4DR3E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3E02
1GQEA 4FN5A 1MU5A 4LFAI 3OTOE 4YHHE 4DV0E 2A2CA 2LUPB 4LF9E 1ZBTA 3WU5A 2VQFE 4P52A 4MYUA 2DMYA 2VQEE 4PRXA 4Z7CA 3T1YI 3ZZUA 4LF4E 5L3JA 4DUZI 4DPYA 3JAMQ 4GKKI 4JI6E 1YYKA 4DV3I 4WYQB 3J80Q 3J81Q 1KTVA 1XMOE 4JI1I 4B3TI 5BR8E 1UHZA 4AQYI 3ZM7A 4JG4A 4DUYI 1IBLI 4B3RI 2UXCE 2V34A 4DPTA 2IHR1 4YY3I 2DEIA 2X36A 4URLA 1Z0EA 3V5RA 1ZXNA 1EA6A 4X65I 1FWLA 1N32I 3QT7A 4JI0I 1Z5BA 4HYMA 4LF6E 3Q1QA 5FLXQ 1RQ0A 2UU9I 4DV6I 4GKJE 5A2QQ 2NUEA 3QT6A 2LJHA 2LTRA 1XNQE 4JI2I 4NXNI 1HNZE 2JY9A 2HHHE 4X66E 4DV2E 1EKZA 2B3TB 4JI3I 2JVAA 3ZZ0A 4USMA 5LMNI 4DR7I 4B3SE 4M2ZA 1ZM3A 1YYOA 3LPSA 3LTOA 1T4LB 4OX9E 1ZM2A 2BM0A 2NUGA 2E1RA 1N33I 4ZVIA 1FNMA 3PYDA 4DV5I 2HK2A 5GMDA 1N0VC 1Z0WA 2Q2EB 3J7Yp 2ZM6I 2UXBI 4MYTA 4I3HA 4B3ME 3PYFA 1D6TA 2V2VA 4HACA 3QT8A 4JI4I 1STUA 1B62A 1WHQA 1HNXE 1EI1A 3B82A 4NXME 2N3GA 2UUCE 2UXDE 4LFCE 2N3HA 3K17A 5LMUI 1T4OA 2DEJA 4FWDA 2HK3A 1N0UA 3HTXA 4YHHI 4DV0I 4HACB 1KVKA 4LF9I 2VQFI 1XHKA 4JI8E 4JYAE 2E5LE 4UT4A 1RREA 2VQEI 1QU6A 1RR9A 4RPFA 1J5EI 2A2DA 2RS7A 3LNUA 4JI7I 4LF4I 1BKNA 2DB2A 1A6FA 3HULA 3ADJA 4WUCA 4JI6I 4WUBA 1J26A 1XMOI 2ZBKB 4DR5I 2L3CA 1H7UA 4DV1E 4FWHA 5GMEA 5BR8I 4DV7E 1Z5AA 1XMQI 4DR4E 1QZRA 1VISA 4LFBI 2UXCI 1IBLE 1WHNA 4DV4E 4WUDA 4KHPI 3QT5A 4EMDA 4YY3E 1H7SA 4DR6I 1FJGI 3H4LA 3T1HE 2AJ4A 4Z7YA 4HY1A 2CZ9A 1KKHA 4DR3E 2BV3A 4JI0E 4GKJI 2V2QA 4X62E 2R3VA 1UEKA 4X64E 1HNWI 2MDRA 2HKJA 1XNQI 2HKEA 1ZM9A 4LF8I 4K0KE 3F0NA 3B78A 1ELOA 1HNZI 4X66I 4R1FA 4XTJA 4DU7A 2LRSA 1I94E 4DR1I 5IWAE 1IBKE 3K1JA 1Z59A 5LL6R 5LMNE 1HR0I 2RSMA 4DR7E 2OI2A 2YT4A 3CWVA 3JAMC 2L2MA 1N36E 2LJPA 4DPXA 4UTGA 4DR2E 1DARA 2WW4A 4LF5E 3WU4A 2L2NA 3WU6A 1N33E 2RTXA 2DIXA 1NHJA 3ADIA 1H74A 2UUAI 4WFTA 4DV5E 4LF7E 4B3MI 1XNRE 1Z0VA 4JV5I 1S16A 2F4VI 3J7AG 2ZM6E 1IBME 2UXBE 2UUBI 2LTSA 2B7TA 1HNXI 4KQVA 4JI5E 3VYYA 3ZZTA 4NXMI 4JI4E 1N34E 2EZ6A 2UUCI 2UXDI 4LFCI 1UILA 3PYEA 3OTOI 4FWGA 1RC7A 4DKKA 3C4TA 1NZ0A 4LFAE 5LMUE 3VYXA 3LLHA 1PIEA 2XEXA 1OJ4A 4JI8I 4JYAI 2E5LI 3PYGA 1K47A 3T1YE 2NPFA 2V8PA 4P7AA 4DUZE 1X49A 4GKKE 4PRVA 1Z0BA 4USKA 1J5EE 4DV3E 4JI7E 1WUUA 3B8HA 2BM1A 2HFUA 5IT9C 4JI1E 4HXZA 4B3TE 4DV1I 4AQYE 4DV7I 4DUYE 2B7VA 4DR5E 3ADLA 4B3RE 4DR4I 4DXLA 4OOGC 4PU9A 1T4NA 1PKPA 1XMQE 2CPNA 4DV4I 4LFBE 1YYWA 4X8WA 1Z5CA 4LF6I 4X65E 2EFGA 1N32E 4KHPE 3T1HI 4DR6E 2UU9E 4DV6E 4DR3I 1FJGE 4DPWA 1DI2A 1H73A 1B63A 4X62I 2HHHI 2L33A 4X64I 4DV2I 1NHIA 2LUQA 1NHHA 3P1XA 4JI2E 3V2UC 1MX0A 2RS6A 2LBSB 1FI4A 4K0KI 4NXNE 1HNWE 2HFSA 3M6AA 2R42A 4ED4A 4JI3E 4LF8E 4FW9A 4DPUA 4B3SI 2X7IA 1MG7A 1I94I 2V2ZA 1Z0TA 5IWAI 1IBKI 1ZM4A 3J7AM 1FWKA 2VF3A 1H72C 1S4EA 4DR1E 4OX9I 3J80C 1Z0GA 3J81C 3C4BA 5IT9Q 1Z0CA 1HR0E 2KHXA 2NA2A 4M30A 1N36I 1X48A 2GS8A 4DR2I 3ADGA 3GONA 4LF5I 1O0WA 2J7KA 3ZKDA 1FKAE 4DU8A 1U2RA 3WU3A 4LF7I 1ZXMA 1XNRI 2NUFA 4M1KA 2L3JA 2UUAE 1KIJA 1IBMI 2ZITA 4JV5E 2L2KB 2F4VE 3D4JA 3ZKBA 5FLXC 2UUBE 5CFFE 1YZ9A 1X47A 4JI5I 1N34I 5A2QC 1PVGA
chains in the Genus database with same CATH superfamily
4R2RA 2JP9A 1GQEA 2CG9A 2GQ0A 2CT1A 1MU5A 4FN5A 1SFEA 4WSPA 3TQMA 5C0XE 4LFAI 4BC9A 3OTOE 4YHHE 4DV0E 2ADRA 2A2CA 2LUPB 4LF9E 1VI7A 1ZBTA 3WU5A 2VQFE 2DRPA 4R2CA 2Z5CA 1EH6A 4P52A 4MYUA 1X6FA 2DMYA 3F6HA 2VQEE 5JEAF 4PRXA 2EN6A 4R2AA 2H36X 4Z7CA 3T1YI 3ZZUA 4LF4E 5K36B 2LO3A 2HJJA 2V88A 5L3JA 4DUZI 4DPYA 1R6LA 1PJQA 3JAMQ 2K7IA 2EN2A 4GKKI 1YSAC 5DNYA 4JI6E 1YYKA 4DV3I 1AAYA 4WYQB 2C39B 3J80Q 5AE3A 3J81Q 5AC5A 2NABA 1KTVA 3Q6MA 1T38A 1XMOE 4JI1I 4B3TI 5BR8E 1UHZA 4AQYI 2PO0A 4OO1D 5DNLA 3ZM7A 5ADZA 2M9AA 4GEQB 3GLLA 4JG4A 4DUYI 1IBLI 4B3RI 2BA0G 2LVHA 2UXCE 4HTGA 2V34A 4DPTA 2IHR1 2EM4A 1G2DC 2DEIA 2C37A 4YY3I 4IFDA 2X36A 5AE2A 2C38B 2NN6A 2I13A 4L8NA 4URLA 1Z0EA 3V5RA 4Q28A 1Y5YA 1ZXNA 2ENCA 2EMLA 4F54A 4ZYGA 4BBYA 1EA6A 3M85G 2YTNA 4X65I 1FWLA 2A25A 1X6HA 3BGHA 1N32I 1EH7A 4KZSA 3QT7A 5DROA 2PO0B 4JI0I 2V83A 2EMCA 1Z5BA 4HYMA 1YPNA 4LF6E 3Q1QA 2KONA 5FLXQ 2YWQA 1LLMC 4BC7A 3VHTB 1RQ0A 2ODRD 4DV6I 2UU9I 2LV2A 5A6AA 1A1GA 4GKJE 5A2QQ 2NUEA 1UBDC 4IFDB 2C37B 3KRNA 3QT6A 5K36C 2YPNA 2LJHA 2LTRA 1L4SA 1UDSA 4O24A 2GLIA 3MSWA 1XNQE 4OO1F 4MLVA 4JI2I 2VRDA 4QNJA 4NXNI 1HNZE 2JY9A 2HHHE 4X66E 4DV2E 1EKZA 4FK5C 3P3CA 2YTOA 1XXEA 4LCGA 2B3TB 5ELWA 5A69A 4JI3I 3MHHC 2EMBA 2D9HA 2EMWA 2JVAA 3NZKA 2EOJA 3ZZ0A 4USMA 5LMNI 2YTJA 2ENHA 2GO3A 4U3DA 1A1HA 3IWDA 4DR7I 3P06A 4B3SE 4M2ZA 1ZM3A 1YYOA 4IJDA 5A6KA 2FV4B 2DLQA 2DGCA 3LPSA 4OKGA 1OYPA 2PO2A 2FTXB 3LTOA 4DMIA 1T4LB 2CVEA 3C6MA 4BMJA 4OX9E 1ZM2A 4BA2B 2BM0A 2EPKX 2NUGA 2JOBA 2E1RA 1N33I 4ZVIA 2EMHA 4IZJA 4OO1E 3AV0A 1FNMA 3GCMA 3PYDA 1JK1A 4DV5I 1TF3A 5JEAD 2EOXA 2HK2A 5GMDA 4ZYHA 2DMIA 1N0VC 1Z0WA 2V8QB 2Q2EB 4IFDC 3VK6A 3J7Yp 2YTGA 2ZM6I 2UXBI 2NN6C 4MYTA 4I3HA 1NEIA 5KL7A 4B3ME 2EMAA 4F9CB 3PYFA 5LLQA 1D6TA 2V2VA 2L8TA 4N4RB 2EQ1A 4BA1B 2MC5A 4HACA 2EM5A 3QT8A 2PNZA 3L7ZB 2J65A 4FW6A 5DNXA 4JI4I 4IZJB 1STUA 3EQ1A 1DQ3A 4ZYDA 1B62A 1WHQA 1HNXE 1EI1A 1A1LA 3B82A 2YU5A 4NXME 4WXDA 3EPLA 3UHMA 2N3GA 2RQLA 2UUCE 2UXDE 2MKNA 4I8OA 4LFCE 4NZVA 2VESA 2N3HA 2EPPA 3L00A 1A1JA 3K17A 5LMUI 1T4OA 2EN8A 2DEJA 2EMXA 3P3EA 4FWDA 2PNMA 2WBSA 1UN6B 2HK3A 1N0UA 3K6QA 3HTXA 2EJ4A 4YHHI 4DV0I 4HACB 3EPHA 4LTYA 1KVKA 2VE7C 4LF9I 2EOEA 4R2DA 1XHKA 4JI8E 2IESA 5AC4A 4IZKB 4JYAE 2BR2A 3C6KA 2E5LE 4UT4A 1RREA 2VQEI 2EM0A 1QU6A 1RR9A 5AE1A 2EE8A 4RPFA 1J5EI 2A2DA 2RS7A 3LNUA 5DRQA 3OMLA 4JI7I 3JTZA 1IMUA 4LF4I 1BKNA 2MDGA 4F2JC 2DB2A 1P47A 1A6FA 2EOIA 3KWRA 2JPAA 3HULA 4QNKA 4P78A 3ADJA 4WUCA 4JI6I 2EMIA 2ELYA 4X9JA 4WUBA 3M7ND 5DRPA 1GZ6A 2Q8UA 2V85A 2Z5CB 5K36F 2EPNA 3H09A 3PS3A 1J26A 3EPJA 4O4KA 1XMOI 4BCAA 2ZBKB 2L3CA 4DR5I 1H7UA 4DV1E 4FWHA 5GMEA 5BR8I 4AIDA 4DV7E 2O1TA 2BBGA 1Z5AA 1XMQI 2HC5A 2BB8A 4DR4E 4J3DA 1QZRA 3UK3C 1VISA 4LFBI 2UXCI 3LMLA 5JEAE 2CTDA 5AASA 5A6BA 1IBLE 1WHNA 1WJPA 1E3HA 4O43A 4DV4E 3QG5C 3PS1A 4MU0A 4WUDA 4KHPI 1ZBQA 3QT5A 1UDQA 4EMDA 2ELZA 4YY3E 2KOUA 2N8XA 1H7SA 4DR6I 2LMZA 4WX9A 3U1YA 4IS1C 2JEAA 1FJGI 3H4LA 3T1HE 3H1CA 5FWKA 2AJ4A 4Z7YA 2EL4A 2L92A 2BA1D 2WBUA 2CZ9A 1KKHA 4HY1A 2M7QA 2HGHA 2NN6B 1OYSA 4DR3E 3F6GA 2BV3A 4N3OA 4JI0E 1F2IG 4GKJI 2DSYA 1YUJA 2V2QA 4X62E 2MKDA 2R3VA 2EPXA 5A6JA 1UEKA 4X64E 4FW4A 2WCC3 2EM2A 2MDRA 1HNWI 2HKJA 4RH8A 1XNQI 2HKEA 1ZM9A 4LF8I 5EL9A 4IFDF 4K0KE 3F0NA 2EN1A 3B78A 1ELOA 1HNZI 4X66I 2NN6F 4R1FA 1TF6A 4XTJA 2JEAB 5C0XA 3PRYA 1Y60A 2EPOA 3AUZA 4DU7A 4TUIA 3P76A 1OYRA 5EKWA 4LCHA 2LCEA 2LRSA 1BBGA 1I94E 3BBGA 4DR1I 2EM6A 2I9IA 5IWAE 1IBKE 1IQOA 2PNLA 3K1JA 1Z59A 5LL6R 3GMEA 5LMNE 2EMFA 1HR0I 2RSMA 2EORA 5KL2A 1T39A 4DR7E 2OI2A 2YT4A 3CWVA 3JAMC 4IZJD 2O1UA 5C0XB 2L2MA 4NHRA 4R2PA 1N36E 4R2QA 2ENAA 3BIDA 1BBOA 2LJPA 4UTGA 4DPXA 4DR2E 2YRKA 1DARA 4MU1A 2WW4A 4LF5E 4IFDE 2VF1A 3WU4A 3ECRA 2L2NA 3WU6A 2EPMX 1N33E 2EPUA 1TN9A 2RTXA 4R03A 2DIXA 2JOXA 4R8OA 1NHJA 2PO2B 1MGTA 3KZZA 3ADIA 4F9BB 2EWLA 5F3WA 1WRJA 1H74A 4WFTA 2EOMA 4DV5E 2UUAI 4LF7E 4WPYA 1RMDA 1R6MA 2JYAA 3RMPA 4B3MI 1XNRE 2IOQA 4WXCA 2JWOA 2EQ0A 4M9VC 1Z0VA 1S16A 3IWCA 3J7AG 2F4VI 4JV5I 4P7DA 2EN7A 3FIGA 2YTFA 2ZM6E 1IBME 2UXBE 5JEAA 2EPRA 2UUBI 2LTSA 2EMYA 2YSPA 1N3GA 2B7TA 5KL5A 4MQYA 5KL3A 1HNXI 4KQVA 4JI5E 2FGGA 3VYYA 4NBQA 3ZZTA 2EOOA 4F9AB 1Y4SA 4NXMI 2EL5A 2YTEA 4JI4E 1N34E 3K85A 2EZ6A 2UUCI 2UXDI 4LFCI 1PJSA 2RSIA 4M0VA 1UILA 3PYEA 3OTOI 4FWGA 2CSHA 1G2FC 2PNZB 1RC7A 3IWBA 4DKKA 1USUA 3P3GA 5T6JA 3DD6A 3C4TA 1NZ0A 2EP3A 4LFAE 1SR9A 5JEAB 5LMUE 3VYXA 4LU9A 4GQUA 3HQ1A 3LLHA 1PIEA 2EMGA 2C39A 2XEXA 4IS9A 4HEIA 1OJ4A 1WXRA 4KWYA 5C0XC 1P42A 4JI8I 2LT7A 3DJWA 4JYAI 2E5LI 2EL6A 4F6MA 2EMKA 3PYGA 1K47A 2BA0D 3M99B 2EPCA 3T1YE 3HKMA 4ZYEA 2NPFA 2V8PA 4P7AA 4DUZE 1X49A 4LCFA 4GKKE 4PRVA 1Z0BA 2O1WA 1RHYA 4LOMA 4USKA 2EPLX 2YZTA 1J5EE 4DV3E 4JI7E 1WUUA 1A1IA 2BM1A 2WNRA 3B8HA 2G7HA 2HFUA 5IT9C 2BR2B 2EPZA 4IFDD 2C38A 3M85D 2RPCA 4JI1E 4HXZA 2NN6D 2EOQA 1YUIA 4B3TE 4DV1I 4AIMA 4RHBB 4AQYE 4DV7I 3BF2A 4DUYE 2F1DA 2B7VA 1GTKA 2M4IA 5A6BD 2L6MA 1ZR9A 4BS9A 4DR5E 3ADLA 4B3RE 4DXLA 4DR4I 4OOGC 2EOSA 2V86A 1ZAAC 4OO1A 3THOB 4PU9A 1PKPA 1T4NA 2B9DA 2EOZA 4GZNC 1USVA 1Y6ZA 1XMQE 2AE8A 2CPNA 2YU8A 1AH5A 2LE2A 4DV4I 4ISAA 4LFBE 2JR1A 3HXLA 1YYWA 3M7NG 4X8WA 2YTQA 2WNRB 1Z5CA 2K4VA 5K36D 3HJCA 4FW7A 1NCSA 4LF6I 2YRHA 4X65E 2EFGA 2R76A 2IOPA 3EPKA 1N32E 5DRRA 2EPAA 2MC6A 4F6NA 4KHPE 4O5GA 3MHSC 5JEAC 5K36E 3U1KA 3T1HI 4MU3A 3CDIA 4R2SA 2VQFI 2EM9A 5TSEA 1JK2A 4DR6E 1PJTA 2IERA 4MDTA 5IXMB 2JE6A 2UU9E 4DV6E 3B4TA 4DR3I 2GHFA 1FJGE 4OO1B 2EN4A 4DPWA 1DI2A 4TUGA 1A1KA 3DF6A 1H73A 2EOFA 2EM3A 1QNTA 1B63A 4X62I 2WP8A 2HHHI 2L33A 1X6EA 2Z5BA 4X64I 1NHIA 4DV2I 4WSGA 2LUQA 1NHHA 3P1XA 4JI2E 3V2UC 5C0XD 1MX0A 2PO1A 2RS6A 2LBSB 1FI4A 4K0KI 2PRTA 4NXNE 2YTPA 2GO4A 1HNWE 2EQ3A 2YTIA 3HPSA 4L5NC 1DGCA 1E3PA 2HFSA 1HK7A 2R42A 3M6AA 1KJKA 4FW3A 4U3BA 4ED4A 4JI3E 2E1MA 4LF8E 2E72A 2BA1G 4FW9A 2V89A 1UDOA 4DPUA 4B3SI 2JE6B 3HPZA 2GPIA 1X3CA 2X7IA 4BA2A 1IQSA 2YSOA 1PDAA 1MG7A 1I94I 2V2ZA 1YFHA 1Z0TA 2JEBA 5IWAI 1IBKI 1ZM4A 3J7AM 1FWKA 4MU4A 2WP8B 2VF3A 2R1FA 2Z5BB 1H72C 1S4EA 4DR1E 4OX9I 3J80C 1X5WA 1Z0GA 3J81C 2O3ZA 2PO1B 3C4BA 5IT9Q 5KL4A 2EMZA 1Z0CA 1HR0E 4J8ZA 2KHXA 1B69A 1MEYC 2NA2A 4M30A 1N36I 2NN6E 1Y4UA 2YTDA 2EOYA 3ZOQB 1X48A 1EH8A 2GS8A 4BHCA 4DR2I 3ADGA 5KL6A 4MLQA 1ZU1A 3GONA 1O0WA 4BA1A 4LF5I 2EN3A 2CGEA 3JU0A 2J7KA 1YHCA 3L7ZA 2M1SA 2JEBB 3ZKDA 5C0XF 4Q35B 4OO1C 1FKAE 5IV8B 4DU8A 1U2RA 3WU3A 2DLKA 2JT2A 4LF7I 1KYQA 2LJUA 1ZXMA 1XNRI 3CDJA 2NUFA 3KZYA 4AM3A 4M1KA 2F8BA 2L3JA 2UUAE 2EM7A 1KIJA 2O1VA 4BHBA 1IBMI 1A1FA 2WZOA 2ZITA 4R2EA 2V87A 4JV5E 3PS2A 2L2KB 2F4VE 3D4JA 4FW5A 3ZKBA 2JXPA 5FLXC 2UUBE 3THNA 5CFFE 1Z1BA 1X47A 1YZ9A 4LPFA 4JI5I 1YH8A 4OZEA 2Z5EA 2WBTA 2J7JA 2EOHA 2YRMA 5A2QC 1N34I 5K36A 4IZKA 1BB8A 1PVGA 3Q6NA 2ODRC 2EM8A 1UDNA
chains in the Genus database with same CATH topology
2CG9A 2GQ0A 1GQEA 4FN5A 1MU5A 4WSPA 4LFAI 4BC9A 3OTOE 4YHHE 4DV0E 2A2CA 2LUPB 4LF9E 1ZBTA 3WU5A 2VQFE 2Z5CA 4P52A 4MYUA 2DMYA 3F6HA 2VQEE 4PRXA 2H36X 4Z7CA 3T1YI 3ZZUA 4LF4E 2V88A 5L3JA 4DUZI 4DPYA 3JAMQ 4GKKI 5DNYA 4JI6E 1YYKA 4DV3I 4WYQB 3J80Q 5AE3A 3J81Q 1KTVA 3Q6MA 1XMOE 4JI1I 4B3TI 5BR8E 1UHZA 4AQYI 3ZM7A 5ADZA 4JG4A 4GEQB 4DUYI 1IBLI 4B3RI 2UXCE 2V34A 4DPTA 2IHR1 4YY3I 2DEIA 2X36A 5AE2A 4L8NA 4URLA 1Z0EA 3V5RA 4Q28A 1ZXNA 4F54A 4BBYA 1EA6A 4X65I 1FWLA 1N32I 4KZSA 3QT7A 4JI0I 2V83A 1Z5BA 4HYMA 4LF6E 3Q1QA 2KONA 5FLXQ 4BC7A 1RQ0A 2ODRD 4DV6I 2UU9I 4GKJE 5A2QQ 2NUEA 3QT6A 2LJHA 2LTRA 3MSWA 1XNQE 4JI2I 4NXNI 1HNZE 2JY9A 2HHHE 4X66E 4DV2E 1EKZA 2B3TB 4JI3I 2JVAA 3ZZ0A 4USMA 5LMNI 3IWDA 4DR7I 3P06A 4B3SE 4M2ZA 1ZM3A 1YYOA 2FV4B 3LPSA 2FTXB 3LTOA 4DMIA 1T4LB 4BMJA 4OX9E 1ZM2A 2BM0A 2NUGA 2JOBA 2E1RA 1N33I 4ZVIA 4IZJA 3AV0A 1FNMA 3PYDA 4DV5I 2HK2A 5GMDA 1N0VC 1Z0WA 2V8QB 2Q2EB 3VK6A 3J7Yp 2ZM6I 2UXBI 4MYTA 4I3HA 4B3ME 4F9CB 3PYFA 1D6TA 2V2VA 2L8TA 2MC5A 4HACA 3QT8A 4JI4I 4IZJB 1STUA 1DQ3A 1B62A 1WHQA 1HNXE 1EI1A 3B82A 4NXME 2N3GA 2UUCE 2UXDE 4I8OA 4LFCE 2N3HA 3K17A 5LMUI 1T4OA 2DEJA 4FWDA 2PNMA 2HK3A 1N0UA 3K6QA 3HTXA 4YHHI 4DV0I 4HACB 4LTYA 1KVKA 2VE7C 4LF9I 2VQFI 1XHKA 4JI8E 4IZKB 4JYAE 2E5LE 4UT4A 1RREA 2VQEI 1QU6A 1RR9A 5AE1A 4RPFA 1J5EI 2A2DA 2RS7A 3LNUA 3OMLA 4JI7I 3JTZA 4LF4I 1BKNA 2DB2A 1A6FA 3KWRA 3HULA 4P78A 3ADJA 4WUCA 4JI6I 4WUBA 1GZ6A 2V85A 2Z5CB 3H09A 1J26A 1XMOI 4BCAA 2ZBKB 2L3CA 4DR5I 1H7UA 4DV1E 4FWHA 5GMEA 5BR8I 4DV7E 2O1TA 1Z5AA 1XMQI 4DR4E 1QZRA 1VISA 4LFBI 2UXCI 3LMLA 5AASA 1IBLE 1WHNA 4DV4E 4WUDA 4KHPI 1ZBQA 3QT5A 4EMDA 4YY3E 2KOUA 1H7SA 4DR6I 2LMZA 1FJGI 3H4LA 3T1HE 5FWKA 2AJ4A 4Z7YA 2L92A 2CZ9A 4HY1A 1KKHA 2M7QA 4DR3E 3F6GA 2BV3A 4N3OA 4JI0E 4GKJI 2DSYA 2V2QA 4X62E 2R3VA 1UEKA 4X64E 1HNWI 2MDRA 2HKJA 1XNQI 2HKEA 1ZM9A 4LF8I 4K0KE 3F0NA 3B78A 1ELOA 1HNZI 4X66I 4R1FA 4XTJA 3PRYA 3AUZA 4DU7A 4TUIA 2LRSA 1I94E 4DR1I 5IWAE 1IBKE 2PNLA 3K1JA 1Z59A 5LL6R 5LMNE 1HR0I 2RSMA 4DR7E 2OI2A 2YT4A 3CWVA 3JAMC 4IZJD 2O1UA 2L2MA 1N36E 2LJPA 4DPXA 4UTGA 4DR2E 1DARA 2WW4A 4LF5E 2VF1A 3WU4A 2L2NA 3WU6A 1N33E 2RTXA 4R03A 2DIXA 2JOXA 4R8OA 1NHJA 3ADIA 4F9BB 2EWLA 5F3WA 1H74A 2UUAI 4WFTA 4DV5E 4LF7E 4WPYA 3RMPA 4B3MI 1XNRE 2IOQA 2JWOA 1Z0VA 4JV5I 1S16A 3IWCA 3J7AG 2F4VI 4P7DA 3FIGA 2ZM6E 1IBME 2UXBE 2UUBI 2LTSA 2B7TA 1HNXI 4KQVA 4JI5E 2FGGA 3VYYA 3ZZTA 4F9AB 1Y4SA 4NXMI 4JI4E 1N34E 3K85A 2EZ6A 2UUCI 2UXDI 4LFCI 4M0VA 1UILA 3PYEA 3OTOI 4FWGA 1RC7A 3IWBA 4DKKA 1USUA 5T6JA 3C4TA 1NZ0A 4LFAE 1SR9A 5LMUE 3VYXA 4LU9A 3HQ1A 3LLHA 1PIEA 2XEXA 1OJ4A 1WXRA 4JI8I 3DJWA 4JYAI 2E5LI 3PYGA 1K47A 3T1YE 2NPFA 2V8PA 4P7AA 4DUZE 1X49A 4GKKE 4PRVA 1Z0BA 2O1WA 4USKA 2YZTA 1J5EE 4DV3E 4JI7E 1WUUA 3B8HA 2BM1A 2G7HA 2HFUA 5IT9C 4JI1E 4HXZA 4B3TE 4DV1I 4AQYE 4DV7I 4DUYE 2B7VA 2M4IA 4DR5E 2L6MA 4BS9A 3ADLA 4B3RE 4DR4I 4DXLA 4OOGC 2V86A 4PU9A 1T4NA 1PKPA 2B9DA 1USVA 1Y6ZA 1XMQE 2CPNA 2LE2A 4DV4I 4LFBE 2JR1A 3HXLA 1YYWA 4X8WA 1Z5CA 2K4VA 3HJCA 4LF6I 4X65E 2EFGA 2IOPA 1N32E 2MC6A 4KHPE 3T1HI 4DR6E 2UU9E 4DV6E 4DR3I 1FJGE 4DPWA 1DI2A 4TUGA 1H73A 3DF6A 1B63A 4X62I 2HHHI 2L33A 2Z5BA 4X64I 4DV2I 1NHIA 2LUQA 1NHHA 3P1XA 4JI2E 3V2UC 1MX0A 2RS6A 2LBSB 1FI4A 4K0KI 4NXNE 1HNWE 2HFSA 3HPSA 4L5NC 3M6AA 2R42A 1HK7A 4ED4A 4JI3E 2E1MA 4LF8E 4FW9A 2V89A 4DPUA 4B3SI 3HPZA 2X7IA 1MG7A 1I94I 2V2ZA 1Z0TA 5IWAI 1IBKI 1ZM4A 3J7AM 1FWKA 2VF3A 2Z5BB 1H72C 1S4EA 4DR1E 4OX9I 3J80C 1Z0GA 3J81C 3C4BA 5IT9Q 1Z0CA 1HR0E 4J8ZA 2KHXA 2NA2A 4M30A 1N36I 1Y4UA 3ZOQB 1X48A 2GS8A 4DR2I 3ADGA 3GONA 4LF5I 1O0WA 2CGEA 3JU0A 2J7KA 2M1SA 3ZKDA 1FKAE 4DU8A 1U2RA 3WU3A 4LF7I 1ZXMA 1XNRI 2NUFA 4M1KA 2F8BA 2L3JA 2UUAE 1KIJA 2O1VA 1IBMI 2WZOA 2ZITA 2V87A 4JV5E 2L2KB 2F4VE 3D4JA 3ZKBA 5FLXC 2UUBE 5CFFE 1YZ9A 1X47A 4JI5I 2Z5EA 1N34I 5A2QC 4IZKA 1PVGA 3Q6NA 2ODRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQE A;  4FN5 A;  1MU5 A;  4LFA I;  3OTO E;  4YHH E;  4DV0 E;  2A2C A;  2LUP B;  4LF9 E;  1ZBT A;  3WU5 A;  2VQF E;  4P52 A;  4MYU A;  2DMY A;  2VQE E;  4PRX A;  4Z7C A;  3T1Y I;  3ZZU A;  4LF4 E;  5L3J A;  4DUZ I;  4DPY A;  3JAM Q;  4GKK I;  4JI6 E;  1YYK A;  4DV3 I;  4WYQ B;  3J80 Q;  3J81 Q;  1KTV A;  1XMO E;  4JI1 I;  4B3T I;  5BR8 E;  1UHZ A;  4AQY I;  3ZM7 A;  4JG4 A;  4DUY I;  1IBL I;  4B3R I;  2UXC E;  2V34 A;  4DPT A;  2IHR 1;  4YY3 I;  2DEI A;  2X36 A;  4URL A;  1Z0E A;  3V5R A;  1ZXN A;  1EA6 A;  4X65 I;  1FWL A;  1N32 I;  3QT7 A;  4JI0 I;  1Z5B A;  4HYM A;  4LF6 E;  3Q1Q A;  5FLX Q;  1RQ0 A;  2UU9 I;  4DV6 I;  4GKJ E;  5A2Q Q;  2NUE A;  3QT6 A;  2LJH A;  2LTR A;  1XNQ E;  4JI2 I;  4NXN I;  1HNZ E;  2JY9 A;  2HHH E;  4X66 E;  4DV2 E;  1EKZ A;  2B3T B;  4JI3 I;  2JVA A;  3ZZ0 A;  4USM A;  5LMN I;  4DR7 I;  4B3S E;  4M2Z A;  1ZM3 A;  1YYO A;  3LPS A;  3LTO A;  1T4L B;  4OX9 E;  1ZM2 A;  2BM0 A;  2NUG A;  2E1R A;  1N33 I;  4ZVI A;  1FNM A;  3PYD A;  4DV5 I;  2HK2 A;  5GMD A;  1N0V C;  1Z0W A;  2Q2E B;  3J7Y p;  2ZM6 I;  2UXB I;  4MYT A;  4I3H A;  4B3M E;  3PYF A;  1D6T A;  2V2V A;  4HAC A;  3QT8 A;  4JI4 I;  1STU A;  1B62 A;  1WHQ A;  1HNX E;  1EI1 A;  3B82 A;  4NXM E;  2N3G A;  2UUC E;  2UXD E;  4LFC E;  2N3H A;  3K17 A;  5LMU I;  1T4O A;  2DEJ A;  4FWD A;  2HK3 A;  1N0U A;  3HTX A;  4YHH I;  4DV0 I;  4HAC B;  1KVK A;  4LF9 I;  2VQF I;  1XHK A;  4JI8 E;  4JYA E;  2E5L E;  4UT4 A;  1RRE A;  2VQE I;  1QU6 A;  1RR9 A;  4RPF A;  1J5E I;  2A2D A;  2RS7 A;  3LNU A;  4JI7 I;  4LF4 I;  1BKN A;  2DB2 A;  1A6F A;  3HUL A;  3ADJ A;  4WUC A;  4JI6 I;  4WUB A;  1J26 A;  1XMO I;  2ZBK B;  4DR5 I;  2L3C A;  1H7U A;  4DV1 E;  4FWH A;  5GME A;  5BR8 I;  4DV7 E;  1Z5A A;  1XMQ I;  4DR4 E;  1QZR A;  1VIS A;  4LFB I;  2UXC I;  1IBL E;  1WHN A;  4DV4 E;  4WUD A;  4KHP I;  3QT5 A;  4EMD A;  4YY3 E;  1H7S A;  4DR6 I;  1FJG I;  3H4L A;  3T1H E;  2AJ4 A;  4Z7Y A;  4HY1 A;  2CZ9 A;  1KKH A;  4DR3 E;  2BV3 A;  4JI0 E;  4GKJ I;  2V2Q A;  4X62 E;  2R3V A;  1UEK A;  4X64 E;  1HNW I;  2MDR A;  2HKJ A;  1XNQ I;  2HKE A;  1ZM9 A;  4LF8 I;  4K0K E;  3F0N A;  3B78 A;  1ELO A;  1HNZ I;  4X66 I;  4R1F A;  4XTJ A;  4DU7 A;  2LRS A;  1I94 E;  4DR1 I;  5IWA E;  1IBK E;  3K1J A;  1Z59 A;  5LL6 R;  5LMN E;  1HR0 I;  2RSM A;  4DR7 E;  2OI2 A;  2YT4 A;  3CWV A;  3JAM C;  2L2M A;  1N36 E;  2LJP A;  4DPX A;  4UTG A;  4DR2 E;  1DAR A;  2WW4 A;  4LF5 E;  3WU4 A;  2L2N A;  3WU6 A;  1N33 E;  2RTX A;  2DIX A;  1NHJ A;  3ADI A;  1H74 A;  2UUA I;  4WFT A;  4DV5 E;  4LF7 E;  4B3M I;  1XNR E;  1Z0V A;  4JV5 I;  1S16 A;  2F4V I;  3J7A G;  2ZM6 E;  1IBM E;  2UXB E;  2UUB I;  2LTS A;  2B7T A;  1HNX I;  4KQV A;  4JI5 E;  3VYY A;  3ZZT A;  4NXM I;  4JI4 E;  1N34 E;  2EZ6 A;  2UUC I;  2UXD I;  4LFC I;  1UIL A;  3PYE A;  3OTO I;  4FWG A;  1RC7 A;  4DKK A;  3C4T A;  1NZ0 A;  4LFA E;  5LMU E;  3VYX A;  3LLH A;  1PIE A;  2XEX A;  1OJ4 A;  4JI8 I;  4JYA I;  2E5L I;  3PYG A;  1K47 A;  3T1Y E;  2NPF A;  2V8P A;  4P7A A;  4DUZ E;  1X49 A;  4GKK E;  4PRV A;  1Z0B A;  4USK A;  1J5E E;  4DV3 E;  4JI7 E;  1WUU A;  3B8H A;  2BM1 A;  2HFU A;  5IT9 C;  4JI1 E;  4HXZ A;  4B3T E;  4DV1 I;  4AQY E;  4DV7 I;  4DUY E;  2B7V A;  4DR5 E;  3ADL A;  4B3R E;  4DR4 I;  4DXL A;  4OOG C;  4PU9 A;  1T4N A;  1PKP A;  1XMQ E;  2CPN A;  4DV4 I;  4LFB E;  1YYW A;  4X8W A;  1Z5C A;  4LF6 I;  4X65 E;  2EFG A;  1N32 E;  4KHP E;  3T1H I;  4DR6 E;  2UU9 E;  4DV6 E;  4DR3 I;  1FJG E;  4DPW A;  1DI2 A;  1H73 A;  1B63 A;  4X62 I;  2HHH I;  2L33 A;  4X64 I;  4DV2 I;  1NHI A;  2LUQ A;  1NHH A;  3P1X A;  4JI2 E;  3V2U C;  1MX0 A;  2RS6 A;  2LBS B;  1FI4 A;  4K0K I;  4NXN E;  1HNW E;  2HFS A;  3M6A A;  2R42 A;  4ED4 A;  4JI3 E;  4LF8 E;  4FW9 A;  4DPU A;  4B3S I;  2X7I A;  1MG7 A;  1I94 I;  2V2Z A;  1Z0T A;  5IWA I;  1IBK I;  1ZM4 A;  3J7A M;  1FWK A;  2VF3 A;  1H72 C;  1S4E A;  4DR1 E;  4OX9 I;  3J80 C;  1Z0G A;  3J81 C;  3C4B A;  5IT9 Q;  1Z0C A;  1HR0 E;  2KHX A;  2NA2 A;  4M30 A;  1N36 I;  1X48 A;  2GS8 A;  4DR2 I;  3ADG A;  3GON A;  4LF5 I;  1O0W A;  2J7K A;  3ZKD A;  1FKA E;  4DU8 A;  1U2R A;  3WU3 A;  4LF7 I;  1ZXM A;  1XNR I;  2NUF A;  4M1K A;  2L3J A;  2UUA E;  1KIJ A;  1IBM I;  2ZIT A;  4JV5 E;  2L2K B;  2F4V E;  3D4J A;  3ZKB A;  5FLX C;  2UUB E;  5CFF E;  1YZ9 A;  1X47 A;  4JI5 I;  1N34 I;  5A2Q C;  1PVG A; 
#chains in the Genus database with same CATH topology
 4R2R A;  2JP9 A;  1GQE A;  2CG9 A;  2GQ0 A;  2CT1 A;  1MU5 A;  4FN5 A;  1SFE A;  4WSP A;  3TQM A;  5C0X E;  4LFA I;  4BC9 A;  3OTO E;  4YHH E;  4DV0 E;  2ADR A;  2A2C A;  2LUP B;  4LF9 E;  1VI7 A;  1ZBT A;  3WU5 A;  2VQF E;  2DRP A;  4R2C A;  2Z5C A;  1EH6 A;  4P52 A;  4MYU A;  1X6F A;  2DMY A;  3F6H A;  2VQE E;  5JEA F;  4PRX A;  2EN6 A;  4R2A A;  2H36 X;  4Z7C A;  3T1Y I;  3ZZU A;  4LF4 E;  5K36 B;  2LO3 A;  2HJJ A;  2V88 A;  5L3J A;  4DUZ I;  4DPY A;  1R6L A;  1PJQ A;  3JAM Q;  2K7I A;  2EN2 A;  4GKK I;  1YSA C;  5DNY A;  4JI6 E;  1YYK A;  4DV3 I;  1AAY A;  4WYQ B;  2C39 B;  3J80 Q;  5AE3 A;  3J81 Q;  5AC5 A;  2NAB A;  1KTV A;  3Q6M A;  1T38 A;  1XMO E;  4JI1 I;  4B3T I;  5BR8 E;  1UHZ A;  4AQY I;  2PO0 A;  4OO1 D;  5DNL A;  3ZM7 A;  5ADZ A;  2M9A A;  4GEQ B;  3GLL A;  4JG4 A;  4DUY I;  1IBL I;  4B3R I;  2BA0 G;  2LVH A;  2UXC E;  4HTG A;  2V34 A;  4DPT A;  2IHR 1;  2EM4 A;  1G2D C;  2DEI A;  2C37 A;  4YY3 I;  4IFD A;  2X36 A;  5AE2 A;  2C38 B;  2NN6 A;  2I13 A;  4L8N A;  4URL A;  1Z0E A;  3V5R A;  4Q28 A;  1Y5Y A;  1ZXN A;  2ENC A;  2EML A;  4F54 A;  4ZYG A;  4BBY A;  1EA6 A;  3M85 G;  2YTN A;  4X65 I;  1FWL A;  2A25 A;  1X6H A;  3BGH A;  1N32 I;  1EH7 A;  4KZS A;  3QT7 A;  5DRO A;  2PO0 B;  4JI0 I;  2V83 A;  2EMC A;  1Z5B A;  4HYM A;  1YPN A;  4LF6 E;  3Q1Q A;  2KON A;  5FLX Q;  2YWQ A;  1LLM C;  4BC7 A;  3VHT B;  1RQ0 A;  2ODR D;  4DV6 I;  2UU9 I;  2LV2 A;  5A6A A;  1A1G A;  4GKJ E;  5A2Q Q;  2NUE A;  1UBD C;  4IFD B;  2C37 B;  3KRN A;  3QT6 A;  5K36 C;  2YPN A;  2LJH A;  2LTR A;  1L4S A;  1UDS A;  4O24 A;  2GLI A;  3MSW A;  1XNQ E;  4OO1 F;  4MLV A;  4JI2 I;  2VRD A;  4QNJ A;  4NXN I;  1HNZ E;  2JY9 A;  2HHH E;  4X66 E;  4DV2 E;  1EKZ A;  4FK5 C;  3P3C A;  2YTO A;  1XXE A;  4LCG A;  2B3T B;  5ELW A;  5A69 A;  4JI3 I;  3MHH C;  2EMB A;  2D9H A;  2EMW A;  2JVA A;  3NZK A;  2EOJ A;  3ZZ0 A;  4USM A;  5LMN I;  2YTJ A;  2ENH A;  2GO3 A;  4U3D A;  1A1H A;  3IWD A;  4DR7 I;  3P06 A;  4B3S E;  4M2Z A;  1ZM3 A;  1YYO A;  4IJD A;  5A6K A;  2FV4 B;  2DLQ A;  2DGC A;  3LPS A;  4OKG A;  1OYP A;  2PO2 A;  2FTX B;  3LTO A;  4DMI A;  1T4L B;  2CVE A;  3C6M A;  4BMJ A;  4OX9 E;  1ZM2 A;  4BA2 B;  2BM0 A;  2EPK X;  2NUG A;  2JOB A;  2E1R A;  1N33 I;  4ZVI A;  2EMH A;  4IZJ A;  4OO1 E;  3AV0 A;  1FNM A;  3GCM A;  3PYD A;  1JK1 A;  4DV5 I;  1TF3 A;  5JEA D;  2EOX A;  2HK2 A;  5GMD A;  4ZYH A;  2DMI A;  1N0V C;  1Z0W A;  2V8Q B;  2Q2E B;  4IFD C;  3VK6 A;  3J7Y p;  2YTG A;  2ZM6 I;  2UXB I;  2NN6 C;  4MYT A;  4I3H A;  1NEI A;  5KL7 A;  4B3M E;  2EMA A;  4F9C B;  3PYF A;  5LLQ A;  1D6T A;  2V2V A;  2L8T A;  4N4R B;  2EQ1 A;  4BA1 B;  2MC5 A;  4HAC A;  2EM5 A;  3QT8 A;  2PNZ A;  3L7Z B;  2J65 A;  4FW6 A;  5DNX A;  4JI4 I;  4IZJ B;  1STU A;  3EQ1 A;  1DQ3 A;  4ZYD A;  1B62 A;  1WHQ A;  1HNX E;  1EI1 A;  1A1L A;  3B82 A;  2YU5 A;  4NXM E;  4WXD A;  3EPL A;  3UHM A;  2N3G A;  2RQL A;  2UUC E;  2UXD E;  2MKN A;  4I8O A;  4LFC E;  4NZV A;  2VES A;  2N3H A;  2EPP A;  3L00 A;  1A1J A;  3K17 A;  5LMU I;  1T4O A;  2EN8 A;  2DEJ A;  2EMX A;  3P3E A;  4FWD A;  2PNM A;  2WBS A;  1UN6 B;  2HK3 A;  1N0U A;  3K6Q A;  3HTX A;  2EJ4 A;  4YHH I;  4DV0 I;  4HAC B;  3EPH A;  4LTY A;  1KVK A;  2VE7 C;  4LF9 I;  2EOE A;  4R2D A;  1XHK A;  4JI8 E;  2IES A;  5AC4 A;  4IZK B;  4JYA E;  2BR2 A;  3C6K A;  2E5L E;  4UT4 A;  1RRE A;  2VQE I;  2EM0 A;  1QU6 A;  1RR9 A;  5AE1 A;  2EE8 A;  4RPF A;  1J5E I;  2A2D A;  2RS7 A;  3LNU A;  5DRQ A;  3OML A;  4JI7 I;  3JTZ A;  1IMU A;  4LF4 I;  1BKN A;  2MDG A;  4F2J C;  2DB2 A;  1P47 A;  1A6F A;  2EOI A;  3KWR A;  2JPA A;  3HUL A;  4QNK A;  4P78 A;  3ADJ A;  4WUC A;  4JI6 I;  2EMI A;  2ELY A;  4X9J A;  4WUB A;  3M7N D;  5DRP A;  1GZ6 A;  2Q8U A;  2V85 A;  2Z5C B;  5K36 F;  2EPN A;  3H09 A;  3PS3 A;  1J26 A;  3EPJ A;  4O4K A;  1XMO I;  4BCA A;  2ZBK B;  2L3C A;  4DR5 I;  1H7U A;  4DV1 E;  4FWH A;  5GME A;  5BR8 I;  4AID A;  4DV7 E;  2O1T A;  2BBG A;  1Z5A A;  1XMQ I;  2HC5 A;  2BB8 A;  4DR4 E;  4J3D A;  1QZR A;  3UK3 C;  1VIS A;  4LFB I;  2UXC I;  3LML A;  5JEA E;  2CTD A;  5AAS A;  5A6B A;  1IBL E;  1WHN A;  1WJP A;  1E3H A;  4O43 A;  4DV4 E;  3QG5 C;  3PS1 A;  4MU0 A;  4WUD A;  4KHP I;  1ZBQ A;  3QT5 A;  1UDQ A;  4EMD A;  2ELZ A;  4YY3 E;  2KOU A;  2N8X A;  1H7S A;  4DR6 I;  2LMZ A;  4WX9 A;  3U1Y A;  4IS1 C;  2JEA A;  1FJG I;  3H4L A;  3T1H E;  3H1C A;  5FWK A;  2AJ4 A;  4Z7Y A;  2EL4 A;  2L92 A;  2BA1 D;  2WBU A;  2CZ9 A;  1KKH A;  4HY1 A;  2M7Q A;  2HGH A;  2NN6 B;  1OYS A;  4DR3 E;  3F6G A;  2BV3 A;  4N3O A;  4JI0 E;  1F2I G;  4GKJ I;  2DSY A;  1YUJ A;  2V2Q A;  4X62 E;  2MKD A;  2R3V A;  2EPX A;  5A6J A;  1UEK A;  4X64 E;  4FW4 A;  2WCC 3;  2EM2 A;  2MDR A;  1HNW I;  2HKJ A;  4RH8 A;  1XNQ I;  2HKE A;  1ZM9 A;  4LF8 I;  5EL9 A;  4IFD F;  4K0K E;  3F0N A;  2EN1 A;  3B78 A;  1ELO A;  1HNZ I;  4X66 I;  2NN6 F;  4R1F A;  1TF6 A;  4XTJ A;  2JEA B;  5C0X A;  3PRY A;  1Y60 A;  2EPO A;  3AUZ A;  4DU7 A;  4TUI A;  3P76 A;  1OYR A;  5EKW A;  4LCH A;  2LCE A;  2LRS A;  1BBG A;  1I94 E;  3BBG A;  4DR1 I;  2EM6 A;  2I9I A;  5IWA E;  1IBK E;  1IQO A;  2PNL A;  3K1J A;  1Z59 A;  5LL6 R;  3GME A;  5LMN E;  2EMF A;  1HR0 I;  2RSM A;  2EOR A;  5KL2 A;  1T39 A;  4DR7 E;  2OI2 A;  2YT4 A;  3CWV A;  3JAM C;  4IZJ D;  2O1U A;  5C0X B;  2L2M A;  4NHR A;  4R2P A;  1N36 E;  4R2Q A;  2ENA A;  3BID A;  1BBO A;  2LJP A;  4UTG A;  4DPX A;  4DR2 E;  2YRK A;  1DAR A;  4MU1 A;  2WW4 A;  4LF5 E;  4IFD E;  2VF1 A;  3WU4 A;  3ECR A;  2L2N A;  3WU6 A;  2EPM X;  1N33 E;  2EPU A;  1TN9 A;  2RTX A;  4R03 A;  2DIX A;  2JOX A;  4R8O A;  1NHJ A;  2PO2 B;  1MGT A;  3KZZ A;  3ADI A;  4F9B B;  2EWL A;  5F3W A;  1WRJ A;  1H74 A;  4WFT A;  2EOM A;  4DV5 E;  2UUA I;  4LF7 E;  4WPY A;  1RMD A;  1R6M A;  2JYA A;  3RMP A;  4B3M I;  1XNR E;  2IOQ A;  4WXC A;  2JWO A;  2EQ0 A;  4M9V C;  1Z0V A;  1S16 A;  3IWC A;  3J7A G;  2F4V I;  4JV5 I;  4P7D A;  2EN7 A;  3FIG A;  2YTF A;  2ZM6 E;  1IBM E;  2UXB E;  5JEA A;  2EPR A;  2UUB I;  2LTS A;  2EMY A;  2YSP A;  1N3G A;  2B7T A;  5KL5 A;  4MQY A;  5KL3 A;  1HNX I;  4KQV A;  4JI5 E;  2FGG A;  3VYY A;  4NBQ A;  3ZZT A;  2EOO A;  4F9A B;  1Y4S A;  4NXM I;  2EL5 A;  2YTE A;  4JI4 E;  1N34 E;  3K85 A;  2EZ6 A;  2UUC I;  2UXD I;  4LFC I;  1PJS A;  2RSI A;  4M0V A;  1UIL A;  3PYE A;  3OTO I;  4FWG A;  2CSH A;  1G2F C;  2PNZ B;  1RC7 A;  3IWB A;  4DKK A;  1USU A;  3P3G A;  5T6J A;  3DD6 A;  3C4T A;  1NZ0 A;  2EP3 A;  4LFA E;  1SR9 A;  5JEA B;  5LMU E;  3VYX A;  4LU9 A;  4GQU A;  3HQ1 A;  3LLH A;  1PIE A;  2EMG A;  2C39 A;  2XEX A;  4IS9 A;  4HEI A;  1OJ4 A;  1WXR A;  4KWY A;  5C0X C;  1P42 A;  4JI8 I;  2LT7 A;  3DJW A;  4JYA I;  2E5L I;  2EL6 A;  4F6M A;  2EMK A;  3PYG A;  1K47 A;  2BA0 D;  3M99 B;  2EPC A;  3T1Y E;  3HKM A;  4ZYE A;  2NPF A;  2V8P A;  4P7A A;  4DUZ E;  1X49 A;  4LCF A;  4GKK E;  4PRV A;  1Z0B A;  2O1W A;  1RHY A;  4LOM A;  4USK A;  2EPL X;  2YZT A;  1J5E E;  4DV3 E;  4JI7 E;  1WUU A;  1A1I A;  2BM1 A;  2WNR A;  3B8H A;  2G7H A;  2HFU A;  5IT9 C;  2BR2 B;  2EPZ A;  4IFD D;  2C38 A;  3M85 D;  2RPC A;  4JI1 E;  4HXZ A;  2NN6 D;  2EOQ A;  1YUI A;  4B3T E;  4DV1 I;  4AIM A;  4RHB B;  4AQY E;  4DV7 I;  3BF2 A;  4DUY E;  2F1D A;  2B7V A;  1GTK A;  2M4I A;  5A6B D;  2L6M A;  1ZR9 A;  4BS9 A;  4DR5 E;  3ADL A;  4B3R E;  4DXL A;  4DR4 I;  4OOG C;  2EOS A;  2V86 A;  1ZAA C;  4OO1 A;  3THO B;  4PU9 A;  1PKP A;  1T4N A;  2B9D A;  2EOZ A;  4GZN C;  1USV A;  1Y6Z A;  1XMQ E;  2AE8 A;  2CPN A;  2YU8 A;  1AH5 A;  2LE2 A;  4DV4 I;  4ISA A;  4LFB E;  2JR1 A;  3HXL A;  1YYW A;  3M7N G;  4X8W A;  2YTQ A;  2WNR B;  1Z5C A;  2K4V A;  5K36 D;  3HJC A;  4FW7 A;  1NCS A;  4LF6 I;  2YRH A;  4X65 E;  2EFG A;  2R76 A;  2IOP A;  3EPK A;  1N32 E;  5DRR A;  2EPA A;  2MC6 A;  4F6N A;  4KHP E;  4O5G A;  3MHS C;  5JEA C;  5K36 E;  3U1K A;  3T1H I;  4MU3 A;  3CDI A;  4R2S A;  2VQF I;  2EM9 A;  5TSE A;  1JK2 A;  4DR6 E;  1PJT A;  2IER A;  4MDT A;  5IXM B;  2JE6 A;  2UU9 E;  4DV6 E;  3B4T A;  4DR3 I;  2GHF A;  1FJG E;  4OO1 B;  2EN4 A;  4DPW A;  1DI2 A;  4TUG A;  1A1K A;  3DF6 A;  1H73 A;  2EOF A;  2EM3 A;  1QNT A;  1B63 A;  4X62 I;  2WP8 A;  2HHH I;  2L33 A;  1X6E A;  2Z5B A;  4X64 I;  1NHI A;  4DV2 I;  4WSG A;  2LUQ A;  1NHH A;  3P1X A;  4JI2 E;  3V2U C;  5C0X D;  1MX0 A;  2PO1 A;  2RS6 A;  2LBS B;  1FI4 A;  4K0K I;  2PRT A;  4NXN E;  2YTP A;  2GO4 A;  1HNW E;  2EQ3 A;  2YTI A;  3HPS A;  4L5N C;  1DGC A;  1E3P A;  2HFS A;  1HK7 A;  2R42 A;  3M6A A;  1KJK A;  4FW3 A;  4U3B A;  4ED4 A;  4JI3 E;  2E1M A;  4LF8 E;  2E72 A;  2BA1 G;  4FW9 A;  2V89 A;  1UDO A;  4DPU A;  4B3S I;  2JE6 B;  3HPZ A;  2GPI A;  1X3C A;  2X7I A;  4BA2 A;  1IQS A;  2YSO A;  1PDA A;  1MG7 A;  1I94 I;  2V2Z A;  1YFH A;  1Z0T A;  2JEB A;  5IWA I;  1IBK I;  1ZM4 A;  3J7A M;  1FWK A;  4MU4 A;  2WP8 B;  2VF3 A;  2R1F A;  2Z5B B;  1H72 C;  1S4E A;  4DR1 E;  4OX9 I;  3J80 C;  1X5W A;  1Z0G A;  3J81 C;  2O3Z A;  2PO1 B;  3C4B A;  5IT9 Q;  5KL4 A;  2EMZ A;  1Z0C A;  1HR0 E;  4J8Z A;  2KHX A;  1B69 A;  1MEY C;  2NA2 A;  4M30 A;  1N36 I;  2NN6 E;  1Y4U A;  2YTD A;  2EOY A;  3ZOQ B;  1X48 A;  1EH8 A;  2GS8 A;  4BHC A;  4DR2 I;  3ADG A;  5KL6 A;  4MLQ A;  1ZU1 A;  3GON A;  1O0W A;  4BA1 A;  4LF5 I;  2EN3 A;  2CGE A;  3JU0 A;  2J7K A;  1YHC A;  3L7Z A;  2M1S A;  2JEB B;  3ZKD A;  5C0X F;  4Q35 B;  4OO1 C;  1FKA E;  5IV8 B;  4DU8 A;  1U2R A;  3WU3 A;  2DLK A;  2JT2 A;  4LF7 I;  1KYQ A;  2LJU A;  1ZXM A;  1XNR I;  3CDJ A;  2NUF A;  3KZY A;  4AM3 A;  4M1K A;  2F8B A;  2L3J A;  2UUA E;  2EM7 A;  1KIJ A;  2O1V A;  4BHB A;  1IBM I;  1A1F A;  2WZO A;  2ZIT A;  4R2E A;  2V87 A;  4JV5 E;  3PS2 A;  2L2K B;  2F4V E;  3D4J A;  4FW5 A;  3ZKB A;  2JXP A;  5FLX C;  2UUB E;  3THN A;  5CFF E;  1Z1B A;  1X47 A;  1YZ9 A;  4LPF A;  4JI5 I;  1YH8 A;  4OZE A;  2Z5E A;  2WBT A;  2J7J A;  2EOH A;  2YRM A;  5A2Q C;  1N34 I;  5K36 A;  4IZK A;  1BB8 A;  1PVG A;  3Q6N A;  2ODR C;  2EM8 A;  1UDN A; 
#chains in the Genus database with same CATH homology
 2CG9 A;  2GQ0 A;  1GQE A;  4FN5 A;  1MU5 A;  4WSP A;  4LFA I;  4BC9 A;  3OTO E;  4YHH E;  4DV0 E;  2A2C A;  2LUP B;  4LF9 E;  1ZBT A;  3WU5 A;  2VQF E;  2Z5C A;  4P52 A;  4MYU A;  2DMY A;  3F6H A;  2VQE E;  4PRX A;  2H36 X;  4Z7C A;  3T1Y I;  3ZZU A;  4LF4 E;  2V88 A;  5L3J A;  4DUZ I;  4DPY A;  3JAM Q;  4GKK I;  5DNY A;  4JI6 E;  1YYK A;  4DV3 I;  4WYQ B;  3J80 Q;  5AE3 A;  3J81 Q;  1KTV A;  3Q6M A;  1XMO E;  4JI1 I;  4B3T I;  5BR8 E;  1UHZ A;  4AQY I;  3ZM7 A;  5ADZ A;  4JG4 A;  4GEQ B;  4DUY I;  1IBL I;  4B3R I;  2UXC E;  2V34 A;  4DPT A;  2IHR 1;  4YY3 I;  2DEI A;  2X36 A;  5AE2 A;  4L8N A;  4URL A;  1Z0E A;  3V5R A;  4Q28 A;  1ZXN A;  4F54 A;  4BBY A;  1EA6 A;  4X65 I;  1FWL A;  1N32 I;  4KZS A;  3QT7 A;  4JI0 I;  2V83 A;  1Z5B A;  4HYM A;  4LF6 E;  3Q1Q A;  2KON A;  5FLX Q;  4BC7 A;  1RQ0 A;  2ODR D;  4DV6 I;  2UU9 I;  4GKJ E;  5A2Q Q;  2NUE A;  3QT6 A;  2LJH A;  2LTR A;  3MSW A;  1XNQ E;  4JI2 I;  4NXN I;  1HNZ E;  2JY9 A;  2HHH E;  4X66 E;  4DV2 E;  1EKZ A;  2B3T B;  4JI3 I;  2JVA A;  3ZZ0 A;  4USM A;  5LMN I;  3IWD A;  4DR7 I;  3P06 A;  4B3S E;  4M2Z A;  1ZM3 A;  1YYO A;  2FV4 B;  3LPS A;  2FTX B;  3LTO A;  4DMI A;  1T4L B;  4BMJ A;  4OX9 E;  1ZM2 A;  2BM0 A;  2NUG A;  2JOB A;  2E1R A;  1N33 I;  4ZVI A;  4IZJ A;  3AV0 A;  1FNM A;  3PYD A;  4DV5 I;  2HK2 A;  5GMD A;  1N0V C;  1Z0W A;  2V8Q B;  2Q2E B;  3VK6 A;  3J7Y p;  2ZM6 I;  2UXB I;  4MYT A;  4I3H A;  4B3M E;  4F9C B;  3PYF A;  1D6T A;  2V2V A;  2L8T A;  2MC5 A;  4HAC A;  3QT8 A;  4JI4 I;  4IZJ B;  1STU A;  1DQ3 A;  1B62 A;  1WHQ A;  1HNX E;  1EI1 A;  3B82 A;  4NXM E;  2N3G A;  2UUC E;  2UXD E;  4I8O A;  4LFC E;  2N3H A;  3K17 A;  5LMU I;  1T4O A;  2DEJ A;  4FWD A;  2PNM A;  2HK3 A;  1N0U A;  3K6Q A;  3HTX A;  4YHH I;  4DV0 I;  4HAC B;  4LTY A;  1KVK A;  2VE7 C;  4LF9 I;  2VQF I;  1XHK A;  4JI8 E;  4IZK B;  4JYA E;  2E5L E;  4UT4 A;  1RRE A;  2VQE I;  1QU6 A;  1RR9 A;  5AE1 A;  4RPF A;  1J5E I;  2A2D A;  2RS7 A;  3LNU A;  3OML A;  4JI7 I;  3JTZ A;  4LF4 I;  1BKN A;  2DB2 A;  1A6F A;  3KWR A;  3HUL A;  4P78 A;  3ADJ A;  4WUC A;  4JI6 I;  4WUB A;  1GZ6 A;  2V85 A;  2Z5C B;  3H09 A;  1J26 A;  1XMO I;  4BCA A;  2ZBK B;  2L3C A;  4DR5 I;  1H7U A;  4DV1 E;  4FWH A;  5GME A;  5BR8 I;  4DV7 E;  2O1T A;  1Z5A A;  1XMQ I;  4DR4 E;  1QZR A;  1VIS A;  4LFB I;  2UXC I;  3LML A;  5AAS A;  1IBL E;  1WHN A;  4DV4 E;  4WUD A;  4KHP I;  1ZBQ A;  3QT5 A;  4EMD A;  4YY3 E;  2KOU A;  1H7S A;  4DR6 I;  2LMZ A;  1FJG I;  3H4L A;  3T1H E;  5FWK A;  2AJ4 A;  4Z7Y A;  2L92 A;  2CZ9 A;  4HY1 A;  1KKH A;  2M7Q A;  4DR3 E;  3F6G A;  2BV3 A;  4N3O A;  4JI0 E;  4GKJ I;  2DSY A;  2V2Q A;  4X62 E;  2R3V A;  1UEK A;  4X64 E;  1HNW I;  2MDR A;  2HKJ A;  1XNQ I;  2HKE A;  1ZM9 A;  4LF8 I;  4K0K E;  3F0N A;  3B78 A;  1ELO A;  1HNZ I;  4X66 I;  4R1F A;  4XTJ A;  3PRY A;  3AUZ A;  4DU7 A;  4TUI A;  2LRS A;  1I94 E;  4DR1 I;  5IWA E;  1IBK E;  2PNL A;  3K1J A;  1Z59 A;  5LL6 R;  5LMN E;  1HR0 I;  2RSM A;  4DR7 E;  2OI2 A;  2YT4 A;  3CWV A;  3JAM C;  4IZJ D;  2O1U A;  2L2M A;  1N36 E;  2LJP A;  4DPX A;  4UTG A;  4DR2 E;  1DAR A;  2WW4 A;  4LF5 E;  2VF1 A;  3WU4 A;  2L2N A;  3WU6 A;  1N33 E;  2RTX A;  4R03 A;  2DIX A;  2JOX A;  4R8O A;  1NHJ A;  3ADI A;  4F9B B;  2EWL A;  5F3W A;  1H74 A;  2UUA I;  4WFT A;  4DV5 E;  4LF7 E;  4WPY A;  3RMP A;  4B3M I;  1XNR E;  2IOQ A;  2JWO A;  1Z0V A;  4JV5 I;  1S16 A;  3IWC A;  3J7A G;  2F4V I;  4P7D A;  3FIG A;  2ZM6 E;  1IBM E;  2UXB E;  2UUB I;  2LTS A;  2B7T A;  1HNX I;  4KQV A;  4JI5 E;  2FGG A;  3VYY A;  3ZZT A;  4F9A B;  1Y4S A;  4NXM I;  4JI4 E;  1N34 E;  3K85 A;  2EZ6 A;  2UUC I;  2UXD I;  4LFC I;  4M0V A;  1UIL A;  3PYE A;  3OTO I;  4FWG A;  1RC7 A;  3IWB A;  4DKK A;  1USU A;  5T6J A;  3C4T A;  1NZ0 A;  4LFA E;  1SR9 A;  5LMU E;  3VYX A;  4LU9 A;  3HQ1 A;  3LLH A;  1PIE A;  2XEX A;  1OJ4 A;  1WXR A;  4JI8 I;  3DJW A;  4JYA I;  2E5L I;  3PYG A;  1K47 A;  3T1Y E;  2NPF A;  2V8P A;  4P7A A;  4DUZ E;  1X49 A;  4GKK E;  4PRV A;  1Z0B A;  2O1W A;  4USK A;  2YZT A;  1J5E E;  4DV3 E;  4JI7 E;  1WUU A;  3B8H A;  2BM1 A;  2G7H A;  2HFU A;  5IT9 C;  4JI1 E;  4HXZ A;  4B3T E;  4DV1 I;  4AQY E;  4DV7 I;  4DUY E;  2B7V A;  2M4I A;  4DR5 E;  2L6M A;  4BS9 A;  3ADL A;  4B3R E;  4DR4 I;  4DXL A;  4OOG C;  2V86 A;  4PU9 A;  1T4N A;  1PKP A;  2B9D A;  1USV A;  1Y6Z A;  1XMQ E;  2CPN A;  2LE2 A;  4DV4 I;  4LFB E;  2JR1 A;  3HXL A;  1YYW A;  4X8W A;  1Z5C A;  2K4V A;  3HJC A;  4LF6 I;  4X65 E;  2EFG A;  2IOP A;  1N32 E;  2MC6 A;  4KHP E;  3T1H I;  4DR6 E;  2UU9 E;  4DV6 E;  4DR3 I;  1FJG E;  4DPW A;  1DI2 A;  4TUG A;  1H73 A;  3DF6 A;  1B63 A;  4X62 I;  2HHH I;  2L33 A;  2Z5B A;  4X64 I;  4DV2 I;  1NHI A;  2LUQ A;  1NHH A;  3P1X A;  4JI2 E;  3V2U C;  1MX0 A;  2RS6 A;  2LBS B;  1FI4 A;  4K0K I;  4NXN E;  1HNW E;  2HFS A;  3HPS A;  4L5N C;  3M6A A;  2R42 A;  1HK7 A;  4ED4 A;  4JI3 E;  2E1M A;  4LF8 E;  4FW9 A;  2V89 A;  4DPU A;  4B3S I;  3HPZ A;  2X7I A;  1MG7 A;  1I94 I;  2V2Z A;  1Z0T A;  5IWA I;  1IBK I;  1ZM4 A;  3J7A M;  1FWK A;  2VF3 A;  2Z5B B;  1H72 C;  1S4E A;  4DR1 E;  4OX9 I;  3J80 C;  1Z0G A;  3J81 C;  3C4B A;  5IT9 Q;  1Z0C A;  1HR0 E;  4J8Z A;  2KHX A;  2NA2 A;  4M30 A;  1N36 I;  1Y4U A;  3ZOQ B;  1X48 A;  2GS8 A;  4DR2 I;  3ADG A;  3GON A;  4LF5 I;  1O0W A;  2CGE A;  3JU0 A;  2J7K A;  2M1S A;  3ZKD A;  1FKA E;  4DU8 A;  1U2R A;  3WU3 A;  4LF7 I;  1ZXM A;  1XNR I;  2NUF A;  4M1K A;  2F8B A;  2L3J A;  2UUA E;  1KIJ A;  2O1V A;  1IBM I;  2WZO A;  2ZIT A;  2V87 A;  4JV5 E;  2L2K B;  2F4V E;  3D4J A;  3ZKB A;  5FLX C;  2UUB E;  5CFF E;  1YZ9 A;  1X47 A;  4JI5 I;  2Z5E A;  1N34 I;  5A2Q C;  4IZK A;  1PVG A;  3Q6N A;  2ODR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...