4OX9I

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9I00
1EA6A 3K1JA 3QT7A 2UXCE 4HXZA 4OX9I 4YHHE 1FJGE 4DR6I 1N34I 2XEXA 4PRVA 4B3RE 5LMNI 4NXNE 4JI5E 4EMDA 3ZKDA 4LF5I 2WW4A 3B82A 1IBLE 4JI8I 4JI0I 3QT5A 1B63A 3CWVA 3ZZTA 4LFCE 2E1RA 1ZM3A 4NXMI 4X65E 1J5EE 4X62I 2HFSA 1N0VC 1ZM4A 4DV6I 3PYEA 4K0KE 4JI1E 2ZM6I 4DR4I 2VQFE 2UUAE 4GKJI 4JI7I 1PIEA 3J80C 1XNRE 4DUZI 1IBMI 2UU9E 4DPTA 4JI3I 1K47A 4LF8I 2LJPA 4KHPE 4DV5I 2R3VA 4DV3E 1KIJA 4YY3E 2HKEA 5IWAE 3B78A 4OX9E 4DR6E 1Z0GA 4JI2I 1N34E 1MG7A 3ZM7A 4DR3E 5LMNE 4LF9I 1HNWI 1HNXE 4JI8E 4JI0E 1ZM2A 1N0UA 4MYTA 4NXME 1IBKI 2A2DA 4X62E 1DARA 3PYGA 3QT6A 2UXDI 3T1YI 2HHHI 4DV6E 2X36A 4AQYI 1ZM9A 3ZZ0A 2ZM6E 4DR4E 1XMOI 4JI7E 1FWKA 2BM1A 4LFAI 4ED4A 4DV2I 2ZITA 1N33I 1OJ4A 4DUZE 1IBME 1Z5AA 1HR0E 4JI3E 3WU5A 5LMUI 4HACA 4DXLA 2V8PA 3LTOA 4DPXA 3PYDA 2F4VI 4RPFA 2NPFA 1Z0WA 4DU7A 4DUYI 3F0NA 3OTOI 4JI2E 4FN5A 4B3MI 3HULA 3QT8A 1Z5BA 4USMA 1EI1A 4FWHA 4LF9E 3J81Q 1HNWE 4Z7CA 1NHJA 3M6AA 4ZVIA 4DPWA 1Z0BA 1IBKE 1PVGA 3T1YE 1KVKA 3JAMQ 1UEKA 2HHHE 4AQYE 3WU4A 2OI2A 5LL6R 4DR5I 1N32I 4DR1I 1XMOE 4P7AA 4HYMA 4DV2E 1RREA 1FI4A 1N33E 4HY1A 2Q2EB 3J7AG 1NZ0A 1Z59A 5A2QQ 1MU5A 4JI4I 2VF3A 1ZXNA 2EFGA 4LFBI 1U2RA 4B3SI 4JG4A 2VQEI 1H7UA 2E5LI 2F4VE 4P52A 2A2CA 3WU3A 4FWDA 2AJ4A 5FLXQ 2V2QA 3OTOE 4DU8A 4LF5E 4WUDA 4B3ME 1KKHA 2UXCI 4X64I 1FJGI 3JAMC 4DV1I 3K17A 5IT9Q 2HKJA 4NXNI 4DPYA 3LNUA 3T1HI 4DV4I 4GKKI 1RR9A 4GKJE 5A2QC 2HFUA 4JYAI 4DR5E 4KQVA 1N32E 4DR1E 4WUBA 5GMEA 1Z5CA 3ZKBA 4LF8E 4JV5I 4DV5E 3D4JA 4X66I 4R1FA 2DEIA 4JI4E 1XHKA 2UU9I 4LFBE 4B3SE 2CZ9A 1N36I 2V2VA 4DR2I 1Z0TA 4LF7I 2E5LE 4B3TI 3J80Q 3V5RA 2HK2A 4DR7I 3LPSA 4DV0I 1B62A 2BM0A 1H7SA 1H74A 4I3HA 4Z7YA 1WUUA 2UUCI 1XNQI 4X64E 3Q1QA 2UXBI 2UUBI 1FKAE 4DV1E 4DR3I 4URLA 1BKNA 1HNXI 2UXDE 2BV3A 3T1HE 1I94I 1XMQI 4PU9A 1S4EA 1D6TA 4DV4E 4LF4I 4GKKE 5BR8I 4LFAE 4JYAE 1FNMA 4UTGA 4JI6I 5LMUE 4FW9A 1VISA 4HACB 4JV5E 4DV7I 4X66E 1Z0CA 1Z0VA 4PRXA 1HNZI 4LF6I 3J81C 1HR0I 4UT4A 1N36E 2V34A 4DR2E 2GS8A 4LF7E 2HK3A 1NHIA 4DUYE 4B3TE 3PYFA 4M1KA 4DR7E 1Z0EA 4DV0E 4YHHI 2UUCE 1XNQE 4B3RI 1MX0A 4JI5I 2UXBE 1IBLI 5GMDA 2DEJA 2UUBE 1H73A 5L3JA 4LFCI 1QZRA 3V2UC 1A6FA 3WU6A 1NHHA 3B8HA 3J7AM 1I94E 1XMQE 1FWLA 4X65I 1J5EI 4LF4E 5BR8E 1ELOA 4K0KI 4JI1I 1H72C 2VQFI 2UUAI 1PKPA 1S16A 2V2ZA 4JI6E 4USKA 1ZXMA 2J7KA 4FWGA 1KTVA 1XNRI 2ZBKB 3GONA 5FLXC 4DV7E 3H4LA 4KHPI 2VQEE 1HNZE 4LF6E 4DPUA 4DV3I 4YY3I 3ZZUA 2R42A 4MYUA 2X7IA 5IWAI 4WUCA 5IT9C 4XTJA
chains in the Genus database with same CATH superfamily
2C37B 1EA6A 2GO4A 3K1JA 3QT7A 2UXCE 2O1UA 4HXZA 3UHMA 4OX9I 4YHHE 1FJGE 4DR6I 1N34I 2XEXA 4PRVA 4B3RE 5LMNI 4NXNE 4JI5E 4EMDA 3ZKDA 4LF5I 2WW4A 3B82A 1IBLE 4JI8I 4JI0I 3QT5A 1B63A 3CWVA 2JE6B 4AIMA 3ZZTA 4LFCE 2E1RA 4J3DA 2Z5CA 1ZM3A 2F1DA 4NXMI 2BA0G 4X65E 1J5EE 3H1CA 4X62I 2HFSA 1N0VC 2PO0B 1ZM4A 2IESA 1XXEA 4DV6I 3PYEA 4K0KE 5C0XF 2BA1D 4LOMA 4JI1E 2ZM6I 4DR4I 5C0XC 2VQFE 2UUAE 4GQUA 4GKJI 4JI7I 1PIEA 1P42A 1E3PA 3J80C 2O1TA 1XNRE 4DUZI 4U3BA 4IFDF 1IBMI 2UU9E 4DPTA 4JI3I 1K47A 4LF8I 2LJPA 4IFDC 4KHPE 4DV5I 2R3VA 4DV3E 1KIJA 4FW4A 4IZJA 4YY3E 4BA1B 2HKEA 5IWAE 1Y60A 3B78A 1OYSA 4IFDD 2IERA 4NBQA 4OKGA 5DRPA 4OX9E 2PO2A 4DR6E 1Z0GA 4JI2I 2JEBA 1N34E 1MG7A 3M85G 2JT2A 3ZM7A 4DR3E 5LMNE 1VI7A 4LF9I 1HNWI 2PO1A 1HNXE 4JI8E 4JI0E 3PS2A 1ZM2A 3HKMA 1N0UA 5DNXA 4MYTA 4QNJA 4NXME 1YH8A 2Z5BA 3DD6A 1IBKI 2A2DA 4X62E 1DARA 4LCFA 3PYGA 3QT6A 2UXDI 3T1YI 2HHHI 4DV6E 2X36A 3U1YA 4AQYI 2CGEA 1ZM9A 5K36F 3ZZ0A 2ZM6E 4DR4E 4FW6A 1XMOI 5K36C 4JI7E 1FWKA 2BM1A 4LFAI 3GLLA 4ED4A 4QNKA 4DV2I 2BA1G 2PO0A 2ZITA 1N33I 1OJ4A 4DUZE 1IBME 1Z5AA 1HR0E 4JI3E 3WU5A 5LMUI 3U1KA 2JEAB 4HACA 4AIDA 5C0XA 4DXLA 4OO1E 3M7ND 1R6LA 2V8PA 3LTOA 3P3GA 4DPXA 3PYDA 4MQYA 2F4VI 2GQ0A 2NN6E 2IOQA 4IFDA 4RPFA 2NPFA 1Z0WA 4DU7A 4DUYI 3F0NA 1USUA 1Y6ZA 2C39A 3OTOI 4JI2E 4BA1A 4FN5A 4B3MI 3HULA 3QT8A 1Z5BA 4USMA 1EI1A 4FWHA 1OYRA 4LF9E 2WNRA 3J81Q 1HNWE 4Z7CA 2C38B 4MDTA 1RHYA 1NHJA 3M6AA 4ZVIA 2PNZB 4DPWA 4BA2B 1Z0BA 1IBKE 3K85A 1PVGA 3T1YE 5FWKA 1KVKA 3JAMQ 1UEKA 2HHHE 5JEAE 4AQYE 3WU4A 2OI2A 5LL6R 4DR5I 1N32I 4DR1I 1XMOE 4LCGA 4P7AA 4HYMA 4OO1F 4DV2E 1RREA 1FI4A 4IZKA 1N33E 4HY1A 2J65A 4OO1B 2Q2EB 2WP8A 3L7ZB 3J7AG 5EKWA 1NZ0A 1Z59A 5A2QQ 1MU5A 2NN6F 3GCMA 4JI4I 2VF3A 1ZXNA 5K36A 2NN6B 2EFGA 4LFBI 1U2RA 4B3SI 4JG4A 4OO1D 2AE8A 2VQEI 1H7UA 2E5LI 2F4VE 4P52A 2A2CA 3NZKA 1E3HA 2CVEA 1OYPA 3WU3A 1YHCA 4FW5A 2NN6D 2PNMA 4FWDA 2AJ4A 5FLXQ 2V2QA 3OTOE 4DU8A 4LF5E 4WUDA 4B3ME 2C37A 1KKHA 2UXCI 4U3DA 4X64I 2Z5CB 4ISAA 1FJGI 3JAMC 2PNLA 4DV1I 3K17A 5JEAF 5IT9Q 2HKJA 2O1VA 4NXNI 4DPYA 5JEAB 5JEAC 3LNUA 2O1WA 3P3CA 3T1HI 2JE6A 4DV4I 4GKKI 1RR9A 4GKJE 5A2QC 2HFUA 4JYAI 4DR5E 4KQVA 4MU4A 1N32E 1UDNA 4DR1E 4WUBA 5JEAD 5GMEA 1Z5CA 2PNZA 3ZKBA 4LF8E 3B4TA 4JV5I 4DV5E 4IZJB 4N3OA 3D4JA 4X66I 4AM3A 4R1FA 2DEIA 4JI4E 2Z5EA 3PRYA 5C0XE 1XHKA 2UU9I 4LFBE 4B3SE 2CZ9A 1N36I 2V2VA 4DR2I 4IZJD 2O3ZA 1Z0TA 4LF7I 3CDIA 1UDQA 2E5LE 4B3TI 2JEBB 3J80Q 2GO3A 5EL9A 3V5RA 2HK2A 4DR7I 3LPSA 4DV0I 1B62A 1R6MA 2BM0A 1H7SA 1H74A 4I3HA 2PO1B 4Z7YA 3M85D 2BR2B 1WUUA 5DNLA 2UUCI 1XNQI 4X64E 5DRQA 3Q1QA 2UXBI 2Z5BB 2UUBI 1Y4SA 1FKAE 1USVA 4DV1E 4DR3I 4FW3A 4URLA 1BKNA 1HNXI 2UXDE 2BV3A 3T1HE 1I94I 1XMQI 4PU9A 1S4EA 1D6TA 4DV4E 4LF4I 4GKKE 5BR8I 4LFAE 4JYAE 1FNMA 2CG9A 4OO1C 5JEAA 3P76A 4UTGA 4JI6I 5LMUE 4FW9A 4LPFA 1VISA 4HACB 3HJCA 5C0XB 4JV5E 4MU3A 4DV7I 4X66E 1Z0CA 2NN6C 4FW7A 1Z0VA 5DRRA 3P06A 4PRXA 1HNZI 4LF6I 5DROA 5K36E 2IOPA 3J81C 1HR0I 4UT4A 4IFDB 3M7NG 1N36E 2V34A 5C0XD 1UDSA 2GS8A 4DR2E 2JEAA 4MU1A 4LF7E 2HK3A 1NHIA 4DUYE 2C39B 3CDJA 4B3TE 4IS9A 3PYFA 4M1KA 4DR7E 1Z0EA 4DV0E 2WNRB 4YHHI 2UUCE 1XNQE 5ELWA 4B3RI 1MX0A 4JI5I 2UXBE 1IBLI 3P3EA 5GMDA 2DEJA 2UUBE 2BA0D 1H73A 5L3JA 4LFCI 1QZRA 3Q6MA 1A6FA 3V2UC 3WU6A 1NHHA 3B8HA 4OZEA 3J7AM 2BR2A 1I94E 1XMQE 1FWLA 2C38A 4X65I 1J5EI 4LF4E 5BR8E 1HK7A 1ELOA 4K0KI 4IZKB 4BA2A 4JI1I 1H72C 2VQFI 2WP8B 2UUAI 1PKPA 1S16A 2V2ZA 2VESA 4JI6E 1Y5YA 4USKA 1ZXMA 2J7KA 4FWGA 1KTVA 3PS1A 1XNRI 2ZBKB 3GONA 5K36B 3GMEA 5FLXC 3H4LA 3PS3A 4DV7E 4KHPI 1Y4UA 2VQEE 1HNZE 4LF6E 4OO1A 4DPUA 4DV3I 4YY3I 2PO2B 3KRNA 3L7ZA 2R42A 3ZZUA 4IFDE 4MYUA 2X7IA 5K36D 3Q6NA 5IWAI 4WUCA 5IT9C 1UDOA 4XTJA 4MU0A 4LCHA 2NN6A
chains in the Genus database with same CATH topology
1EA6A 3K1JA 3QT7A 2UXCE 2O1UA 4HXZA 4OX9I 4YHHE 1FJGE 4DR6I 1N34I 2XEXA 4PRVA 4B3RE 5LMNI 4NXNE 4JI5E 4EMDA 3ZKDA 4LF5I 2WW4A 3B82A 1IBLE 4JI8I 4JI0I 3QT5A 1B63A 3CWVA 3ZZTA 4LFCE 2E1RA 2Z5CA 1ZM3A 4NXMI 4X65E 1J5EE 4X62I 2HFSA 1N0VC 1ZM4A 4DV6I 3PYEA 4K0KE 4JI1E 2ZM6I 4DR4I 2VQFE 2UUAE 4GKJI 4JI7I 1PIEA 3J80C 2O1TA 1XNRE 4DUZI 1IBMI 2UU9E 4DPTA 4JI3I 1K47A 4LF8I 2LJPA 4KHPE 4DV5I 2R3VA 4DV3E 1KIJA 4IZJA 4YY3E 2HKEA 5IWAE 3B78A 4OX9E 4DR6E 1Z0GA 4JI2I 1N34E 1MG7A 3ZM7A 4DR3E 5LMNE 4LF9I 1HNWI 1HNXE 4JI8E 4JI0E 1ZM2A 1N0UA 4MYTA 4NXME 2Z5BA 1IBKI 2A2DA 4X62E 1DARA 3PYGA 3QT6A 2UXDI 3T1YI 2HHHI 4DV6E 2X36A 4AQYI 2CGEA 1ZM9A 3ZZ0A 2ZM6E 4DR4E 1XMOI 4JI7E 1FWKA 2BM1A 4LFAI 4ED4A 4DV2I 2ZITA 1N33I 1OJ4A 4DUZE 1IBME 1Z5AA 1HR0E 4JI3E 3WU5A 5LMUI 4HACA 4DXLA 2V8PA 3LTOA 4DPXA 3PYDA 2F4VI 2GQ0A 2IOQA 4RPFA 2NPFA 1Z0WA 4DU7A 4DUYI 3F0NA 1USUA 1Y6ZA 3OTOI 4JI2E 4FN5A 4B3MI 3HULA 3QT8A 1Z5BA 4USMA 1EI1A 4FWHA 4LF9E 3J81Q 1HNWE 4Z7CA 1NHJA 3M6AA 4ZVIA 4DPWA 1Z0BA 1IBKE 3K85A 1PVGA 3T1YE 5FWKA 1KVKA 3JAMQ 1UEKA 2HHHE 4AQYE 3WU4A 2OI2A 5LL6R 4DR5I 1N32I 4DR1I 1XMOE 4P7AA 4HYMA 4DV2E 1RREA 1FI4A 4IZKA 1N33E 4HY1A 2Q2EB 3J7AG 1NZ0A 1Z59A 5A2QQ 1MU5A 4JI4I 2VF3A 1ZXNA 2EFGA 4LFBI 1U2RA 4B3SI 4JG4A 2VQEI 1H7UA 2E5LI 2F4VE 4P52A 2A2CA 3WU3A 2PNMA 4FWDA 2AJ4A 5FLXQ 2V2QA 3OTOE 4DU8A 4LF5E 4WUDA 4B3ME 1KKHA 2UXCI 4X64I 2Z5CB 1FJGI 3JAMC 2PNLA 4DV1I 3K17A 5IT9Q 2HKJA 2O1VA 4NXNI 4DPYA 3LNUA 2O1WA 3T1HI 4DV4I 4GKKI 1RR9A 4GKJE 5A2QC 2HFUA 4JYAI 4DR5E 4KQVA 1N32E 4DR1E 4WUBA 5GMEA 1Z5CA 3ZKBA 4LF8E 4JV5I 4DV5E 4IZJB 4N3OA 3D4JA 4X66I 4R1FA 2DEIA 4JI4E 2Z5EA 3PRYA 1XHKA 2UU9I 4LFBE 4B3SE 2CZ9A 1N36I 2V2VA 4DR2I 4IZJD 1Z0TA 4LF7I 2E5LE 4B3TI 3J80Q 3V5RA 2HK2A 4DR7I 3LPSA 4DV0I 1B62A 2BM0A 1H7SA 1H74A 4I3HA 4Z7YA 1WUUA 2UUCI 1XNQI 4X64E 3Q1QA 2UXBI 2Z5BB 2UUBI 1Y4SA 1FKAE 1USVA 4DV1E 4DR3I 4URLA 1BKNA 1HNXI 2UXDE 2BV3A 3T1HE 1I94I 1XMQI 4PU9A 1S4EA 1D6TA 4DV4E 4LF4I 4GKKE 5BR8I 4LFAE 4JYAE 1FNMA 2CG9A 4UTGA 4JI6I 5LMUE 4FW9A 1VISA 4HACB 3HJCA 4JV5E 4DV7I 4X66E 1Z0CA 1Z0VA 3P06A 4PRXA 1HNZI 4LF6I 2IOPA 3J81C 1HR0I 4UT4A 1N36E 2V34A 4DR2E 2GS8A 4LF7E 2HK3A 1NHIA 4DUYE 4B3TE 3PYFA 4M1KA 4DR7E 1Z0EA 4DV0E 4YHHI 2UUCE 1XNQE 4B3RI 1MX0A 4JI5I 2UXBE 1IBLI 5GMDA 2DEJA 2UUBE 1H73A 5L3JA 4LFCI 1QZRA 3Q6MA 1A6FA 3V2UC 3WU6A 1NHHA 3B8HA 3J7AM 1I94E 1XMQE 1FWLA 4X65I 1J5EI 4LF4E 5BR8E 1HK7A 1ELOA 4K0KI 4IZKB 4JI1I 1H72C 2VQFI 2UUAI 1PKPA 1S16A 2V2ZA 4JI6E 4USKA 1ZXMA 2J7KA 4FWGA 1KTVA 1XNRI 2ZBKB 3GONA 5FLXC 4DV7E 3H4LA 4KHPI 1Y4UA 2VQEE 1HNZE 4LF6E 4DPUA 4DV3I 4YY3I 3ZZUA 2R42A 4MYUA 2X7IA 3Q6NA 5IWAI 4WUCA 5IT9C 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  3K1J A;  3QT7 A;  2UXC E;  4HXZ A;  4OX9 I;  4YHH E;  1FJG E;  4DR6 I;  1N34 I;  2XEX A;  4PRV A;  4B3R E;  5LMN I;  4NXN E;  4JI5 E;  4EMD A;  3ZKD A;  4LF5 I;  2WW4 A;  3B82 A;  1IBL E;  4JI8 I;  4JI0 I;  3QT5 A;  1B63 A;  3CWV A;  3ZZT A;  4LFC E;  2E1R A;  1ZM3 A;  4NXM I;  4X65 E;  1J5E E;  4X62 I;  2HFS A;  1N0V C;  1ZM4 A;  4DV6 I;  3PYE A;  4K0K E;  4JI1 E;  2ZM6 I;  4DR4 I;  2VQF E;  2UUA E;  4GKJ I;  4JI7 I;  1PIE A;  3J80 C;  1XNR E;  4DUZ I;  1IBM I;  2UU9 E;  4DPT A;  4JI3 I;  1K47 A;  4LF8 I;  2LJP A;  4KHP E;  4DV5 I;  2R3V A;  4DV3 E;  1KIJ A;  4YY3 E;  2HKE A;  5IWA E;  3B78 A;  4OX9 E;  4DR6 E;  1Z0G A;  4JI2 I;  1N34 E;  1MG7 A;  3ZM7 A;  4DR3 E;  5LMN E;  4LF9 I;  1HNW I;  1HNX E;  4JI8 E;  4JI0 E;  1ZM2 A;  1N0U A;  4MYT A;  4NXM E;  1IBK I;  2A2D A;  4X62 E;  1DAR A;  3PYG A;  3QT6 A;  2UXD I;  3T1Y I;  2HHH I;  4DV6 E;  2X36 A;  4AQY I;  1ZM9 A;  3ZZ0 A;  2ZM6 E;  4DR4 E;  1XMO I;  4JI7 E;  1FWK A;  2BM1 A;  4LFA I;  4ED4 A;  4DV2 I;  2ZIT A;  1N33 I;  1OJ4 A;  4DUZ E;  1IBM E;  1Z5A A;  1HR0 E;  4JI3 E;  3WU5 A;  5LMU I;  4HAC A;  4DXL A;  2V8P A;  3LTO A;  4DPX A;  3PYD A;  2F4V I;  4RPF A;  2NPF A;  1Z0W A;  4DU7 A;  4DUY I;  3F0N A;  3OTO I;  4JI2 E;  4FN5 A;  4B3M I;  3HUL A;  3QT8 A;  1Z5B A;  4USM A;  1EI1 A;  4FWH A;  4LF9 E;  3J81 Q;  1HNW E;  4Z7C A;  1NHJ A;  3M6A A;  4ZVI A;  4DPW A;  1Z0B A;  1IBK E;  1PVG A;  3T1Y E;  1KVK A;  3JAM Q;  1UEK A;  2HHH E;  4AQY E;  3WU4 A;  2OI2 A;  5LL6 R;  4DR5 I;  1N32 I;  4DR1 I;  1XMO E;  4P7A A;  4HYM A;  4DV2 E;  1RRE A;  1FI4 A;  1N33 E;  4HY1 A;  2Q2E B;  3J7A G;  1NZ0 A;  1Z59 A;  5A2Q Q;  1MU5 A;  4JI4 I;  2VF3 A;  1ZXN A;  2EFG A;  4LFB I;  1U2R A;  4B3S I;  4JG4 A;  2VQE I;  1H7U A;  2E5L I;  2F4V E;  4P52 A;  2A2C A;  3WU3 A;  4FWD A;  2AJ4 A;  5FLX Q;  2V2Q A;  3OTO E;  4DU8 A;  4LF5 E;  4WUD A;  4B3M E;  1KKH A;  2UXC I;  4X64 I;  1FJG I;  3JAM C;  4DV1 I;  3K17 A;  5IT9 Q;  2HKJ A;  4NXN I;  4DPY A;  3LNU A;  3T1H I;  4DV4 I;  4GKK I;  1RR9 A;  4GKJ E;  5A2Q C;  2HFU A;  4JYA I;  4DR5 E;  4KQV A;  1N32 E;  4DR1 E;  4WUB A;  5GME A;  1Z5C A;  3ZKB A;  4LF8 E;  4JV5 I;  4DV5 E;  3D4J A;  4X66 I;  4R1F A;  2DEI A;  4JI4 E;  1XHK A;  2UU9 I;  4LFB E;  4B3S E;  2CZ9 A;  1N36 I;  2V2V A;  4DR2 I;  1Z0T A;  4LF7 I;  2E5L E;  4B3T I;  3J80 Q;  3V5R A;  2HK2 A;  4DR7 I;  3LPS A;  4DV0 I;  1B62 A;  2BM0 A;  1H7S A;  1H74 A;  4I3H A;  4Z7Y A;  1WUU A;  2UUC I;  1XNQ I;  4X64 E;  3Q1Q A;  2UXB I;  2UUB I;  1FKA E;  4DV1 E;  4DR3 I;  4URL A;  1BKN A;  1HNX I;  2UXD E;  2BV3 A;  3T1H E;  1I94 I;  1XMQ I;  4PU9 A;  1S4E A;  1D6T A;  4DV4 E;  4LF4 I;  4GKK E;  5BR8 I;  4LFA E;  4JYA E;  1FNM A;  4UTG A;  4JI6 I;  5LMU E;  4FW9 A;  1VIS A;  4HAC B;  4JV5 E;  4DV7 I;  4X66 E;  1Z0C A;  1Z0V A;  4PRX A;  1HNZ I;  4LF6 I;  3J81 C;  1HR0 I;  4UT4 A;  1N36 E;  2V34 A;  4DR2 E;  2GS8 A;  4LF7 E;  2HK3 A;  1NHI A;  4DUY E;  4B3T E;  3PYF A;  4M1K A;  4DR7 E;  1Z0E A;  4DV0 E;  4YHH I;  2UUC E;  1XNQ E;  4B3R I;  1MX0 A;  4JI5 I;  2UXB E;  1IBL I;  5GMD A;  2DEJ A;  2UUB E;  1H73 A;  5L3J A;  4LFC I;  1QZR A;  3V2U C;  1A6F A;  3WU6 A;  1NHH A;  3B8H A;  3J7A M;  1I94 E;  1XMQ E;  1FWL A;  4X65 I;  1J5E I;  4LF4 E;  5BR8 E;  1ELO A;  4K0K I;  4JI1 I;  1H72 C;  2VQF I;  2UUA I;  1PKP A;  1S16 A;  2V2Z A;  4JI6 E;  4USK A;  1ZXM A;  2J7K A;  4FWG A;  1KTV A;  1XNR I;  2ZBK B;  3GON A;  5FLX C;  4DV7 E;  3H4L A;  4KHP I;  2VQE E;  1HNZ E;  4LF6 E;  4DPU A;  4DV3 I;  4YY3 I;  3ZZU A;  2R42 A;  4MYU A;  2X7I A;  5IWA I;  4WUC A;  5IT9 C;  4XTJ A; 
#chains in the Genus database with same CATH topology
 2C37 B;  1EA6 A;  2GO4 A;  3K1J A;  3QT7 A;  2UXC E;  2O1U A;  4HXZ A;  3UHM A;  4OX9 I;  4YHH E;  1FJG E;  4DR6 I;  1N34 I;  2XEX A;  4PRV A;  4B3R E;  5LMN I;  4NXN E;  4JI5 E;  4EMD A;  3ZKD A;  4LF5 I;  2WW4 A;  3B82 A;  1IBL E;  4JI8 I;  4JI0 I;  3QT5 A;  1B63 A;  3CWV A;  2JE6 B;  4AIM A;  3ZZT A;  4LFC E;  2E1R A;  4J3D A;  2Z5C A;  1ZM3 A;  2F1D A;  4NXM I;  2BA0 G;  4X65 E;  1J5E E;  3H1C A;  4X62 I;  2HFS A;  1N0V C;  2PO0 B;  1ZM4 A;  2IES A;  1XXE A;  4DV6 I;  3PYE A;  4K0K E;  5C0X F;  2BA1 D;  4LOM A;  4JI1 E;  2ZM6 I;  4DR4 I;  5C0X C;  2VQF E;  2UUA E;  4GQU A;  4GKJ I;  4JI7 I;  1PIE A;  1P42 A;  1E3P A;  3J80 C;  2O1T A;  1XNR E;  4DUZ I;  4U3B A;  4IFD F;  1IBM I;  2UU9 E;  4DPT A;  4JI3 I;  1K47 A;  4LF8 I;  2LJP A;  4IFD C;  4KHP E;  4DV5 I;  2R3V A;  4DV3 E;  1KIJ A;  4FW4 A;  4IZJ A;  4YY3 E;  4BA1 B;  2HKE A;  5IWA E;  1Y60 A;  3B78 A;  1OYS A;  4IFD D;  2IER A;  4NBQ A;  4OKG A;  5DRP A;  4OX9 E;  2PO2 A;  4DR6 E;  1Z0G A;  4JI2 I;  2JEB A;  1N34 E;  1MG7 A;  3M85 G;  2JT2 A;  3ZM7 A;  4DR3 E;  5LMN E;  1VI7 A;  4LF9 I;  1HNW I;  2PO1 A;  1HNX E;  4JI8 E;  4JI0 E;  3PS2 A;  1ZM2 A;  3HKM A;  1N0U A;  5DNX A;  4MYT A;  4QNJ A;  4NXM E;  1YH8 A;  2Z5B A;  3DD6 A;  1IBK I;  2A2D A;  4X62 E;  1DAR A;  4LCF A;  3PYG A;  3QT6 A;  2UXD I;  3T1Y I;  2HHH I;  4DV6 E;  2X36 A;  3U1Y A;  4AQY I;  2CGE A;  1ZM9 A;  5K36 F;  3ZZ0 A;  2ZM6 E;  4DR4 E;  4FW6 A;  1XMO I;  5K36 C;  4JI7 E;  1FWK A;  2BM1 A;  4LFA I;  3GLL A;  4ED4 A;  4QNK A;  4DV2 I;  2BA1 G;  2PO0 A;  2ZIT A;  1N33 I;  1OJ4 A;  4DUZ E;  1IBM E;  1Z5A A;  1HR0 E;  4JI3 E;  3WU5 A;  5LMU I;  3U1K A;  2JEA B;  4HAC A;  4AID A;  5C0X A;  4DXL A;  4OO1 E;  3M7N D;  1R6L A;  2V8P A;  3LTO A;  3P3G A;  4DPX A;  3PYD A;  4MQY A;  2F4V I;  2GQ0 A;  2NN6 E;  2IOQ A;  4IFD A;  4RPF A;  2NPF A;  1Z0W A;  4DU7 A;  4DUY I;  3F0N A;  1USU A;  1Y6Z A;  2C39 A;  3OTO I;  4JI2 E;  4BA1 A;  4FN5 A;  4B3M I;  3HUL A;  3QT8 A;  1Z5B A;  4USM A;  1EI1 A;  4FWH A;  1OYR A;  4LF9 E;  2WNR A;  3J81 Q;  1HNW E;  4Z7C A;  2C38 B;  4MDT A;  1RHY A;  1NHJ A;  3M6A A;  4ZVI A;  2PNZ B;  4DPW A;  4BA2 B;  1Z0B A;  1IBK E;  3K85 A;  1PVG A;  3T1Y E;  5FWK A;  1KVK A;  3JAM Q;  1UEK A;  2HHH E;  5JEA E;  4AQY E;  3WU4 A;  2OI2 A;  5LL6 R;  4DR5 I;  1N32 I;  4DR1 I;  1XMO E;  4LCG A;  4P7A A;  4HYM A;  4OO1 F;  4DV2 E;  1RRE A;  1FI4 A;  4IZK A;  1N33 E;  4HY1 A;  2J65 A;  4OO1 B;  2Q2E B;  2WP8 A;  3L7Z B;  3J7A G;  5EKW A;  1NZ0 A;  1Z59 A;  5A2Q Q;  1MU5 A;  2NN6 F;  3GCM A;  4JI4 I;  2VF3 A;  1ZXN A;  5K36 A;  2NN6 B;  2EFG A;  4LFB I;  1U2R A;  4B3S I;  4JG4 A;  4OO1 D;  2AE8 A;  2VQE I;  1H7U A;  2E5L I;  2F4V E;  4P52 A;  2A2C A;  3NZK A;  1E3H A;  2CVE A;  1OYP A;  3WU3 A;  1YHC A;  4FW5 A;  2NN6 D;  2PNM A;  4FWD A;  2AJ4 A;  5FLX Q;  2V2Q A;  3OTO E;  4DU8 A;  4LF5 E;  4WUD A;  4B3M E;  2C37 A;  1KKH A;  2UXC I;  4U3D A;  4X64 I;  2Z5C B;  4ISA A;  1FJG I;  3JAM C;  2PNL A;  4DV1 I;  3K17 A;  5JEA F;  5IT9 Q;  2HKJ A;  2O1V A;  4NXN I;  4DPY A;  5JEA B;  5JEA C;  3LNU A;  2O1W A;  3P3C A;  3T1H I;  2JE6 A;  4DV4 I;  4GKK I;  1RR9 A;  4GKJ E;  5A2Q C;  2HFU A;  4JYA I;  4DR5 E;  4KQV A;  4MU4 A;  1N32 E;  1UDN A;  4DR1 E;  4WUB A;  5JEA D;  5GME A;  1Z5C A;  2PNZ A;  3ZKB A;  4LF8 E;  3B4T A;  4JV5 I;  4DV5 E;  4IZJ B;  4N3O A;  3D4J A;  4X66 I;  4AM3 A;  4R1F A;  2DEI A;  4JI4 E;  2Z5E A;  3PRY A;  5C0X E;  1XHK A;  2UU9 I;  4LFB E;  4B3S E;  2CZ9 A;  1N36 I;  2V2V A;  4DR2 I;  4IZJ D;  2O3Z A;  1Z0T A;  4LF7 I;  3CDI A;  1UDQ A;  2E5L E;  4B3T I;  2JEB B;  3J80 Q;  2GO3 A;  5EL9 A;  3V5R A;  2HK2 A;  4DR7 I;  3LPS A;  4DV0 I;  1B62 A;  1R6M A;  2BM0 A;  1H7S A;  1H74 A;  4I3H A;  2PO1 B;  4Z7Y A;  3M85 D;  2BR2 B;  1WUU A;  5DNL A;  2UUC I;  1XNQ I;  4X64 E;  5DRQ A;  3Q1Q A;  2UXB I;  2Z5B B;  2UUB I;  1Y4S A;  1FKA E;  1USV A;  4DV1 E;  4DR3 I;  4FW3 A;  4URL A;  1BKN A;  1HNX I;  2UXD E;  2BV3 A;  3T1H E;  1I94 I;  1XMQ I;  4PU9 A;  1S4E A;  1D6T A;  4DV4 E;  4LF4 I;  4GKK E;  5BR8 I;  4LFA E;  4JYA E;  1FNM A;  2CG9 A;  4OO1 C;  5JEA A;  3P76 A;  4UTG A;  4JI6 I;  5LMU E;  4FW9 A;  4LPF A;  1VIS A;  4HAC B;  3HJC A;  5C0X B;  4JV5 E;  4MU3 A;  4DV7 I;  4X66 E;  1Z0C A;  2NN6 C;  4FW7 A;  1Z0V A;  5DRR A;  3P06 A;  4PRX A;  1HNZ I;  4LF6 I;  5DRO A;  5K36 E;  2IOP A;  3J81 C;  1HR0 I;  4UT4 A;  4IFD B;  3M7N G;  1N36 E;  2V34 A;  5C0X D;  1UDS A;  2GS8 A;  4DR2 E;  2JEA A;  4MU1 A;  4LF7 E;  2HK3 A;  1NHI A;  4DUY E;  2C39 B;  3CDJ A;  4B3T E;  4IS9 A;  3PYF A;  4M1K A;  4DR7 E;  1Z0E A;  4DV0 E;  2WNR B;  4YHH I;  2UUC E;  1XNQ E;  5ELW A;  4B3R I;  1MX0 A;  4JI5 I;  2UXB E;  1IBL I;  3P3E A;  5GMD A;  2DEJ A;  2UUB E;  2BA0 D;  1H73 A;  5L3J A;  4LFC I;  1QZR A;  3Q6M A;  1A6F A;  3V2U C;  3WU6 A;  1NHH A;  3B8H A;  4OZE A;  3J7A M;  2BR2 A;  1I94 E;  1XMQ E;  1FWL A;  2C38 A;  4X65 I;  1J5E I;  4LF4 E;  5BR8 E;  1HK7 A;  1ELO A;  4K0K I;  4IZK B;  4BA2 A;  4JI1 I;  1H72 C;  2VQF I;  2WP8 B;  2UUA I;  1PKP A;  1S16 A;  2V2Z A;  2VES A;  4JI6 E;  1Y5Y A;  4USK A;  1ZXM A;  2J7K A;  4FWG A;  1KTV A;  3PS1 A;  1XNR I;  2ZBK B;  3GON A;  5K36 B;  3GME A;  5FLX C;  3H4L A;  3PS3 A;  4DV7 E;  4KHP I;  1Y4U A;  2VQE E;  1HNZ E;  4LF6 E;  4OO1 A;  4DPU A;  4DV3 I;  4YY3 I;  2PO2 B;  3KRN A;  3L7Z A;  2R42 A;  3ZZU A;  4IFD E;  4MYU A;  2X7I A;  5K36 D;  3Q6N A;  5IWA I;  4WUC A;  5IT9 C;  1UDO A;  4XTJ A;  4MU0 A;  4LCH A;  2NN6 A; 
#chains in the Genus database with same CATH homology
 1EA6 A;  3K1J A;  3QT7 A;  2UXC E;  2O1U A;  4HXZ A;  4OX9 I;  4YHH E;  1FJG E;  4DR6 I;  1N34 I;  2XEX A;  4PRV A;  4B3R E;  5LMN I;  4NXN E;  4JI5 E;  4EMD A;  3ZKD A;  4LF5 I;  2WW4 A;  3B82 A;  1IBL E;  4JI8 I;  4JI0 I;  3QT5 A;  1B63 A;  3CWV A;  3ZZT A;  4LFC E;  2E1R A;  2Z5C A;  1ZM3 A;  4NXM I;  4X65 E;  1J5E E;  4X62 I;  2HFS A;  1N0V C;  1ZM4 A;  4DV6 I;  3PYE A;  4K0K E;  4JI1 E;  2ZM6 I;  4DR4 I;  2VQF E;  2UUA E;  4GKJ I;  4JI7 I;  1PIE A;  3J80 C;  2O1T A;  1XNR E;  4DUZ I;  1IBM I;  2UU9 E;  4DPT A;  4JI3 I;  1K47 A;  4LF8 I;  2LJP A;  4KHP E;  4DV5 I;  2R3V A;  4DV3 E;  1KIJ A;  4IZJ A;  4YY3 E;  2HKE A;  5IWA E;  3B78 A;  4OX9 E;  4DR6 E;  1Z0G A;  4JI2 I;  1N34 E;  1MG7 A;  3ZM7 A;  4DR3 E;  5LMN E;  4LF9 I;  1HNW I;  1HNX E;  4JI8 E;  4JI0 E;  1ZM2 A;  1N0U A;  4MYT A;  4NXM E;  2Z5B A;  1IBK I;  2A2D A;  4X62 E;  1DAR A;  3PYG A;  3QT6 A;  2UXD I;  3T1Y I;  2HHH I;  4DV6 E;  2X36 A;  4AQY I;  2CGE A;  1ZM9 A;  3ZZ0 A;  2ZM6 E;  4DR4 E;  1XMO I;  4JI7 E;  1FWK A;  2BM1 A;  4LFA I;  4ED4 A;  4DV2 I;  2ZIT A;  1N33 I;  1OJ4 A;  4DUZ E;  1IBM E;  1Z5A A;  1HR0 E;  4JI3 E;  3WU5 A;  5LMU I;  4HAC A;  4DXL A;  2V8P A;  3LTO A;  4DPX A;  3PYD A;  2F4V I;  2GQ0 A;  2IOQ A;  4RPF A;  2NPF A;  1Z0W A;  4DU7 A;  4DUY I;  3F0N A;  1USU A;  1Y6Z A;  3OTO I;  4JI2 E;  4FN5 A;  4B3M I;  3HUL A;  3QT8 A;  1Z5B A;  4USM A;  1EI1 A;  4FWH A;  4LF9 E;  3J81 Q;  1HNW E;  4Z7C A;  1NHJ A;  3M6A A;  4ZVI A;  4DPW A;  1Z0B A;  1IBK E;  3K85 A;  1PVG A;  3T1Y E;  5FWK A;  1KVK A;  3JAM Q;  1UEK A;  2HHH E;  4AQY E;  3WU4 A;  2OI2 A;  5LL6 R;  4DR5 I;  1N32 I;  4DR1 I;  1XMO E;  4P7A A;  4HYM A;  4DV2 E;  1RRE A;  1FI4 A;  4IZK A;  1N33 E;  4HY1 A;  2Q2E B;  3J7A G;  1NZ0 A;  1Z59 A;  5A2Q Q;  1MU5 A;  4JI4 I;  2VF3 A;  1ZXN A;  2EFG A;  4LFB I;  1U2R A;  4B3S I;  4JG4 A;  2VQE I;  1H7U A;  2E5L I;  2F4V E;  4P52 A;  2A2C A;  3WU3 A;  2PNM A;  4FWD A;  2AJ4 A;  5FLX Q;  2V2Q A;  3OTO E;  4DU8 A;  4LF5 E;  4WUD A;  4B3M E;  1KKH A;  2UXC I;  4X64 I;  2Z5C B;  1FJG I;  3JAM C;  2PNL A;  4DV1 I;  3K17 A;  5IT9 Q;  2HKJ A;  2O1V A;  4NXN I;  4DPY A;  3LNU A;  2O1W A;  3T1H I;  4DV4 I;  4GKK I;  1RR9 A;  4GKJ E;  5A2Q C;  2HFU A;  4JYA I;  4DR5 E;  4KQV A;  1N32 E;  4DR1 E;  4WUB A;  5GME A;  1Z5C A;  3ZKB A;  4LF8 E;  4JV5 I;  4DV5 E;  4IZJ B;  4N3O A;  3D4J A;  4X66 I;  4R1F A;  2DEI A;  4JI4 E;  2Z5E A;  3PRY A;  1XHK A;  2UU9 I;  4LFB E;  4B3S E;  2CZ9 A;  1N36 I;  2V2V A;  4DR2 I;  4IZJ D;  1Z0T A;  4LF7 I;  2E5L E;  4B3T I;  3J80 Q;  3V5R A;  2HK2 A;  4DR7 I;  3LPS A;  4DV0 I;  1B62 A;  2BM0 A;  1H7S A;  1H74 A;  4I3H A;  4Z7Y A;  1WUU A;  2UUC I;  1XNQ I;  4X64 E;  3Q1Q A;  2UXB I;  2Z5B B;  2UUB I;  1Y4S A;  1FKA E;  1USV A;  4DV1 E;  4DR3 I;  4URL A;  1BKN A;  1HNX I;  2UXD E;  2BV3 A;  3T1H E;  1I94 I;  1XMQ I;  4PU9 A;  1S4E A;  1D6T A;  4DV4 E;  4LF4 I;  4GKK E;  5BR8 I;  4LFA E;  4JYA E;  1FNM A;  2CG9 A;  4UTG A;  4JI6 I;  5LMU E;  4FW9 A;  1VIS A;  4HAC B;  3HJC A;  4JV5 E;  4DV7 I;  4X66 E;  1Z0C A;  1Z0V A;  3P06 A;  4PRX A;  1HNZ I;  4LF6 I;  2IOP A;  3J81 C;  1HR0 I;  4UT4 A;  1N36 E;  2V34 A;  4DR2 E;  2GS8 A;  4LF7 E;  2HK3 A;  1NHI A;  4DUY E;  4B3T E;  3PYF A;  4M1K A;  4DR7 E;  1Z0E A;  4DV0 E;  4YHH I;  2UUC E;  1XNQ E;  4B3R I;  1MX0 A;  4JI5 I;  2UXB E;  1IBL I;  5GMD A;  2DEJ A;  2UUB E;  1H73 A;  5L3J A;  4LFC I;  1QZR A;  3Q6M A;  1A6F A;  3V2U C;  3WU6 A;  1NHH A;  3B8H A;  3J7A M;  1I94 E;  1XMQ E;  1FWL A;  4X65 I;  1J5E I;  4LF4 E;  5BR8 E;  1HK7 A;  1ELO A;  4K0K I;  4IZK B;  4JI1 I;  1H72 C;  2VQF I;  2UUA I;  1PKP A;  1S16 A;  2V2Z A;  4JI6 E;  4USK A;  1ZXM A;  2J7K A;  4FWG A;  1KTV A;  1XNR I;  2ZBK B;  3GON A;  5FLX C;  4DV7 E;  3H4L A;  4KHP I;  1Y4U A;  2VQE E;  1HNZ E;  4LF6 E;  4DPU A;  4DV3 I;  4YY3 I;  3ZZU A;  2R42 A;  4MYU A;  2X7I A;  3Q6N A;  5IWA I;  4WUC A;  5IT9 C;  4XTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...