4OX9I

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9I00
1XNRE 5L3JA 2VQEI 1NHIA 1MU5A 4DV1I 4DV3I 2V2QA 1HNWI 4LFAE 2A2DA 4HXZA 2ZM6I 4JV5I 4I3HA 4DR2I 2V2ZA 5BR8I 4DV5I 1H74A 4DUYI 4HACA 4DR3E 2UUBI 4X64I 1Z0EA 1FKAE 1H7SA 3QT8A 3K17A 4GKJI 4NXMI 2CZ9A 5LMUI 4LF8E 2HKJA 2HKEA 2ZBKB 1XMOI 4DR4E 1ZM9A 1I94I 4DXLA 4JI0E 4DV6E 2NPFA 4P52A 4JI5E 4FWGA 4JI1I 2R3VA 1ZM4A 4DV0E 4KHPE 2HHHE 4HACB 2V8PA 2UUCI 4AQYE 1XNRI 1B63A 1N36E 4LFAI 3J7AG 3T1YE 4B3SE 3V5RA 1FI4A 1HNZE 1VISA 4OX9I 1NZ0A 4DPXA 5A2QQ 4DPUA 5GMDA 4LF9E 4MYTA 4DR3I 2ZITA 4EMDA 4JG4A 2HFUA 1MG7A 1N33I 1IBKE 3M6AA 4R1FA 1XMQE 4DR4I 2R42A 2UU9E 4FWDA 4X66E 4JI0I 4DV6I 1Z59A 4JI5I 1XHKA 4JI8E 4ED4A 4DV0I 4KHPI 1N0VC 3PYFA 3ZZUA 4JI4E 4UTGA 1UEKA 2J7KA 3H4LA 2UXDE 1KKHA 1Z0CA 1NHJA 3T1YI 1FJGI 4NXNE 4PU9A 4B3SI 4DR6E 2UXCE 1HNZI 1ZXNA 4JI6E 4JYAE 1XNQE 2VQFE 4RPFA 4B3TE 1HNXE 4FN5A 4LF4E 2BV3A 3B82A 2UXBE 1Z5AA 3J80C 4LF7E 1RREA 3B78A 1XMQI 4FW9A 5LL6R 1BKNA 4X66I 1H7UA 1D6TA 1KVKA 2HK2A 4DR5E 4K0KE 1IBME 3JAMC 4LFBI 4KQVA 4DV2I 4X62E 3D4JA 4XTJA 4UT4A 4JI4I 4B3ME 2UXDI 2E1RA 1Z0VA 3J80Q 4NXNI 4DR6I 1Z0TA 2HK3A 1ELOA 4JI6I 4JYAI 1XNQI 3OTOE 2VQFI 2DEIA 3ZZTA 4B3TI 1HNXI 4DU8A 3ZKBA 4LF4I 2BM1A 1Z5BA 2VQEE 4ZVIA 4DV3E 2AJ4A 4LF7I 4M1KA 3J81C 1KIJA 1RR9A 4LF8I 1ZXMA 5FLXC 3WU6A 1N0UA 1QZRA 4DR5I 4DR2E 4K0KI 4B3RE 1IBMI 3J7AM 3PYEA 3WU5A 4DR7E 2HHHI 1K47A 1HR0E 1PKPA 4AQYI 4USMA 1N36I 1H72C 2V2VA 4DUZE 1N34E 3HULA 1Z0GA 5LMNE 1I94E 1EA6A 3J81Q 4DR1E 2F4VE 1PIEA 3OTOI 5IT9C 4WUCA 5FLXQ 4LF5E 1Z5CA 3QT7A 3V2UC 4JI1E 4X65E 1ZM2A 3Q1QA 1PVGA 4LF9I 1J5EE 4YHHE 3K1JA 1FWKA 4HY1A 4DV4E 3F0NA 3QT5A 1IBKI 1IBLE 4OX9E 4Z7CA 2V34A 3CWVA 2UU9I 3LNUA 1H73A 2WW4A 3QT6A 2E5LE 4DV7E 2UUAE 4B3RI 4MYUA 1OJ4A 1Z0WA 5GMEA 5IT9Q 4LF6E 3WU3A 4JI8I 5IWAE 4YY3E 4DR7I 1FWLA 1WUUA 4PRXA 4JI3E 1B62A 1HR0I 4USKA 1Z0BA 4Z7YA 1N33E 4DPTA 2A2CA 4DUZI 4URLA 1N34I 5A2QC 5LMNI 2VF3A 4DPYA 4LFCE 1FNMA 4WUBA 2UXCI 4DR1I 2F4VI 4HYMA 1S16A 3GONA 1N32E 1MX0A 3T1HE 4LF5I 4X65I 1U2RA 4GKKE 4JI7E 1J5EI 3JAMQ 4YHHI 4JI2E 3ZM7A 2Q2EB 4P7AA 4DU7A 2UXBI 1KTVA 3LPSA 4DV1E 1ZM3A 4DV4I 1HNWE 3B8HA 1FJGE 3LTOA 1DARA 1IBLI 2OI2A 2EFGA 2X36A 3ZZ0A 2ZM6E 2E5LI 4DV7I 2UUAI 3WU4A 4JV5E 5BR8E 4DV5E 2X7IA 4LF6I 3PYDA 4DUYE 2GS8A 5IWAI 4YY3I 2UUBE 4JI3I 4X64E 2BM0A 4X62I 1A6FA 4FWHA 1EI1A 2HFSA 4GKJE 1NHHA 4NXME 4B3MI 3ZKDA 5LMUE 3PYGA 4LFCI 1XMOE 4PRVA 4WUDA 1S4EA 1N32I 3T1HI 4LFBE 4DV2E 4DPWA 4GKKI 2DEJA 2LJPA 4JI7I 2XEXA 2UUCE 4JI2I
chains in the Genus database with same CATH superfamily
2BA0D 1XNRE 5L3JA 4U3DA 2CG9A 2VQEI 4LCGA 1NHIA 1MU5A 4DV1I 4DV3I 2V2QA 4IFDC 1HNWI 4LFAE 2A2DA 3UHMA 4QNKA 3NZKA 5K36B 2C39A 5C0XB 4HXZA 2ZM6I 2PO0A 4JV5I 4I3HA 4DR2I 2V2ZA 5BR8I 4DV5I 1H74A 4DUYI 4HACA 4DR3E 2UUBI 4X64I 1Z0EA 4MU0A 4LCFA 1FKAE 1H7SA 5K36C 5DRPA 5C0XC 3QT8A 3K17A 4GKJI 4NXMI 2CZ9A 5LMUI 1Y6ZA 4LF8E 2HKJA 2HKEA 2ZBKB 1XMOI 4DR4E 1ZM9A 2C38B 4DXLA 1I94I 4JI0E 4FW4A 4DV6E 2O3ZA 4QNJA 2NPFA 4P52A 4JI5E 4FWGA 2PO0B 4JI1I 5EL9A 2PO2B 2R3VA 1ZM4A 4DV0E 4KHPE 2HHHE 4HACB 2V8PA 4OO1A 2UUCI 2BA1D 4OO1D 4AQYE 1XNRI 1B63A 1N36E 5JEAB 3M85G 4LFAI 3J7AG 3T1YE 4B3SE 3V5RA 1FI4A 4LCHA 1HNZE 1VISA 3P3CA 4OX9I 1NZ0A 2Z5EA 4DPXA 5A2QQ 4DPUA 5GMDA 4OO1E 1E3PA 3P76A 5JEAC 4LF9E 4MYTA 3H1CA 2NN6D 4DR3I 2ZITA 4EMDA 3CDIA 4JG4A 2Z5BB 4LPFA 2HFUA 1Y60A 2AE8A 2Z5CA 4OO1F 1MG7A 4IFDD 1N33I 2BR2B 1IBKE 3M6AA 4R1FA 1XMQE 4DR4I 1Y4UA 2R42A 2UU9E 4FWDA 4X66E 4JI0I 4ISAA 4DV6I 1Z59A 1YHCA 2WP8A 3HJCA 4JI5I 1XHKA 4JI8E 2C37A 3PS1A 4AM3A 1R6MA 2JE6A 4ED4A 4DV0I 4KHPI 4IFDE 1N0VC 3PYFA 3ZZUA 4JI4E 4UTGA 1UEKA 4OZEA 2J7KA 3H4LA 5C0XD 4IS9A 1KKHA 2UXDE 1Z0CA 2VESA 1NHJA 3T1YI 1FJGI 2Z5CB 4NXNE 4PU9A 4B3SI 4DR6E 2UXCE 1HNZI 1ZXNA 4JI6E 4JYAE 2IOPA 1XNQE 1XXEA 2VQFE 4RPFA 1UDOA 1HNXE 4B3TE 4FN5A 4LF4E 2BV3A 3B82A 2GO3A 2UXBE 3L7ZA 1Z5AA 5DROA 3J80C 4LF7E 1RREA 2JEAA 3B78A 1XMQI 4FW9A 5LL6R 3P3GA 1BKNA 5EKWA 4X66I 1H7UA 1D6TA 1KVKA 2HK2A 4MDTA 3PS3A 4DR5E 2O1TA 4K0KE 2C39B 2BA0G 1IBME 5ELWA 3JAMC 4BA2A 4LFBI 4KQVA 4DV2I 2WNRA 4X62E 3D4JA 4XTJA 4UT4A 4JI4I 4MQYA 4B3ME 2UXDI 3L7ZB 2E1RA 1Z0VA 3J80Q 4NXNI 4DR6I 1Z0TA 1YH8A 1ELOA 2HK3A 4JI6I 4JYAI 1XNQI 4MU3A 3OTOE 2IERA 4MU4A 2VQFI 2DEIA 4IZKA 5FWKA 3ZZTA 4B3TI 1HNXI 4DU8A 3ZKBA 4LF4I 2NN6A 3GLLA 5DNXA 2BM1A 4IZJA 1P42A 2J65A 1Z5BA 2WNRB 3GMEA 4OKGA 1UDSA 2VQEE 4IZJD 4ZVIA 3M7NG 4DV3E 2AJ4A 4LF7I 4M1KA 4OO1B 4IFDA 3J81C 1KIJA 1RR9A 4LF8I 1ZXMA 2JEBA 3Q6MA 3WU6A 5FLXC 1N0UA 1QZRA 4DR5I 4DR2E 4K0KI 4BA1A 2NN6E 2PO1A 2BA1G 4B3RE 1IBMI 3J7AM 1USUA 4FW5A 3PYEA 4NBQA 4OO1C 3WU5A 3PS2A 4DR7E 5DRQA 2HHHI 1K47A 2O1VA 1HR0E 2NN6B 1PKPA 4AQYI 2NN6F 4USMA 1N36I 5K36A 1UDQA 5C0XA 5K36D 1H72C 2V2VA 4DUZE 1N34E 3HULA 1Z0GA 5LMNE 1I94E 1EA6A 4IFDB 3J81Q 4IFDF 3Q6NA 4DR1E 2IESA 1PIEA 2F4VE 4GQUA 3OTOI 5IT9C 4WUCA 5FLXQ 4LF5E 2GO4A 1Z5CA 3QT7A 3V2UC 3KRNA 4JI1E 4X65E 4BA1B 2PO1B 1ZM2A 3Q1QA 3P3EA 1PVGA 5K36E 4LF9I 5C0XE 2WP8B 1J5EE 1UDNA 4YHHE 3K1JA 2C37B 2JE6B 4J3DA 2C38A 1FWKA 4HY1A 4DV4E 4AIMA 3F0NA 3QT5A 1IBKI 1Y4SA 1IBLE 4OX9E 5K36F 5C0XF 4Z7CA 2V34A 1Y5YA 2JT2A 3CWVA 2UU9I 3LNUA 3M85D 2PO2A 1H73A 2WW4A 3QT6A 4AIDA 2E5LE 4DV7E 2UUAE 4B3RI 4MYUA 1OJ4A 1Z0WA 5GMEA 5IT9Q 4LF6E 2GQ0A 3WU3A 4JI8I 5JEAA 5IWAE 4YY3E 4U3BA 4DR7I 1FWLA 1WUUA 4PRXA 5JEAD 4JI3E 1B62A 1HR0I 4USKA 1Z0BA 3U1YA 4Z7YA 1N33E 4DPTA 2A2CA 5DRRA 1R6LA 4DUZI 4URLA 1N34I 2F1DA 2IOQA 3M7ND 5A2QC 5LMNI 5DNLA 2VF3A 4DPYA 4LFCE 4MU1A 1FNMA 4WUBA 2UXCI 4DR1I 2F4VI 2JEAB 2CGEA 4HYMA 1S16A 3GONA 1N32E 5JEAE 1OYRA 1MX0A 3T1HE 4LF5I 1OYSA 3CDJA 4X65I 1U2RA 4GKKE 4JI7E 2Z5BA 1J5EI 2BR2A 3JAMQ 4YHHI 4BA2B 4JI2E 3ZM7A 2Q2EB 1OYPA 4P7AA 3GCMA 1KTVA 3LPSA 2PNMA 4DU7A 5JEAF 2UXBI 4DV1E 1ZM3A 4DV4I 1HNWE 3B8HA 1FJGE 3LTOA 4FW6A 4LOMA 1DARA 3K85A 1IBLI 2OI2A 4FW7A 2EFGA 2X36A 2O1WA 1RHYA 3P06A 3ZZ0A 2ZM6E 2E5LI 4N3OA 4DV7I 3WU4A 2UUAI 4JV5E 5BR8E 4DV5E 2PNZA 2X7IA 4LF6I 3PYDA 4DUYE 2GS8A 1USVA 5IWAI 4YY3I 2UUBE 4JI3I 4X64E 2BM0A 4FW3A 4X62I 1A6FA 4FWHA 1EI1A 4IZKB 3HKMA 3DD6A 2HFSA 4GKJE 4IZJB 1NHHA 4NXME 4B3MI 3ZKDA 5LMUE 3PYGA 3PRYA 2O1UA 4LFCI 1XMOE 4PRVA 3B4TA 4WUDA 1E3HA 2PNLA 1S4EA 1HK7A 1N32I 3T1HI 1VI7A 2JEBB 4LFBE 4DV2E 4DPWA 4GKKI 2DEJA 2LJPA 2NN6C 4JI7I 2PNZB 2XEXA 3U1KA 2UUCE 2CVEA 4JI2I
chains in the Genus database with same CATH topology
1XNRE 5L3JA 2CG9A 2VQEI 1NHIA 1MU5A 4DV1I 4DV3I 2V2QA 1HNWI 4LFAE 2A2DA 4HXZA 2ZM6I 4JV5I 4I3HA 4DR2I 2V2ZA 5BR8I 4DV5I 1H74A 4DUYI 4HACA 4DR3E 2UUBI 4X64I 1Z0EA 1FKAE 1H7SA 3QT8A 3K17A 4GKJI 4NXMI 2CZ9A 5LMUI 1Y6ZA 4LF8E 2HKJA 2HKEA 2ZBKB 1XMOI 4DR4E 1ZM9A 1I94I 4DXLA 4JI0E 4DV6E 2NPFA 4P52A 4JI5E 4FWGA 4JI1I 2R3VA 1ZM4A 4DV0E 4KHPE 2HHHE 4HACB 2V8PA 2UUCI 4AQYE 1XNRI 1B63A 1N36E 4LFAI 3J7AG 3T1YE 4B3SE 3V5RA 1FI4A 1HNZE 1VISA 4OX9I 1NZ0A 2Z5EA 4DPXA 5A2QQ 4DPUA 5GMDA 4LF9E 4MYTA 4DR3I 2ZITA 4EMDA 4JG4A 2Z5BB 2HFUA 2Z5CA 1MG7A 1N33I 1IBKE 3M6AA 4R1FA 1XMQE 4DR4I 1Y4UA 2R42A 2UU9E 4FWDA 4X66E 4JI0I 4DV6I 1Z59A 3HJCA 4JI5I 1XHKA 4JI8E 4ED4A 4DV0I 4KHPI 1N0VC 3PYFA 3ZZUA 4JI4E 4UTGA 1UEKA 2J7KA 3H4LA 2UXDE 1KKHA 1Z0CA 1NHJA 3T1YI 1FJGI 2Z5CB 4NXNE 4PU9A 4B3SI 4DR6E 2UXCE 1HNZI 1ZXNA 4JI6E 4JYAE 2IOPA 1XNQE 2VQFE 4RPFA 4B3TE 1HNXE 4FN5A 4LF4E 2BV3A 3B82A 2UXBE 1Z5AA 3J80C 4LF7E 1RREA 3B78A 1XMQI 4FW9A 5LL6R 1BKNA 4X66I 1H7UA 1D6TA 1KVKA 2HK2A 4DR5E 2O1TA 4K0KE 1IBME 3JAMC 4LFBI 4KQVA 4DV2I 4X62E 3D4JA 4XTJA 4UT4A 4JI4I 4B3ME 2UXDI 2E1RA 1Z0VA 3J80Q 4NXNI 4DR6I 1Z0TA 2HK3A 1ELOA 4JI6I 4JYAI 1XNQI 3OTOE 2VQFI 2DEIA 4IZKA 5FWKA 3ZZTA 4B3TI 1HNXI 4DU8A 3ZKBA 4LF4I 2BM1A 4IZJA 1Z5BA 2VQEE 4IZJD 4ZVIA 4DV3E 2AJ4A 4LF7I 4M1KA 3J81C 1KIJA 1RR9A 4LF8I 1ZXMA 3Q6MA 3WU6A 5FLXC 1N0UA 1QZRA 4DR5I 4DR2E 4K0KI 4B3RE 1IBMI 3J7AM 1USUA 3PYEA 3WU5A 4DR7E 2HHHI 1K47A 2O1VA 1HR0E 1PKPA 4AQYI 4USMA 1N36I 1H72C 2V2VA 4DUZE 1N34E 3HULA 1Z0GA 5LMNE 1I94E 1EA6A 3J81Q 3Q6NA 4DR1E 2F4VE 1PIEA 3OTOI 5IT9C 4WUCA 5FLXQ 4LF5E 1Z5CA 3QT7A 3V2UC 4JI1E 4X65E 1ZM2A 3Q1QA 1PVGA 4LF9I 1J5EE 4YHHE 3K1JA 1FWKA 4HY1A 4DV4E 3F0NA 3QT5A 1IBKI 1Y4SA 1IBLE 4OX9E 4Z7CA 2V34A 3CWVA 2UU9I 3LNUA 1H73A 2WW4A 3QT6A 2E5LE 4DV7E 2UUAE 4B3RI 4MYUA 1OJ4A 1Z0WA 5GMEA 5IT9Q 4LF6E 2GQ0A 3WU3A 4JI8I 5IWAE 4YY3E 4DR7I 1FWLA 1WUUA 4PRXA 4JI3E 1B62A 1HR0I 4USKA 1Z0BA 4Z7YA 1N33E 4DPTA 2A2CA 4DUZI 4URLA 1N34I 2IOQA 5A2QC 5LMNI 2VF3A 4DPYA 4LFCE 1FNMA 4WUBA 2UXCI 4DR1I 2F4VI 2CGEA 4HYMA 1S16A 3GONA 1N32E 1MX0A 3T1HE 4LF5I 4X65I 1U2RA 4GKKE 4JI7E 2Z5BA 1J5EI 3JAMQ 4YHHI 4JI2E 3ZM7A 2Q2EB 4P7AA 4DU7A 2UXBI 1KTVA 3LPSA 2PNMA 4DV1E 1ZM3A 4DV4I 1HNWE 3B8HA 1FJGE 3LTOA 1DARA 3K85A 1IBLI 2OI2A 2EFGA 2X36A 2O1WA 3P06A 3ZZ0A 2ZM6E 2E5LI 4N3OA 4DV7I 3WU4A 2UUAI 4JV5E 5BR8E 4DV5E 2X7IA 4LF6I 3PYDA 4DUYE 2GS8A 1USVA 5IWAI 4YY3I 2UUBE 4JI3I 4X64E 2BM0A 4X62I 1A6FA 4FWHA 1EI1A 4IZKB 2HFSA 4GKJE 4IZJB 1NHHA 4NXME 4B3MI 3ZKDA 5LMUE 3PYGA 3PRYA 2O1UA 4LFCI 1XMOE 4PRVA 4WUDA 2PNLA 1S4EA 1HK7A 1N32I 3T1HI 4LFBE 4DV2E 4DPWA 4GKKI 2DEJA 2LJPA 4JI7I 2XEXA 2UUCE 4JI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR E;  5L3J A;  2VQE I;  1NHI A;  1MU5 A;  4DV1 I;  4DV3 I;  2V2Q A;  1HNW I;  4LFA E;  2A2D A;  4HXZ A;  2ZM6 I;  4JV5 I;  4I3H A;  4DR2 I;  2V2Z A;  5BR8 I;  4DV5 I;  1H74 A;  4DUY I;  4HAC A;  4DR3 E;  2UUB I;  4X64 I;  1Z0E A;  1FKA E;  1H7S A;  3QT8 A;  3K17 A;  4GKJ I;  4NXM I;  2CZ9 A;  5LMU I;  4LF8 E;  2HKJ A;  2HKE A;  2ZBK B;  1XMO I;  4DR4 E;  1ZM9 A;  1I94 I;  4DXL A;  4JI0 E;  4DV6 E;  2NPF A;  4P52 A;  4JI5 E;  4FWG A;  4JI1 I;  2R3V A;  1ZM4 A;  4DV0 E;  4KHP E;  2HHH E;  4HAC B;  2V8P A;  2UUC I;  4AQY E;  1XNR I;  1B63 A;  1N36 E;  4LFA I;  3J7A G;  3T1Y E;  4B3S E;  3V5R A;  1FI4 A;  1HNZ E;  1VIS A;  4OX9 I;  1NZ0 A;  4DPX A;  5A2Q Q;  4DPU A;  5GMD A;  4LF9 E;  4MYT A;  4DR3 I;  2ZIT A;  4EMD A;  4JG4 A;  2HFU A;  1MG7 A;  1N33 I;  1IBK E;  3M6A A;  4R1F A;  1XMQ E;  4DR4 I;  2R42 A;  2UU9 E;  4FWD A;  4X66 E;  4JI0 I;  4DV6 I;  1Z59 A;  4JI5 I;  1XHK A;  4JI8 E;  4ED4 A;  4DV0 I;  4KHP I;  1N0V C;  3PYF A;  3ZZU A;  4JI4 E;  4UTG A;  1UEK A;  2J7K A;  3H4L A;  2UXD E;  1KKH A;  1Z0C A;  1NHJ A;  3T1Y I;  1FJG I;  4NXN E;  4PU9 A;  4B3S I;  4DR6 E;  2UXC E;  1HNZ I;  1ZXN A;  4JI6 E;  4JYA E;  1XNQ E;  2VQF E;  4RPF A;  4B3T E;  1HNX E;  4FN5 A;  4LF4 E;  2BV3 A;  3B82 A;  2UXB E;  1Z5A A;  3J80 C;  4LF7 E;  1RRE A;  3B78 A;  1XMQ I;  4FW9 A;  5LL6 R;  1BKN A;  4X66 I;  1H7U A;  1D6T A;  1KVK A;  2HK2 A;  4DR5 E;  4K0K E;  1IBM E;  3JAM C;  4LFB I;  4KQV A;  4DV2 I;  4X62 E;  3D4J A;  4XTJ A;  4UT4 A;  4JI4 I;  4B3M E;  2UXD I;  2E1R A;  1Z0V A;  3J80 Q;  4NXN I;  4DR6 I;  1Z0T A;  2HK3 A;  1ELO A;  4JI6 I;  4JYA I;  1XNQ I;  3OTO E;  2VQF I;  2DEI A;  3ZZT A;  4B3T I;  1HNX I;  4DU8 A;  3ZKB A;  4LF4 I;  2BM1 A;  1Z5B A;  2VQE E;  4ZVI A;  4DV3 E;  2AJ4 A;  4LF7 I;  4M1K A;  3J81 C;  1KIJ A;  1RR9 A;  4LF8 I;  1ZXM A;  5FLX C;  3WU6 A;  1N0U A;  1QZR A;  4DR5 I;  4DR2 E;  4K0K I;  4B3R E;  1IBM I;  3J7A M;  3PYE A;  3WU5 A;  4DR7 E;  2HHH I;  1K47 A;  1HR0 E;  1PKP A;  4AQY I;  4USM A;  1N36 I;  1H72 C;  2V2V A;  4DUZ E;  1N34 E;  3HUL A;  1Z0G A;  5LMN E;  1I94 E;  1EA6 A;  3J81 Q;  4DR1 E;  2F4V E;  1PIE A;  3OTO I;  5IT9 C;  4WUC A;  5FLX Q;  4LF5 E;  1Z5C A;  3QT7 A;  3V2U C;  4JI1 E;  4X65 E;  1ZM2 A;  3Q1Q A;  1PVG A;  4LF9 I;  1J5E E;  4YHH E;  3K1J A;  1FWK A;  4HY1 A;  4DV4 E;  3F0N A;  3QT5 A;  1IBK I;  1IBL E;  4OX9 E;  4Z7C A;  2V34 A;  3CWV A;  2UU9 I;  3LNU A;  1H73 A;  2WW4 A;  3QT6 A;  2E5L E;  4DV7 E;  2UUA E;  4B3R I;  4MYU A;  1OJ4 A;  1Z0W A;  5GME A;  5IT9 Q;  4LF6 E;  3WU3 A;  4JI8 I;  5IWA E;  4YY3 E;  4DR7 I;  1FWL A;  1WUU A;  4PRX A;  4JI3 E;  1B62 A;  1HR0 I;  4USK A;  1Z0B A;  4Z7Y A;  1N33 E;  4DPT A;  2A2C A;  4DUZ I;  4URL A;  1N34 I;  5A2Q C;  5LMN I;  2VF3 A;  4DPY A;  4LFC E;  1FNM A;  4WUB A;  2UXC I;  4DR1 I;  2F4V I;  4HYM A;  1S16 A;  3GON A;  1N32 E;  1MX0 A;  3T1H E;  4LF5 I;  4X65 I;  1U2R A;  4GKK E;  4JI7 E;  1J5E I;  3JAM Q;  4YHH I;  4JI2 E;  3ZM7 A;  2Q2E B;  4P7A A;  4DU7 A;  2UXB I;  1KTV A;  3LPS A;  4DV1 E;  1ZM3 A;  4DV4 I;  1HNW E;  3B8H A;  1FJG E;  3LTO A;  1DAR A;  1IBL I;  2OI2 A;  2EFG A;  2X36 A;  3ZZ0 A;  2ZM6 E;  2E5L I;  4DV7 I;  2UUA I;  3WU4 A;  4JV5 E;  5BR8 E;  4DV5 E;  2X7I A;  4LF6 I;  3PYD A;  4DUY E;  2GS8 A;  5IWA I;  4YY3 I;  2UUB E;  4JI3 I;  4X64 E;  2BM0 A;  4X62 I;  1A6F A;  4FWH A;  1EI1 A;  2HFS A;  4GKJ E;  1NHH A;  4NXM E;  4B3M I;  3ZKD A;  5LMU E;  3PYG A;  4LFC I;  1XMO E;  4PRV A;  4WUD A;  1S4E A;  1N32 I;  3T1H I;  4LFB E;  4DV2 E;  4DPW A;  4GKK I;  2DEJ A;  2LJP A;  4JI7 I;  2XEX A;  2UUC E;  4JI2 I; 
#chains in the Genus database with same CATH topology
 2BA0 D;  1XNR E;  5L3J A;  4U3D A;  2CG9 A;  2VQE I;  4LCG A;  1NHI A;  1MU5 A;  4DV1 I;  4DV3 I;  2V2Q A;  4IFD C;  1HNW I;  4LFA E;  2A2D A;  3UHM A;  4QNK A;  3NZK A;  5K36 B;  2C39 A;  5C0X B;  4HXZ A;  2ZM6 I;  2PO0 A;  4JV5 I;  4I3H A;  4DR2 I;  2V2Z A;  5BR8 I;  4DV5 I;  1H74 A;  4DUY I;  4HAC A;  4DR3 E;  2UUB I;  4X64 I;  1Z0E A;  4MU0 A;  4LCF A;  1FKA E;  1H7S A;  5K36 C;  5DRP A;  5C0X C;  3QT8 A;  3K17 A;  4GKJ I;  4NXM I;  2CZ9 A;  5LMU I;  1Y6Z A;  4LF8 E;  2HKJ A;  2HKE A;  2ZBK B;  1XMO I;  4DR4 E;  1ZM9 A;  2C38 B;  4DXL A;  1I94 I;  4JI0 E;  4FW4 A;  4DV6 E;  2O3Z A;  4QNJ A;  2NPF A;  4P52 A;  4JI5 E;  4FWG A;  2PO0 B;  4JI1 I;  5EL9 A;  2PO2 B;  2R3V A;  1ZM4 A;  4DV0 E;  4KHP E;  2HHH E;  4HAC B;  2V8P A;  4OO1 A;  2UUC I;  2BA1 D;  4OO1 D;  4AQY E;  1XNR I;  1B63 A;  1N36 E;  5JEA B;  3M85 G;  4LFA I;  3J7A G;  3T1Y E;  4B3S E;  3V5R A;  1FI4 A;  4LCH A;  1HNZ E;  1VIS A;  3P3C A;  4OX9 I;  1NZ0 A;  2Z5E A;  4DPX A;  5A2Q Q;  4DPU A;  5GMD A;  4OO1 E;  1E3P A;  3P76 A;  5JEA C;  4LF9 E;  4MYT A;  3H1C A;  2NN6 D;  4DR3 I;  2ZIT A;  4EMD A;  3CDI A;  4JG4 A;  2Z5B B;  4LPF A;  2HFU A;  1Y60 A;  2AE8 A;  2Z5C A;  4OO1 F;  1MG7 A;  4IFD D;  1N33 I;  2BR2 B;  1IBK E;  3M6A A;  4R1F A;  1XMQ E;  4DR4 I;  1Y4U A;  2R42 A;  2UU9 E;  4FWD A;  4X66 E;  4JI0 I;  4ISA A;  4DV6 I;  1Z59 A;  1YHC A;  2WP8 A;  3HJC A;  4JI5 I;  1XHK A;  4JI8 E;  2C37 A;  3PS1 A;  4AM3 A;  1R6M A;  2JE6 A;  4ED4 A;  4DV0 I;  4KHP I;  4IFD E;  1N0V C;  3PYF A;  3ZZU A;  4JI4 E;  4UTG A;  1UEK A;  4OZE A;  2J7K A;  3H4L A;  5C0X D;  4IS9 A;  1KKH A;  2UXD E;  1Z0C A;  2VES A;  1NHJ A;  3T1Y I;  1FJG I;  2Z5C B;  4NXN E;  4PU9 A;  4B3S I;  4DR6 E;  2UXC E;  1HNZ I;  1ZXN A;  4JI6 E;  4JYA E;  2IOP A;  1XNQ E;  1XXE A;  2VQF E;  4RPF A;  1UDO A;  1HNX E;  4B3T E;  4FN5 A;  4LF4 E;  2BV3 A;  3B82 A;  2GO3 A;  2UXB E;  3L7Z A;  1Z5A A;  5DRO A;  3J80 C;  4LF7 E;  1RRE A;  2JEA A;  3B78 A;  1XMQ I;  4FW9 A;  5LL6 R;  3P3G A;  1BKN A;  5EKW A;  4X66 I;  1H7U A;  1D6T A;  1KVK A;  2HK2 A;  4MDT A;  3PS3 A;  4DR5 E;  2O1T A;  4K0K E;  2C39 B;  2BA0 G;  1IBM E;  5ELW A;  3JAM C;  4BA2 A;  4LFB I;  4KQV A;  4DV2 I;  2WNR A;  4X62 E;  3D4J A;  4XTJ A;  4UT4 A;  4JI4 I;  4MQY A;  4B3M E;  2UXD I;  3L7Z B;  2E1R A;  1Z0V A;  3J80 Q;  4NXN I;  4DR6 I;  1Z0T A;  1YH8 A;  1ELO A;  2HK3 A;  4JI6 I;  4JYA I;  1XNQ I;  4MU3 A;  3OTO E;  2IER A;  4MU4 A;  2VQF I;  2DEI A;  4IZK A;  5FWK A;  3ZZT A;  4B3T I;  1HNX I;  4DU8 A;  3ZKB A;  4LF4 I;  2NN6 A;  3GLL A;  5DNX A;  2BM1 A;  4IZJ A;  1P42 A;  2J65 A;  1Z5B A;  2WNR B;  3GME A;  4OKG A;  1UDS A;  2VQE E;  4IZJ D;  4ZVI A;  3M7N G;  4DV3 E;  2AJ4 A;  4LF7 I;  4M1K A;  4OO1 B;  4IFD A;  3J81 C;  1KIJ A;  1RR9 A;  4LF8 I;  1ZXM A;  2JEB A;  3Q6M A;  3WU6 A;  5FLX C;  1N0U A;  1QZR A;  4DR5 I;  4DR2 E;  4K0K I;  4BA1 A;  2NN6 E;  2PO1 A;  2BA1 G;  4B3R E;  1IBM I;  3J7A M;  1USU A;  4FW5 A;  3PYE A;  4NBQ A;  4OO1 C;  3WU5 A;  3PS2 A;  4DR7 E;  5DRQ A;  2HHH I;  1K47 A;  2O1V A;  1HR0 E;  2NN6 B;  1PKP A;  4AQY I;  2NN6 F;  4USM A;  1N36 I;  5K36 A;  1UDQ A;  5C0X A;  5K36 D;  1H72 C;  2V2V A;  4DUZ E;  1N34 E;  3HUL A;  1Z0G A;  5LMN E;  1I94 E;  1EA6 A;  4IFD B;  3J81 Q;  4IFD F;  3Q6N A;  4DR1 E;  2IES A;  1PIE A;  2F4V E;  4GQU A;  3OTO I;  5IT9 C;  4WUC A;  5FLX Q;  4LF5 E;  2GO4 A;  1Z5C A;  3QT7 A;  3V2U C;  3KRN A;  4JI1 E;  4X65 E;  4BA1 B;  2PO1 B;  1ZM2 A;  3Q1Q A;  3P3E A;  1PVG A;  5K36 E;  4LF9 I;  5C0X E;  2WP8 B;  1J5E E;  1UDN A;  4YHH E;  3K1J A;  2C37 B;  2JE6 B;  4J3D A;  2C38 A;  1FWK A;  4HY1 A;  4DV4 E;  4AIM A;  3F0N A;  3QT5 A;  1IBK I;  1Y4S A;  1IBL E;  4OX9 E;  5K36 F;  5C0X F;  4Z7C A;  2V34 A;  1Y5Y A;  2JT2 A;  3CWV A;  2UU9 I;  3LNU A;  3M85 D;  2PO2 A;  1H73 A;  2WW4 A;  3QT6 A;  4AID A;  2E5L E;  4DV7 E;  2UUA E;  4B3R I;  4MYU A;  1OJ4 A;  1Z0W A;  5GME A;  5IT9 Q;  4LF6 E;  2GQ0 A;  3WU3 A;  4JI8 I;  5JEA A;  5IWA E;  4YY3 E;  4U3B A;  4DR7 I;  1FWL A;  1WUU A;  4PRX A;  5JEA D;  4JI3 E;  1B62 A;  1HR0 I;  4USK A;  1Z0B A;  3U1Y A;  4Z7Y A;  1N33 E;  4DPT A;  2A2C A;  5DRR A;  1R6L A;  4DUZ I;  4URL A;  1N34 I;  2F1D A;  2IOQ A;  3M7N D;  5A2Q C;  5LMN I;  5DNL A;  2VF3 A;  4DPY A;  4LFC E;  4MU1 A;  1FNM A;  4WUB A;  2UXC I;  4DR1 I;  2F4V I;  2JEA B;  2CGE A;  4HYM A;  1S16 A;  3GON A;  1N32 E;  5JEA E;  1OYR A;  1MX0 A;  3T1H E;  4LF5 I;  1OYS A;  3CDJ A;  4X65 I;  1U2R A;  4GKK E;  4JI7 E;  2Z5B A;  1J5E I;  2BR2 A;  3JAM Q;  4YHH I;  4BA2 B;  4JI2 E;  3ZM7 A;  2Q2E B;  1OYP A;  4P7A A;  3GCM A;  1KTV A;  3LPS A;  2PNM A;  4DU7 A;  5JEA F;  2UXB I;  4DV1 E;  1ZM3 A;  4DV4 I;  1HNW E;  3B8H A;  1FJG E;  3LTO A;  4FW6 A;  4LOM A;  1DAR A;  3K85 A;  1IBL I;  2OI2 A;  4FW7 A;  2EFG A;  2X36 A;  2O1W A;  1RHY A;  3P06 A;  3ZZ0 A;  2ZM6 E;  2E5L I;  4N3O A;  4DV7 I;  3WU4 A;  2UUA I;  4JV5 E;  5BR8 E;  4DV5 E;  2PNZ A;  2X7I A;  4LF6 I;  3PYD A;  4DUY E;  2GS8 A;  1USV A;  5IWA I;  4YY3 I;  2UUB E;  4JI3 I;  4X64 E;  2BM0 A;  4FW3 A;  4X62 I;  1A6F A;  4FWH A;  1EI1 A;  4IZK B;  3HKM A;  3DD6 A;  2HFS A;  4GKJ E;  4IZJ B;  1NHH A;  4NXM E;  4B3M I;  3ZKD A;  5LMU E;  3PYG A;  3PRY A;  2O1U A;  4LFC I;  1XMO E;  4PRV A;  3B4T A;  4WUD A;  1E3H A;  2PNL A;  1S4E A;  1HK7 A;  1N32 I;  3T1H I;  1VI7 A;  2JEB B;  4LFB E;  4DV2 E;  4DPW A;  4GKK I;  2DEJ A;  2LJP A;  2NN6 C;  4JI7 I;  2PNZ B;  2XEX A;  3U1K A;  2UUC E;  2CVE A;  4JI2 I; 
#chains in the Genus database with same CATH homology
 1XNR E;  5L3J A;  2CG9 A;  2VQE I;  1NHI A;  1MU5 A;  4DV1 I;  4DV3 I;  2V2Q A;  1HNW I;  4LFA E;  2A2D A;  4HXZ A;  2ZM6 I;  4JV5 I;  4I3H A;  4DR2 I;  2V2Z A;  5BR8 I;  4DV5 I;  1H74 A;  4DUY I;  4HAC A;  4DR3 E;  2UUB I;  4X64 I;  1Z0E A;  1FKA E;  1H7S A;  3QT8 A;  3K17 A;  4GKJ I;  4NXM I;  2CZ9 A;  5LMU I;  1Y6Z A;  4LF8 E;  2HKJ A;  2HKE A;  2ZBK B;  1XMO I;  4DR4 E;  1ZM9 A;  1I94 I;  4DXL A;  4JI0 E;  4DV6 E;  2NPF A;  4P52 A;  4JI5 E;  4FWG A;  4JI1 I;  2R3V A;  1ZM4 A;  4DV0 E;  4KHP E;  2HHH E;  4HAC B;  2V8P A;  2UUC I;  4AQY E;  1XNR I;  1B63 A;  1N36 E;  4LFA I;  3J7A G;  3T1Y E;  4B3S E;  3V5R A;  1FI4 A;  1HNZ E;  1VIS A;  4OX9 I;  1NZ0 A;  2Z5E A;  4DPX A;  5A2Q Q;  4DPU A;  5GMD A;  4LF9 E;  4MYT A;  4DR3 I;  2ZIT A;  4EMD A;  4JG4 A;  2Z5B B;  2HFU A;  2Z5C A;  1MG7 A;  1N33 I;  1IBK E;  3M6A A;  4R1F A;  1XMQ E;  4DR4 I;  1Y4U A;  2R42 A;  2UU9 E;  4FWD A;  4X66 E;  4JI0 I;  4DV6 I;  1Z59 A;  3HJC A;  4JI5 I;  1XHK A;  4JI8 E;  4ED4 A;  4DV0 I;  4KHP I;  1N0V C;  3PYF A;  3ZZU A;  4JI4 E;  4UTG A;  1UEK A;  2J7K A;  3H4L A;  2UXD E;  1KKH A;  1Z0C A;  1NHJ A;  3T1Y I;  1FJG I;  2Z5C B;  4NXN E;  4PU9 A;  4B3S I;  4DR6 E;  2UXC E;  1HNZ I;  1ZXN A;  4JI6 E;  4JYA E;  2IOP A;  1XNQ E;  2VQF E;  4RPF A;  4B3T E;  1HNX E;  4FN5 A;  4LF4 E;  2BV3 A;  3B82 A;  2UXB E;  1Z5A A;  3J80 C;  4LF7 E;  1RRE A;  3B78 A;  1XMQ I;  4FW9 A;  5LL6 R;  1BKN A;  4X66 I;  1H7U A;  1D6T A;  1KVK A;  2HK2 A;  4DR5 E;  2O1T A;  4K0K E;  1IBM E;  3JAM C;  4LFB I;  4KQV A;  4DV2 I;  4X62 E;  3D4J A;  4XTJ A;  4UT4 A;  4JI4 I;  4B3M E;  2UXD I;  2E1R A;  1Z0V A;  3J80 Q;  4NXN I;  4DR6 I;  1Z0T A;  2HK3 A;  1ELO A;  4JI6 I;  4JYA I;  1XNQ I;  3OTO E;  2VQF I;  2DEI A;  4IZK A;  5FWK A;  3ZZT A;  4B3T I;  1HNX I;  4DU8 A;  3ZKB A;  4LF4 I;  2BM1 A;  4IZJ A;  1Z5B A;  2VQE E;  4IZJ D;  4ZVI A;  4DV3 E;  2AJ4 A;  4LF7 I;  4M1K A;  3J81 C;  1KIJ A;  1RR9 A;  4LF8 I;  1ZXM A;  3Q6M A;  3WU6 A;  5FLX C;  1N0U A;  1QZR A;  4DR5 I;  4DR2 E;  4K0K I;  4B3R E;  1IBM I;  3J7A M;  1USU A;  3PYE A;  3WU5 A;  4DR7 E;  2HHH I;  1K47 A;  2O1V A;  1HR0 E;  1PKP A;  4AQY I;  4USM A;  1N36 I;  1H72 C;  2V2V A;  4DUZ E;  1N34 E;  3HUL A;  1Z0G A;  5LMN E;  1I94 E;  1EA6 A;  3J81 Q;  3Q6N A;  4DR1 E;  2F4V E;  1PIE A;  3OTO I;  5IT9 C;  4WUC A;  5FLX Q;  4LF5 E;  1Z5C A;  3QT7 A;  3V2U C;  4JI1 E;  4X65 E;  1ZM2 A;  3Q1Q A;  1PVG A;  4LF9 I;  1J5E E;  4YHH E;  3K1J A;  1FWK A;  4HY1 A;  4DV4 E;  3F0N A;  3QT5 A;  1IBK I;  1Y4S A;  1IBL E;  4OX9 E;  4Z7C A;  2V34 A;  3CWV A;  2UU9 I;  3LNU A;  1H73 A;  2WW4 A;  3QT6 A;  2E5L E;  4DV7 E;  2UUA E;  4B3R I;  4MYU A;  1OJ4 A;  1Z0W A;  5GME A;  5IT9 Q;  4LF6 E;  2GQ0 A;  3WU3 A;  4JI8 I;  5IWA E;  4YY3 E;  4DR7 I;  1FWL A;  1WUU A;  4PRX A;  4JI3 E;  1B62 A;  1HR0 I;  4USK A;  1Z0B A;  4Z7Y A;  1N33 E;  4DPT A;  2A2C A;  4DUZ I;  4URL A;  1N34 I;  2IOQ A;  5A2Q C;  5LMN I;  2VF3 A;  4DPY A;  4LFC E;  1FNM A;  4WUB A;  2UXC I;  4DR1 I;  2F4V I;  2CGE A;  4HYM A;  1S16 A;  3GON A;  1N32 E;  1MX0 A;  3T1H E;  4LF5 I;  4X65 I;  1U2R A;  4GKK E;  4JI7 E;  2Z5B A;  1J5E I;  3JAM Q;  4YHH I;  4JI2 E;  3ZM7 A;  2Q2E B;  4P7A A;  4DU7 A;  2UXB I;  1KTV A;  3LPS A;  2PNM A;  4DV1 E;  1ZM3 A;  4DV4 I;  1HNW E;  3B8H A;  1FJG E;  3LTO A;  1DAR A;  3K85 A;  1IBL I;  2OI2 A;  2EFG A;  2X36 A;  2O1W A;  3P06 A;  3ZZ0 A;  2ZM6 E;  2E5L I;  4N3O A;  4DV7 I;  3WU4 A;  2UUA I;  4JV5 E;  5BR8 E;  4DV5 E;  2X7I A;  4LF6 I;  3PYD A;  4DUY E;  2GS8 A;  1USV A;  5IWA I;  4YY3 I;  2UUB E;  4JI3 I;  4X64 E;  2BM0 A;  4X62 I;  1A6F A;  4FWH A;  1EI1 A;  4IZK B;  2HFS A;  4GKJ E;  4IZJ B;  1NHH A;  4NXM E;  4B3M I;  3ZKD A;  5LMU E;  3PYG A;  3PRY A;  2O1U A;  4LFC I;  1XMO E;  4PRV A;  4WUD A;  2PNL A;  1S4E A;  1HK7 A;  1N32 I;  3T1H I;  4LFB E;  4DV2 E;  4DPW A;  4GKK I;  2DEJ A;  2LJP A;  4JI7 I;  2XEX A;  2UUC E;  4JI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...