4OX9I

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9I00
4JV5I 1ELOA 4AQYE 1D6TA 4DV5E 1Z59A 1HNXE 5L3JA 4NXNE 4FWDA 4X62I 4FWHA 4DV6E 2V2QA 4DR6I 4HY1A 1MU5A 2BM0A 3D4JA 4B3SI 5LMNI 4DUYE 3J81Q 4LFBI 1HR0I 4HXZA 4JI7E 4Z7CA 4JG4A 4JI5E 3F0NA 4JI2E 3J80Q 1KVKA 4FN5A 1PVGA 3WU3A 1XNQI 1FWKA 1DARA 4FW9A 5FLXC 2HK2A 1J5EI 4DU8A 4NXME 3ZZUA 4AQYI 3ZKBA 4DV7I 2EFGA 4JV5E 1XNRE 1N0UA 1U2RA 2VQEE 2R42A 2Q2EB 4JI8E 3M6AA 4LFCI 1XMOI 4DR4I 4DR2E 2F4VI 1IBKE 4B3TI 1HNWI 4DV1I 4LFCE 4MYUA 2E5LE 4DR3I 3OTOE 4HACA 2VQEI 4JYAI 4DPUA 4DV0E 1HNXI 1IBMI 3V2UC 4DR7I 4KQVA 2UUCI 4JYAE 4HACB 3PYDA 4YY3I 4LF4E 3QT8A 4WUBA 4B3RE 4K0KI 1ZM4A 1FJGI 2VF3A 4DPXA 2HHHI 3T1HE 2HFUA 1MX0A 4XTJA 1HR0E 2VQFI 1RR9A 1ZM2A 5GMEA 5LMNE 4DUYI 2XEXA 2HKEA 2V8PA 1S4EA 2BV3A 3T1HI 2HHHE 1NHIA 3J7AM 1HNZE 4PRXA 4Z7YA 4PU9A 4ED4A 4B3ME 1XNRI 4USKA 4DPTA 2LJPA 1IBLE 1Z5AA 1EI1A 1ZXNA 4DV3E 1NHHA 4KHPI 4DR3E 2V2ZA 2NPFA 4UTGA 1XMQE 2E5LI 4HYMA 4JI4I 1N33E 4DV1E 4LF9E 1KIJA 1Z0EA 1Z0GA 1IBKI 1H7SA 4ZVIA 2J7KA 2OI2A 2UUAI 1Z0VA 3ZKDA 4LF7I 3K1JA 4YY3E 5GMDA 4LF5E 2UUCE 4LF8I 3QT7A 4B3MI 1Z5BA 1H73A 4URLA 3V5RA 2UUAE 4PRVA 4GKJE 1QZRA 1I94I 2UXDI 3T1YI 4YHHE 1PIEA 2VQFE 4OX9I 4LFBE 4B3SE 3T1YE 4DPYA 1EA6A 1N34I 2WW4A 4EMDA 2E1RA 5A2QQ 4I3HA 4DU7A 1H72C 5BR8I 2UU9E 1N32E 2X36A 3HULA 4P52A 4X64E 3H4LA 4JI3E 1N0VC 4LF5I 4P7AA 4LF8E 3CWVA 1FNMA 1WUUA 3J7AG 1XNQE 2DEJA 2UXCE 3QT5A 2R3VA 5A2QC 4LF6I 4JI0E 4DR4E 1XMOE 1MG7A 4DR2I 4LF9I 4K0KE 1H7UA 4FWGA 4DR1E 4JI1E 4X65I 2HFSA 4X62E 3K17A 4NXNI 4WUCA 4DV7E 3ZZ0A 1J5EE 1RREA 4X66I 3B78A 1N32I 2X7IA 5LMUI 4X65E 2V34A 4JI1I 1A6FA 3B8HA 3PYFA 3WU6A 4JI2I 4WUDA 4JI5I 3LTOA 2UXDE 1UEKA 3J81C 4DR6E 1NHJA 1FKAE 3LNUA 1KTVA 3J80C 1N36I 1H74A 2ZITA 1Z0TA 4JI6I 4X64I 4DPWA 1Z5CA 4NXMI 1FWLA 2CZ9A 2UU9I 4DV2E 4GKKE 3WU5A 4USMA 1B63A 3QT6A 1HNZI 4JI6E 1VISA 4DUZE 1ZM3A 3OTOI 2ZM6I 4LF6E 2UUBE 4RPFA 4JI4E 3GONA 4UT4A 1BKNA 2HKJA 4JI8I 1S16A 4DV6I 4GKJI 4DUZI 3PYEA 4JI3I 1PKPA 5LL6R 3PYGA 4B3RI 4DV5I 4LF4I 5LMUE 5IT9Q 4X66E 2UXBI 1ZM9A 4DR5I 3JAMC 4LF7E 3WU4A 3LPSA 5IWAE 1ZXMA 1XHKA 2BM1A 2ZBKB 3Q1QA 3ZZTA 4DR1I 1KKHA 4DXLA 2DEIA 1N33I 1Z0WA 1XMQI 2A2CA 4M1KA 4JI7I 4LFAI 5IWAI 2V2VA 2UXCI 1K47A 4DV3I 1IBLI 4DV2I 4GKKI 1Z0BA 3ZM7A 5IT9C 2HK3A 2AJ4A 3B82A 1IBME 4DR7E 1N34E 1FI4A 4DV0I 1B62A 5BR8E 4LFAE 2GS8A 5FLXQ 1N36E 4DV4I 3JAMQ 1OJ4A 4YHHI 1Z0CA 2ZM6E 1I94E 2UUBI 1HNWE 4B3TE 4OX9E 2F4VE 4JI0I 1NZ0A 1FJGE 4R1FA 4KHPE 4DV4E 2A2DA 4MYTA 4DR5E 2UXBE
chains in the Genus database with same CATH superfamily
5JEAC 4JV5I 1ELOA 4AQYE 1D6TA 2O1WA 4AIDA 4FW6A 4DV5E 1Z59A 1HNXE 5L3JA 4NXNE 4FWDA 5JEAE 4FWHA 4X62I 4DV6E 2V2QA 3NZKA 4DR6I 2NN6F 2Z5BA 4HY1A 1MU5A 2BM0A 3D4JA 4B3SI 5LMNI 4DUYE 3J81Q 4LFBI 1HR0I 4HXZA 4JI7E 4Z7CA 4JG4A 4JI5E 4BA1A 3F0NA 2PO2A 3CDIA 4JI2E 4OO1B 3J80Q 1KVKA 4FN5A 1PVGA 4OO1D 1XXEA 3WU3A 4IFDA 2IESA 1XNQI 1FWKA 2PO2B 1DARA 4FW9A 2C39B 5FLXC 2HK2A 1J5EI 4DU8A 3GCMA 4NXME 3ZZUA 4AQYI 3ZKBA 4DV7I 2EFGA 1OYRA 4JV5E 1XNRE 2JEAB 4QNKA 1N0UA 1U2RA 2VQEE 2R42A 2Q2EB 2JE6A 4JI8E 4MQYA 3M6AA 1UDSA 4LFCI 2NN6D 1XMOI 4DR4I 2PO0A 4DR2E 2F4VI 1IBKE 4B3TI 1HNWI 2PO1B 4DV1I 4LFCE 4MYUA 2E5LE 4DR3I 3OTOE 4HACA 5DROA 2VQEI 4LOMA 4LPFA 4JYAI 4IFDE 5EL9A 4DPUA 4DV0E 5K36E 1HNXI 2J65A 2WNRB 2C38B 4N3OA 1Y6ZA 3V2UC 1IBMI 4DR7I 4KQVA 2UUCI 1R6LA 2F1DA 3K85A 4JYAE 4HACB 3PYDA 4YY3I 4LF4E 2O1VA 3QT8A 4WUBA 4B3RE 4K0KI 5DNXA 5JEAB 3M7NG 4LCFA 1ZM4A 1FJGI 1USUA 4MU0A 2VF3A 4DPXA 2HHHI 2HFUA 2JEBB 1MX0A 3T1HE 4XTJA 1HR0E 2VQFI 1RR9A 1ZM2A 5GMEA 5DRPA 1RHYA 4LCHA 5LMNE 4DUYI 2XEXA 2Z5CA 2HKEA 2V8PA 2JEAA 1S4EA 2BV3A 3T1HI 2HHHE 2WNRA 1NHIA 3J7AM 2CG9A 5JEAF 1Y5YA 5C0XC 4PRXA 1HNZE 4MU1A 4Z7YA 4PU9A 4ED4A 1UDOA 4FW4A 4B3ME 1XNRI 4USKA 4IS9A 4DPTA 2LJPA 1IBLE 1Z5AA 1EI1A 1ZXNA 4DV3E 1NHHA 2WP8B 3KRNA 4KHPI 4IZJD 2IERA 4FW3A 4IZJB 4DR3E 2V2ZA 2NPFA 3P06A 4UTGA 1XMQE 5C0XF 2E5LI 4HYMA 4JI4I 1N33E 4DV1E 3DD6A 4LF9E 4MDTA 1KIJA 1Z0EA 1UDNA 1Z0GA 1H7SA 1IBKI 3M7ND 2O1TA 4ZVIA 1P42A 2C39A 2J7KA 2OI2A 2UUAI 4OKGA 1Z0VA 5C0XE 3ZKDA 4LF7I 4IFDB 2O1UA 3K1JA 4YY3E 5GMDA 1OYSA 4LF5E 2UUCE 4LF8I 3QT7A 4B3MI 1Z5BA 1H73A 4URLA 4FW7A 3V5RA 2UUAE 4PRVA 3P3EA 4GKJE 2IOQA 2BA0G 1QZRA 1I94I 1YH8A 2UXDI 3T1YI 4YHHE 1PIEA 2VQFE 4OX9I 4LFBE 4OZEA 1USVA 5JEAA 4B3SE 2NN6E 3T1YE 5C0XA 4DPYA 1EA6A 1N34I 2WW4A 4EMDA 2E1RA 5A2QQ 5K36B 4I3HA 1H72C 4DU7A 2BA1G 3H1CA 5BR8I 2UU9E 1YHCA 1N32E 3Q6NA 4BA2B 2X36A 3HULA 4AM3A 4P52A 4X64E 3PS3A 3H4LA 4JI3E 1N0VC 4LF5I 4P7AA 4LF8E 3CWVA 1FNMA 3P3GA 1WUUA 3J7AG 1XNQE 2DEJA 5DRQA 2PO1A 2UXCE 3QT5A 5ELWA 2AE8A 2R3VA 3GLLA 3P76A 5A2QC 5K36F 5K36C 4LF6I 3UHMA 2C37A 4JI0E 2IOPA 4DR4E 1XMOE 4U3DA 2CVEA 1MG7A 5K36D 4DR2I 4LF9I 1E3HA 4LCGA 4K0KE 1H7UA 4FWGA 4DR1E 4JI1E 4X65I 2HFSA 4X62E 4QNJA 3K17A 4NXNI 4WUCA 4DV7E 3ZZ0A 1J5EE 3HKMA 1RREA 4X66I 3B78A 1N32I 2X7IA 5LMUI 4X65E 2V34A 4JI1I 1A6FA 3B8HA 3PYFA 4MU4A 4BA1B 5DRRA 3WU6A 4JI2I 4U3BA 4WUDA 3B4TA 4JI5I 3LTOA 1Y60A 2GO3A 2Z5BB 3U1YA 2UXDE 1UEKA 3J81C 4BA2A 5K36A 4DR6E 1NHJA 1FKAE 4IZJA 2Z5EA 3LNUA 1KTVA 3J80C 1N36I 1H74A 2WP8A 2ZITA 1Z0TA 4JI6I 4X64I 4DPWA 1Z5CA 4NXMI 2O3ZA 4IFDC 2GO4A 3P3CA 1HK7A 1FWLA 2CZ9A 2UU9I 4AIMA 4DV2E 4GKKE 3WU5A 4GQUA 4USMA 1B63A 3QT6A 3U1KA 5JEAD 1HNZI 4FW5A 4JI6E 1VISA 4DUZE 3L7ZB 2PNMA 1ZM3A 3PS1A 3OTOI 4OO1C 2ZM6I 4LF6E 2UUBE 4RPFA 4JI4E 3GONA 5EKWA 4UT4A 1BKNA 2HKJA 4JI8I 2JEBA 2NN6B 1S16A 4OO1E 4DV6I 4GKJI 4DUZI 3PYEA 4OO1A 2CGEA 4JI3I 1PKPA 5LL6R 1VI7A 3PYGA 4MU3A 4B3RI 4DV5I 4LF4I 2PNZA 3L7ZA 5LMUE 5IT9Q 4X66E 2UXBI 1ZM9A 1Y4SA 4DR5I 3JAMC 4LF7E 3Q6MA 2BA0D 2NN6C 3WU4A 1OYPA 3LPSA 5IWAE 1ZXMA 1XHKA 2BM1A 2ZBKB 5C0XB 3Q1QA 3ZZTA 4DR1I 1KKHA 4DXLA 2DEIA 1N33I 1Z0WA 3GMEA 4ISAA 2NN6A 1XMQI 2PO0B 2A2CA 4M1KA 4JI7I 1UDQA 4LFAI 5IWAI 2V2VA 2UXCI 2BR2A 2BA1D 4IFDD 1K47A 5DNLA 4DV3I 1IBLI 4DV2I 2Z5CB 3PS2A 2PNZB 4IFDF 4GKKI 1Z0BA 3ZM7A 1E3PA 5C0XD 5IT9C 2HK3A 2AJ4A 3B82A 2PNLA 1IBME 4DR7E 1N34E 1R6MA 1FI4A 4DV0I 5FWKA 1B62A 2VESA 5BR8E 4LFAE 3M85G 2GS8A 5FLXQ 1Y4UA 1N36E 4IZKB 4DV4I 3JAMQ 1OJ4A 4YHHI 3M85D 1Z0CA 2ZM6E 2JE6B 1I94E 2UUBI 1HNWE 4B3TE 2GQ0A 4OX9E 4OO1F 4J3DA 2F4VE 4JI0I 2BR2B 2C38A 4NBQA 1NZ0A 1FJGE 4R1FA 4KHPE 4DV4E 2A2DA 3HJCA 2JT2A 3PRYA 4MYTA 4DR5E 4IZKA 3CDJA 2UXBE 2C37B
chains in the Genus database with same CATH topology
4JV5I 1ELOA 4AQYE 1D6TA 2O1WA 4DV5E 1Z59A 1HNXE 5L3JA 4NXNE 4FWDA 4X62I 4FWHA 4DV6E 2V2QA 4DR6I 4HY1A 2Z5BA 1MU5A 2BM0A 3D4JA 4B3SI 5LMNI 4DUYE 3J81Q 4LFBI 1HR0I 4HXZA 4JI7E 4Z7CA 4JG4A 4JI5E 3F0NA 4JI2E 3J80Q 1KVKA 4FN5A 1PVGA 3WU3A 1XNQI 1FWKA 1DARA 4FW9A 5FLXC 2HK2A 1J5EI 4DU8A 4NXME 3ZZUA 4AQYI 3ZKBA 4DV7I 2EFGA 4JV5E 1XNRE 1N0UA 1U2RA 2VQEE 2R42A 2Q2EB 4JI8E 3M6AA 4LFCI 1XMOI 4DR4I 4DR2E 2F4VI 1IBKE 4B3TI 1HNWI 4DV1I 4LFCE 4MYUA 2E5LE 4DR3I 3OTOE 4HACA 2VQEI 4JYAI 4DPUA 4DV0E 1HNXI 4N3OA 1Y6ZA 3V2UC 1IBMI 4DR7I 4KQVA 2UUCI 3K85A 4JYAE 4HACB 3PYDA 4YY3I 4LF4E 2O1VA 3QT8A 4WUBA 4B3RE 4K0KI 1ZM4A 1FJGI 1USUA 2VF3A 4DPXA 2HHHI 3T1HE 2HFUA 1MX0A 4XTJA 1HR0E 2VQFI 1RR9A 1ZM2A 5GMEA 5LMNE 4DUYI 2XEXA 2Z5CA 2HKEA 2V8PA 1S4EA 2BV3A 3T1HI 2HHHE 1NHIA 3J7AM 2CG9A 1HNZE 4PRXA 4Z7YA 4PU9A 4ED4A 4B3ME 1XNRI 4USKA 4DPTA 2LJPA 1IBLE 1Z5AA 1EI1A 1ZXNA 4DV3E 1NHHA 4KHPI 4IZJD 4IZJB 4DR3E 2V2ZA 2NPFA 3P06A 4UTGA 1XMQE 2E5LI 4HYMA 4JI4I 1N33E 4DV1E 4LF9E 1KIJA 1Z0EA 1Z0GA 1IBKI 1H7SA 2O1TA 4ZVIA 2J7KA 2OI2A 2UUAI 1Z0VA 3ZKDA 4LF7I 2O1UA 3K1JA 4YY3E 5GMDA 4LF5E 2UUCE 4LF8I 3QT7A 4B3MI 1Z5BA 1H73A 4URLA 3V5RA 2UUAE 4PRVA 4GKJE 2IOQA 1QZRA 1I94I 2UXDI 3T1YI 4YHHE 1PIEA 2VQFE 4OX9I 4LFBE 1USVA 4B3SE 3T1YE 4DPYA 1EA6A 1N34I 2WW4A 4EMDA 2E1RA 5A2QQ 4I3HA 4DU7A 1H72C 5BR8I 2UU9E 1N32E 3Q6NA 2X36A 3HULA 4P52A 4X64E 3H4LA 4JI3E 1N0VC 4LF5I 4P7AA 4LF8E 3CWVA 1FNMA 1WUUA 3J7AG 1XNQE 2DEJA 2UXCE 3QT5A 2R3VA 5A2QC 4LF6I 4JI0E 2IOPA 4DR4E 1XMOE 1MG7A 4DR2I 4LF9I 4K0KE 1H7UA 4FWGA 4DR1E 4JI1E 4X65I 2HFSA 4X62E 3K17A 4NXNI 4WUCA 4DV7E 3ZZ0A 1J5EE 1RREA 4X66I 3B78A 1N32I 2X7IA 5LMUI 4X65E 2V34A 4JI1I 1A6FA 3B8HA 3PYFA 3WU6A 4JI2I 4WUDA 4JI5I 3LTOA 2Z5BB 2UXDE 1UEKA 3J81C 4DR6E 1NHJA 1FKAE 4IZJA 2Z5EA 3LNUA 1KTVA 3J80C 1N36I 1H74A 2ZITA 1Z0TA 4JI6I 4X64I 4DPWA 1Z5CA 4NXMI 1HK7A 1FWLA 2CZ9A 2UU9I 4DV2E 4GKKE 3WU5A 4USMA 1B63A 3QT6A 1HNZI 4JI6E 1VISA 4DUZE 2PNMA 1ZM3A 3OTOI 2ZM6I 4LF6E 2UUBE 4RPFA 4JI4E 3GONA 4UT4A 1BKNA 2HKJA 4JI8I 1S16A 4DV6I 4GKJI 4DUZI 3PYEA 2CGEA 4JI3I 1PKPA 5LL6R 3PYGA 4B3RI 4DV5I 4LF4I 5LMUE 5IT9Q 4X66E 2UXBI 1ZM9A 1Y4SA 4DR5I 3JAMC 4LF7E 3Q6MA 3WU4A 3LPSA 5IWAE 1ZXMA 1XHKA 2BM1A 2ZBKB 3Q1QA 3ZZTA 4DR1I 1KKHA 4DXLA 2DEIA 1N33I 1Z0WA 1XMQI 2A2CA 4M1KA 4JI7I 4LFAI 5IWAI 2V2VA 2UXCI 1K47A 4DV3I 1IBLI 4DV2I 2Z5CB 4GKKI 1Z0BA 3ZM7A 5IT9C 2HK3A 2AJ4A 3B82A 2PNLA 1IBME 4DR7E 1N34E 1FI4A 4DV0I 5FWKA 1B62A 5BR8E 4LFAE 2GS8A 5FLXQ 1Y4UA 1N36E 4IZKB 4DV4I 3JAMQ 1OJ4A 4YHHI 1Z0CA 2ZM6E 1I94E 2UUBI 1HNWE 4B3TE 2GQ0A 4OX9E 2F4VE 4JI0I 1NZ0A 1FJGE 4R1FA 4KHPE 4DV4E 2A2DA 3HJCA 3PRYA 4MYTA 4DR5E 4IZKA 2UXBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 I;  1ELO A;  4AQY E;  1D6T A;  4DV5 E;  1Z59 A;  1HNX E;  5L3J A;  4NXN E;  4FWD A;  4X62 I;  4FWH A;  4DV6 E;  2V2Q A;  4DR6 I;  4HY1 A;  1MU5 A;  2BM0 A;  3D4J A;  4B3S I;  5LMN I;  4DUY E;  3J81 Q;  4LFB I;  1HR0 I;  4HXZ A;  4JI7 E;  4Z7C A;  4JG4 A;  4JI5 E;  3F0N A;  4JI2 E;  3J80 Q;  1KVK A;  4FN5 A;  1PVG A;  3WU3 A;  1XNQ I;  1FWK A;  1DAR A;  4FW9 A;  5FLX C;  2HK2 A;  1J5E I;  4DU8 A;  4NXM E;  3ZZU A;  4AQY I;  3ZKB A;  4DV7 I;  2EFG A;  4JV5 E;  1XNR E;  1N0U A;  1U2R A;  2VQE E;  2R42 A;  2Q2E B;  4JI8 E;  3M6A A;  4LFC I;  1XMO I;  4DR4 I;  4DR2 E;  2F4V I;  1IBK E;  4B3T I;  1HNW I;  4DV1 I;  4LFC E;  4MYU A;  2E5L E;  4DR3 I;  3OTO E;  4HAC A;  2VQE I;  4JYA I;  4DPU A;  4DV0 E;  1HNX I;  1IBM I;  3V2U C;  4DR7 I;  4KQV A;  2UUC I;  4JYA E;  4HAC B;  3PYD A;  4YY3 I;  4LF4 E;  3QT8 A;  4WUB A;  4B3R E;  4K0K I;  1ZM4 A;  1FJG I;  2VF3 A;  4DPX A;  2HHH I;  3T1H E;  2HFU A;  1MX0 A;  4XTJ A;  1HR0 E;  2VQF I;  1RR9 A;  1ZM2 A;  5GME A;  5LMN E;  4DUY I;  2XEX A;  2HKE A;  2V8P A;  1S4E A;  2BV3 A;  3T1H I;  2HHH E;  1NHI A;  3J7A M;  1HNZ E;  4PRX A;  4Z7Y A;  4PU9 A;  4ED4 A;  4B3M E;  1XNR I;  4USK A;  4DPT A;  2LJP A;  1IBL E;  1Z5A A;  1EI1 A;  1ZXN A;  4DV3 E;  1NHH A;  4KHP I;  4DR3 E;  2V2Z A;  2NPF A;  4UTG A;  1XMQ E;  2E5L I;  4HYM A;  4JI4 I;  1N33 E;  4DV1 E;  4LF9 E;  1KIJ A;  1Z0E A;  1Z0G A;  1IBK I;  1H7S A;  4ZVI A;  2J7K A;  2OI2 A;  2UUA I;  1Z0V A;  3ZKD A;  4LF7 I;  3K1J A;  4YY3 E;  5GMD A;  4LF5 E;  2UUC E;  4LF8 I;  3QT7 A;  4B3M I;  1Z5B A;  1H73 A;  4URL A;  3V5R A;  2UUA E;  4PRV A;  4GKJ E;  1QZR A;  1I94 I;  2UXD I;  3T1Y I;  4YHH E;  1PIE A;  2VQF E;  4OX9 I;  4LFB E;  4B3S E;  3T1Y E;  4DPY A;  1EA6 A;  1N34 I;  2WW4 A;  4EMD A;  2E1R A;  5A2Q Q;  4I3H A;  4DU7 A;  1H72 C;  5BR8 I;  2UU9 E;  1N32 E;  2X36 A;  3HUL A;  4P52 A;  4X64 E;  3H4L A;  4JI3 E;  1N0V C;  4LF5 I;  4P7A A;  4LF8 E;  3CWV A;  1FNM A;  1WUU A;  3J7A G;  1XNQ E;  2DEJ A;  2UXC E;  3QT5 A;  2R3V A;  5A2Q C;  4LF6 I;  4JI0 E;  4DR4 E;  1XMO E;  1MG7 A;  4DR2 I;  4LF9 I;  4K0K E;  1H7U A;  4FWG A;  4DR1 E;  4JI1 E;  4X65 I;  2HFS A;  4X62 E;  3K17 A;  4NXN I;  4WUC A;  4DV7 E;  3ZZ0 A;  1J5E E;  1RRE A;  4X66 I;  3B78 A;  1N32 I;  2X7I A;  5LMU I;  4X65 E;  2V34 A;  4JI1 I;  1A6F A;  3B8H A;  3PYF A;  3WU6 A;  4JI2 I;  4WUD A;  4JI5 I;  3LTO A;  2UXD E;  1UEK A;  3J81 C;  4DR6 E;  1NHJ A;  1FKA E;  3LNU A;  1KTV A;  3J80 C;  1N36 I;  1H74 A;  2ZIT A;  1Z0T A;  4JI6 I;  4X64 I;  4DPW A;  1Z5C A;  4NXM I;  1FWL A;  2CZ9 A;  2UU9 I;  4DV2 E;  4GKK E;  3WU5 A;  4USM A;  1B63 A;  3QT6 A;  1HNZ I;  4JI6 E;  1VIS A;  4DUZ E;  1ZM3 A;  3OTO I;  2ZM6 I;  4LF6 E;  2UUB E;  4RPF A;  4JI4 E;  3GON A;  4UT4 A;  1BKN A;  2HKJ A;  4JI8 I;  1S16 A;  4DV6 I;  4GKJ I;  4DUZ I;  3PYE A;  4JI3 I;  1PKP A;  5LL6 R;  3PYG A;  4B3R I;  4DV5 I;  4LF4 I;  5LMU E;  5IT9 Q;  4X66 E;  2UXB I;  1ZM9 A;  4DR5 I;  3JAM C;  4LF7 E;  3WU4 A;  3LPS A;  5IWA E;  1ZXM A;  1XHK A;  2BM1 A;  2ZBK B;  3Q1Q A;  3ZZT A;  4DR1 I;  1KKH A;  4DXL A;  2DEI A;  1N33 I;  1Z0W A;  1XMQ I;  2A2C A;  4M1K A;  4JI7 I;  4LFA I;  5IWA I;  2V2V A;  2UXC I;  1K47 A;  4DV3 I;  1IBL I;  4DV2 I;  4GKK I;  1Z0B A;  3ZM7 A;  5IT9 C;  2HK3 A;  2AJ4 A;  3B82 A;  1IBM E;  4DR7 E;  1N34 E;  1FI4 A;  4DV0 I;  1B62 A;  5BR8 E;  4LFA E;  2GS8 A;  5FLX Q;  1N36 E;  4DV4 I;  3JAM Q;  1OJ4 A;  4YHH I;  1Z0C A;  2ZM6 E;  1I94 E;  2UUB I;  1HNW E;  4B3T E;  4OX9 E;  2F4V E;  4JI0 I;  1NZ0 A;  1FJG E;  4R1F A;  4KHP E;  4DV4 E;  2A2D A;  4MYT A;  4DR5 E;  2UXB E; 
#chains in the Genus database with same CATH topology
 5JEA C;  4JV5 I;  1ELO A;  4AQY E;  1D6T A;  2O1W A;  4AID A;  4FW6 A;  4DV5 E;  1Z59 A;  1HNX E;  5L3J A;  4NXN E;  4FWD A;  5JEA E;  4FWH A;  4X62 I;  4DV6 E;  2V2Q A;  3NZK A;  4DR6 I;  2NN6 F;  2Z5B A;  4HY1 A;  1MU5 A;  2BM0 A;  3D4J A;  4B3S I;  5LMN I;  4DUY E;  3J81 Q;  4LFB I;  1HR0 I;  4HXZ A;  4JI7 E;  4Z7C A;  4JG4 A;  4JI5 E;  4BA1 A;  3F0N A;  2PO2 A;  3CDI A;  4JI2 E;  4OO1 B;  3J80 Q;  1KVK A;  4FN5 A;  1PVG A;  4OO1 D;  1XXE A;  3WU3 A;  4IFD A;  2IES A;  1XNQ I;  1FWK A;  2PO2 B;  1DAR A;  4FW9 A;  2C39 B;  5FLX C;  2HK2 A;  1J5E I;  4DU8 A;  3GCM A;  4NXM E;  3ZZU A;  4AQY I;  3ZKB A;  4DV7 I;  2EFG A;  1OYR A;  4JV5 E;  1XNR E;  2JEA B;  4QNK A;  1N0U A;  1U2R A;  2VQE E;  2R42 A;  2Q2E B;  2JE6 A;  4JI8 E;  4MQY A;  3M6A A;  1UDS A;  4LFC I;  2NN6 D;  1XMO I;  4DR4 I;  2PO0 A;  4DR2 E;  2F4V I;  1IBK E;  4B3T I;  1HNW I;  2PO1 B;  4DV1 I;  4LFC E;  4MYU A;  2E5L E;  4DR3 I;  3OTO E;  4HAC A;  5DRO A;  2VQE I;  4LOM A;  4LPF A;  4JYA I;  4IFD E;  5EL9 A;  4DPU A;  4DV0 E;  5K36 E;  1HNX I;  2J65 A;  2WNR B;  2C38 B;  4N3O A;  1Y6Z A;  3V2U C;  1IBM I;  4DR7 I;  4KQV A;  2UUC I;  1R6L A;  2F1D A;  3K85 A;  4JYA E;  4HAC B;  3PYD A;  4YY3 I;  4LF4 E;  2O1V A;  3QT8 A;  4WUB A;  4B3R E;  4K0K I;  5DNX A;  5JEA B;  3M7N G;  4LCF A;  1ZM4 A;  1FJG I;  1USU A;  4MU0 A;  2VF3 A;  4DPX A;  2HHH I;  2HFU A;  2JEB B;  1MX0 A;  3T1H E;  4XTJ A;  1HR0 E;  2VQF I;  1RR9 A;  1ZM2 A;  5GME A;  5DRP A;  1RHY A;  4LCH A;  5LMN E;  4DUY I;  2XEX A;  2Z5C A;  2HKE A;  2V8P A;  2JEA A;  1S4E A;  2BV3 A;  3T1H I;  2HHH E;  2WNR A;  1NHI A;  3J7A M;  2CG9 A;  5JEA F;  1Y5Y A;  5C0X C;  4PRX A;  1HNZ E;  4MU1 A;  4Z7Y A;  4PU9 A;  4ED4 A;  1UDO A;  4FW4 A;  4B3M E;  1XNR I;  4USK A;  4IS9 A;  4DPT A;  2LJP A;  1IBL E;  1Z5A A;  1EI1 A;  1ZXN A;  4DV3 E;  1NHH A;  2WP8 B;  3KRN A;  4KHP I;  4IZJ D;  2IER A;  4FW3 A;  4IZJ B;  4DR3 E;  2V2Z A;  2NPF A;  3P06 A;  4UTG A;  1XMQ E;  5C0X F;  2E5L I;  4HYM A;  4JI4 I;  1N33 E;  4DV1 E;  3DD6 A;  4LF9 E;  4MDT A;  1KIJ A;  1Z0E A;  1UDN A;  1Z0G A;  1H7S A;  1IBK I;  3M7N D;  2O1T A;  4ZVI A;  1P42 A;  2C39 A;  2J7K A;  2OI2 A;  2UUA I;  4OKG A;  1Z0V A;  5C0X E;  3ZKD A;  4LF7 I;  4IFD B;  2O1U A;  3K1J A;  4YY3 E;  5GMD A;  1OYS A;  4LF5 E;  2UUC E;  4LF8 I;  3QT7 A;  4B3M I;  1Z5B A;  1H73 A;  4URL A;  4FW7 A;  3V5R A;  2UUA E;  4PRV A;  3P3E A;  4GKJ E;  2IOQ A;  2BA0 G;  1QZR A;  1I94 I;  1YH8 A;  2UXD I;  3T1Y I;  4YHH E;  1PIE A;  2VQF E;  4OX9 I;  4LFB E;  4OZE A;  1USV A;  5JEA A;  4B3S E;  2NN6 E;  3T1Y E;  5C0X A;  4DPY A;  1EA6 A;  1N34 I;  2WW4 A;  4EMD A;  2E1R A;  5A2Q Q;  5K36 B;  4I3H A;  1H72 C;  4DU7 A;  2BA1 G;  3H1C A;  5BR8 I;  2UU9 E;  1YHC A;  1N32 E;  3Q6N A;  4BA2 B;  2X36 A;  3HUL A;  4AM3 A;  4P52 A;  4X64 E;  3PS3 A;  3H4L A;  4JI3 E;  1N0V C;  4LF5 I;  4P7A A;  4LF8 E;  3CWV A;  1FNM A;  3P3G A;  1WUU A;  3J7A G;  1XNQ E;  2DEJ A;  5DRQ A;  2PO1 A;  2UXC E;  3QT5 A;  5ELW A;  2AE8 A;  2R3V A;  3GLL A;  3P76 A;  5A2Q C;  5K36 F;  5K36 C;  4LF6 I;  3UHM A;  2C37 A;  4JI0 E;  2IOP A;  4DR4 E;  1XMO E;  4U3D A;  2CVE A;  1MG7 A;  5K36 D;  4DR2 I;  4LF9 I;  1E3H A;  4LCG A;  4K0K E;  1H7U A;  4FWG A;  4DR1 E;  4JI1 E;  4X65 I;  2HFS A;  4X62 E;  4QNJ A;  3K17 A;  4NXN I;  4WUC A;  4DV7 E;  3ZZ0 A;  1J5E E;  3HKM A;  1RRE A;  4X66 I;  3B78 A;  1N32 I;  2X7I A;  5LMU I;  4X65 E;  2V34 A;  4JI1 I;  1A6F A;  3B8H A;  3PYF A;  4MU4 A;  4BA1 B;  5DRR A;  3WU6 A;  4JI2 I;  4U3B A;  4WUD A;  3B4T A;  4JI5 I;  3LTO A;  1Y60 A;  2GO3 A;  2Z5B B;  3U1Y A;  2UXD E;  1UEK A;  3J81 C;  4BA2 A;  5K36 A;  4DR6 E;  1NHJ A;  1FKA E;  4IZJ A;  2Z5E A;  3LNU A;  1KTV A;  3J80 C;  1N36 I;  1H74 A;  2WP8 A;  2ZIT A;  1Z0T A;  4JI6 I;  4X64 I;  4DPW A;  1Z5C A;  4NXM I;  2O3Z A;  4IFD C;  2GO4 A;  3P3C A;  1HK7 A;  1FWL A;  2CZ9 A;  2UU9 I;  4AIM A;  4DV2 E;  4GKK E;  3WU5 A;  4GQU A;  4USM A;  1B63 A;  3QT6 A;  3U1K A;  5JEA D;  1HNZ I;  4FW5 A;  4JI6 E;  1VIS A;  4DUZ E;  3L7Z B;  2PNM A;  1ZM3 A;  3PS1 A;  3OTO I;  4OO1 C;  2ZM6 I;  4LF6 E;  2UUB E;  4RPF A;  4JI4 E;  3GON A;  5EKW A;  4UT4 A;  1BKN A;  2HKJ A;  4JI8 I;  2JEB A;  2NN6 B;  1S16 A;  4OO1 E;  4DV6 I;  4GKJ I;  4DUZ I;  3PYE A;  4OO1 A;  2CGE A;  4JI3 I;  1PKP A;  5LL6 R;  1VI7 A;  3PYG A;  4MU3 A;  4B3R I;  4DV5 I;  4LF4 I;  2PNZ A;  3L7Z A;  5LMU E;  5IT9 Q;  4X66 E;  2UXB I;  1ZM9 A;  1Y4S A;  4DR5 I;  3JAM C;  4LF7 E;  3Q6M A;  2BA0 D;  2NN6 C;  3WU4 A;  1OYP A;  3LPS A;  5IWA E;  1ZXM A;  1XHK A;  2BM1 A;  2ZBK B;  5C0X B;  3Q1Q A;  3ZZT A;  4DR1 I;  1KKH A;  4DXL A;  2DEI A;  1N33 I;  1Z0W A;  3GME A;  4ISA A;  2NN6 A;  1XMQ I;  2PO0 B;  2A2C A;  4M1K A;  4JI7 I;  1UDQ A;  4LFA I;  5IWA I;  2V2V A;  2UXC I;  2BR2 A;  2BA1 D;  4IFD D;  1K47 A;  5DNL A;  4DV3 I;  1IBL I;  4DV2 I;  2Z5C B;  3PS2 A;  2PNZ B;  4IFD F;  4GKK I;  1Z0B A;  3ZM7 A;  1E3P A;  5C0X D;  5IT9 C;  2HK3 A;  2AJ4 A;  3B82 A;  2PNL A;  1IBM E;  4DR7 E;  1N34 E;  1R6M A;  1FI4 A;  4DV0 I;  5FWK A;  1B62 A;  2VES A;  5BR8 E;  4LFA E;  3M85 G;  2GS8 A;  5FLX Q;  1Y4U A;  1N36 E;  4IZK B;  4DV4 I;  3JAM Q;  1OJ4 A;  4YHH I;  3M85 D;  1Z0C A;  2ZM6 E;  2JE6 B;  1I94 E;  2UUB I;  1HNW E;  4B3T E;  2GQ0 A;  4OX9 E;  4OO1 F;  4J3D A;  2F4V E;  4JI0 I;  2BR2 B;  2C38 A;  4NBQ A;  1NZ0 A;  1FJG E;  4R1F A;  4KHP E;  4DV4 E;  2A2D A;  3HJC A;  2JT2 A;  3PRY A;  4MYT A;  4DR5 E;  4IZK A;  3CDJ A;  2UXB E;  2C37 B; 
#chains in the Genus database with same CATH homology
 4JV5 I;  1ELO A;  4AQY E;  1D6T A;  2O1W A;  4DV5 E;  1Z59 A;  1HNX E;  5L3J A;  4NXN E;  4FWD A;  4X62 I;  4FWH A;  4DV6 E;  2V2Q A;  4DR6 I;  4HY1 A;  2Z5B A;  1MU5 A;  2BM0 A;  3D4J A;  4B3S I;  5LMN I;  4DUY E;  3J81 Q;  4LFB I;  1HR0 I;  4HXZ A;  4JI7 E;  4Z7C A;  4JG4 A;  4JI5 E;  3F0N A;  4JI2 E;  3J80 Q;  1KVK A;  4FN5 A;  1PVG A;  3WU3 A;  1XNQ I;  1FWK A;  1DAR A;  4FW9 A;  5FLX C;  2HK2 A;  1J5E I;  4DU8 A;  4NXM E;  3ZZU A;  4AQY I;  3ZKB A;  4DV7 I;  2EFG A;  4JV5 E;  1XNR E;  1N0U A;  1U2R A;  2VQE E;  2R42 A;  2Q2E B;  4JI8 E;  3M6A A;  4LFC I;  1XMO I;  4DR4 I;  4DR2 E;  2F4V I;  1IBK E;  4B3T I;  1HNW I;  4DV1 I;  4LFC E;  4MYU A;  2E5L E;  4DR3 I;  3OTO E;  4HAC A;  2VQE I;  4JYA I;  4DPU A;  4DV0 E;  1HNX I;  4N3O A;  1Y6Z A;  3V2U C;  1IBM I;  4DR7 I;  4KQV A;  2UUC I;  3K85 A;  4JYA E;  4HAC B;  3PYD A;  4YY3 I;  4LF4 E;  2O1V A;  3QT8 A;  4WUB A;  4B3R E;  4K0K I;  1ZM4 A;  1FJG I;  1USU A;  2VF3 A;  4DPX A;  2HHH I;  3T1H E;  2HFU A;  1MX0 A;  4XTJ A;  1HR0 E;  2VQF I;  1RR9 A;  1ZM2 A;  5GME A;  5LMN E;  4DUY I;  2XEX A;  2Z5C A;  2HKE A;  2V8P A;  1S4E A;  2BV3 A;  3T1H I;  2HHH E;  1NHI A;  3J7A M;  2CG9 A;  1HNZ E;  4PRX A;  4Z7Y A;  4PU9 A;  4ED4 A;  4B3M E;  1XNR I;  4USK A;  4DPT A;  2LJP A;  1IBL E;  1Z5A A;  1EI1 A;  1ZXN A;  4DV3 E;  1NHH A;  4KHP I;  4IZJ D;  4IZJ B;  4DR3 E;  2V2Z A;  2NPF A;  3P06 A;  4UTG A;  1XMQ E;  2E5L I;  4HYM A;  4JI4 I;  1N33 E;  4DV1 E;  4LF9 E;  1KIJ A;  1Z0E A;  1Z0G A;  1IBK I;  1H7S A;  2O1T A;  4ZVI A;  2J7K A;  2OI2 A;  2UUA I;  1Z0V A;  3ZKD A;  4LF7 I;  2O1U A;  3K1J A;  4YY3 E;  5GMD A;  4LF5 E;  2UUC E;  4LF8 I;  3QT7 A;  4B3M I;  1Z5B A;  1H73 A;  4URL A;  3V5R A;  2UUA E;  4PRV A;  4GKJ E;  2IOQ A;  1QZR A;  1I94 I;  2UXD I;  3T1Y I;  4YHH E;  1PIE A;  2VQF E;  4OX9 I;  4LFB E;  1USV A;  4B3S E;  3T1Y E;  4DPY A;  1EA6 A;  1N34 I;  2WW4 A;  4EMD A;  2E1R A;  5A2Q Q;  4I3H A;  4DU7 A;  1H72 C;  5BR8 I;  2UU9 E;  1N32 E;  3Q6N A;  2X36 A;  3HUL A;  4P52 A;  4X64 E;  3H4L A;  4JI3 E;  1N0V C;  4LF5 I;  4P7A A;  4LF8 E;  3CWV A;  1FNM A;  1WUU A;  3J7A G;  1XNQ E;  2DEJ A;  2UXC E;  3QT5 A;  2R3V A;  5A2Q C;  4LF6 I;  4JI0 E;  2IOP A;  4DR4 E;  1XMO E;  1MG7 A;  4DR2 I;  4LF9 I;  4K0K E;  1H7U A;  4FWG A;  4DR1 E;  4JI1 E;  4X65 I;  2HFS A;  4X62 E;  3K17 A;  4NXN I;  4WUC A;  4DV7 E;  3ZZ0 A;  1J5E E;  1RRE A;  4X66 I;  3B78 A;  1N32 I;  2X7I A;  5LMU I;  4X65 E;  2V34 A;  4JI1 I;  1A6F A;  3B8H A;  3PYF A;  3WU6 A;  4JI2 I;  4WUD A;  4JI5 I;  3LTO A;  2Z5B B;  2UXD E;  1UEK A;  3J81 C;  4DR6 E;  1NHJ A;  1FKA E;  4IZJ A;  2Z5E A;  3LNU A;  1KTV A;  3J80 C;  1N36 I;  1H74 A;  2ZIT A;  1Z0T A;  4JI6 I;  4X64 I;  4DPW A;  1Z5C A;  4NXM I;  1HK7 A;  1FWL A;  2CZ9 A;  2UU9 I;  4DV2 E;  4GKK E;  3WU5 A;  4USM A;  1B63 A;  3QT6 A;  1HNZ I;  4JI6 E;  1VIS A;  4DUZ E;  2PNM A;  1ZM3 A;  3OTO I;  2ZM6 I;  4LF6 E;  2UUB E;  4RPF A;  4JI4 E;  3GON A;  4UT4 A;  1BKN A;  2HKJ A;  4JI8 I;  1S16 A;  4DV6 I;  4GKJ I;  4DUZ I;  3PYE A;  2CGE A;  4JI3 I;  1PKP A;  5LL6 R;  3PYG A;  4B3R I;  4DV5 I;  4LF4 I;  5LMU E;  5IT9 Q;  4X66 E;  2UXB I;  1ZM9 A;  1Y4S A;  4DR5 I;  3JAM C;  4LF7 E;  3Q6M A;  3WU4 A;  3LPS A;  5IWA E;  1ZXM A;  1XHK A;  2BM1 A;  2ZBK B;  3Q1Q A;  3ZZT A;  4DR1 I;  1KKH A;  4DXL A;  2DEI A;  1N33 I;  1Z0W A;  1XMQ I;  2A2C A;  4M1K A;  4JI7 I;  4LFA I;  5IWA I;  2V2V A;  2UXC I;  1K47 A;  4DV3 I;  1IBL I;  4DV2 I;  2Z5C B;  4GKK I;  1Z0B A;  3ZM7 A;  5IT9 C;  2HK3 A;  2AJ4 A;  3B82 A;  2PNL A;  1IBM E;  4DR7 E;  1N34 E;  1FI4 A;  4DV0 I;  5FWK A;  1B62 A;  5BR8 E;  4LFA E;  2GS8 A;  5FLX Q;  1Y4U A;  1N36 E;  4IZK B;  4DV4 I;  3JAM Q;  1OJ4 A;  4YHH I;  1Z0C A;  2ZM6 E;  1I94 E;  2UUB I;  1HNW E;  4B3T E;  2GQ0 A;  4OX9 E;  2F4V E;  4JI0 I;  1NZ0 A;  1FJG E;  4R1F A;  4KHP E;  4DV4 E;  2A2D A;  3HJC A;  3PRY A;  4MYT A;  4DR5 E;  4IZK A;  2UXB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...