNMA 4X66E 2B7VA 3LLHA 1B62A 2B3TB 4LF6I 4DR3E 4DKKA 5LMUE 1RQ0A 4DR4E 4K0KI 3JAMC 2X36A 3QT7A 4YHHI 2BM1A 4DU7A 1EKZA 2V2ZA 2UXCE 4DR4I 2LJHA 1MG7A 1YZ9A 4USKA 2N3HA 4X64E 2VQEE 4LFCI 5LL6R 3LPSA 2UXBI 1PVGA 2B7TA 2CPNA 2L2MA 2XEXA 4DV1I 1XMOE 1ELOA 3ZKBA 4LFCE 1WUUA 1J5EI 4DU8A 4DV2I 1FI4A 1H72C 1S16A 4JI1E 2R3VA 3B78A 4PRXA 4DV3E 3LTOA 3T1HI 1ZXNA 3J81C 4DV6E 1HNZI 4LF7I 5IWAE 4FWHA 4JG4A 1X47A 1N33I 4DR6I 3ADIA 1H7SA 1KIJA 4AQYE 4P52A 1ZXMA 1T4LB 2DB2A 3J81Q 1HNZE 1IBME 4DV6I 1FWLA 1I94I 2EZ6A 4LF9I 1YYOA 4JI5E 2UXBE 4DV0E 1WHNA 4DPUA 4NXMI 3PYFA 2MDRA 1ZM2A 1NHHA 2CZ9A 3GONA 2VQFE 1IBKE 1H74A 1ZM4A 4JI4I 2KHXA 4X62I 1HR0I 1XNRE 4JI7I 3C4TA 4JI3I 2L33A 1Z0EA 4GKJI 4Z7YA 2HKEA 1N0UA 3WU4A 4OX9I 4DV4E 4X65E 1Z5CA 4DR3I 1ZM9A 1FJGE 1Z5AA 1BKNA 4WUBA 4AQYI 4JI0E 4URLA 1KKHA 4LF5I 2L3CA 4FN5A 2UUBE 1X48A 3OTOE 2ZBKB 3QT8A 4JI1I 3PYGA 4JI0I 3ZKDA 4M1KA 1GQEA 4LF7E 4LF8I 1HNWI 1UILA 2UUCE 4K0KE 4KQVA 3T1YI 1J26A 4USMA 4DR5I 3D4JA 2R42A 1FJGI 3HTXA 3B8HA 2RSMA 1OJ4A 2V8PA 2WW4A 3CWVA 4HXZA 4DR1I 4X64I 1D6TA 4R1FA 3HULA 1YYWA 3WU5A 2GS8A 1N0VC 2VQEI 1H7UA 4JI8E 2LUQA 2F4VE 1H73A 4HACB 3PYDA 2E5LI 2HKJA 4JV5I 3V5RA 2JVAA 1XHKA 4KHPE 4GKKI 3PYEA 1PIEA 4DR6E 4DR1E 2UUAI 4DR7I 4B3RI 2BV3A 4DV1E 4GKJE 4FW9A 2LUPB 1MU5A 4B3SI 4M2ZA 1HNXE 4UTGA 4DV5E 3ZZ0A 4B3RE 2A2CA 4X8WA 2EFGA 4LF4E 1Z0WA 5BR8I 2IHR1 5LMNI 2DEJA 5IWAI 1EA6A 4ED4A 4DR5E 1QU6A 2LTRA 1UEKA 4JYAE 4WUDA 1XNQI 3ZM7A 2ZM6I 2V34A 1N32E 1RREA 2HFUA 5BR8E 3J80Q 1XMOI 1Z0BA 2BM0A 2LRSA 4OOGC 2E5LE 2JY9A 2NPFA 3WU3A 1XMQI
chains in the Genus database with same CATH superfamily
4DV0I 2UUAE 3UK3C 2EORA 2JEBB 4DPYA 3BIDA 2X7IA 3P3EA 4QNKA 2EPLX 2G7HA 1EI1A 2M1SA 3T1HE 2LMZA 1KTVA 2E1RA 4P78A 3TQMA 4DUZI 2YTQA 2N3GA 4R2DA 4F6NA 3PS2A 2C38A 2EOFA 2Z5BB 2UU9I 1UN6B 1N33E 4DV5I 1KYQA 4DR2E 1A1IA 2EPMX 2V88A 4BHBA 1Z5BA 3J7AG 4IFDA 1DARA 4NBQA 5L3JA 2YZTA 4GEQB 1AH5A 2RTXA 5IT9C 5A6KA 1Y60A 2JT2A 4I3HA 2EQ1A 2JEBA 4FW5A 1F2IG 1YH8A 3MHHC 4DV4I 1A1LA 2DIXA 2K4VA 1RC7A 3IWBA 2DRPA 5C0XF 5FLXC 5IT9Q 2EN3A 2CSHA 1MX0A 2EM7A 2HC5A 3FIGA 4WX9A 5KL3A 2PRTA 1J5EE 5KL2A 2LBSB 1I94E 4LF8E 4JV5E 1HNWE 4FW4A 1NHJA 2ZITA 3ADJA 4WFTA 4DV2E 4DR2I 5DNLA 4JYAI 2O1TA 3BGHA 4LOMA 4NXME 2NN6E 1A1HA 3KRNA 3Q1QA 1Z0GA 2Q2EB 4B3TI 4IFDE 5A6JA 3K85A 2VQFI 1MGTA 3GMEA 2GO3A 4RPFA 2ODRD 1A1JA 3WU6A 4LF6E 1KVKA 4MU4A 2DMIA 2HGHA 2PO1A 2EMFA 4LF5E 2JPAA 1VISA 5LMUI 5F3WA 2EN7A 1YSAC 4BCAA 4X62E 1A6FA 3B4TA 1GZ6A 1XMQE 2UUBI 2IERA 1WHQA 4R2RA 4MYUA 2MDGA 1TF6A 2OI2A 4JI6I 1U2RA 2NN6A 1B63A 1NHIA 5DNYA 4DUYE 2EPUA 4IZJA 4B3MI 2NUGA 5LMNE 4MU3A 1WJPA 4JI8I 2M4IA 4YY3I 4JI5I 5AC4A 1RR9A 4XTJA 2VRDA 4ZYEA 1ZM3A 3DJWA 2ZM6E 1YFHA 4GKKE 4KHPI 2UUCI 4FWGA 2BBGA 4DV7I 5JEAE 1K47A 1N34E 4M9VC 2A25A 2EL5A 2JXPA 1X49A 2ENHA 4B3ME 4BMJA 2BA1G 4OZEA 5FLXQ 2J7KA 2HFSA 2KONA 4MDTA 3DF6A 5TSEA 3V2UC 4BA2A 2RS7A 5A2QC 3M6AA 4DPXA 2EN8A 2A2DA 4JI4E 2L2KB 1DI2A 3MSWA 4R2PA 2AJ4A 1Z59A 2EMZA 5GMEA 4BA2B 2YT4A 3ADGA 5C0XE 5CFFE 2WP8B 1E3PA 1QZRA 4O24A 3C4BA 4Z7CA 2DEIA 4OO1C 2L2NA 2DMYA 1GTKA 1X6EA 4AM3A 3UHMA 2B9DA 1PJQA 3VK6A 4X9JA 1EH7A 4YHHE 1L4SA 4X65I 3Q6NA 3LNUA 4FW7A 2DLKA 4WSGA 3M99B 2H36X 2VF3A 1UDOA 2V8QB 4IFDF 5A6AA 3CDIA 4UT4A 3ZZTA 3P1XA 2FTXB 4EMDA 1N32I 2RPCA 2WCC3 4DR7E 3F0NA 4L8NA 1IBKI 2C38B 2Z5BA 2NA2A 4DUYI 4LFBE 2EPOA 5DROA 5JEAC 3HXLA 1WXRA 1IBLI 1DQ3A 3VYXA 4KZSA 1UHZA 2LJPA 1HNXI 2LCEA 4N3OA 1VI7A 3L00A 1N36I 2PO1B 4JI2I 3C6MA 1XNRI 5K36E 3B82A 1G2DC 2V2QA 3ZOQB 4LFAE 2HHHE 2JEAB 4JI3E 1Z0CA 2BA0D 3QT6A 4NXNI 5ADZA 2O1WA 1IBMI 2EOQA 2EPPA 4DXLA 2F4VI 1Z0TA 1A1FA 4O5GA 3K17A 4LF9E 2V83A 2AE8A 4FWDA 2MKNA 5KL7A 4JI2E 2L3JA 1E3HA 2YTEA 5A2QQ 2UXCI 5K36D 3J7AM 4ISAA 2M7QA 4HY1A 2HHHI 1XNQE 4U3DA 1FWKA 3PRYA 5K36A 4JI6E 4LTYA 1BBGA 4U3BA 4DV3I 1YPNA 1S4EA 2HK2A 5JEAF 4RH8A 1RHYA 4ZVIA 2RS6A 2CVEA 1X5WA 1NZ0A 2JYAA 2NN6B 2NUEA 3NZKA 1ZU1A 5AE3A 4WUCA 3HPSA 2ELZA 3EPKA 4R2QA 1R6MA 4JI7E 4M30A 1HR0E 2EOOA 4DV7E 4QNJA 3VHTB 1UDNA 4HYMA 5EKWA 1T4NA 5GMDA 1N34I 2GHFA 2EM6A 2EOMA 2HK3A 1XXEA 4LFBI 2ENCA 3ZZUA 2EPKX 4R2AA 4OX9E 4OO1A 2WBTA 3QT5A 3HPZA 3J7Yp 4DUZE 3KWRA 4OO1F 2UXDI 1X6FA 3L7ZB 3J80C 1O0WA 2UU9E 1N36E 2JR1A 2CTDA 3JAMQ 1STUA 4P7DA 4PU9A 3ADLA 4P7AA 2RSIA 4LFAI 3GCMA 2EPNA 1B69A 1OYSA 2EOZA 4NXNE 4DPWA 3T1YE 4WYQB 1Z0VA 3H4LA 4HACA 4X66I 2YU8A 4B3SE 2EE8A 2L8TA 4R03A 4YY3E 2YRKA 2KOUA 1Z1BA 2YTDA 1AAYA 2UXDE 2BA0G 5KL5A 2PO2B 3K1JA 4IS9A 1T4OA 3HQ1A 1FKAE 2C37A 4HEIA 2EL6A 2WBSA 4PRVA 3OTOI 2R76A 3KZYA 3EPLA 1BBOA 1ZBTA 2WBUA 3P3GA 3VYYA 4IJDA 2EMXA 4LF4I 2LTSA 1PKPA 4B3TE 2V2VA 2NUFA 1JK2A 4IZKA 2EMWA 4DPTA 1IBLE 1FNMA 4X66E 2B7VA 4M0VA 3U1YA 2NN6C 3LLHA 1B62A 4NZVA 2CT1A 3WU3A 4MYTA 2B3TB 1RMDA 4LF6I 2EP3A 2EM4A 4DR3E 5JEAB 5IV8B 3KZZA 3M7ND 4DKKA 5LMUE 4BBYA 2GPIA 1RQ0A 2MKDA 2YTNA 1DGCA 4DR4E 2PO2A 2PO0B 2C39B 2EMHA 2V85A 4IS1C 2JE6B 4K0KI 2J7JA 3JAMC 3P3CA 2BA1D 5A69A 1NCSA 2X36A 2WNRB 3QT7A 4YHHI 2BM1A 4N4RB 4FW3A 1YUJA 2YPNA 4IFDD 2LO3A 4DU7A 2EN4A 1EKZA 2V2ZA 2DGCA 2UXCE 2EOIA 4DR4I 2ODRC 2JE6A 2LJHA 1MG7A 1G2FC 4MU1A 1YZ9A 4USKA 2PO0A 4LCFA 2N3HA 4X64E 3M7NG 3C6KA 2DSYA 2EJ4A 5JEAA 2VQEE 2EM2A 4TUIA 5LLQA 4LCHA 2ENAA 1PDAA 4LFCI 2ELYA 2JOBA 2PNZA 5LL6R 3LPSA 2UXBI 1PVGA 2BR2B 5ELWA 4BA1A 2EPXA 5AE2A 2V87A 2ADRA 4WXCA 2B7TA 2CPNA 2L2MA 2EMBA 2MC6A 1T38A 2CG9A 2XEXA 3PS3A 4DV1I 2EMGA 3QG5C 1XMOE 1ELOA 2PNMA 3ZKBA 4LFCE 5C0XA 2I13A 1WUUA 2EMIA 5FWKA 1J5EI 4DU8A 4DV2I 1UBDC 1FI4A 1H72C 2IOQA 2EM8A 3PYFA 3RMPA 1USVA 3ECRA 2WNRA 1S16A 4IZJD 3LMLA 4JI1E 3PS1A 4F2JC 2R3VA 3B78A 4DV3E 4PRXA 2LE2A 1BB8A 2FGGA 3LTOA 5C0XB 3T1HI 1USUA 3J81C 1ZXNA 1KJKA 4DV6E 1HNZI 2YWQA 4MLQA 4F54A 1MEYC 5IWAE 4LF7I 2K7IA 4FWHA 4JG4A 2E1MA 2LVHA 4BS9A 1X47A 1N33I 3CDJA 2JWOA 4F9AB 2YRMA 4DR6I 3F6HA 3ADIA 1H7SA 2Z5CB 1KIJA 4AQYE 4P52A 4LU9A 1OYPA 1NEIA 1ZXMA 1T4LB 3MHSC 2DB2A 3J81Q 4J8ZA 1HNZE 1IBME 4DV6I 1FWLA 4LCGA 1I94I 2EZ6A 4LF9I 5EL9A 1YYOA 4JI5E 1N3GA 1UDSA 2Z5EA 4AIMA 2O3ZA 4GQUA 4BHCA 2UXBE 4DV0E 1WHNA 3K6QA 2EOJA 4DPUA 4NXMI 2JP9A 2MDRA 1ZM2A 2MC5A 1NHHA 5A6BD 2E72A 3F6GA 2CZ9A 3GONA 1QNTA 2VQFE 1IBKE 1H74A 2EM3A 1ZM4A 2NN6D 4Q28A 1JK1A 4JI4I 5KL4A 3L7ZA 3H1CA 2GLIA 2KHXA 4F9CB 2YRHA 4X62I 2EWLA 1XNRE 1HR0I 4JI7I 1T39A 3C4TA 3H09A 2JEAA 4JI3I 1X6HA 2L33A 1X3CA 4BC9A 5IXMB 1Z0EA 5C0XC 4NHRA 4GKJI 4O43A 4Z7YA 4O4KA 4R2SA 2HKEA 1N0UA 2EN1A 3WU4A 4OO1E 4OX9I 4DV4E 4X65E 2YTGA 4ZYGA 2EOYA 2EQ3A 5JEAD 5DNXA 2LT7A 1Z5CA 1P47A 4DR3I 1ZM9A 1FJGE 4IFDC 3HJCA 2BB8A 4FW6A 3GLLA 1Z5AA 2YTFA 1UDQA 1BKNA 4OKGA 2EPRA 4WUBA 4AQYI 2EM9A 4JI0E 2CGEA 4L5NC 4URLA 2WZOA 3P06A 1KKHA 2M9AA 2I9IA 2V89A 4Q35B 4F9BB 2O1VA 2L3CA 2PNLA 4LF5I 5K36C 2EOSA 4I8OA 4ZYDA 4FN5A 1PJSA 2C37B 1Y6ZA 5AASA 2UUBE 2J65A 4J3DA 4ZYHA 1HK7A 2EL4A 2YSOA 1X48A 3OTOE 3THOB 2F1DA 4R8OA 2ZBKB 2GQ0A 1WRJA 5DRRA 3QT8A 4JI1I 3PYGA 2R1FA 2YU5A 3EPHA 4JI0I 2LJUA 2FV4B 2VE7C 3ZKDA 4M1KA 1GQEA 1SFEA 3BBGA 4LF7E 2EMAA 5C0XD 2HJJA 1EH8A 4LF8I 1HNWI 4FK5C 2JOXA 2L92A 1UILA 2UUCE 1Y5YA 1P42A 3P76A 4OO1B 5DRQA 2YSPA 4K0KE 3HKMA 2Q8UA 2YTPA 4KQVA 5K36F 3M85G 2V86A 3T1YI 1PJTA 4LPFA 1J26A 1R6LA 3JU0A 4BA1B 2EN2A 3EPJA 4USMA 2EMLA 4IFDB 2F8BA 2EOXA 3AV0A 3D4JA 4DR5I 4WXDA 1ZBQA 2R42A 2EPCA 2Z5CA 1FJGI 3HTXA 4WPYA 3B8HA 4R2CA 2RSMA 1OJ4A 3IWCA 2V8PA 2WW4A 3CWVA 2IOPA 4HXZA 4DR1I 5AE1A 4X64I 2GO4A 2YTJA 1D6TA 4R1FA 3HULA 1YYWA 3WU5A 1A1GA 2GS8A 5AC5A 4OO1D 1N0VC 2WP8A 2VQEI 1H7UA 3DD6A 4JI8E 2LUQA 5K36B 2F4VE 1TF3A 4WSPA 1Y4SA 1H73A 4HACB 3PYDA 2IESA 2E5LI 3M85D 5KL6A 2HKJA 4JV5I 3V5RA 3JTZA 2EQ0A 2JVAA 1XHKA 2EMYA 4MLVA 4KHPE 5T6JA 3PYEA 1PIEA 4GKKI 4MU0A 4DR6E 4DR1E 2VESA 2UUAI 4DR7I 4B3RI 2BV3A 4DV1E 3OMLA 4GKJE 4FW9A 4TUGA 3BF2A 2LUPB 2YTIA 2EOHA 1MU5A 2O1UA 2EM5A 4B3SI 4M2ZA 1HNXE 2EPAA 1YUIA 1ZR9A 4UTGA 4DV5E 2YTOA 2EN6A 2BR2A 3THNA 3ZZ0A 4GZNC 2NABA 4R2EA 4B3RE 2A2CA 1SR9A 2PNZB 4X8WA 1ZAAC 4IZKB 2EMKA 1YHCA 2EFGA 4IZJB 2N8XA 4LF4E 5DRPA 3U1KA 1Z0WA 3Q6MA 5BR8I 3EQ1A 4BC7A 2IHR1 2VF1A 2NN6F 4MQYA 2LV2A 5LMNI 2DEJA 5IWAI 1EA6A 1OYRA 4ED4A 4DR5E 1QU6A 2LTRA 1IQOA 2EPZA 2L6MA 5A6BA 1UEKA 4JYAE 4WUDA 1XNQI 1LLMC 1IMUA 3ZM7A 4KWYA 2ZM6I 1IQSA 4DMIA 2V34A 3IWDA 1EH6A 1N32E 1RREA 1A1KA 1Y4UA 2HFUA 5BR8E 3AUZA 4AIDA 3J80Q 4HTGA 2EMCA 1XMOI 1Z0BA 2BM0A 2LRSA 2DLQA 1TN9A 4OOGC 2E5LE 4RHBB 2JY9A 2NPFA 2D9HA 1YYKA 2EOEA 2C39A 2RQLA 1XMQI 2EM0A 4F6MA
chains in the Genus database with same CATH topology
4DV0I 2UUAE 4DPYA 2X7IA 2G7HA 1EI1A 2M1SA 3T1HE 2LMZA 1KTVA 2E1RA 4P78A 4DUZI 2N3GA 2Z5BB 2UU9I 1N33E 4DV5I 4DR2E 2V88A 1Z5BA 3J7AG 1DARA 5L3JA 2YZTA 4GEQB 2RTXA 5IT9C 4I3HA 4DV4I 2DIXA 2K4VA 1RC7A 3IWBA 5IT9Q 5FLXC 1MX0A 4MYTA 3FIGA 1I94E 4JV5E 1J5EE 4LF8E 1HNWE 2LBSB 1NHJA 2ZITA 3ADJA 4WFTA 4DV2E 4DR2I 4JYAI 2O1TA 4NXME 3Q1QA 1Z0GA 2Q2EB 4B3TI 3K85A 2VQFI 4RPFA 2ODRD 3WU6A 4LF6E 1KVKA 4LF5E 1VISA 5LMUI 5F3WA 4BCAA 4X62E 1A6FA 1GZ6A 1XMQE 2UUBI 1WHQA 4MYUA 2OI2A 4JI6I 1U2RA 1B63A 1NHIA 5DNYA 4DUYE 4IZJA 4B3MI 2NUGA 5LMNE 4JI8I 2M4IA 4YY3I 4JI5I 1RR9A 4XTJA 1ZM3A 3DJWA 2ZM6E 4GKKE 4KHPI 2UUCI 4FWGA 4DV7I 1K47A 1N34E 1X49A 4B3ME 4BMJA 5FLXQ 2J7KA 2HFSA 2KONA 3DF6A 3V2UC 2RS7A 5A2QC 3M6AA 4DPXA 2A2DA 4JI4E 2L2KB 1DI2A 3MSWA 2AJ4A 1Z59A 5GMEA 2YT4A 3ADGA 5CFFE 1QZRA 4Z7CA 3C4BA 2DEIA 2L2NA 2DMYA 2B9DA 3VK6A 4YHHE 4X65I 3Q6NA 3LNUA 2H36X 2VF3A 2V8QB 4UT4A 3ZZTA 3P1XA 2FTXB 4EMDA 1N32I 4DR7E 3F0NA 4L8NA 1IBKI 2Z5BA 2NA2A 4DUYI 4LFBE 1IBLI 3HXLA 1WXRA 1DQ3A 3VYXA 4KZSA 1UHZA 2LJPA 1HNXI 4N3OA 1N36I 4JI2I 1XNRI 3B82A 2V2QA 3ZOQB 4LFAE 2HHHE 4JI3E 1Z0CA 3QT6A 4NXNI 5ADZA 2O1WA 1IBMI 4DXLA 2F4VI 1Z0TA 3K17A 4LF9E 2V83A 4FWDA 4JI2E 5A2QQ 2L3JA 2UXCI 3J7AM 2M7QA 4HY1A 2HHHI 1XNQE 1FWKA 3PRYA 4JI6E 4LTYA 4DV3I 1S4EA 2HK2A 4ZVIA 2RS6A 1NZ0A 2NUEA 4WUCA 5AE3A 3HPSA 4JI7E 4M30A 1HR0E 4DV7E 4HYMA 5GMDA 1T4NA 1N34I 2HK3A 4LFBI 3ZZUA 4OX9E 3QT5A 3HPZA 3J7Yp 4DUZE 3KWRA 2UXDI 3J80C 1O0WA 2UU9E 1N36E 2JR1A 3JAMQ 1STUA 4P7DA 4PU9A 3ADLA 4P7AA 4LFAI 4NXNE 4DPWA 3T1YE 4WYQB 1Z0VA 3H4LA 4HACA 4X66I 4B3SE 2L8TA 4R03A 4YY3E 2UXDE 2KOUA 3K1JA 1T4OA 3HQ1A 1FKAE 4PRVA 3OTOI 1ZBTA 3VYYA 4LF4I 2LTSA 1PKPA 4B3TE 2V2VA 2NUFA 4IZKA 4DPTA 1IBLE 1FNMA 4X66E 2B7VA 4M0VA 3LLHA 1B62A 3WU3A 2B3TB 4LF6I 4DR3E 4DKKA 5LMUE 4BBYA 1RQ0A 4DR4E 2V85A 4K0KI 3JAMC 2X36A 3QT7A 4YHHI 2BM1A 4DU7A 1EKZA 2V2ZA 2UXCE 4DR4I 2ODRC 2LJHA 1MG7A 1YZ9A 4USKA 2N3HA 4X64E 2DSYA 2VQEE 4TUIA 4LFCI 2JOBA 5LL6R 3LPSA 2UXBI 1PVGA 5AE2A 2V87A 2L2MA 2B7TA 2MC6A 2CPNA 2CG9A 2XEXA 4DV1I 1XMOE 1ELOA 2PNMA 3ZKBA 4LFCE 1WUUA 1J5EI 5FWKA 4DU8A 4DV2I 1FI4A 1H72C 2IOQA 3RMPA 1USVA 1S16A 4IZJD 3LMLA 4JI1E 2R3VA 3B78A 4PRXA 4DV3E 2LE2A 2FGGA 3LTOA 3T1HI 1USUA 3J81C 1ZXNA 4DV6E 1HNZI 4LF7I 4F54A 5IWAE 4FWHA 4JG4A 2E1MA 4BS9A 1X47A 1N33I 2JWOA 4F9AB 4DR6I 3F6HA 3ADIA 1H7SA 2Z5CB 1KIJA 4AQYE 4P52A 4LU9A 1ZXMA 1T4LB 2DB2A 3J81Q 4J8ZA 1HNZE 1IBME 4DV6I 1FWLA 1I94I 2EZ6A 4LF9I 1YYOA 4JI5E 2Z5EA 2UXBE 4DV0E 1WHNA 3K6QA 4DPUA 4NXMI 2MDRA 1ZM2A 2MC5A 1NHHA 2CZ9A 3GONA 3F6GA 3PYFA 2VQFE 1IBKE 1H74A 1ZM4A 4Q28A 4JI4I 2KHXA 4F9CB 4X62I 1HR0I 2EWLA 1XNRE 4JI7I 3C4TA 3H09A 4JI3I 2L33A 4BC9A 1Z0EA 4GKJI 4Z7YA 2HKEA 1N0UA 3WU4A 4OX9I 4DV4E 4X65E 1Z5CA 4DR3I 1ZM9A 1FJGE 3HJCA 1Z5AA 1BKNA 4WUBA 4AQYI 4JI0E 2CGEA 4L5NC 4URLA 2WZOA 3P06A 1KKHA 4F9BB 2V89A 2PNLA 2O1VA 4LF5I 2L3CA 4I8OA 4FN5A 1Y6ZA 5AASA 2UUBE 1HK7A 1X48A 3OTOE 4R8OA 2ZBKB 2GQ0A 3QT8A 4JI1I 3PYGA 4JI0I 2FV4B 2VE7C 3ZKDA 4M1KA 1GQEA 4LF7E 4LF8I 1HNWI 2JOXA 2L92A 1UILA 2UUCE 4K0KE 4KQVA 2V86A 3T1YI 1J26A 3JU0A 4USMA 2F8BA 3AV0A 4DR5I 3D4JA 1ZBQA 2R42A 2Z5CA 1FJGI 3HTXA 4WPYA 3B8HA 2RSMA 1OJ4A 3IWCA 2V8PA 2WW4A 3CWVA 2IOPA 4HXZA 4DR1I 5AE1A 4X64I 1D6TA 4R1FA 3HULA 1YYWA 3WU5A 2GS8A 1N0VC 2VQEI 1H7UA 4JI8E 2LUQA 2F4VE 1Y4SA 4WSPA 1H73A 4HACB 3PYDA 2E5LI 2HKJA 4JV5I 3V5RA 3JTZA 2JVAA 1XHKA 4KHPE 4GKKI 5T6JA 3PYEA 1PIEA 4DR6E 4DR1E 2UUAI 4DR7I 4B3RI 2BV3A 4DV1E 3OMLA 4GKJE 4FW9A 4TUGA 2LUPB 1MU5A 2O1UA 4B3SI 4M2ZA 1HNXE 4UTGA 4DV5E 3ZZ0A 4B3RE 2A2CA 1SR9A 4X8WA 4IZJB 4IZKB 2EFGA 4LF4E 1Z0WA 3Q6MA 5BR8I 4BC7A 2IHR1 2VF1A 5LMNI 2DEJA 5IWAI 1EA6A 4ED4A 4DR5E 1QU6A 2LTRA 2L6MA 1UEKA 4JYAE 4WUDA 1XNQI 3ZM7A 2ZM6I 4DMIA 2V34A 3IWDA 1N32E 1RREA 1Y4UA 2HFUA 5BR8E 3AUZA 3J80Q 1XMOI 1Z0BA 2BM0A 2LRSA 4OOGC 2E5LE 2JY9A 2NPFA 1YYKA 1XMQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 I;  2UUA E;  1YYK A;  4DPY A;  2X7I A;  1EI1 A;  3T1H E;  1KTV A;  2E1R A;  4DUZ I;  2N3G A;  2UU9 I;  1N33 E;  4DV5 I;  4DR2 E;  1Z5B A;  3J7A G;  1DAR A;  5L3J A;  2RTX A;  5IT9 C;  4I3H A;  4DV4 I;  2DIX A;  1RC7 A;  5IT9 Q;  5FLX C;  1MX0 A;  4MYT A;  1I94 E;  4JV5 E;  1J5E E;  4LF8 E;  1HNW E;  2LBS B;  1NHJ A;  2ZIT A;  3ADJ A;  4WFT A;  4DV2 E;  4DR2 I;  4JYA I;  4NXM E;  3Q1Q A;  1Z0G A;  2Q2E B;  4B3T I;  2VQF I;  4RPF A;  3WU6 A;  4LF6 E;  1KVK A;  4LF5 E;  1VIS A;  5LMU I;  4X62 E;  1A6F A;  2UUB I;  1XMQ E;  1WHQ A;  4MYU A;  2OI2 A;  4JI6 I;  1U2R A;  1B63 A;  1NHI A;  4DUY E;  4B3M I;  2NUG A;  5LMN E;  4JI8 I;  4YY3 I;  4JI5 I;  1RR9 A;  4XTJ A;  1ZM3 A;  2ZM6 E;  4GKK E;  4KHP I;  2UUC I;  4FWG A;  4DV7 I;  1K47 A;  1N34 E;  1X49 A;  4B3M E;  5FLX Q;  2J7K A;  2HFS A;  3V2U C;  2RS7 A;  5A2Q C;  3M6A A;  4DPX A;  2A2D A;  4JI4 E;  2L2K B;  1DI2 A;  2AJ4 A;  1Z59 A;  5GME A;  2YT4 A;  3ADG A;  5CFF E;  1QZR A;  4Z7C A;  3C4B A;  2DEI A;  2L2N A;  2DMY A;  4YHH E;  4X65 I;  3LNU A;  2VF3 A;  4UT4 A;  3ZZT A;  3P1X A;  4EMD A;  1N32 I;  4DR7 E;  3F0N A;  1IBK I;  2NA2 A;  4DUY I;  4LFB E;  1IBL I;  3VYX A;  1UHZ A;  2LJP A;  1HNX I;  1N36 I;  4JI2 I;  1XNR I;  3B82 A;  2V2Q A;  4LFA E;  2HHH E;  4JI3 E;  1Z0C A;  3QT6 A;  4NXN I;  1IBM I;  4DXL A;  2F4V I;  1Z0T A;  3K17 A;  4LF9 E;  4FWD A;  4JI2 E;  5A2Q Q;  2L3J A;  2UXC I;  3J7A M;  4HY1 A;  2HHH I;  1XNQ E;  1FWK A;  4JI6 E;  4DV3 I;  1S4E A;  2HK2 A;  4ZVI A;  2RS6 A;  1NZ0 A;  2NUE A;  4WUC A;  4JI7 E;  4M30 A;  1HR0 E;  4DV7 E;  4HYM A;  5GMD A;  1T4N A;  1N34 I;  2HK3 A;  4LFB I;  3ZZU A;  4OX9 E;  3QT5 A;  4DUZ E;  3J7Y p;  2UXD I;  3J80 C;  1O0W A;  2UU9 E;  1N36 E;  3JAM Q;  1STU A;  4PU9 A;  3ADL A;  4P7A A;  4LFA I;  4NXN E;  4DPW A;  3T1Y E;  4WYQ B;  1Z0V A;  3H4L A;  4HAC A;  4X66 I;  4B3S E;  4YY3 E;  2UXD E;  3K1J A;  1T4O A;  1FKA E;  4PRV A;  3OTO I;  1ZBT A;  3VYY A;  4LF4 I;  2LTS A;  1PKP A;  4B3T E;  2V2V A;  2NUF A;  4DPT A;  1IBL E;  1FNM A;  4X66 E;  2B7V A;  3LLH A;  1B62 A;  2B3T B;  4LF6 I;  4DR3 E;  4DKK A;  5LMU E;  1RQ0 A;  4DR4 E;  4K0K I;  3JAM C;  2X36 A;  3QT7 A;  4YHH I;  2BM1 A;  4DU7 A;  1EKZ A;  2V2Z A;  2UXC E;  4DR4 I;  2LJH A;  1MG7 A;  1YZ9 A;  4USK A;  2N3H A;  4X64 E;  2VQE E;  4LFC I;  5LL6 R;  3LPS A;  2UXB I;  1PVG A;  2B7T A;  2CPN A;  2L2M A;  2XEX A;  4DV1 I;  1XMO E;  1ELO A;  3ZKB A;  4LFC E;  1WUU A;  1J5E I;  4DU8 A;  4DV2 I;  1FI4 A;  1H72 C;  1S16 A;  4JI1 E;  2R3V A;  3B78 A;  4PRX A;  4DV3 E;  3LTO A;  3T1H I;  1ZXN A;  3J81 C;  4DV6 E;  1HNZ I;  4LF7 I;  5IWA E;  4FWH A;  4JG4 A;  1X47 A;  1N33 I;  4DR6 I;  3ADI A;  1H7S A;  1KIJ A;  4AQY E;  4P52 A;  1ZXM A;  1T4L B;  2DB2 A;  3J81 Q;  1HNZ E;  1IBM E;  4DV6 I;  1FWL A;  1I94 I;  2EZ6 A;  4LF9 I;  1YYO A;  4JI5 E;  2UXB E;  4DV0 E;  1WHN A;  4DPU A;  4NXM I;  3PYF A;  2MDR A;  1ZM2 A;  1NHH A;  2CZ9 A;  3GON A;  2VQF E;  1IBK E;  1H74 A;  1ZM4 A;  4JI4 I;  2KHX A;  4X62 I;  1HR0 I;  1XNR E;  4JI7 I;  3C4T A;  4JI3 I;  2L33 A;  1Z0E A;  4GKJ I;  4Z7Y A;  2HKE A;  1N0U A;  3WU4 A;  4OX9 I;  4DV4 E;  4X65 E;  1Z5C A;  4DR3 I;  1ZM9 A;  1FJG E;  1Z5A A;  1BKN A;  4WUB A;  4AQY I;  4JI0 E;  4URL A;  1KKH A;  4LF5 I;  2L3C A;  4FN5 A;  2UUB E;  1X48 A;  3OTO E;  2ZBK B;  3QT8 A;  4JI1 I;  3PYG A;  4JI0 I;  3ZKD A;  4M1K A;  1GQE A;  4LF7 E;  4LF8 I;  1HNW I;  1UIL A;  2UUC E;  4K0K E;  4KQV A;  3T1Y I;  1J26 A;  4USM A;  4DR5 I;  3D4J A;  2R42 A;  1FJG I;  3HTX A;  3B8H A;  2RSM A;  1OJ4 A;  2V8P A;  2WW4 A;  3CWV A;  4HXZ A;  4DR1 I;  4X64 I;  1D6T A;  4R1F A;  3HUL A;  1YYW A;  3WU5 A;  2GS8 A;  1N0V C;  2VQE I;  1H7U A;  4JI8 E;  2LUQ A;  2F4V E;  1H73 A;  4HAC B;  3PYD A;  2E5L I;  2HKJ A;  4JV5 I;  3V5R A;  2JVA A;  1XHK A;  4KHP E;  4GKK I;  3PYE A;  1PIE A;  4DR6 E;  4DR1 E;  2UUA I;  4DR7 I;  4B3R I;  2BV3 A;  4DV1 E;  4GKJ E;  4FW9 A;  2LUP B;  1MU5 A;  4B3S I;  4M2Z A;  1HNX E;  4UTG A;  4DV5 E;  3ZZ0 A;  4B3R E;  2A2C A;  4X8W A;  2EFG A;  4LF4 E;  1Z0W A;  5BR8 I;  2IHR 1;  5LMN I;  2DEJ A;  5IWA I;  1EA6 A;  4ED4 A;  4DR5 E;  1QU6 A;  2LTR A;  1UEK A;  4JYA E;  4WUD A;  1XNQ I;  3ZM7 A;  2ZM6 I;  2V34 A;  1N32 E;  1RRE A;  2HFU A;  5BR8 E;  3J80 Q;  1XMO I;  1Z0B A;  2BM0 A;  2LRS A;  4OOG C;  2E5L E;  2JY9 A;  2NPF A;  3WU3 A;  1XMQ I; 
#chains in the Genus database with same CATH topology
 4DV0 I;  2UUA E;  3UK3 C;  2EOR A;  2JEB B;  4DPY A;  3BID A;  2X7I A;  3P3E A;  4QNK A;  2EPL X;  2G7H A;  1EI1 A;  2M1S A;  3T1H E;  2LMZ A;  1KTV A;  2E1R A;  4P78 A;  3TQM A;  4DUZ I;  2YTQ A;  2N3G A;  4R2D A;  4F6N A;  3PS2 A;  2C38 A;  2EOF A;  2Z5B B;  2UU9 I;  1UN6 B;  1N33 E;  4DV5 I;  1KYQ A;  4DR2 E;  1A1I A;  2EPM X;  2V88 A;  4BHB A;  1Z5B A;  3J7A G;  4IFD A;  1DAR A;  4NBQ A;  5L3J A;  2YZT A;  4GEQ B;  1AH5 A;  2RTX A;  5IT9 C;  5A6K A;  1Y60 A;  2JT2 A;  4I3H A;  2EQ1 A;  2JEB A;  4FW5 A;  1F2I G;  1YH8 A;  3MHH C;  4DV4 I;  1A1L A;  2DIX A;  2K4V A;  1RC7 A;  3IWB A;  2DRP A;  5C0X F;  5FLX C;  5IT9 Q;  2EN3 A;  2CSH A;  1MX0 A;  2EM7 A;  2HC5 A;  3FIG A;  4WX9 A;  5KL3 A;  2PRT A;  1J5E E;  5KL2 A;  2LBS B;  1I94 E;  4LF8 E;  4JV5 E;  1HNW E;  4FW4 A;  1NHJ A;  2ZIT A;  3ADJ A;  4WFT A;  4DV2 E;  4DR2 I;  5DNL A;  4JYA I;  2O1T A;  3BGH A;  4LOM A;  4NXM E;  2NN6 E;  1A1H A;  3KRN A;  3Q1Q A;  1Z0G A;  2Q2E B;  4B3T I;  4IFD E;  5A6J A;  3K85 A;  2VQF I;  1MGT A;  3GME A;  2GO3 A;  4RPF A;  2ODR D;  1A1J A;  3WU6 A;  4LF6 E;  1KVK A;  4MU4 A;  2DMI A;  2HGH A;  2PO1 A;  2EMF A;  4LF5 E;  2JPA A;  1VIS A;  5LMU I;  5F3W A;  2EN7 A;  1YSA C;  4BCA A;  4X62 E;  1A6F A;  3B4T A;  1GZ6 A;  1XMQ E;  2UUB I;  2IER A;  1WHQ A;  4R2R A;  4MYU A;  2MDG A;  1TF6 A;  2OI2 A;  4JI6 I;  1U2R A;  2NN6 A;  1B63 A;  1NHI A;  5DNY A;  4DUY E;  2EPU A;  4IZJ A;  4B3M I;  2NUG A;  5LMN E;  4MU3 A;  1WJP A;  4JI8 I;  2M4I A;  4YY3 I;  4JI5 I;  5AC4 A;  1RR9 A;  4XTJ A;  2VRD A;  4ZYE A;  1ZM3 A;  3DJW A;  2ZM6 E;  1YFH A;  4GKK E;  4KHP I;  2UUC I;  4FWG A;  2BBG A;  4DV7 I;  5JEA E;  1K47 A;  1N34 E;  4M9V C;  2A25 A;  2EL5 A;  2JXP A;  1X49 A;  2ENH A;  4B3M E;  4BMJ A;  2BA1 G;  4OZE A;  5FLX Q;  2J7K A;  2HFS A;  2KON A;  4MDT A;  3DF6 A;  5TSE A;  3V2U C;  4BA2 A;  2RS7 A;  5A2Q C;  3M6A A;  4DPX A;  2EN8 A;  2A2D A;  4JI4 E;  2L2K B;  1DI2 A;  3MSW A;  4R2P A;  2AJ4 A;  1Z59 A;  2EMZ A;  5GME A;  4BA2 B;  2YT4 A;  3ADG A;  5C0X E;  5CFF E;  2WP8 B;  1E3P A;  1QZR A;  4O24 A;  3C4B A;  4Z7C A;  2DEI A;  4OO1 C;  2L2N A;  2DMY A;  1GTK A;  1X6E A;  4AM3 A;  3UHM A;  2B9D A;  1PJQ A;  3VK6 A;  4X9J A;  1EH7 A;  4YHH E;  1L4S A;  4X65 I;  3Q6N A;  3LNU A;  4FW7 A;  2DLK A;  4WSG A;  3M99 B;  2H36 X;  2VF3 A;  1UDO A;  2V8Q B;  4IFD F;  5A6A A;  3CDI A;  4UT4 A;  3ZZT A;  3P1X A;  2FTX B;  4EMD A;  1N32 I;  2RPC A;  2WCC 3;  4DR7 E;  3F0N A;  4L8N A;  1IBK I;  2C38 B;  2Z5B A;  2NA2 A;  4DUY I;  4LFB E;  2EPO A;  5DRO A;  5JEA C;  3HXL A;  1WXR A;  1IBL I;  1DQ3 A;  3VYX A;  4KZS A;  1UHZ A;  2LJP A;  1HNX I;  2LCE A;  4N3O A;  1VI7 A;  3L00 A;  1N36 I;  2PO1 B;  4JI2 I;  3C6M A;  1XNR I;  5K36 E;  3B82 A;  1G2D C;  2V2Q A;  3ZOQ B;  4LFA E;  2HHH E;  2JEA B;  4JI3 E;  1Z0C A;  2BA0 D;  3QT6 A;  4NXN I;  5ADZ A;  2O1W A;  1IBM I;  2EOQ A;  2EPP A;  4DXL A;  2F4V I;  1Z0T A;  1A1F A;  4O5G A;  3K17 A;  4LF9 E;  2V83 A;  2AE8 A;  4FWD A;  2MKN A;  5KL7 A;  4JI2 E;  2L3J A;  1E3H A;  2YTE A;  5A2Q Q;  2UXC I;  5K36 D;  3J7A M;  4ISA A;  2M7Q A;  4HY1 A;  2HHH I;  1XNQ E;  4U3D A;  1FWK A;  3PRY A;  5K36 A;  4JI6 E;  4LTY A;  1BBG A;  4U3B A;  4DV3 I;  1YPN A;  1S4E A;  2HK2 A;  5JEA F;  4RH8 A;  1RHY A;  4ZVI A;  2RS6 A;  2CVE A;  1X5W A;  1NZ0 A;  2JYA A;  2NN6 B;  2NUE A;  3NZK A;  1ZU1 A;  5AE3 A;  4WUC A;  3HPS A;  2ELZ A;  3EPK A;  4R2Q A;  1R6M A;  4JI7 E;  4M30 A;  1HR0 E;  2EOO A;  4DV7 E;  4QNJ A;  3VHT B;  1UDN A;  4HYM A;  5EKW A;  1T4N A;  5GMD A;  1N34 I;  2GHF A;  2EM6 A;  2EOM A;  2HK3 A;  1XXE A;  4LFB I;  2ENC A;  3ZZU A;  2EPK X;  4R2A A;  4OX9 E;  4OO1 A;  2WBT A;  3QT5 A;  3HPZ A;  3J7Y p;  4DUZ E;  3KWR A;  4OO1 F;  2UXD I;  1X6F A;  3L7Z B;  3J80 C;  1O0W A;  2UU9 E;  1N36 E;  2JR1 A;  2CTD A;  3JAM Q;  1STU A;  4P7D A;  4PU9 A;  3ADL A;  4P7A A;  2RSI A;  4LFA I;  3GCM A;  2EPN A;  1B69 A;  1OYS A;  2EOZ A;  4NXN E;  4DPW A;  3T1Y E;  4WYQ B;  1Z0V A;  3H4L A;  4HAC A;  4X66 I;  2YU8 A;  4B3S E;  2EE8 A;  2L8T A;  4R03 A;  4YY3 E;  2YRK A;  2KOU A;  1Z1B A;  2YTD A;  1AAY A;  2UXD E;  2BA0 G;  5KL5 A;  2PO2 B;  3K1J A;  4IS9 A;  1T4O A;  3HQ1 A;  1FKA E;  2C37 A;  4HEI A;  2EL6 A;  2WBS A;  4PRV A;  3OTO I;  2R76 A;  3KZY A;  3EPL A;  1BBO A;  1ZBT A;  2WBU A;  3P3G A;  3VYY A;  4IJD A;  2EMX A;  4LF4 I;  2LTS A;  1PKP A;  4B3T E;  2V2V A;  2NUF A;  1JK2 A;  4IZK A;  2EMW A;  4DPT A;  1IBL E;  1FNM A;  4X66 E;  2B7V A;  4M0V A;  3U1Y A;  2NN6 C;  3LLH A;  1B62 A;  4NZV A;  2CT1 A;  3WU3 A;  4MYT A;  2B3T B;  1RMD A;  4LF6 I;  2EP3 A;  2EM4 A;  4DR3 E;  5JEA B;  5IV8 B;  3KZZ A;  3M7N D;  4DKK A;  5LMU E;  4BBY A;  2GPI A;  1RQ0 A;  2MKD A;  2YTN A;  1DGC A;  4DR4 E;  2PO2 A;  2PO0 B;  2C39 B;  2EMH A;  2V85 A;  4IS1 C;  2JE6 B;  4K0K I;  2J7J A;  3JAM C;  3P3C A;  2BA1 D;  5A69 A;  1NCS A;  2X36 A;  2WNR B;  3QT7 A;  4YHH I;  2BM1 A;  4N4R B;  4FW3 A;  1YUJ A;  2YPN A;  4IFD D;  2LO3 A;  4DU7 A;  2EN4 A;  1EKZ A;  2V2Z A;  2DGC A;  2UXC E;  2EOI A;  4DR4 I;  2ODR C;  2JE6 A;  2LJH A;  1MG7 A;  1G2F C;  4MU1 A;  1YZ9 A;  4USK A;  2PO0 A;  4LCF A;  2N3H A;  4X64 E;  3M7N G;  3C6K A;  2DSY A;  2EJ4 A;  5JEA A;  2VQE E;  2EM2 A;  4TUI A;  5LLQ A;  4LCH A;  2ENA A;  1PDA A;  4LFC I;  2ELY A;  2JOB A;  2PNZ A;  5LL6 R;  3LPS A;  2UXB I;  1PVG A;  2BR2 B;  5ELW A;  4BA1 A;  2EPX A;  5AE2 A;  2V87 A;  2ADR A;  4WXC A;  2B7T A;  2CPN A;  2L2M A;  2EMB A;  2MC6 A;  1T38 A;  2CG9 A;  2XEX A;  3PS3 A;  4DV1 I;  2EMG A;  3QG5 C;  1XMO E;  1ELO A;  2PNM A;  3ZKB A;  4LFC E;  5C0X A;  2I13 A;  1WUU A;  2EMI A;  5FWK A;  1J5E I;  4DU8 A;  4DV2 I;  1UBD C;  1FI4 A;  1H72 C;  2IOQ A;  2EM8 A;  3PYF A;  3RMP A;  1USV A;  3ECR A;  2WNR A;  1S16 A;  4IZJ D;  3LML A;  4JI1 E;  3PS1 A;  4F2J C;  2R3V A;  3B78 A;  4DV3 E;  4PRX A;  2LE2 A;  1BB8 A;  2FGG A;  3LTO A;  5C0X B;  3T1H I;  1USU A;  3J81 C;  1ZXN A;  1KJK A;  4DV6 E;  1HNZ I;  2YWQ A;  4MLQ A;  4F54 A;  1MEY C;  5IWA E;  4LF7 I;  2K7I A;  4FWH A;  4JG4 A;  2E1M A;  2LVH A;  4BS9 A;  1X47 A;  1N33 I;  3CDJ A;  2JWO A;  4F9A B;  2YRM A;  4DR6 I;  3F6H A;  3ADI A;  1H7S A;  2Z5C B;  1KIJ A;  4AQY E;  4P52 A;  4LU9 A;  1OYP A;  1NEI A;  1ZXM A;  1T4L B;  3MHS C;  2DB2 A;  3J81 Q;  4J8Z A;  1HNZ E;  1IBM E;  4DV6 I;  1FWL A;  4LCG A;  1I94 I;  2EZ6 A;  4LF9 I;  5EL9 A;  1YYO A;  4JI5 E;  1N3G A;  1UDS A;  2Z5E A;  4AIM A;  2O3Z A;  4GQU A;  4BHC A;  2UXB E;  4DV0 E;  1WHN A;  3K6Q A;  2EOJ A;  4DPU A;  4NXM I;  2JP9 A;  2MDR A;  1ZM2 A;  2MC5 A;  1NHH A;  5A6B D;  2E72 A;  3F6G A;  2CZ9 A;  3GON A;  1QNT A;  2VQF E;  1IBK E;  1H74 A;  2EM3 A;  1ZM4 A;  2NN6 D;  4Q28 A;  1JK1 A;  4JI4 I;  5KL4 A;  3L7Z A;  3H1C A;  2GLI A;  2KHX A;  4F9C B;  2YRH A;  4X62 I;  2EWL A;  1XNR E;  1HR0 I;  4JI7 I;  1T39 A;  3C4T A;  3H09 A;  2JEA A;  4JI3 I;  1X6H A;  2L33 A;  1X3C A;  4BC9 A;  5IXM B;  1Z0E A;  5C0X C;  4NHR A;  4GKJ I;  4O43 A;  4Z7Y A;  4O4K A;  4R2S A;  2HKE A;  1N0U A;  2EN1 A;  3WU4 A;  4OO1 E;  4OX9 I;  4DV4 E;  4X65 E;  2YTG A;  4ZYG A;  2EOY A;  2EQ3 A;  5JEA D;  5DNX A;  2LT7 A;  1Z5C A;  1P47 A;  4DR3 I;  1ZM9 A;  1FJG E;  4IFD C;  3HJC A;  2BB8 A;  4FW6 A;  3GLL A;  1Z5A A;  2YTF A;  1UDQ A;  1BKN A;  4OKG A;  2EPR A;  4WUB A;  4AQY I;  2EM9 A;  4JI0 E;  2CGE A;  4L5N C;  4URL A;  2WZO A;  3P06 A;  1KKH A;  2M9A A;  2I9I A;  2V89 A;  4Q35 B;  4F9B B;  2O1V A;  2L3C A;  2PNL A;  4LF5 I;  5K36 C;  2EOS A;  4I8O A;  4ZYD A;  4FN5 A;  1PJS A;  2C37 B;  1Y6Z A;  5AAS A;  2UUB E;  2J65 A;  4J3D A;  4ZYH A;  1HK7 A;  2EL4 A;  2YSO A;  1X48 A;  3OTO E;  3THO B;  2F1D A;  4R8O A;  2ZBK B;  2GQ0 A;  1WRJ A;  5DRR A;  3QT8 A;  4JI1 I;  3PYG A;  2R1F A;  2YU5 A;  3EPH A;  4JI0 I;  2LJU A;  2FV4 B;  2VE7 C;  3ZKD A;  4M1K A;  1GQE A;  1SFE A;  3BBG A;  4LF7 E;  2EMA A;  5C0X D;  2HJJ A;  1EH8 A;  4LF8 I;  1HNW I;  4FK5 C;  2JOX A;  2L92 A;  1UIL A;  2UUC E;  1Y5Y A;  1P42 A;  3P76 A;  4OO1 B;  5DRQ A;  2YSP A;  4K0K E;  3HKM A;  2Q8U A;  2YTP A;  4KQV A;  5K36 F;  3M85 G;  2V86 A;  3T1Y I;  1PJT A;  4LPF A;  1J26 A;  1R6L A;  3JU0 A;  4BA1 B;  2EN2 A;  3EPJ A;  4USM A;  2EML A;  4IFD B;  2F8B A;  2EOX A;  3AV0 A;  3D4J A;  4DR5 I;  4WXD A;  1ZBQ A;  2R42 A;  2EPC A;  2Z5C A;  1FJG I;  3HTX A;  4WPY A;  3B8H A;  4R2C A;  2RSM A;  1OJ4 A;  3IWC A;  2V8P A;  2WW4 A;  3CWV A;  2IOP A;  4HXZ A;  4DR1 I;  5AE1 A;  4X64 I;  2GO4 A;  2YTJ A;  1D6T A;  4R1F A;  3HUL A;  1YYW A;  3WU5 A;  1A1G A;  2GS8 A;  5AC5 A;  4OO1 D;  1N0V C;  2WP8 A;  2VQE I;  1H7U A;  3DD6 A;  4JI8 E;  2LUQ A;  5K36 B;  2F4V E;  1TF3 A;  4WSP A;  1Y4S A;  1H73 A;  4HAC B;  3PYD A;  2IES A;  2E5L I;  3M85 D;  5KL6 A;  2HKJ A;  4JV5 I;  3V5R A;  3JTZ A;  2EQ0 A;  2JVA A;  1XHK A;  2EMY A;  4MLV A;  4KHP E;  5T6J A;  3PYE A;  1PIE A;  4GKK I;  4MU0 A;  4DR6 E;  4DR1 E;  2VES A;  2UUA I;  4DR7 I;  4B3R I;  2BV3 A;  4DV1 E;  3OML A;  4GKJ E;  4FW9 A;  4TUG A;  3BF2 A;  2LUP B;  2YTI A;  2EOH A;  1MU5 A;  2O1U A;  2EM5 A;  4B3S I;  4M2Z A;  1HNX E;  2EPA A;  1YUI A;  1ZR9 A;  4UTG A;  4DV5 E;  2YTO A;  2EN6 A;  2BR2 A;  3THN A;  3ZZ0 A;  4GZN C;  2NAB A;  4R2E A;  4B3R E;  2A2C A;  1SR9 A;  2PNZ B;  4X8W A;  1ZAA C;  4IZK B;  2EMK A;  1YHC A;  2EFG A;  4IZJ B;  2N8X A;  4LF4 E;  5DRP A;  3U1K A;  1Z0W A;  3Q6M A;  5BR8 I;  3EQ1 A;  4BC7 A;  2IHR 1;  2VF1 A;  2NN6 F;  4MQY A;  2LV2 A;  5LMN I;  2DEJ A;  5IWA I;  1EA6 A;  1OYR A;  4ED4 A;  4DR5 E;  1QU6 A;  2LTR A;  1IQO A;  2EPZ A;  2L6M A;  5A6B A;  1UEK A;  4JYA E;  4WUD A;  1XNQ I;  1LLM C;  1IMU A;  3ZM7 A;  4KWY A;  2ZM6 I;  1IQS A;  4DMI A;  2V34 A;  3IWD A;  1EH6 A;  1N32 E;  1RRE A;  1A1K A;  1Y4U A;  2HFU A;  5BR8 E;  3AUZ A;  4AID A;  3J80 Q;  4HTG A;  2EMC A;  1XMO I;  1Z0B A;  2BM0 A;  2LRS A;  2DLQ A;  1TN9 A;  4OOG C;  2E5L E;  4RHB B;  2JY9 A;  2NPF A;  2D9H A;  1YYK A;  2EOE A;  2C39 A;  2RQL A;  1XMQ I;  2EM0 A;  4F6M A; 
#chains in the Genus database with same CATH homology
 4DV0 I;  2UUA E;  4DPY A;  2X7I A;  2G7H A;  1EI1 A;  2M1S A;  3T1H E;  2LMZ A;  1KTV A;  2E1R A;  4P78 A;  4DUZ I;  2N3G A;  2Z5B B;  2UU9 I;  1N33 E;  4DV5 I;  4DR2 E;  2V88 A;  1Z5B A;  3J7A G;  1DAR A;  5L3J A;  2YZT A;  4GEQ B;  2RTX A;  5IT9 C;  4I3H A;  4DV4 I;  2DIX A;  2K4V A;  1RC7 A;  3IWB A;  5IT9 Q;  5FLX C;  1MX0 A;  4MYT A;  3FIG A;  1I94 E;  4JV5 E;  1J5E E;  4LF8 E;  1HNW E;  2LBS B;  1NHJ A;  2ZIT A;  3ADJ A;  4WFT A;  4DV2 E;  4DR2 I;  4JYA I;  2O1T A;  4NXM E;  3Q1Q A;  1Z0G A;  2Q2E B;  4B3T I;  3K85 A;  2VQF I;  4RPF A;  2ODR D;  3WU6 A;  4LF6 E;  1KVK A;  4LF5 E;  1VIS A;  5LMU I;  5F3W A;  4BCA A;  4X62 E;  1A6F A;  1GZ6 A;  1XMQ E;  2UUB I;  1WHQ A;  4MYU A;  2OI2 A;  4JI6 I;  1U2R A;  1B63 A;  1NHI A;  5DNY A;  4DUY E;  4IZJ A;  4B3M I;  2NUG A;  5LMN E;  4JI8 I;  2M4I A;  4YY3 I;  4JI5 I;  1RR9 A;  4XTJ A;  1ZM3 A;  3DJW A;  2ZM6 E;  4GKK E;  4KHP I;  2UUC I;  4FWG A;  4DV7 I;  1K47 A;  1N34 E;  1X49 A;  4B3M E;  4BMJ A;  5FLX Q;  2J7K A;  2HFS A;  2KON A;  3DF6 A;  3V2U C;  2RS7 A;  5A2Q C;  3M6A A;  4DPX A;  2A2D A;  4JI4 E;  2L2K B;  1DI2 A;  3MSW A;  2AJ4 A;  1Z59 A;  5GME A;  2YT4 A;  3ADG A;  5CFF E;  1QZR A;  4Z7C A;  3C4B A;  2DEI A;  2L2N A;  2DMY A;  2B9D A;  3VK6 A;  4YHH E;  4X65 I;  3Q6N A;  3LNU A;  2H36 X;  2VF3 A;  2V8Q B;  4UT4 A;  3ZZT A;  3P1X A;  2FTX B;  4EMD A;  1N32 I;  4DR7 E;  3F0N A;  4L8N A;  1IBK I;  2Z5B A;  2NA2 A;  4DUY I;  4LFB E;  1IBL I;  3HXL A;  1WXR A;  1DQ3 A;  3VYX A;  4KZS A;  1UHZ A;  2LJP A;  1HNX I;  4N3O A;  1N36 I;  4JI2 I;  1XNR I;  3B82 A;  2V2Q A;  3ZOQ B;  4LFA E;  2HHH E;  4JI3 E;  1Z0C A;  3QT6 A;  4NXN I;  5ADZ A;  2O1W A;  1IBM I;  4DXL A;  2F4V I;  1Z0T A;  3K17 A;  4LF9 E;  2V83 A;  4FWD A;  4JI2 E;  5A2Q Q;  2L3J A;  2UXC I;  3J7A M;  2M7Q A;  4HY1 A;  2HHH I;  1XNQ E;  1FWK A;  3PRY A;  4JI6 E;  4LTY A;  4DV3 I;  1S4E A;  2HK2 A;  4ZVI A;  2RS6 A;  1NZ0 A;  2NUE A;  4WUC A;  5AE3 A;  3HPS A;  4JI7 E;  4M30 A;  1HR0 E;  4DV7 E;  4HYM A;  5GMD A;  1T4N A;  1N34 I;  2HK3 A;  4LFB I;  3ZZU A;  4OX9 E;  3QT5 A;  3HPZ A;  3J7Y p;  4DUZ E;  3KWR A;  2UXD I;  3J80 C;  1O0W A;  2UU9 E;  1N36 E;  2JR1 A;  3JAM Q;  1STU A;  4P7D A;  4PU9 A;  3ADL A;  4P7A A;  4LFA I;  4NXN E;  4DPW A;  3T1Y E;  4WYQ B;  1Z0V A;  3H4L A;  4HAC A;  4X66 I;  4B3S E;  2L8T A;  4R03 A;  4YY3 E;  2UXD E;  2KOU A;  3K1J A;  1T4O A;  3HQ1 A;  1FKA E;  4PRV A;  3OTO I;  1ZBT A;  3VYY A;  4LF4 I;  2LTS A;  1PKP A;  4B3T E;  2V2V A;  2NUF A;  4IZK A;  4DPT A;  1IBL E;  1FNM A;  4X66 E;  2B7V A;  4M0V A;  3LLH A;  1B62 A;  3WU3 A;  2B3T B;  4LF6 I;  4DR3 E;  4DKK A;  5LMU E;  4BBY A;  1RQ0 A;  4DR4 E;  2V85 A;  4K0K I;  3JAM C;  2X36 A;  3QT7 A;  4YHH I;  2BM1 A;  4DU7 A;  1EKZ A;  2V2Z A;  2UXC E;  4DR4 I;  2ODR C;  2LJH A;  1MG7 A;  1YZ9 A;  4USK A;  2N3H A;  4X64 E;  2DSY A;  2VQE E;  4TUI A;  4LFC I;  2JOB A;  5LL6 R;  3LPS A;  2UXB I;  1PVG A;  5AE2 A;  2V87 A;  2L2M A;  2B7T A;  2MC6 A;  2CPN A;  2CG9 A;  2XEX A;  4DV1 I;  1XMO E;  1ELO A;  2PNM A;  3ZKB A;  4LFC E;  1WUU A;  1J5E I;  5FWK A;  4DU8 A;  4DV2 I;  1FI4 A;  1H72 C;  2IOQ A;  3RMP A;  1USV A;  1S16 A;  4IZJ D;  3LML A;  4JI1 E;  2R3V A;  3B78 A;  4PRX A;  4DV3 E;  2LE2 A;  2FGG A;  3LTO A;  3T1H I;  1USU A;  3J81 C;  1ZXN A;  4DV6 E;  1HNZ I;  4LF7 I;  4F54 A;  5IWA E;  4FWH A;  4JG4 A;  2E1M A;  4BS9 A;  1X47 A;  1N33 I;  2JWO A;  4F9A B;  4DR6 I;  3F6H A;  3ADI A;  1H7S A;  2Z5C B;  1KIJ A;  4AQY E;  4P52 A;  4LU9 A;  1ZXM A;  1T4L B;  2DB2 A;  3J81 Q;  4J8Z A;  1HNZ E;  1IBM E;  4DV6 I;  1FWL A;  1I94 I;  2EZ6 A;  4LF9 I;  1YYO A;  4JI5 E;  2Z5E A;  2UXB E;  4DV0 E;  1WHN A;  3K6Q A;  4DPU A;  4NXM I;  2MDR A;  1ZM2 A;  2MC5 A;  1NHH A;  2CZ9 A;  3GON A;  3F6G A;  3PYF A;  2VQF E;  1IBK E;  1H74 A;  1ZM4 A;  4Q28 A;  4JI4 I;  2KHX A;  4F9C B;  4X62 I;  1HR0 I;  2EWL A;  1XNR E;  4JI7 I;  3C4T A;  3H09 A;  4JI3 I;  2L33 A;  4BC9 A;  1Z0E A;  4GKJ I;  4Z7Y A;  2HKE A;  1N0U A;  3WU4 A;  4OX9 I;  4DV4 E;  4X65 E;  1Z5C A;  4DR3 I;  1ZM9 A;  1FJG E;  3HJC A;  1Z5A A;  1BKN A;  4WUB A;  4AQY I;  4JI0 E;  2CGE A;  4L5N C;  4URL A;  2WZO A;  3P06 A;  1KKH A;  4F9B B;  2V89 A;  2PNL A;  2O1V A;  4LF5 I;  2L3C A;  4I8O A;  4FN5 A;  1Y6Z A;  5AAS A;  2UUB E;  1HK7 A;  1X48 A;  3OTO E;  4R8O A;  2ZBK B;  2GQ0 A;  3QT8 A;  4JI1 I;  3PYG A;  4JI0 I;  2FV4 B;  2VE7 C;  3ZKD A;  4M1K A;  1GQE A;  4LF7 E;  4LF8 I;  1HNW I;  2JOX A;  2L92 A;  1UIL A;  2UUC E;  4K0K E;  4KQV A;  2V86 A;  3T1Y I;  1J26 A;  3JU0 A;  4USM A;  2F8B A;  3AV0 A;  4DR5 I;  3D4J A;  1ZBQ A;  2R42 A;  2Z5C A;  1FJG I;  3HTX A;  4WPY A;  3B8H A;  2RSM A;  1OJ4 A;  3IWC A;  2V8P A;  2WW4 A;  3CWV A;  2IOP A;  4HXZ A;  4DR1 I;  5AE1 A;  4X64 I;  1D6T A;  4R1F A;  3HUL A;  1YYW A;  3WU5 A;  2GS8 A;  1N0V C;  2VQE I;  1H7U A;  4JI8 E;  2LUQ A;  2F4V E;  1Y4S A;  4WSP A;  1H73 A;  4HAC B;  3PYD A;  2E5L I;  2HKJ A;  4JV5 I;  3V5R A;  3JTZ A;  2JVA A;  1XHK A;  4KHP E;  4GKK I;  5T6J A;  3PYE A;  1PIE A;  4DR6 E;  4DR1 E;  2UUA I;  4DR7 I;  4B3R I;  2BV3 A;  4DV1 E;  3OML A;  4GKJ E;  4FW9 A;  4TUG A;  2LUP B;  1MU5 A;  2O1U A;  4B3S I;  4M2Z A;  1HNX E;  4UTG A;  4DV5 E;  3ZZ0 A;  4B3R E;  2A2C A;  1SR9 A;  4X8W A;  4IZJ B;  4IZK B;  2EFG A;  4LF4 E;  1Z0W A;  3Q6M A;  5BR8 I;  4BC7 A;  2IHR 1;  2VF1 A;  5LMN I;  2DEJ A;  5IWA I;  1EA6 A;  4ED4 A;  4DR5 E;  1QU6 A;  2LTR A;  2L6M A;  1UEK A;  4JYA E;  4WUD A;  1XNQ I;  3ZM7 A;  2ZM6 I;  4DMI A;  2V34 A;  3IWD A;  1N32 E;  1RRE A;  1Y4U A;  2HFU A;  5BR8 E;  3AUZ A;  3J80 Q;  1XMO I;  1Z0B A;  2BM0 A;  2LRS A;  4OOG C;  2E5L E;  2JY9 A;  2NPF A;  1YYK A;  1XMQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...