4DR3E

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4dr3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dr3E02
2HK3A 3WU4A 2DEIA 4FW9A 1OJ4A 2XEXA 2LRSA 1N33E 4URLA 4WUCA 3C4BA 4LF9I 3JAMC 4M30A 4JI1I 2VQFI 2MDRA 2NUFA 4K0KE 4KHPE 1YZ9A 1QZRA 4HY1A 4RPFA 1GQEA 2KHXA 2V2QA 4UT4A 1T4NA 1X49A 4X64E 2ZM6I 4B3SI 3V5RA 1IBMI 1XNQE 1NHJA 1PKPA 5GMEA 4X65I 1N32E 1PIEA 1S4EA 3K17A 3VYXA 4JI2I 4DR6I 4JI0E 1Z0WA 1Z0VA 2YT4A 3V2UC 4X66E 1ZM4A 1HR0I 2UUAI 4NXNI 4GKKI 4DR3E 1H7SA 4DR4E 1ZXNA 1FI4A 2N3HA 4HACA 5BR8E 1I94I 2UUBE 2UUCI 4M1KA 3WU6A 2DMYA 1FWKA 4HXZA 1ZXMA 4OX9E 2BM1A 1RREA 1MX0A 1ZM2A 4YY3E 1X48A 1WHNA 4YHHE 2UXCI 2F4VI 1ELOA 4NXME 1MG7A 1IBLI 2JY9A 3K1JA 4B3RE 2HHHI 4Z7YA 4LFBE 4DV5I 4DU7A 4LF6I 1N36I 4KQVA 3ZZTA 4LF4E 2V2VA 4JI4E 3QT6A 3OTOI 4JI7I 1H74A 3HTXA 4DV2I 4X62I 2A2DA 4WUBA 5IT9C 1J5EI 4HYMA 2GS8A 3PYEA 4B3ME 1N34I 5A2QC 4DV4I 1Z5CA 4LFCI 1NHHA 2B3TB 3J7Yp 2B7TA 3ADGA 2NA2A 3ZKBA 2DB2A 3T1YE 1HNXE 1HNZI 1B62A 3T1HE 4DV7E 3C4TA 3F0NA 4DR5E 1N0UA 2HFUA 1Z5BA 5LMUI 4JV5E 2HKJA 2RS7A 4LF5I 2HKEA 2EZ6A 4DU8A 5FLXC 3J80C 4MYTA 1B63A 4LFAI 2L3JA 4LF9E 4JI1E 3M6AA 2VQFE 2X36A 5CFFE 1STUA 1WUUA 1VISA 1UILA 2ZBKB 4B3TI 3P1XA 1FJGI 4DV0I 2ZM6E 4B3SE 4FWGA 1IBME 4JI3I 2R42A 4AQYI 4X65E 1U2RA 3QT7A 2VQEI 3D4JA 4JI2E 4DR6E 1PVGA 2A2CA 1XMQI 4DKKA 1HR0E 2UUAE 4GKJI 4NXNE 4GKKE 4LF7I 3B8HA 3PYGA 1I94E 1Z0BA 1XMOI 2UUCE 2E5LI 2N3GA 4P52A 1RQ0A 3QT8A 1RR9A 4HACB 3QT5A 4DUZI 4JI8I 2UXCE 2F4VE 4DV6I 3WU5A 3ZM7A 1WHQA 3J7AG 1HNWI 1IBLE 2HHHE 3J80Q 3B82A 3LNUA 1Z0GA 4DV5E 4I3HA 4JYAI 1EI1A 3J7AM 1S16A 4UTGA 4ZVIA 3JAMQ 4LF6E 1N36E 1A6FA 1Z0CA 4DR1I 3OTOE 4JI7E 4JG4A 5IWAI 2EFGA 2L2KB 4DV2E 2UU9I 2CPNA 4DV1I 4X62E 1T4OA 2BV3A 4R1FA 1J5EE 4DR2I 2DIXA 4JI5I 4DPUA 2OI2A 1N34E 2UXDI 4DV4E 4P7AA 4LFCE 2L2NA 1RC7A 1DARA 5LMNI 3J81C 2LTRA 4JI6I 1HNZE 3VYYA 3HULA 4LF8I 2CZ9A 4DUYI 1KIJA 4EMDA 2UXBI 4M2ZA 4WYQB 2JVAA 1YYKA 1BKNA 2RTXA 5LMUE 1FKAE 3Q1QA 5L3JA 2R3VA 4DR7I 1EA6A 4LF5E 4MYUA 2NPFA 1UHZA 2IHR1 3PYFA 2LTSA 4DV3I 1FNMA 2L3CA 1Z5AA 2V8PA 1NHIA 4LFAE 1XNRI 1J26A 1QU6A 1XHKA 2RS6A 1IBKI 2LJHA 2HK2A 4OOGC 4B3TE 2ZITA 1FJGE 2Q2EB 4DV0E 1N33I 4WFTA 4JI3E 2V34A 4AQYE 5IT9Q 4DPWA 1YYOA 2VQEE 1Z0EA 4KHPI 4K0KI 2HFSA 2WW4A 5A2QQ 4X64I 4PRXA 1XMQE 2LUQA 1XNQI 4GKJE 3ADIA 1H73A 1KVKA 2NUGA 4LF7E 5LL6R 4USMA 1XMOE 1T4LB 2E5LE 2J7KA 3H4LA 3J81Q 1N32I 4XTJA 4JI0I 1K47A 1KKHA 4X66I 4DPXA 4DR3I 1DI2A 2L33A 1NZ0A 4DR4I 4PRVA 4DUZE 4USKA 5BR8I 2UUBI 4FWDA 3LLHA 3LPSA 4JI8E 2B7VA 4DV6E 2RSMA 3WU3A 2BM0A 5FLXQ 4X8WA 1HNWE 3ZZ0A 4OX9I 2E1RA 1O0WA 1ZM3A 4YY3I 2LUPB 1Z59A 4JYAE 2LJPA 3ADLA 4YHHI 1D6TA 4DPYA 2L2MA 4NXMI 1Z0TA 4DR1E 4B3RI 5IWAE 4FWHA 1H72C 3ZKDA 3LTOA 2UU9E 2LBSB 4LFBI 4ED4A 1MU5A 4DV1E 1ZBTA 5GMDA 2V2ZA 1UEKA 4DR2E 4JI5E 1KTVA 4LF4I 4JI4I 2DEJA 4WUDA 4PU9A 2UXDE 1H7UA 3PYDA 1EKZA 5LMNE 4Z7CA 2X7IA 4B3MI 2NUEA 2AJ4A 4JI6E 1FWLA 4LF8E 3CWVA 4DUYE 2UXBE 3ADJA 4DXLA 3T1YI 1HNXI 4DR7E 3B78A 3T1HI 1YYWA 4DV7I 1X47A 1N0VC 3ZZUA 4DV3E 4FN5A 4DR5I 1XNRE 4DPTA 1ZM9A 4JV5I 1IBKE 2VF3A 3GONA
chains in the Genus database with same CATH superfamily
2FV4B 2HK3A 2V89A 1YPNA 3WU4A 3ZOQB 2DEIA 4Q28A 5KL4A 4FW9A 2UUBI 1OJ4A 2JPAA 2LRSA 2EMBA 3KZZA 2XEXA 4X9JA 1N33E 1YSAC 4URLA 2FGGA 3BF2A 3C4BA 4WPYA 2IOQA 4MDTA 4WUCA 4LF9I 5A6KA 3JAMC 2H36X 4M30A 4JI1I 2VQFI 5JEAE 2MDRA 2NUFA 3THOB 4N3OA 4K0KE 4N4RB 4KHPE 1YZ9A 4LPFA 5A6JA 4F6MA 1QZRA 4HY1A 4TUIA 4RPFA 2ENCA 1GQEA 2KHXA 2JOBA 2YTIA 2V2QA 4UT4A 4OO1C 1T4NA 1X49A 3IWBA 4X64E 2ZM6I 2R1FA 1OYSA 4B3SI 3V5RA 1IBMI 1XNQE 1PJQA 4WXCA 1NHJA 3KRNA 4IZJD 4BS9A 2VRDA 5KL2A 1PKPA 5GMEA 4X65I 2G7HA 2EOOA 1YUJA 1TN9A 1N32E 2LO3A 1A1HA 2EPOA 2I9IA 1PIEA 4HTGA 1S4EA 3K17A 3VYXA 4JI2I 4DR6I 2V85A 2YTGA 4JI0E 2EMFA 1BBGA 2VF1A 2EMCA 1Z0VA 1Z0WA 2GO3A 2YT4A 3P76A 2GO4A 3V2UC 2YSOA 2YU5A 4X66E 2WBUA 4Q35B 1OYPA 1ZM4A 1HR0I 2EMGA 2UUAI 2EMLA 3EPJA 4NXNI 2LT7A 2L92A 4DR3E 2EOSA 1YFHA 4DR4E 1H7SA 2Z5BA 1ZXNA 1YH8A 3PS1A 1FI4A 2N3HA 2Z5CB 4HACA 5BR8E 4FW3A 1I94I 2UUBE 2UUCI 4M1KA 3KZYA 5ELWA 3OMLA 3WU6A 2DMYA 2EN6A 1FWKA 2EOZA 2YRHA 2PO0B 2EPRA 1T38A 5K36A 2EL6A 4HXZA 1ZXMA 4OX9E 4F54A 2EM6A 2BM1A 2YTOA 4FW5A 4KZSA 2BR2B 1RREA 1MX0A 1ZM2A 4LCFA 4YY3E 2A25A 2DSYA 3M99B 2O1VA 1F2IG 4DMIA 1WHNA 1X48A 4YHHE 2UXCI 2JE6B 4FK5C 2F4VI 1ELOA 2IERA 3H09A 4ISAA 4NXME 2EJ4A 5IV8B 1IBKE 1MG7A 1XXEA 4P78A 1IBLI 2JY9A 4ZYHA 3K1JA 4B3RE 4BHBA 2HHHI 2BA0G 1X6EA 1IMUA 2NN6C 4O5GA 1G2FC 4Z7YA 2I13A 5DNXA 4LFBE 2AE8A 4DV5I 2EOEA 2Q8UA 4FW7A 4DU7A 5EKWA 4IS9A 2WCC3 2PO2A 4LF6I 1N36I 4KQVA 3ZZTA 4LF4E 3HQ1A 2E1MA 2MC6A 2EQ0A 4JI4E 1KJKA 1UN6B 3UK3C 2V2VA 3QT6A 3OTOI 4JI7I 1H74A 1R6MA 5KL6A 3HPZA 3HTXA 4DV2I 2F1DA 4IFDA 4BA1B 2EORA 2A2DA 4OO1A 4X62I 4J3DA 4WUBA 4F9BB 2C38B 5IT9C 4AM3A 1J5EI 2YTQA 4HYMA 3M7ND 2WZOA 2GS8A 3PYEA 5K36D 4B3ME 2EM5A 2PNLA 3GCMA 1N34I 4U3BA 2EQ3A 1ZU1A 2LV2A 5A2QC 2EMZA 1JK1A 4DV4I 2DLQA 1Z5CA 5DRQA 4LFCI 2EOYA 1NHHA 4OKGA 4TUGA 2B3TB 3J7Yp 2GHFA 1RHYA 2B7TA 5K36F 5JEAA 5C0XF 5K36C 3ADGA 1UDNA 2NA2A 1EH7A 3ZKBA 2DB2A 1WXRA 3T1YE 1HNXE 3EPLA 1HNZI 1T39A 2O1WA 1B62A 4F9CB 3T1HE 2WBSA 4DV7E 1AH5A 1JK2A 3C4TA 2O1UA 1EH6A 1UDSA 2IOPA 2JEBA 3F0NA 4DR5E 2B9DA 4IZJB 3EPHA 4QNJA 1YUIA 1N0UA 2HFUA 3BBGA 1Z5BA 5LMUI 1A1LA 4JV5E 2WNRB 2HKJA 2RS7A 4LF5I 2HKEA 4R2QA 5FLXC 2EZ6A 1HK7A 4DU8A 1VI7A 2BA1G 4IFDD 3J80C 4R2DA 4MYTA 4OO1D 2EM4A 1B63A 2O1TA 4LFAI 2PO1A 2L3JA 2NN6A 4LF9E 2RSIA 2LE2A 2EOJA 4JI1E 2VQFE 3M6AA 2X36A 2YSPA 5CFFE 2C39B 1R6LA 2V8QB 2EOQA 5ADZA 4IFDF 1STUA 3VHTB 1WUUA 4OO1F 4IFDC 1VISA 1UILA 1A1IA 2ZBKB 4MQYA 4B3TI 2EOXA 1L4SA 3P1XA 1IQOA 1FJGI 2C37B 4RHBB 2ELYA 4DV0I 2ZM6E 3HXLA 4LOMA 4GKKI 2V83A 4B3SE 4FWGA 1IBME 4JI3I 3C6KA 1X3CA 5JEAD 4NHRA 5IXMB 2R42A 2YTNA 4AQYI 1KYQA 3P3GA 4X65E 4LCHA 1U2RA 4MU4A 3QT7A 2EMIA 2VQEI 3QG5C 1BB8A 3C6MA 3D4JA 2CG9A 2J65A 2M1SA 3JTZA 2HGHA 4JI2E 2EM2A 4DR6E 1PVGA 4MU0A 2A2CA 4BA2B 1XMQI 4M9VC 1A1FA 4DKKA 1HR0E 5JEAC 2UUAE 4GKJI 4IS1C 4NXNE 4GKKE 3L7ZA 4LF7I 3B8HA 1DGCA 3BIDA 3DF6A 2PNZA 2JT2A 1RMDA 3PYGA 3RMPA 2EPNA 1I94E 2LCEA 2UUCE 2EMAA 1Z0BA 3P3CA 1XMOI 2E5LI 2N3GA 4P52A 2EN3A 1PJSA 3ECRA 2WP8A 1RQ0A 2Z5BB 3Q6MA 3QT8A 2J7JA 4U3DA 1E3PA 4BCAA 1RR9A 2NN6D 4HACB 2BA0D 3QT5A 4IZKA 2EMWA 4DUZI 2EPUA 4LTYA 4GQUA 2EL5A 3AV0A 3CDJA 1Y6ZA 4JI8I 4AIMA 2UXCE 2F4VE 2BR2A 3M85D 5K36B 4DV6I 4WX9A 3WU5A 5C0XB 3TQMA 3DJWA 1WHQA 4MLVA 3J7AG 2NN6F 3ZM7A 1HNWI 1IBLE 2L8TA 2BBGA 2HHHE 1WJPA 2EMHA 3J80Q 2VE7C 5JEAB 2CVEA 2JEAA 3B82A 1USUA 5AE1A 3LNUA 1Z0GA 4DV5E 1OYRA 4I3HA 2YTPA 4JYAI 1EI1A 2YPNA 3J7AM 1BBOA 4ZYEA 1S16A 4UTGA 4ZVIA 3JAMQ 2EM9A 2MDGA 1Z1BA 1UDQA 4LF6E 2EM8A 1N36E 5DNYA 1A6FA 3GMEA 1Z0CA 4DR1I 2EOIA 2EPCA 3OTOE 4JI7E 1N3GA 4JG4A 5IWAI 5A6BA 2EFGA 2JYAA 2L2KB 4DV2E 1LLMC 2UU9I 1ZAAC 2CPNA 4DV1I 2EPPA 4X62E 1T4OA 2BV3A 4R2CA 1P47A 5LLQA 4R1FA 1USVA 5KL5A 3EPKA 4FW6A 1J5EE 4I8OA 5DNLA 4BMJA 4DR2I 2DIXA 4JI5I 1ZR9A 2EWLA 4DPUA 3JU0A 1QNTA 2OI2A 4BC9A 1N34E 3L7ZB 2BB8A 2WBTA 2C38A 3HJCA 4IFDB 2CT1A 5TSEA 4OO1B 3B4TA 3PRYA 2UXDI 3DD6A 4DV4E 3P3EA 2JOXA 4P7AA 5K36E 4LFCE 2CSHA 2L2NA 5C0XE 4P7DA 2JWOA 4LU9A 2O3ZA 1RC7A 1DQ3A 2EPXA 2RQLA 5KL7A 1DARA 2V86A 5LMNI 4O4KA 3J81C 2LTRA 4ZYDA 1GTKA 1NCSA 4R2SA 3PS2A 2ODRD 3VK6A 4LCGA 5DRPA 2ENAA 1HNZE 4JI6I 3VYYA 3HULA 4LF8I 1PJTA 2CZ9A 4BC7A 2BA1D 4NBQA 4DUYI 1KIJA 2EM3A 4EMDA 2YWQA 2EP3A 4M2ZA 3GLLA 2L6MA 2N8XA 4KWYA 1Y60A 3BGHA 2UXBI 4WYQB 2JVAA 2LMZA 1G2DC 1YYKA 3F6GA 1BKNA 2EOHA 2RTXA 4QNKA 5LMUE 5AASA 1B69A 2ODRC 1A1GA 2EPZA 4WSPA 1X6FA 2EN8A 1FKAE 5L3JA 3Q1QA 2R3VA 4DR7I 5A6BD 2KOUA 1EA6A 2F8BA 4LF5E 4MYUA 2NPFA 1UHZA 4F9AB 2IHR1 3PYFA 4IJDA 2LTSA 4DV3I 1FNMA 2L3CA 1Z5AA 2V8PA 1UDOA 1NHIA 4LFAE 1XNRI 4IFDE 1J26A 2EMYA 4OO1E 1QU6A 3K6QA 5A6AA 1XHKA 2RS6A 2EM7A 5KL3A 2K4VA 1UBDC 1IBKI 2LJHA 2YTJA 3EQ1A 2PRTA 2YTFA 3NZKA 3K85A 2M7QA 1GZ6A 2HK2A 4OOGC 4B3TE 1TF3A 2ZITA 2PO1B 1FJGE 2Q2EB 2NN6B 2C39A 2EPMX 1Y5YA 4DV0E 2YTDA 1N33I 4WFTA 3PS3A 4JI3E 2V34A 3HKMA 2HJJA 2EN7A 4AQYE 2C37A 5IT9Q 4DPWA 2HC5A 5AC5A 1Y4UA 1YYOA 2VQEE 1Z0EA 4KHPI 4K0KI 3FIGA 1YHCA 2HFSA 2WW4A 2Z5EA 2PNMA 2MC5A 5JEAF 4WSGA 4HEIA 4MU1A 5A2QQ 4X64I 4WXDA 4PRXA 2DMIA 1XMQE 2YU8A 2EMKA 2LUQA 3L00A 5T6JA 3P06A 1A1JA 2YRMA 3F6HA 4GKJE 3ADIA 1H73A 1KVKA 1XNQI 2D9HA 2FTXB 2NUGA 4LF7E 5F3WA 5LL6R 1X5WA 3AUZA 4BA2A 4USMA 1XMOE 1T4LB 2E5LE 2J7KA 3H4LA 2JXPA 2DGCA 3J81Q 4XTJA 1N32I 2EE8A 2Z5CA 4JI0I 2EN2A 1IQSA 2ADRA 1K47A 1PDAA 1KKHA 4X66I 4DPXA 4F2JC 2PNZB 4DR3I 4J8ZA 1DI2A 2L33A 1NZ0A 2PO0A 3H1CA 1E3HA 4DR4I 3Q6NA 4DUZE 4PRVA 2GPIA 4USKA 3HPSA 4O43A 2MKDA 5BR8I 3THNA 1AAYA 2K7IA 2YTEA 2NN6E 2WP8B 3LLHA 3LPSA 4JI8E 4FWDA 4MU3A 2B7VA 2CTDA 2YRKA 4DV6E 2RSMA 2EPKX 3WU3A 2BM0A 4F6NA 5FLXQ 2EM0A 3MHSC 4X8WA 2JE6A 4IZKB 1HNWE 4R8OA 3ZZ0A 4OX9I 2E1RA 1O0WA 1X6HA 1TF6A 5C0XA 1ZM3A 2V88A 4YY3I 2LUPB 4OZEA 1Z59A 4JYAE 2E72A 4O24A 2LJPA 1MGTA 3ADLA 4YHHI 1D6TA 5DROA 4DPYA 4MLQA 5DRRA 4R2PA 4GEQB 2L2MA 4NXMI 4R2EA 1Y4SA 2JEAB 1Z0TA 4DR1E 2JP9A 4B3RI 2GLIA 5IWAE 1H72C 4FWHA 3ZKDA 3LTOA 5EL9A 1A1KA 2LBSB 2UU9E 2PO2B 4LFBI 4ED4A 1MU5A 4DV1E 2M4IA 1ZBTA 3MSWA 2VESA 5GMDA 4R2AA 2V2ZA 5AE3A 2EOFA 1UEKA 4BA1A 3M85G 4L5NC 4DR2E 4JI5E 1KTVA 4LF4I 4JI4I 2DEJA 3U1YA 4WUDA 4AIDA 4PU9A 5AE2A 2UXDE 2EL4A 2LVHA 1H7UA 3LMLA 3PYDA 3IWCA 2EN4A 1EKZA 2GQ0A 5FWKA 1MEYC 2EPAA 5LMNE 4NZVA 4Z7CA 2IESA 2DRPA 2X7IA 4B3MI 1SR9A 2NUEA 4R03A 2CGEA 2AJ4A 4JI6E 4R2RA 3UHMA 1FWLA 5C0XD 4LF8E 3IWDA 2YZTA 4GZNC 2EPLX 5AC4A 2RPCA 3CWVA 4DUYE 2R76A 4M0VA 2EQ1A 2UXBE 3KWRA 5A69A 3MHHC 3ADJA 3CDIA 3M7NG 1WRJA 4IZJA 2JR1A 4DXLA 3T1YI 2NABA 1HNXI 4DR7E 2ENHA 2LJUA 2JEBB 4FW4A 5C0XC 4ZYGA 1NEIA 2EN1A 4BBYA 3B78A 4RH8A 3T1HI 4L8NA 2M9AA 2MKNA 1YYWA 4DV7I 2WNRA 1X47A 2EOMA 2DLKA 1N0VC 1EH8A 3ZZUA 1ZBQA 2KONA 4DV3E 1SFEA 4FN5A 4DR5I 2V87A 1XNRE 4DPTA 3U1KA 1ZM9A 2EMXA 4JV5I 1P42A 4BHCA 2VF3A 2ELZA 3GONA
chains in the Genus database with same CATH topology
2FV4B 2HK3A 2V89A 3WU4A 3ZOQB 2DEIA 4Q28A 4FW9A 1OJ4A 2XEXA 2LRSA 1N33E 4URLA 2FGGA 4WPYA 3C4BA 2IOQA 4WUCA 4LF9I 3JAMC 2H36X 4M30A 4JI1I 2VQFI 2MDRA 2NUFA 4N3OA 4K0KE 4KHPE 1YZ9A 1QZRA 4HY1A 4TUIA 4RPFA 1GQEA 2KHXA 2JOBA 2V2QA 4UT4A 1T4NA 1X49A 3IWBA 4X64E 2ZM6I 4B3SI 3V5RA 1IBMI 1XNQE 1NHJA 4IZJD 4BS9A 1PKPA 5GMEA 4X65I 2G7HA 1N32E 1PIEA 1S4EA 3K17A 3VYXA 4JI2I 4DR6I 2V85A 4JI0E 1Z0WA 2VF1A 1Z0VA 2YT4A 3V2UC 4X66E 1ZM4A 1HR0I 2UUAI 4NXNI 4GKKI 2L92A 4DR3E 1H7SA 2Z5BA 4DR4E 1ZXNA 1FI4A 2N3HA 2Z5CB 4HACA 5BR8E 1I94I 2UUBE 2UUCI 4M1KA 3OMLA 3WU6A 2DMYA 1FWKA 4HXZA 1ZXMA 4OX9E 4F54A 2BM1A 4KZSA 1RREA 1MX0A 1ZM2A 4YY3E 2DSYA 2O1VA 4DMIA 1X48A 1WHNA 4YHHE 2UXCI 2F4VI 1ELOA 3H09A 4NXME 1MG7A 4P78A 1IBLI 2JY9A 3K1JA 4B3RE 2HHHI 4Z7YA 4LFBE 4DV5I 4DU7A 4LF6I 1N36I 4KQVA 3ZZTA 4LF4E 3HQ1A 2E1MA 2MC6A 4JI4E 2V2VA 3QT6A 3OTOI 4JI7I 1H74A 3HPZA 3HTXA 4DV2I 4X62I 2A2DA 4WUBA 4F9BB 5IT9C 1J5EI 4HYMA 2WZOA 2GS8A 3PYEA 4B3ME 2PNLA 1N34I 5A2QC 4DV4I 1Z5CA 4LFCI 1NHHA 4TUGA 2B3TB 3J7Yp 2B7TA 3ADGA 2NA2A 3ZKBA 2DB2A 1WXRA 3T1YE 1HNXE 1HNZI 2O1WA 1B62A 4F9CB 3T1HE 4DV7E 3C4TA 2O1UA 2IOPA 4IZJB 3F0NA 4DR5E 2B9DA 1N0UA 2HFUA 1Z5BA 5LMUI 4JV5E 2HKJA 2RS7A 4LF5I 2HKEA 2EZ6A 5FLXC 1HK7A 4DU8A 3J80C 4MYTA 1B63A 2O1TA 4LFAI 2L3JA 4LF9E 2LE2A 4JI1E 2VQFE 3M6AA 2X36A 5CFFE 2V8QB 5ADZA 1STUA 1WUUA 1VISA 1UILA 2ZBKB 4B3TI 3P1XA 1FJGI 4DV0I 2ZM6E 3HXLA 2V83A 4B3SE 4FWGA 1IBME 4JI3I 2R42A 4AQYI 4X65E 1U2RA 3QT7A 2VQEI 3D4JA 2CG9A 2M1SA 3JTZA 4JI2E 4DR6E 1PVGA 2A2CA 1XMQI 4DKKA 1HR0E 2UUAE 4GKJI 4NXNE 4GKKE 4LF7I 3B8HA 3DF6A 3PYGA 3RMPA 1I94E 1Z0BA 1XMOI 2UUCE 2E5LI 2N3GA 4P52A 1RQ0A 2Z5BB 3Q6MA 3QT8A 4BCAA 1RR9A 4HACB 3QT5A 4IZKA 4DUZI 4LTYA 3AV0A 1Y6ZA 4JI8I 2UXCE 2F4VE 4DV6I 3WU5A 3DJWA 1WHQA 3J7AG 3ZM7A 1HNWI 1IBLE 2L8TA 2HHHE 3J80Q 2VE7C 3B82A 1USUA 5AE1A 3LNUA 1Z0GA 4DV5E 4I3HA 4JYAI 1EI1A 3J7AM 1S16A 4UTGA 4ZVIA 3JAMQ 4LF6E 1N36E 5DNYA 1A6FA 1Z0CA 4DR1I 3OTOE 4JI7E 4JG4A 5IWAI 2EFGA 2L2KB 4DV2E 2UU9I 2CPNA 4DV1I 4X62E 1T4OA 2BV3A 4R1FA 1USVA 1J5EE 4I8OA 4BMJA 4DR2I 2DIXA 4JI5I 2EWLA 4DPUA 3JU0A 2OI2A 4BC9A 1N34E 3HJCA 3PRYA 2UXDI 4DV4E 2JOXA 4P7AA 4LFCE 2L2NA 4P7DA 2JWOA 4LU9A 1RC7A 1DQ3A 1DARA 2V86A 5LMNI 3J81C 2LTRA 2ODRD 3VK6A 4JI6I 1HNZE 3VYYA 3HULA 4LF8I 2CZ9A 4BC7A 4DUYI 1KIJA 4EMDA 2UXBI 4M2ZA 2L6MA 4WYQB 2JVAA 2LMZA 1YYKA 3F6GA 1BKNA 2RTXA 5LMUE 5AASA 2ODRC 1FKAE 4WSPA 5L3JA 3Q1QA 2R3VA 4DR7I 2KOUA 1EA6A 2F8BA 4LF5E 4MYUA 2NPFA 1UHZA 4F9AB 2IHR1 3PYFA 2LTSA 4DV3I 1FNMA 2L3CA 1Z5AA 2V8PA 1NHIA 4LFAE 1XNRI 1J26A 1QU6A 3K6QA 1XHKA 2RS6A 2K4VA 1IBKI 2LJHA 3K85A 2M7QA 1GZ6A 2HK2A 4OOGC 4B3TE 2ZITA 1FJGE 2Q2EB 4DV0E 1N33I 4WFTA 4JI3E 2V34A 4AQYE 5IT9Q 4DPWA 1Y4UA 1YYOA 2VQEE 1Z0EA 4KHPI 4K0KI 3FIGA 2HFSA 2WW4A 2Z5EA 2PNMA 2MC5A 5A2QQ 4X64I 4PRXA 1XMQE 2LUQA 3P06A 5T6JA 3F6HA 4GKJE 1XNQI 3ADIA 1H73A 1KVKA 2NUGA 2FTXB 4LF7E 5F3WA 5LL6R 3AUZA 4USMA 1XMOE 1T4LB 2E5LE 2J7KA 3H4LA 3J81Q 1N32I 4XTJA 2Z5CA 4JI0I 1K47A 1KKHA 4X66I 4DPXA 4DR3I 4J8ZA 1DI2A 2L33A 1NZ0A 4DR4I 3Q6NA 4DUZE 4PRVA 4USKA 3HPSA 5BR8I 2UUBI 4FWDA 3LLHA 3LPSA 4JI8E 2B7VA 4DV6E 2RSMA 3WU3A 2BM0A 5FLXQ 4X8WA 4IZKB 1HNWE 4R8OA 3ZZ0A 4OX9I 2E1RA 1O0WA 1ZM3A 2V88A 4YY3I 2LUPB 1Z59A 4JYAE 2LJPA 3ADLA 4YHHI 1D6TA 4DPYA 4GEQB 2L2MA 4NXMI 1Y4SA 1Z0TA 4DR1E 4B3RI 5IWAE 1H72C 4FWHA 3ZKDA 3LTOA 2UU9E 2LBSB 4LFBI 4ED4A 1MU5A 4DV1E 2M4IA 1ZBTA 3MSWA 5GMDA 2V2ZA 5AE3A 1UEKA 4L5NC 4DR2E 4JI5E 1KTVA 4LF4I 4JI4I 2DEJA 4WUDA 4PU9A 5AE2A 2UXDE 1H7UA 3LMLA 3PYDA 3IWCA 1EKZA 2GQ0A 5FWKA 5LMNE 4Z7CA 2X7IA 4B3MI 1SR9A 2NUEA 4R03A 2CGEA 2AJ4A 4JI6E 1FWLA 4LF8E 3IWDA 2YZTA 3CWVA 4DUYE 4M0VA 2UXBE 3KWRA 3ADJA 4IZJA 2JR1A 4DXLA 3T1YI 1HNXI 4DR7E 4BBYA 3B78A 3T1HI 4L8NA 1YYWA 4DV7I 1X47A 1N0VC 3ZZUA 1ZBQA 2KONA 4DV3E 4FN5A 4DR5I 2V87A 1XNRE 4DPTA 1ZM9A 4JV5I 1IBKE 2VF3A 3GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HK3 A;  3WU4 A;  2DEI A;  4FW9 A;  1OJ4 A;  2XEX A;  2LRS A;  1N33 E;  4URL A;  4WUC A;  3C4B A;  4LF9 I;  3JAM C;  4M30 A;  4JI1 I;  2VQF I;  2MDR A;  2NUF A;  4K0K E;  4KHP E;  1YZ9 A;  1QZR A;  4HY1 A;  4RPF A;  1GQE A;  2KHX A;  2V2Q A;  4UT4 A;  1T4N A;  1X49 A;  4X64 E;  2ZM6 I;  4B3S I;  3V5R A;  1IBM I;  1XNQ E;  1NHJ A;  1PKP A;  5GME A;  4X65 I;  1N32 E;  1PIE A;  1S4E A;  3K17 A;  3VYX A;  4JI2 I;  4DR6 I;  4JI0 E;  1Z0W A;  1Z0V A;  2YT4 A;  3V2U C;  4X66 E;  1ZM4 A;  1HR0 I;  2UUA I;  4NXN I;  4GKK I;  4DR3 E;  1H7S A;  4DR4 E;  1ZXN A;  1FI4 A;  2N3H A;  4HAC A;  5BR8 E;  1I94 I;  2UUB E;  2UUC I;  4M1K A;  3WU6 A;  2DMY A;  1FWK A;  4HXZ A;  1ZXM A;  4OX9 E;  2BM1 A;  1RRE A;  1MX0 A;  1ZM2 A;  4YY3 E;  1X48 A;  1WHN A;  4YHH E;  2UXC I;  2F4V I;  1ELO A;  4NXM E;  1MG7 A;  1IBL I;  2JY9 A;  3K1J A;  4B3R E;  2HHH I;  4Z7Y A;  4LFB E;  4DV5 I;  4DU7 A;  4LF6 I;  1N36 I;  4KQV A;  3ZZT A;  4LF4 E;  2V2V A;  4JI4 E;  3QT6 A;  3OTO I;  4JI7 I;  1H74 A;  3HTX A;  4DV2 I;  4X62 I;  2A2D A;  4WUB A;  5IT9 C;  1J5E I;  4HYM A;  2GS8 A;  3PYE A;  4B3M E;  1N34 I;  5A2Q C;  4DV4 I;  1Z5C A;  4LFC I;  1NHH A;  2B3T B;  3J7Y p;  2B7T A;  3ADG A;  2NA2 A;  3ZKB A;  2DB2 A;  3T1Y E;  1HNX E;  1HNZ I;  1B62 A;  3T1H E;  4DV7 E;  3C4T A;  3F0N A;  4DR5 E;  1N0U A;  2HFU A;  1Z5B A;  5LMU I;  4JV5 E;  2HKJ A;  2RS7 A;  4LF5 I;  2HKE A;  2EZ6 A;  4DU8 A;  5FLX C;  3J80 C;  4MYT A;  1B63 A;  4LFA I;  2L3J A;  4LF9 E;  4JI1 E;  3M6A A;  2VQF E;  2X36 A;  5CFF E;  1STU A;  1WUU A;  1VIS A;  1UIL A;  2ZBK B;  4B3T I;  3P1X A;  1FJG I;  4DV0 I;  2ZM6 E;  4B3S E;  4FWG A;  1IBM E;  4JI3 I;  2R42 A;  4AQY I;  4X65 E;  1U2R A;  3QT7 A;  2VQE I;  3D4J A;  4JI2 E;  4DR6 E;  1PVG A;  2A2C A;  1XMQ I;  4DKK A;  1HR0 E;  2UUA E;  4GKJ I;  4NXN E;  4GKK E;  4LF7 I;  3B8H A;  3PYG A;  1I94 E;  1Z0B A;  1XMO I;  2UUC E;  2E5L I;  2N3G A;  4P52 A;  1RQ0 A;  3QT8 A;  1RR9 A;  4HAC B;  3QT5 A;  4DUZ I;  4JI8 I;  2UXC E;  2F4V E;  4DV6 I;  3WU5 A;  3ZM7 A;  1WHQ A;  3J7A G;  1HNW I;  1IBL E;  2HHH E;  3J80 Q;  3B82 A;  3LNU A;  1Z0G A;  4DV5 E;  4I3H A;  4JYA I;  1EI1 A;  3J7A M;  1S16 A;  4UTG A;  4ZVI A;  3JAM Q;  4LF6 E;  1N36 E;  1A6F A;  1Z0C A;  4DR1 I;  3OTO E;  4JI7 E;  4JG4 A;  5IWA I;  2EFG A;  2L2K B;  4DV2 E;  2UU9 I;  2CPN A;  4DV1 I;  4X62 E;  1T4O A;  2BV3 A;  4R1F A;  1J5E E;  4DR2 I;  2DIX A;  4JI5 I;  4DPU A;  2OI2 A;  1N34 E;  2UXD I;  4DV4 E;  4P7A A;  4LFC E;  2L2N A;  1RC7 A;  1DAR A;  5LMN I;  3J81 C;  2LTR A;  4JI6 I;  1HNZ E;  3VYY A;  3HUL A;  4LF8 I;  2CZ9 A;  4DUY I;  1KIJ A;  4EMD A;  2UXB I;  4M2Z A;  4WYQ B;  2JVA A;  1YYK A;  1BKN A;  2RTX A;  5LMU E;  1FKA E;  3Q1Q A;  5L3J A;  2R3V A;  4DR7 I;  1EA6 A;  4LF5 E;  4MYU A;  2NPF A;  1UHZ A;  2IHR 1;  3PYF A;  2LTS A;  4DV3 I;  1FNM A;  2L3C A;  1Z5A A;  2V8P A;  1NHI A;  4LFA E;  1XNR I;  1J26 A;  1QU6 A;  1XHK A;  2RS6 A;  1IBK I;  2LJH A;  2HK2 A;  4OOG C;  4B3T E;  2ZIT A;  1FJG E;  2Q2E B;  4DV0 E;  1N33 I;  4WFT A;  4JI3 E;  2V34 A;  4AQY E;  5IT9 Q;  4DPW A;  1YYO A;  2VQE E;  1Z0E A;  4KHP I;  4K0K I;  2HFS A;  2WW4 A;  5A2Q Q;  4X64 I;  4PRX A;  1XMQ E;  2LUQ A;  1XNQ I;  4GKJ E;  3ADI A;  1H73 A;  1KVK A;  2NUG A;  4LF7 E;  5LL6 R;  4USM A;  1XMO E;  1T4L B;  2E5L E;  2J7K A;  3H4L A;  3J81 Q;  1N32 I;  4XTJ A;  4JI0 I;  1K47 A;  1KKH A;  4X66 I;  4DPX A;  4DR3 I;  1DI2 A;  2L33 A;  1NZ0 A;  4DR4 I;  4PRV A;  4DUZ E;  4USK A;  5BR8 I;  2UUB I;  4FWD A;  3LLH A;  3LPS A;  4JI8 E;  2B7V A;  4DV6 E;  2RSM A;  3WU3 A;  2BM0 A;  5FLX Q;  4X8W A;  1HNW E;  3ZZ0 A;  4OX9 I;  2E1R A;  1O0W A;  1ZM3 A;  4YY3 I;  2LUP B;  1Z59 A;  4JYA E;  2LJP A;  3ADL A;  4YHH I;  1D6T A;  4DPY A;  2L2M A;  4NXM I;  1Z0T A;  4DR1 E;  4B3R I;  5IWA E;  4FWH A;  1H72 C;  3ZKD A;  3LTO A;  2UU9 E;  2LBS B;  4LFB I;  4ED4 A;  1MU5 A;  4DV1 E;  1ZBT A;  5GMD A;  2V2Z A;  1UEK A;  4DR2 E;  4JI5 E;  1KTV A;  4LF4 I;  4JI4 I;  2DEJ A;  4WUD A;  4PU9 A;  2UXD E;  1H7U A;  3PYD A;  1EKZ A;  5LMN E;  4Z7C A;  2X7I A;  4B3M I;  2NUE A;  2AJ4 A;  4JI6 E;  1FWL A;  4LF8 E;  3CWV A;  4DUY E;  2UXB E;  3ADJ A;  4DXL A;  3T1Y I;  1HNX I;  4DR7 E;  3B78 A;  3T1H I;  1YYW A;  4DV7 I;  1X47 A;  1N0V C;  3ZZU A;  4DV3 E;  4FN5 A;  4DR5 I;  1XNR E;  4DPT A;  1ZM9 A;  4JV5 I;  1IBK E;  2VF3 A;  3GON A; 
#chains in the Genus database with same CATH topology
 2FV4 B;  2HK3 A;  2V89 A;  1YPN A;  3WU4 A;  3ZOQ B;  2DEI A;  4Q28 A;  5KL4 A;  4FW9 A;  2UUB I;  1OJ4 A;  2JPA A;  2LRS A;  2EMB A;  3KZZ A;  2XEX A;  4X9J A;  1N33 E;  1YSA C;  4URL A;  2FGG A;  3BF2 A;  3C4B A;  4WPY A;  2IOQ A;  4MDT A;  4WUC A;  4LF9 I;  5A6K A;  3JAM C;  2H36 X;  4M30 A;  4JI1 I;  2VQF I;  5JEA E;  2MDR A;  2NUF A;  3THO B;  4N3O A;  4K0K E;  4N4R B;  4KHP E;  1YZ9 A;  4LPF A;  5A6J A;  4F6M A;  1QZR A;  4HY1 A;  4TUI A;  4RPF A;  2ENC A;  1GQE A;  2KHX A;  2JOB A;  2YTI A;  2V2Q A;  4UT4 A;  4OO1 C;  1T4N A;  1X49 A;  3IWB A;  4X64 E;  2ZM6 I;  2R1F A;  1OYS A;  4B3S I;  3V5R A;  1IBM I;  1XNQ E;  1PJQ A;  4WXC A;  1NHJ A;  3KRN A;  4IZJ D;  4BS9 A;  2VRD A;  5KL2 A;  1PKP A;  5GME A;  4X65 I;  2G7H A;  2EOO A;  1YUJ A;  1TN9 A;  1N32 E;  2LO3 A;  1A1H A;  2EPO A;  2I9I A;  1PIE A;  4HTG A;  1S4E A;  3K17 A;  3VYX A;  4JI2 I;  4DR6 I;  2V85 A;  2YTG A;  4JI0 E;  2EMF A;  1BBG A;  2VF1 A;  2EMC A;  1Z0V A;  1Z0W A;  2GO3 A;  2YT4 A;  3P76 A;  2GO4 A;  3V2U C;  2YSO A;  2YU5 A;  4X66 E;  2WBU A;  4Q35 B;  1OYP A;  1ZM4 A;  1HR0 I;  2EMG A;  2UUA I;  2EML A;  3EPJ A;  4NXN I;  2LT7 A;  2L92 A;  4DR3 E;  2EOS A;  1YFH A;  4DR4 E;  1H7S A;  2Z5B A;  1ZXN A;  1YH8 A;  3PS1 A;  1FI4 A;  2N3H A;  2Z5C B;  4HAC A;  5BR8 E;  4FW3 A;  1I94 I;  2UUB E;  2UUC I;  4M1K A;  3KZY A;  5ELW A;  3OML A;  3WU6 A;  2DMY A;  2EN6 A;  1FWK A;  2EOZ A;  2YRH A;  2PO0 B;  2EPR A;  1T38 A;  5K36 A;  2EL6 A;  4HXZ A;  1ZXM A;  4OX9 E;  4F54 A;  2EM6 A;  2BM1 A;  2YTO A;  4FW5 A;  4KZS A;  2BR2 B;  1RRE A;  1MX0 A;  1ZM2 A;  4LCF A;  4YY3 E;  2A25 A;  2DSY A;  3M99 B;  2O1V A;  1F2I G;  4DMI A;  1WHN A;  1X48 A;  4YHH E;  2UXC I;  2JE6 B;  4FK5 C;  2F4V I;  1ELO A;  2IER A;  3H09 A;  4ISA A;  4NXM E;  2EJ4 A;  5IV8 B;  1IBK E;  1MG7 A;  1XXE A;  4P78 A;  1IBL I;  2JY9 A;  4ZYH A;  3K1J A;  4B3R E;  4BHB A;  2HHH I;  2BA0 G;  1X6E A;  1IMU A;  2NN6 C;  4O5G A;  1G2F C;  4Z7Y A;  2I13 A;  5DNX A;  4LFB E;  2AE8 A;  4DV5 I;  2EOE A;  2Q8U A;  4FW7 A;  4DU7 A;  5EKW A;  4IS9 A;  2WCC 3;  2PO2 A;  4LF6 I;  1N36 I;  4KQV A;  3ZZT A;  4LF4 E;  3HQ1 A;  2E1M A;  2MC6 A;  2EQ0 A;  4JI4 E;  1KJK A;  1UN6 B;  3UK3 C;  2V2V A;  3QT6 A;  3OTO I;  4JI7 I;  1H74 A;  1R6M A;  5KL6 A;  3HPZ A;  3HTX A;  4DV2 I;  2F1D A;  4IFD A;  4BA1 B;  2EOR A;  2A2D A;  4OO1 A;  4X62 I;  4J3D A;  4WUB A;  4F9B B;  2C38 B;  5IT9 C;  4AM3 A;  1J5E I;  2YTQ A;  4HYM A;  3M7N D;  2WZO A;  2GS8 A;  3PYE A;  5K36 D;  4B3M E;  2EM5 A;  2PNL A;  3GCM A;  1N34 I;  4U3B A;  2EQ3 A;  1ZU1 A;  2LV2 A;  5A2Q C;  2EMZ A;  1JK1 A;  4DV4 I;  2DLQ A;  1Z5C A;  5DRQ A;  4LFC I;  2EOY A;  1NHH A;  4OKG A;  4TUG A;  2B3T B;  3J7Y p;  2GHF A;  1RHY A;  2B7T A;  5K36 F;  5JEA A;  5C0X F;  5K36 C;  3ADG A;  1UDN A;  2NA2 A;  1EH7 A;  3ZKB A;  2DB2 A;  1WXR A;  3T1Y E;  1HNX E;  3EPL A;  1HNZ I;  1T39 A;  2O1W A;  1B62 A;  4F9C B;  3T1H E;  2WBS A;  4DV7 E;  1AH5 A;  1JK2 A;  3C4T A;  2O1U A;  1EH6 A;  1UDS A;  2IOP A;  2JEB A;  3F0N A;  4DR5 E;  2B9D A;  4IZJ B;  3EPH A;  4QNJ A;  1YUI A;  1N0U A;  2HFU A;  3BBG A;  1Z5B A;  5LMU I;  1A1L A;  4JV5 E;  2WNR B;  2HKJ A;  2RS7 A;  4LF5 I;  2HKE A;  4R2Q A;  5FLX C;  2EZ6 A;  1HK7 A;  4DU8 A;  1VI7 A;  2BA1 G;  4IFD D;  3J80 C;  4R2D A;  4MYT A;  4OO1 D;  2EM4 A;  1B63 A;  2O1T A;  4LFA I;  2PO1 A;  2L3J A;  2NN6 A;  4LF9 E;  2RSI A;  2LE2 A;  2EOJ A;  4JI1 E;  2VQF E;  3M6A A;  2X36 A;  2YSP A;  5CFF E;  2C39 B;  1R6L A;  2V8Q B;  2EOQ A;  5ADZ A;  4IFD F;  1STU A;  3VHT B;  1WUU A;  4OO1 F;  4IFD C;  1VIS A;  1UIL A;  1A1I A;  2ZBK B;  4MQY A;  4B3T I;  2EOX A;  1L4S A;  3P1X A;  1IQO A;  1FJG I;  2C37 B;  4RHB B;  2ELY A;  4DV0 I;  2ZM6 E;  3HXL A;  4LOM A;  4GKK I;  2V83 A;  4B3S E;  4FWG A;  1IBM E;  4JI3 I;  3C6K A;  1X3C A;  5JEA D;  4NHR A;  5IXM B;  2R42 A;  2YTN A;  4AQY I;  1KYQ A;  3P3G A;  4X65 E;  4LCH A;  1U2R A;  4MU4 A;  3QT7 A;  2EMI A;  2VQE I;  3QG5 C;  1BB8 A;  3C6M A;  3D4J A;  2CG9 A;  2J65 A;  2M1S A;  3JTZ A;  2HGH A;  4JI2 E;  2EM2 A;  4DR6 E;  1PVG A;  4MU0 A;  2A2C A;  4BA2 B;  1XMQ I;  4M9V C;  1A1F A;  4DKK A;  1HR0 E;  5JEA C;  2UUA E;  4GKJ I;  4IS1 C;  4NXN E;  4GKK E;  3L7Z A;  4LF7 I;  3B8H A;  1DGC A;  3BID A;  3DF6 A;  2PNZ A;  2JT2 A;  1RMD A;  3PYG A;  3RMP A;  2EPN A;  1I94 E;  2LCE A;  2UUC E;  2EMA A;  1Z0B A;  3P3C A;  1XMO I;  2E5L I;  2N3G A;  4P52 A;  2EN3 A;  1PJS A;  3ECR A;  2WP8 A;  1RQ0 A;  2Z5B B;  3Q6M A;  3QT8 A;  2J7J A;  4U3D A;  1E3P A;  4BCA A;  1RR9 A;  2NN6 D;  4HAC B;  2BA0 D;  3QT5 A;  4IZK A;  2EMW A;  4DUZ I;  2EPU A;  4LTY A;  4GQU A;  2EL5 A;  3AV0 A;  3CDJ A;  1Y6Z A;  4JI8 I;  4AIM A;  2UXC E;  2F4V E;  2BR2 A;  3M85 D;  5K36 B;  4DV6 I;  4WX9 A;  3WU5 A;  5C0X B;  3TQM A;  3DJW A;  1WHQ A;  4MLV A;  3J7A G;  2NN6 F;  3ZM7 A;  1HNW I;  1IBL E;  2L8T A;  2BBG A;  2HHH E;  1WJP A;  2EMH A;  3J80 Q;  2VE7 C;  5JEA B;  2CVE A;  2JEA A;  3B82 A;  1USU A;  5AE1 A;  3LNU A;  1Z0G A;  4DV5 E;  1OYR A;  4I3H A;  2YTP A;  4JYA I;  1EI1 A;  2YPN A;  3J7A M;  1BBO A;  4ZYE A;  1S16 A;  4UTG A;  4ZVI A;  3JAM Q;  2EM9 A;  2MDG A;  1Z1B A;  1UDQ A;  4LF6 E;  2EM8 A;  1N36 E;  5DNY A;  1A6F A;  3GME A;  1Z0C A;  4DR1 I;  2EOI A;  2EPC A;  3OTO E;  4JI7 E;  1N3G A;  4JG4 A;  5IWA I;  5A6B A;  2EFG A;  2JYA A;  2L2K B;  4DV2 E;  1LLM C;  2UU9 I;  1ZAA C;  2CPN A;  4DV1 I;  2EPP A;  4X62 E;  1T4O A;  2BV3 A;  4R2C A;  1P47 A;  5LLQ A;  4R1F A;  1USV A;  5KL5 A;  3EPK A;  4FW6 A;  1J5E E;  4I8O A;  5DNL A;  4BMJ A;  4DR2 I;  2DIX A;  4JI5 I;  1ZR9 A;  2EWL A;  4DPU A;  3JU0 A;  1QNT A;  2OI2 A;  4BC9 A;  1N34 E;  3L7Z B;  2BB8 A;  2WBT A;  2C38 A;  3HJC A;  4IFD B;  2CT1 A;  5TSE A;  4OO1 B;  3B4T A;  3PRY A;  2UXD I;  3DD6 A;  4DV4 E;  3P3E A;  2JOX A;  4P7A A;  5K36 E;  4LFC E;  2CSH A;  2L2N A;  5C0X E;  4P7D A;  2JWO A;  4LU9 A;  2O3Z A;  1RC7 A;  1DQ3 A;  2EPX A;  2RQL A;  5KL7 A;  1DAR A;  2V86 A;  5LMN I;  4O4K A;  3J81 C;  2LTR A;  4ZYD A;  1GTK A;  1NCS A;  4R2S A;  3PS2 A;  2ODR D;  3VK6 A;  4LCG A;  5DRP A;  2ENA A;  1HNZ E;  4JI6 I;  3VYY A;  3HUL A;  4LF8 I;  1PJT A;  2CZ9 A;  4BC7 A;  2BA1 D;  4NBQ A;  4DUY I;  1KIJ A;  2EM3 A;  4EMD A;  2YWQ A;  2EP3 A;  4M2Z A;  3GLL A;  2L6M A;  2N8X A;  4KWY A;  1Y60 A;  3BGH A;  2UXB I;  4WYQ B;  2JVA A;  2LMZ A;  1G2D C;  1YYK A;  3F6G A;  1BKN A;  2EOH A;  2RTX A;  4QNK A;  5LMU E;  5AAS A;  1B69 A;  2ODR C;  1A1G A;  2EPZ A;  4WSP A;  1X6F A;  2EN8 A;  1FKA E;  5L3J A;  3Q1Q A;  2R3V A;  4DR7 I;  5A6B D;  2KOU A;  1EA6 A;  2F8B A;  4LF5 E;  4MYU A;  2NPF A;  1UHZ A;  4F9A B;  2IHR 1;  3PYF A;  4IJD A;  2LTS A;  4DV3 I;  1FNM A;  2L3C A;  1Z5A A;  2V8P A;  1UDO A;  1NHI A;  4LFA E;  1XNR I;  4IFD E;  1J26 A;  2EMY A;  4OO1 E;  1QU6 A;  3K6Q A;  5A6A A;  1XHK A;  2RS6 A;  2EM7 A;  5KL3 A;  2K4V A;  1UBD C;  1IBK I;  2LJH A;  2YTJ A;  3EQ1 A;  2PRT A;  2YTF A;  3NZK A;  3K85 A;  2M7Q A;  1GZ6 A;  2HK2 A;  4OOG C;  4B3T E;  1TF3 A;  2ZIT A;  2PO1 B;  1FJG E;  2Q2E B;  2NN6 B;  2C39 A;  2EPM X;  1Y5Y A;  4DV0 E;  2YTD A;  1N33 I;  4WFT A;  3PS3 A;  4JI3 E;  2V34 A;  3HKM A;  2HJJ A;  2EN7 A;  4AQY E;  2C37 A;  5IT9 Q;  4DPW A;  2HC5 A;  5AC5 A;  1Y4U A;  1YYO A;  2VQE E;  1Z0E A;  4KHP I;  4K0K I;  3FIG A;  1YHC A;  2HFS A;  2WW4 A;  2Z5E A;  2PNM A;  2MC5 A;  5JEA F;  4WSG A;  4HEI A;  4MU1 A;  5A2Q Q;  4X64 I;  4WXD A;  4PRX A;  2DMI A;  1XMQ E;  2YU8 A;  2EMK A;  2LUQ A;  3L00 A;  5T6J A;  3P06 A;  1A1J A;  2YRM A;  3F6H A;  4GKJ E;  3ADI A;  1H73 A;  1KVK A;  1XNQ I;  2D9H A;  2FTX B;  2NUG A;  4LF7 E;  5F3W A;  5LL6 R;  1X5W A;  3AUZ A;  4BA2 A;  4USM A;  1XMO E;  1T4L B;  2E5L E;  2J7K A;  3H4L A;  2JXP A;  2DGC A;  3J81 Q;  4XTJ A;  1N32 I;  2EE8 A;  2Z5C A;  4JI0 I;  2EN2 A;  1IQS A;  2ADR A;  1K47 A;  1PDA A;  1KKH A;  4X66 I;  4DPX A;  4F2J C;  2PNZ B;  4DR3 I;  4J8Z A;  1DI2 A;  2L33 A;  1NZ0 A;  2PO0 A;  3H1C A;  1E3H A;  4DR4 I;  3Q6N A;  4DUZ E;  4PRV A;  2GPI A;  4USK A;  3HPS A;  4O43 A;  2MKD A;  5BR8 I;  3THN A;  1AAY A;  2K7I A;  2YTE A;  2NN6 E;  2WP8 B;  3LLH A;  3LPS A;  4JI8 E;  4FWD A;  4MU3 A;  2B7V A;  2CTD A;  2YRK A;  4DV6 E;  2RSM A;  2EPK X;  3WU3 A;  2BM0 A;  4F6N A;  5FLX Q;  2EM0 A;  3MHS C;  4X8W A;  2JE6 A;  4IZK B;  1HNW E;  4R8O A;  3ZZ0 A;  4OX9 I;  2E1R A;  1O0W A;  1X6H A;  1TF6 A;  5C0X A;  1ZM3 A;  2V88 A;  4YY3 I;  2LUP B;  4OZE A;  1Z59 A;  4JYA E;  2E72 A;  4O24 A;  2LJP A;  1MGT A;  3ADL A;  4YHH I;  1D6T A;  5DRO A;  4DPY A;  4MLQ A;  5DRR A;  4R2P A;  4GEQ B;  2L2M A;  4NXM I;  4R2E A;  1Y4S A;  2JEA B;  1Z0T A;  4DR1 E;  2JP9 A;  4B3R I;  2GLI A;  5IWA E;  1H72 C;  4FWH A;  3ZKD A;  3LTO A;  5EL9 A;  1A1K A;  2LBS B;  2UU9 E;  2PO2 B;  4LFB I;  4ED4 A;  1MU5 A;  4DV1 E;  2M4I A;  1ZBT A;  3MSW A;  2VES A;  5GMD A;  4R2A A;  2V2Z A;  5AE3 A;  2EOF A;  1UEK A;  4BA1 A;  3M85 G;  4L5N C;  4DR2 E;  4JI5 E;  1KTV A;  4LF4 I;  4JI4 I;  2DEJ A;  3U1Y A;  4WUD A;  4AID A;  4PU9 A;  5AE2 A;  2UXD E;  2EL4 A;  2LVH A;  1H7U A;  3LML A;  3PYD A;  3IWC A;  2EN4 A;  1EKZ A;  2GQ0 A;  5FWK A;  1MEY C;  2EPA A;  5LMN E;  4NZV A;  4Z7C A;  2IES A;  2DRP A;  2X7I A;  4B3M I;  1SR9 A;  2NUE A;  4R03 A;  2CGE A;  2AJ4 A;  4JI6 E;  4R2R A;  3UHM A;  1FWL A;  5C0X D;  4LF8 E;  3IWD A;  2YZT A;  4GZN C;  2EPL X;  5AC4 A;  2RPC A;  3CWV A;  4DUY E;  2R76 A;  4M0V A;  2EQ1 A;  2UXB E;  3KWR A;  5A69 A;  3MHH C;  3ADJ A;  3CDI A;  3M7N G;  1WRJ A;  4IZJ A;  2JR1 A;  4DXL A;  3T1Y I;  2NAB A;  1HNX I;  4DR7 E;  2ENH A;  2LJU A;  2JEB B;  4FW4 A;  5C0X C;  4ZYG A;  1NEI A;  2EN1 A;  4BBY A;  3B78 A;  4RH8 A;  3T1H I;  4L8N A;  2M9A A;  2MKN A;  1YYW A;  4DV7 I;  2WNR A;  1X47 A;  2EOM A;  2DLK A;  1N0V C;  1EH8 A;  3ZZU A;  1ZBQ A;  2KON A;  4DV3 E;  1SFE A;  4FN5 A;  4DR5 I;  2V87 A;  1XNR E;  4DPT A;  3U1K A;  1ZM9 A;  2EMX A;  4JV5 I;  1P42 A;  4BHC A;  2VF3 A;  2ELZ A;  3GON A; 
#chains in the Genus database with same CATH homology
 2FV4 B;  2HK3 A;  2V89 A;  3WU4 A;  3ZOQ B;  2DEI A;  4Q28 A;  4FW9 A;  1OJ4 A;  2XEX A;  2LRS A;  1N33 E;  4URL A;  2FGG A;  4WPY A;  3C4B A;  2IOQ A;  4WUC A;  4LF9 I;  3JAM C;  2H36 X;  4M30 A;  4JI1 I;  2VQF I;  2MDR A;  2NUF A;  4N3O A;  4K0K E;  4KHP E;  1YZ9 A;  1QZR A;  4HY1 A;  4TUI A;  4RPF A;  1GQE A;  2KHX A;  2JOB A;  2V2Q A;  4UT4 A;  1T4N A;  1X49 A;  3IWB A;  4X64 E;  2ZM6 I;  4B3S I;  3V5R A;  1IBM I;  1XNQ E;  1NHJ A;  4IZJ D;  4BS9 A;  1PKP A;  5GME A;  4X65 I;  2G7H A;  1N32 E;  1PIE A;  1S4E A;  3K17 A;  3VYX A;  4JI2 I;  4DR6 I;  2V85 A;  4JI0 E;  1Z0W A;  2VF1 A;  1Z0V A;  2YT4 A;  3V2U C;  4X66 E;  1ZM4 A;  1HR0 I;  2UUA I;  4NXN I;  4GKK I;  2L92 A;  4DR3 E;  1H7S A;  2Z5B A;  4DR4 E;  1ZXN A;  1FI4 A;  2N3H A;  2Z5C B;  4HAC A;  5BR8 E;  1I94 I;  2UUB E;  2UUC I;  4M1K A;  3OML A;  3WU6 A;  2DMY A;  1FWK A;  4HXZ A;  1ZXM A;  4OX9 E;  4F54 A;  2BM1 A;  4KZS A;  1RRE A;  1MX0 A;  1ZM2 A;  4YY3 E;  2DSY A;  2O1V A;  4DMI A;  1X48 A;  1WHN A;  4YHH E;  2UXC I;  2F4V I;  1ELO A;  3H09 A;  4NXM E;  1MG7 A;  4P78 A;  1IBL I;  2JY9 A;  3K1J A;  4B3R E;  2HHH I;  4Z7Y A;  4LFB E;  4DV5 I;  4DU7 A;  4LF6 I;  1N36 I;  4KQV A;  3ZZT A;  4LF4 E;  3HQ1 A;  2E1M A;  2MC6 A;  4JI4 E;  2V2V A;  3QT6 A;  3OTO I;  4JI7 I;  1H74 A;  3HPZ A;  3HTX A;  4DV2 I;  4X62 I;  2A2D A;  4WUB A;  4F9B B;  5IT9 C;  1J5E I;  4HYM A;  2WZO A;  2GS8 A;  3PYE A;  4B3M E;  2PNL A;  1N34 I;  5A2Q C;  4DV4 I;  1Z5C A;  4LFC I;  1NHH A;  4TUG A;  2B3T B;  3J7Y p;  2B7T A;  3ADG A;  2NA2 A;  3ZKB A;  2DB2 A;  1WXR A;  3T1Y E;  1HNX E;  1HNZ I;  2O1W A;  1B62 A;  4F9C B;  3T1H E;  4DV7 E;  3C4T A;  2O1U A;  2IOP A;  4IZJ B;  3F0N A;  4DR5 E;  2B9D A;  1N0U A;  2HFU A;  1Z5B A;  5LMU I;  4JV5 E;  2HKJ A;  2RS7 A;  4LF5 I;  2HKE A;  2EZ6 A;  5FLX C;  1HK7 A;  4DU8 A;  3J80 C;  4MYT A;  1B63 A;  2O1T A;  4LFA I;  2L3J A;  4LF9 E;  2LE2 A;  4JI1 E;  2VQF E;  3M6A A;  2X36 A;  5CFF E;  2V8Q B;  5ADZ A;  1STU A;  1WUU A;  1VIS A;  1UIL A;  2ZBK B;  4B3T I;  3P1X A;  1FJG I;  4DV0 I;  2ZM6 E;  3HXL A;  2V83 A;  4B3S E;  4FWG A;  1IBM E;  4JI3 I;  2R42 A;  4AQY I;  4X65 E;  1U2R A;  3QT7 A;  2VQE I;  3D4J A;  2CG9 A;  2M1S A;  3JTZ A;  4JI2 E;  4DR6 E;  1PVG A;  2A2C A;  1XMQ I;  4DKK A;  1HR0 E;  2UUA E;  4GKJ I;  4NXN E;  4GKK E;  4LF7 I;  3B8H A;  3DF6 A;  3PYG A;  3RMP A;  1I94 E;  1Z0B A;  1XMO I;  2UUC E;  2E5L I;  2N3G A;  4P52 A;  1RQ0 A;  2Z5B B;  3Q6M A;  3QT8 A;  4BCA A;  1RR9 A;  4HAC B;  3QT5 A;  4IZK A;  4DUZ I;  4LTY A;  3AV0 A;  1Y6Z A;  4JI8 I;  2UXC E;  2F4V E;  4DV6 I;  3WU5 A;  3DJW A;  1WHQ A;  3J7A G;  3ZM7 A;  1HNW I;  1IBL E;  2L8T A;  2HHH E;  3J80 Q;  2VE7 C;  3B82 A;  1USU A;  5AE1 A;  3LNU A;  1Z0G A;  4DV5 E;  4I3H A;  4JYA I;  1EI1 A;  3J7A M;  1S16 A;  4UTG A;  4ZVI A;  3JAM Q;  4LF6 E;  1N36 E;  5DNY A;  1A6F A;  1Z0C A;  4DR1 I;  3OTO E;  4JI7 E;  4JG4 A;  5IWA I;  2EFG A;  2L2K B;  4DV2 E;  2UU9 I;  2CPN A;  4DV1 I;  4X62 E;  1T4O A;  2BV3 A;  4R1F A;  1USV A;  1J5E E;  4I8O A;  4BMJ A;  4DR2 I;  2DIX A;  4JI5 I;  2EWL A;  4DPU A;  3JU0 A;  2OI2 A;  4BC9 A;  1N34 E;  3HJC A;  3PRY A;  2UXD I;  4DV4 E;  2JOX A;  4P7A A;  4LFC E;  2L2N A;  4P7D A;  2JWO A;  4LU9 A;  1RC7 A;  1DQ3 A;  1DAR A;  2V86 A;  5LMN I;  3J81 C;  2LTR A;  2ODR D;  3VK6 A;  4JI6 I;  1HNZ E;  3VYY A;  3HUL A;  4LF8 I;  2CZ9 A;  4BC7 A;  4DUY I;  1KIJ A;  4EMD A;  2UXB I;  4M2Z A;  2L6M A;  4WYQ B;  2JVA A;  2LMZ A;  1YYK A;  3F6G A;  1BKN A;  2RTX A;  5LMU E;  5AAS A;  2ODR C;  1FKA E;  4WSP A;  5L3J A;  3Q1Q A;  2R3V A;  4DR7 I;  2KOU A;  1EA6 A;  2F8B A;  4LF5 E;  4MYU A;  2NPF A;  1UHZ A;  4F9A B;  2IHR 1;  3PYF A;  2LTS A;  4DV3 I;  1FNM A;  2L3C A;  1Z5A A;  2V8P A;  1NHI A;  4LFA E;  1XNR I;  1J26 A;  1QU6 A;  3K6Q A;  1XHK A;  2RS6 A;  2K4V A;  1IBK I;  2LJH A;  3K85 A;  2M7Q A;  1GZ6 A;  2HK2 A;  4OOG C;  4B3T E;  2ZIT A;  1FJG E;  2Q2E B;  4DV0 E;  1N33 I;  4WFT A;  4JI3 E;  2V34 A;  4AQY E;  5IT9 Q;  4DPW A;  1Y4U A;  1YYO A;  2VQE E;  1Z0E A;  4KHP I;  4K0K I;  3FIG A;  2HFS A;  2WW4 A;  2Z5E A;  2PNM A;  2MC5 A;  5A2Q Q;  4X64 I;  4PRX A;  1XMQ E;  2LUQ A;  3P06 A;  5T6J A;  3F6H A;  4GKJ E;  1XNQ I;  3ADI A;  1H73 A;  1KVK A;  2NUG A;  2FTX B;  4LF7 E;  5F3W A;  5LL6 R;  3AUZ A;  4USM A;  1XMO E;  1T4L B;  2E5L E;  2J7K A;  3H4L A;  3J81 Q;  1N32 I;  4XTJ A;  2Z5C A;  4JI0 I;  1K47 A;  1KKH A;  4X66 I;  4DPX A;  4DR3 I;  4J8Z A;  1DI2 A;  2L33 A;  1NZ0 A;  4DR4 I;  3Q6N A;  4DUZ E;  4PRV A;  4USK A;  3HPS A;  5BR8 I;  2UUB I;  4FWD A;  3LLH A;  3LPS A;  4JI8 E;  2B7V A;  4DV6 E;  2RSM A;  3WU3 A;  2BM0 A;  5FLX Q;  4X8W A;  4IZK B;  1HNW E;  4R8O A;  3ZZ0 A;  4OX9 I;  2E1R A;  1O0W A;  1ZM3 A;  2V88 A;  4YY3 I;  2LUP B;  1Z59 A;  4JYA E;  2LJP A;  3ADL A;  4YHH I;  1D6T A;  4DPY A;  4GEQ B;  2L2M A;  4NXM I;  1Y4S A;  1Z0T A;  4DR1 E;  4B3R I;  5IWA E;  1H72 C;  4FWH A;  3ZKD A;  3LTO A;  2UU9 E;  2LBS B;  4LFB I;  4ED4 A;  1MU5 A;  4DV1 E;  2M4I A;  1ZBT A;  3MSW A;  5GMD A;  2V2Z A;  5AE3 A;  1UEK A;  4L5N C;  4DR2 E;  4JI5 E;  1KTV A;  4LF4 I;  4JI4 I;  2DEJ A;  4WUD A;  4PU9 A;  5AE2 A;  2UXD E;  1H7U A;  3LML A;  3PYD A;  3IWC A;  1EKZ A;  2GQ0 A;  5FWK A;  5LMN E;  4Z7C A;  2X7I A;  4B3M I;  1SR9 A;  2NUE A;  4R03 A;  2CGE A;  2AJ4 A;  4JI6 E;  1FWL A;  4LF8 E;  3IWD A;  2YZT A;  3CWV A;  4DUY E;  4M0V A;  2UXB E;  3KWR A;  3ADJ A;  4IZJ A;  2JR1 A;  4DXL A;  3T1Y I;  1HNX I;  4DR7 E;  4BBY A;  3B78 A;  3T1H I;  4L8N A;  1YYW A;  4DV7 I;  1X47 A;  1N0V C;  3ZZU A;  1ZBQ A;  2KON A;  4DV3 E;  4FN5 A;  4DR5 I;  2V87 A;  1XNR E;  4DPT A;  1ZM9 A;  4JV5 I;  1IBK E;  2VF3 A;  3GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...