4OX9I

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ox9I00
3LNUA 4UT4A 4LFBI 2V8PA 4WUBA 4X66E 1XNQE 4LF7E 1XMQE 4NXME 4GKKI 4KQVA 1ZXNA 4DR1I 4DR2E 1MX0A 4LF7I 4WUCA 1XMQI 1A6FA 5A2QQ 4HACA 4NXNE 4NXMI 3D4JA 1I94E 4DV4E 1HNZE 4DR2I 1FWKA 5A2QC 2WW4A 4MYUA 2E1RA 2ZBKB 1ZM2A 1Z0CA 4NXNI 1KTVA 1PVGA 2HK3A 4DU8A 1Z5AA 4DV4I 1HNZI 3K1JA 1B63A 4X64E 4DV2E 2XEXA 1HNXE 4DPWA 1FJGE 3J7AG 1DARA 4JV5E 4X64I 4DV2I 1XNRI 2ZM6E 4LF4E 1FJGI 2VQFE 1U2RA 4X62E 3HULA 1HNWE 2AJ4A 2UU9E 3J80Q 1Z5CA 4FN5A 4JV5I 4X65E 4LFAE 2ZM6I 1ELOA 2UUCI 4LF4I 4WUDA 2VQFI 4X62I 1HNWI 3M6AA 4DV5E 1RREA 4DUYE 1N34E 2J7KA 4X65I 3B78A 4LF9E 4JI6E 4USKA 4YY3E 4YHHI 4DR4E 1IBME 1N34I 2V2QA 1NHIA 2A2DA 4FWHA 1IBLE 4JI6I 1J5EI 4YY3I 1PIEA 5BR8E 4DR4I 3B82A 4JYAE 1NHHA 1IBMI 5GMEA 1IBLI 4DV1I 4GKKE 3CWVA 4DV0I 4OX9I 4DR1E 5BR8I 1Z59A 2UUAE 4HXZA 3PYDA 2Q2EB 1D6TA 4MYTA 1S16A 1QZRA 4K0KI 1Z0WA 2UUAI 4PU9A 1S4EA 4JI5E 1Z0BA 4HY1A 4GKJE 3V5RA 3J7AM 3T1YE 4B3ME 2R42A 4P7AA 3QT6A 3JAMQ 4JI5I 1N0VC 4GKJI 2UXDE 1MU5A 3T1YI 2ZITA 3JAMC 4B3MI 1XNRE 1NZ0A 1B62A 2UXDI 1RR9A 3ZKBA 2UUCE 4LF8E 1HR0E 1N36E 2V2VA 3WU3A 4JI4E 4DV6E 2DEJA 4B3TE 4M1KA 3K17A 4B3RI 4LF8I 1H74A 1HR0I 4FWDA 1XMOI 1H7UA 3LTOA 3J80C 1N36I 1MG7A 4DV3E 2DEIA 2HHHE 4YHHE 1EI1A 4JI4I 4DV6I 4B3TI 1OJ4A 4PRVA 4JI3E 1Z5BA 1J5EE 3LPSA 4DV3I 3ZZ0A 2HHHI 4JI0E 3OTOE 4JI8E 2E5LI 1ZM3A 2OI2A 3ZKDA 1KKHA 5IWAI 3WU5A 4DUZE 4DV1E 4JI3I 2UXCE 3ZZTA 4XTJA 4DV0E 4JI0I 4OX9E 3OTOI 4JI8I 4DUZI 2R3VA 5GMDA 1KVKA 3ZM7A 2UXCI 5FLXQ 2UXBE 4K0KE 4R1FA 4JI2E 1ZXMA 4DR5E 4DR3E 4LF6E 4HYMA 3J81Q 1H7SA 4EMDA 3T1HE 2HFUA 4AQYI 2UXBI 4DPYA 2HKEA 4DU7A 4ZVIA 4I3HA 3J81C 4JI2I 4P52A 4DR5I 4DR7E 4DR3I 4LF6I 4DV7E 3ZZUA 3PYEA 3T1HI 1H73A 1UEKA 1FWLA 1FI4A 2X36A 4DR7I 3F0NA 1ZM4A 4USMA 4DV7I 4LF5E 5L3JA 4X66I 1XNQI 1K47A 1PKPA 1Z0TA 4JI1E 5LL6R 4Z7CA 3QT5A 1KIJA 4Z7YA 5LMNE 1VISA 4LF5I 1H72C 1ZM9A 1FNMA 4URLA 1Z0VA 4JI1I 4KHPE 2EFGA 4DR6E 4RPFA 4B3RE 5LMNI 1Z0EA 3PYFA 1I94I 1XMOE 2VF3A 2F4VE 2BM1A 2CZ9A 4ED4A 2HFSA 4UTGA 4KHPI 4DR6I 3QT8A 3V2UC 2X7IA 2GS8A 4JG4A 1BKNA 1HNXI 4FWGA 3H4LA 4HACB 2F4VI 2V34A 2A2CA 2E5LE 5IWAE 4PRXA 2LJPA 3WU4A 1NHJA 2VQEE 4FW9A 3QT7A 1N32E 2BM0A 2UU9I 3GONA 4LFAI 5LMUE 4DPXA 2VQEI 4DXLA 1N32I 4B3SE 5IT9Q 2HKJA 4DV5I 4JI7E 1WUUA 2HK2A 3WU6A 4DUYI 2UUBE 4AQYE 4LF9I 5IT9C 5LMUI 3PYGA 1Z0GA 1EA6A 1IBKE 4B3SI 2V2ZA 4LFCE 4DPTA 2NPFA 3Q1QA 4JI7I 1N33E 5FLXC 4LFBE 1N0UA 2BV3A 2UUBI 1XHKA 1FKAE 3B8HA 1IBKI 4LFCI 4DPUA 1N33I 4JYAI
chains in the Genus database with same CATH superfamily
3LNUA 4UT4A 1YH8A 4LFBI 2V8PA 3P3GA 4WUBA 2C39B 4X66E 3U1YA 1XNQE 4LF7E 4FW6A 1XMQE 5JEAF 2Z5EA 4NXME 4GKKI 4KQVA 1Y4SA 1ZXNA 1Y4UA 2PNZA 4DR1I 1P42A 4DR2E 1MX0A 1OYSA 5EKWA 2O1UA 4LF7I 4WUCA 1XMQI 1A6FA 5A2QQ 4HACA 4NXNE 4NXMI 2JE6B 2BA1G 3D4JA 2JEBB 2GO4A 1I94E 4DV4E 1HNZE 3U1KA 4DR2I 4FW5A 1FWKA 5A2QC 2WW4A 4MYUA 2E1RA 5C0XC 2ZBKB 1ZM2A 1Z0CA 4NXNI 1KTVA 1PVGA 2HK3A 5C0XA 3HKMA 4DU8A 1Z5AA 2C38A 3NZKA 4DV4I 1HNZI 3K1JA 3Q6MA 1B63A 4X64E 4DV2E 2XEXA 1HNXE 4LCHA 4DPWA 1FJGE 2PO1A 3J7AG 5DNLA 1DARA 2C37B 4JV5E 4X64I 4DV2I 1XNRI 5DRRA 2ZM6E 4LF4E 1FJGI 2VQFE 1U2RA 5K36B 4X62E 3HULA 3M85G 1HNWE 2AJ4A 2UU9E 3J80Q 2PNLA 1E3PA 2O1WA 1Z5CA 4FN5A 4JV5I 4X65E 1OYRA 4LFAE 2ZM6I 1ELOA 1Y60A 2UUCI 4LF4I 4WUDA 2VQFI 2BA0G 4X62I 1HNWI 3M6AA 4DV5E 1RREA 5DRQA 2PO0B 4DUYE 1N34E 4IFDE 2J7KA 4X65I 3B78A 3DD6A 3PS2A 4LF9E 4JI6E 2C39A 4USKA 4YY3E 5C0XF 2BR2B 4YHHI 4DR4E 1IBME 1N34I 2V2QA 4OKGA 1NHIA 2A2DA 4FWHA 1IBLE 4JI6I 4IFDD 4OO1E 4QNKA 3K85A 1J5EI 4YY3I 1PIEA 5BR8E 4DR4I 3B82A 4JYAE 1NHHA 2JE6A 3KRNA 1IBMI 4N3OA 5GMEA 1IBLI 4DV1I 1UDQA 4OO1D 4GKKE 1Y6ZA 3CWVA 2Z5CB 4AIMA 4DV0I 3Q6NA 4DR1E 4OX9I 1RHYA 1HK7A 5BR8I 3P3EA 1Z59A 4IFDB 2UUAE 4HXZA 3PYDA 2Q2EB 1XXEA 1D6TA 4U3BA 5EL9A 3M7ND 4MYTA 1S16A 1QZRA 4K0KI 2JEAB 1Z0WA 2CGEA 2UUAI 4PU9A 4OO1B 1S4EA 4JI5E 1Z0BA 4HY1A 4QNJA 4GKJE 3PS1A 3V5RA 5K36E 3J7AM 3T1YE 4B3ME 2R42A 4P7AA 2Z5BA 3L7ZB 1UDSA 3QT6A 3JAMQ 1VI7A 4JI5I 1N0VC 4GKJI 2UXDE 2IESA 4OO1F 1MU5A 5K36D 3T1YI 2ZITA 3JAMC 4B3MI 1XNRE 1NZ0A 2PO0A 1B62A 2UXDI 3H1CA 1RR9A 2VESA 2F1DA 4IZKA 3UHMA 3ZKBA 4IZJB 4U3DA 2UUCE 4LF8E 3P3CA 3P76A 1HR0E 2PO2A 1N36E 2V2VA 3WU3A 2WNRA 2WP8B 2NN6E 4JI4E 4DV6E 2DEJA 2IERA 4B3TE 2PNMA 4M1KA 3K17A 4B3RI 4LF8I 1H74A 1HR0I 4FWDA 1XMOI 1H7UA 3LTOA 3J80C 4OZEA 1N36I 1MG7A 4DV3E 2DEIA 4ISAA 2HHHE 2O1TA 4MU3A 4YHHE 1EI1A 4JI4I 5K36F 4DV6I 4IFDC 2NN6D 3GLLA 4B3TI 2O1VA 5DROA 4AIDA 1OJ4A 4LCGA 4IFDA 4PRVA 4JI3E 1Z5BA 1J5EE 3LPSA 4DV3I 5JEAE 3ZZ0A 2HHHI 4JI0E 3OTOE 2CG9A 5FWKA 4JI8E 2E5LI 1ZM3A 2OI2A 2O3ZA 3ZKDA 1KKHA 5IWAI 2J65A 3WU5A 4DUZE 4OO1C 2IOQA 4DV1E 4JI3I 3GMEA 4OO1A 4LPFA 2UXCE 3ZZTA 4XTJA 4DV0E 4JI0I 4OX9E 2NN6B 3OTOI 5JEAD 2JEBA 4JI8I 4BA1B 4DUZI 2R3VA 5GMDA 3M7NG 1KVKA 3L7ZA 3ZM7A 2UXCI 4LOMA 5FLXQ 2UXBE 4IS9A 4K0KE 4R1FA 4MQYA 4JI2E 1ZXMA 1YHCA 4DR5E 4DR3E 4LF6E 4HYMA 1Y5YA 3J81Q 1H7SA 4EMDA 5ELWA 5JEAB 3T1HE 2HFUA 4AQYI 2UXBI 4DPYA 2HKEA 4DU7A 4ZVIA 4I3HA 3J81C 4JI2I 4P52A 4DR5I 4DR7E 4DR3I 4IZJA 4LF6I 2C37A 4IFDF 4DV7E 3ZZUA 3PYEA 5K36C 3T1HI 1H73A 1E3HA 1UEKA 5K36A 1FWLA 3P06A 4LCFA 1FI4A 2WP8A 4IZJD 2X36A 4DR7I 3F0NA 4MDTA 1ZM4A 4USMA 4DV7I 2IOPA 4LF5E 4BA2B 4MU1A 5L3JA 4X66I 1XNQI 1K47A 1PKPA 1Z0TA 4JI1E 5LL6R 4Z7CA 3QT5A 1KIJA 4Z7YA 5LMNE 1VISA 4LF5I 1H72C 1ZM9A 1USUA 1FNMA 2GQ0A 4GQUA 1Z0VA 4URLA 1USVA 5C0XE 4JI1I 4KHPE 2BR2A 4AM3A 2JT2A 2EFGA 4DR6E 4RPFA 5DNXA 4B3RE 5LMNI 1Z0EA 2GO3A 3PYFA 1I94I 1XMOE 2BA1D 2VF3A 2F4VE 2NN6C 2BM1A 1R6MA 2CZ9A 2PNZB 4ED4A 2HFSA 4UTGA 4KHPI 5C0XD 2NN6A 4DR6I 4MU4A 3CDIA 4MU0A 4BA1A 3HJCA 3QT8A 3V2UC 2X7IA 2GS8A 4JG4A 1BKNA 1HNXI 4FWGA 3H4LA 4HACB 2F4VI 2V34A 2A2CA 2E5LE 2Z5CA 3PS3A 5IWAE 4PRXA 3CDJA 3GCMA 2Z5BB 2LJPA 4J3DA 3WU4A 2AE8A 5JEAC 1NHJA 2VQEE 4FW9A 3QT7A 5C0XB 4FW7A 1N32E 5JEAA 2C38B 1R6LA 2JEAA 2BM0A 2UU9I 3B4TA 3M85D 3GONA 2PO1B 4LFAI 5LMUE 4DPXA 2VQEI 4DXLA 1N32I 4B3SE 4IZKB 5IT9Q 1UDOA 2HKJA 4DV5I 4JI7E 2BA0D 1WUUA 1UDNA 2HK2A 3PRYA 3WU6A 4DUYI 2PO2B 2UUBE 4AQYE 4LF9I 2WNRB 5LMUI 5IT9C 3PYGA 4BA2A 1Z0GA 1EA6A 1IBKE 4B3SI 2NN6F 2V2ZA 4LFCE 4DPTA 2NPFA 3Q1QA 4JI7I 1N33E 5FLXC 2CVEA 4LFBE 1N0UA 2BV3A 2UUBI 4FW3A 4FW4A 1OYPA 1XHKA 1FKAE 3B8HA 1IBKI 4NBQA 4LFCI 4DPUA 5DRPA 1N33I 4JYAI
chains in the Genus database with same CATH topology
3LNUA 4UT4A 4LFBI 2V8PA 4WUBA 4X66E 1XNQE 4LF7E 1XMQE 2Z5EA 4NXME 4GKKI 4KQVA 1Y4SA 1ZXNA 1Y4UA 4DR1I 4DR2E 1MX0A 2O1UA 4LF7I 4WUCA 1XMQI 1A6FA 5A2QQ 4HACA 4NXNE 4NXMI 3D4JA 1I94E 4DV4E 1HNZE 4DR2I 1FWKA 5A2QC 2WW4A 4MYUA 2E1RA 2ZBKB 1ZM2A 1Z0CA 4NXNI 1KTVA 1PVGA 2HK3A 4DU8A 1Z5AA 4DV4I 1HNZI 3K1JA 3Q6MA 1B63A 4X64E 4DV2E 2XEXA 1HNXE 4DPWA 1FJGE 3J7AG 1DARA 4JV5E 4X64I 4DV2I 1XNRI 2ZM6E 4LF4E 1FJGI 2VQFE 1U2RA 4X62E 3HULA 1HNWE 2AJ4A 2UU9E 3J80Q 2PNLA 2O1WA 1Z5CA 4FN5A 4JV5I 4X65E 4LFAE 2ZM6I 1ELOA 2UUCI 4LF4I 4WUDA 2VQFI 4X62I 1HNWI 3M6AA 4DV5E 1RREA 4DUYE 1N34E 2J7KA 4X65I 3B78A 4LF9E 4JI6E 4USKA 4YY3E 4YHHI 4DR4E 1IBME 1N34I 2V2QA 1NHIA 2A2DA 4FWHA 1IBLE 4JI6I 3K85A 1J5EI 4YY3I 1PIEA 5BR8E 4DR4I 3B82A 4JYAE 1NHHA 1IBMI 4N3OA 5GMEA 1IBLI 4DV1I 4GKKE 1Y6ZA 3CWVA 2Z5CB 4DV0I 3Q6NA 4DR1E 4OX9I 1HK7A 5BR8I 1Z59A 2UUAE 4HXZA 3PYDA 2Q2EB 1D6TA 4MYTA 1S16A 1QZRA 4K0KI 1Z0WA 2CGEA 2UUAI 4PU9A 1S4EA 4JI5E 1Z0BA 4HY1A 4GKJE 3V5RA 3J7AM 3T1YE 4B3ME 2R42A 4P7AA 2Z5BA 3QT6A 3JAMQ 4JI5I 1N0VC 4GKJI 2UXDE 1MU5A 3T1YI 2ZITA 3JAMC 4B3MI 1XNRE 1NZ0A 1B62A 2UXDI 1RR9A 4IZKA 3ZKBA 4IZJB 2UUCE 4LF8E 1HR0E 1N36E 2V2VA 3WU3A 4JI4E 4DV6E 2DEJA 4B3TE 2PNMA 4M1KA 3K17A 4B3RI 4LF8I 1H74A 1HR0I 4FWDA 1XMOI 1H7UA 3LTOA 3J80C 1N36I 1MG7A 4DV3E 2DEIA 2HHHE 2O1TA 4YHHE 1EI1A 4JI4I 4DV6I 4B3TI 2O1VA 1OJ4A 4PRVA 4JI3E 1Z5BA 1J5EE 3LPSA 4DV3I 3ZZ0A 2HHHI 4JI0E 3OTOE 2CG9A 5FWKA 4JI8E 2E5LI 1ZM3A 2OI2A 3ZKDA 1KKHA 5IWAI 3WU5A 4DUZE 2IOQA 4DV1E 4JI3I 2UXCE 3ZZTA 4XTJA 4DV0E 4JI0I 4OX9E 3OTOI 4JI8I 4DUZI 2R3VA 5GMDA 1KVKA 3ZM7A 2UXCI 5FLXQ 2UXBE 4K0KE 4R1FA 4JI2E 1ZXMA 4DR5E 4DR3E 4LF6E 4HYMA 3J81Q 1H7SA 4EMDA 3T1HE 2HFUA 4AQYI 2UXBI 4DPYA 2HKEA 4DU7A 4ZVIA 4I3HA 3J81C 4JI2I 4P52A 4DR5I 4DR7E 4DR3I 4IZJA 4LF6I 4DV7E 3ZZUA 3PYEA 3T1HI 1H73A 1UEKA 1FWLA 3P06A 1FI4A 4IZJD 2X36A 4DR7I 3F0NA 1ZM4A 4USMA 4DV7I 2IOPA 4LF5E 5L3JA 4X66I 1XNQI 1K47A 1PKPA 1Z0TA 4JI1E 5LL6R 4Z7CA 3QT5A 1KIJA 4Z7YA 5LMNE 1VISA 4LF5I 1H72C 1ZM9A 1USUA 1FNMA 2GQ0A 4URLA 1Z0VA 1USVA 4JI1I 4KHPE 2EFGA 4DR6E 4RPFA 4B3RE 5LMNI 1Z0EA 3PYFA 1I94I 1XMOE 2VF3A 2F4VE 2BM1A 2CZ9A 4ED4A 2HFSA 4UTGA 4KHPI 4DR6I 3HJCA 3QT8A 3V2UC 2X7IA 2GS8A 4JG4A 1BKNA 1HNXI 4FWGA 3H4LA 4HACB 2F4VI 2V34A 2A2CA 2E5LE 2Z5CA 5IWAE 4PRXA 2Z5BB 2LJPA 3WU4A 1NHJA 2VQEE 4FW9A 3QT7A 1N32E 2BM0A 2UU9I 3GONA 4LFAI 5LMUE 4DPXA 2VQEI 4DXLA 1N32I 4B3SE 4IZKB 5IT9Q 2HKJA 4DV5I 4JI7E 1WUUA 2HK2A 3PRYA 3WU6A 4DUYI 2UUBE 4AQYE 4LF9I 5IT9C 5LMUI 3PYGA 1Z0GA 1EA6A 1IBKE 4B3SI 2V2ZA 4LFCE 4DPTA 2NPFA 3Q1QA 4JI7I 1N33E 5FLXC 4LFBE 1N0UA 2BV3A 2UUBI 1XHKA 1FKAE 3B8HA 1IBKI 4LFCI 4DPUA 1N33I 4JYAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNU A;  4UT4 A;  4LFB I;  2V8P A;  4WUB A;  4X66 E;  1XNQ E;  4LF7 E;  1XMQ E;  4NXM E;  4GKK I;  4KQV A;  1ZXN A;  4DR1 I;  4DR2 E;  1MX0 A;  4LF7 I;  4WUC A;  1XMQ I;  1A6F A;  5A2Q Q;  4HAC A;  4NXN E;  4NXM I;  3D4J A;  1I94 E;  4DV4 E;  1HNZ E;  4DR2 I;  1FWK A;  5A2Q C;  2WW4 A;  4MYU A;  2E1R A;  2ZBK B;  1ZM2 A;  1Z0C A;  4NXN I;  1KTV A;  1PVG A;  2HK3 A;  4DU8 A;  1Z5A A;  4DV4 I;  1HNZ I;  3K1J A;  1B63 A;  4X64 E;  4DV2 E;  2XEX A;  1HNX E;  4DPW A;  1FJG E;  3J7A G;  1DAR A;  4JV5 E;  4X64 I;  4DV2 I;  1XNR I;  2ZM6 E;  4LF4 E;  1FJG I;  2VQF E;  1U2R A;  4X62 E;  3HUL A;  1HNW E;  2AJ4 A;  2UU9 E;  3J80 Q;  1Z5C A;  4FN5 A;  4JV5 I;  4X65 E;  4LFA E;  2ZM6 I;  1ELO A;  2UUC I;  4LF4 I;  4WUD A;  2VQF I;  4X62 I;  1HNW I;  3M6A A;  4DV5 E;  1RRE A;  4DUY E;  1N34 E;  2J7K A;  4X65 I;  3B78 A;  4LF9 E;  4JI6 E;  4USK A;  4YY3 E;  4YHH I;  4DR4 E;  1IBM E;  1N34 I;  2V2Q A;  1NHI A;  2A2D A;  4FWH A;  1IBL E;  4JI6 I;  1J5E I;  4YY3 I;  1PIE A;  5BR8 E;  4DR4 I;  3B82 A;  4JYA E;  1NHH A;  1IBM I;  5GME A;  1IBL I;  4DV1 I;  4GKK E;  3CWV A;  4DV0 I;  4OX9 I;  4DR1 E;  5BR8 I;  1Z59 A;  2UUA E;  4HXZ A;  3PYD A;  2Q2E B;  1D6T A;  4MYT A;  1S16 A;  1QZR A;  4K0K I;  1Z0W A;  2UUA I;  4PU9 A;  1S4E A;  4JI5 E;  1Z0B A;  4HY1 A;  4GKJ E;  3V5R A;  3J7A M;  3T1Y E;  4B3M E;  2R42 A;  4P7A A;  3QT6 A;  3JAM Q;  4JI5 I;  1N0V C;  4GKJ I;  2UXD E;  1MU5 A;  3T1Y I;  2ZIT A;  3JAM C;  4B3M I;  1XNR E;  1NZ0 A;  1B62 A;  2UXD I;  1RR9 A;  3ZKB A;  2UUC E;  4LF8 E;  1HR0 E;  1N36 E;  2V2V A;  3WU3 A;  4JI4 E;  4DV6 E;  2DEJ A;  4B3T E;  4M1K A;  3K17 A;  4B3R I;  4LF8 I;  1H74 A;  1HR0 I;  4FWD A;  1XMO I;  1H7U A;  3LTO A;  3J80 C;  1N36 I;  1MG7 A;  4DV3 E;  2DEI A;  2HHH E;  4YHH E;  1EI1 A;  4JI4 I;  4DV6 I;  4B3T I;  1OJ4 A;  4PRV A;  4JI3 E;  1Z5B A;  1J5E E;  3LPS A;  4DV3 I;  3ZZ0 A;  2HHH I;  4JI0 E;  3OTO E;  4JI8 E;  2E5L I;  1ZM3 A;  2OI2 A;  3ZKD A;  1KKH A;  5IWA I;  3WU5 A;  4DUZ E;  4DV1 E;  4JI3 I;  2UXC E;  3ZZT A;  4XTJ A;  4DV0 E;  4JI0 I;  4OX9 E;  3OTO I;  4JI8 I;  4DUZ I;  2R3V A;  5GMD A;  1KVK A;  3ZM7 A;  2UXC I;  5FLX Q;  2UXB E;  4K0K E;  4R1F A;  4JI2 E;  1ZXM A;  4DR5 E;  4DR3 E;  4LF6 E;  4HYM A;  3J81 Q;  1H7S A;  4EMD A;  3T1H E;  2HFU A;  4AQY I;  2UXB I;  4DPY A;  2HKE A;  4DU7 A;  4ZVI A;  4I3H A;  3J81 C;  4JI2 I;  4P52 A;  4DR5 I;  4DR7 E;  4DR3 I;  4LF6 I;  4DV7 E;  3ZZU A;  3PYE A;  3T1H I;  1H73 A;  1UEK A;  1FWL A;  1FI4 A;  2X36 A;  4DR7 I;  3F0N A;  1ZM4 A;  4USM A;  4DV7 I;  4LF5 E;  5L3J A;  4X66 I;  1XNQ I;  1K47 A;  1PKP A;  1Z0T A;  4JI1 E;  5LL6 R;  4Z7C A;  3QT5 A;  1KIJ A;  4Z7Y A;  5LMN E;  1VIS A;  4LF5 I;  1H72 C;  1ZM9 A;  1FNM A;  4URL A;  1Z0V A;  4JI1 I;  4KHP E;  2EFG A;  4DR6 E;  4RPF A;  4B3R E;  5LMN I;  1Z0E A;  3PYF A;  1I94 I;  1XMO E;  2VF3 A;  2F4V E;  2BM1 A;  2CZ9 A;  4ED4 A;  2HFS A;  4UTG A;  4KHP I;  4DR6 I;  3QT8 A;  3V2U C;  2X7I A;  2GS8 A;  4JG4 A;  1BKN A;  1HNX I;  4FWG A;  3H4L A;  4HAC B;  2F4V I;  2V34 A;  2A2C A;  2E5L E;  5IWA E;  4PRX A;  2LJP A;  3WU4 A;  1NHJ A;  2VQE E;  4FW9 A;  3QT7 A;  1N32 E;  2BM0 A;  2UU9 I;  3GON A;  4LFA I;  5LMU E;  4DPX A;  2VQE I;  4DXL A;  1N32 I;  4B3S E;  5IT9 Q;  2HKJ A;  4DV5 I;  4JI7 E;  1WUU A;  2HK2 A;  3WU6 A;  4DUY I;  2UUB E;  4AQY E;  4LF9 I;  5IT9 C;  5LMU I;  3PYG A;  1Z0G A;  1EA6 A;  1IBK E;  4B3S I;  2V2Z A;  4LFC E;  4DPT A;  2NPF A;  3Q1Q A;  4JI7 I;  1N33 E;  5FLX C;  4LFB E;  1N0U A;  2BV3 A;  2UUB I;  1XHK A;  1FKA E;  3B8H A;  1IBK I;  4LFC I;  4DPU A;  1N33 I;  4JYA I; 
#chains in the Genus database with same CATH topology
 3LNU A;  4UT4 A;  1YH8 A;  4LFB I;  2V8P A;  3P3G A;  4WUB A;  2C39 B;  4X66 E;  3U1Y A;  1XNQ E;  4LF7 E;  4FW6 A;  1XMQ E;  5JEA F;  2Z5E A;  4NXM E;  4GKK I;  4KQV A;  1Y4S A;  1ZXN A;  1Y4U A;  2PNZ A;  4DR1 I;  1P42 A;  4DR2 E;  1MX0 A;  1OYS A;  5EKW A;  2O1U A;  4LF7 I;  4WUC A;  1XMQ I;  1A6F A;  5A2Q Q;  4HAC A;  4NXN E;  4NXM I;  2JE6 B;  2BA1 G;  3D4J A;  2JEB B;  2GO4 A;  1I94 E;  4DV4 E;  1HNZ E;  3U1K A;  4DR2 I;  4FW5 A;  1FWK A;  5A2Q C;  2WW4 A;  4MYU A;  2E1R A;  5C0X C;  2ZBK B;  1ZM2 A;  1Z0C A;  4NXN I;  1KTV A;  1PVG A;  2HK3 A;  5C0X A;  3HKM A;  4DU8 A;  1Z5A A;  2C38 A;  3NZK A;  4DV4 I;  1HNZ I;  3K1J A;  3Q6M A;  1B63 A;  4X64 E;  4DV2 E;  2XEX A;  1HNX E;  4LCH A;  4DPW A;  1FJG E;  2PO1 A;  3J7A G;  5DNL A;  1DAR A;  2C37 B;  4JV5 E;  4X64 I;  4DV2 I;  1XNR I;  5DRR A;  2ZM6 E;  4LF4 E;  1FJG I;  2VQF E;  1U2R A;  5K36 B;  4X62 E;  3HUL A;  3M85 G;  1HNW E;  2AJ4 A;  2UU9 E;  3J80 Q;  2PNL A;  1E3P A;  2O1W A;  1Z5C A;  4FN5 A;  4JV5 I;  4X65 E;  1OYR A;  4LFA E;  2ZM6 I;  1ELO A;  1Y60 A;  2UUC I;  4LF4 I;  4WUD A;  2VQF I;  2BA0 G;  4X62 I;  1HNW I;  3M6A A;  4DV5 E;  1RRE A;  5DRQ A;  2PO0 B;  4DUY E;  1N34 E;  4IFD E;  2J7K A;  4X65 I;  3B78 A;  3DD6 A;  3PS2 A;  4LF9 E;  4JI6 E;  2C39 A;  4USK A;  4YY3 E;  5C0X F;  2BR2 B;  4YHH I;  4DR4 E;  1IBM E;  1N34 I;  2V2Q A;  4OKG A;  1NHI A;  2A2D A;  4FWH A;  1IBL E;  4JI6 I;  4IFD D;  4OO1 E;  4QNK A;  3K85 A;  1J5E I;  4YY3 I;  1PIE A;  5BR8 E;  4DR4 I;  3B82 A;  4JYA E;  1NHH A;  2JE6 A;  3KRN A;  1IBM I;  4N3O A;  5GME A;  1IBL I;  4DV1 I;  1UDQ A;  4OO1 D;  4GKK E;  1Y6Z A;  3CWV A;  2Z5C B;  4AIM A;  4DV0 I;  3Q6N A;  4DR1 E;  4OX9 I;  1RHY A;  1HK7 A;  5BR8 I;  3P3E A;  1Z59 A;  4IFD B;  2UUA E;  4HXZ A;  3PYD A;  2Q2E B;  1XXE A;  1D6T A;  4U3B A;  5EL9 A;  3M7N D;  4MYT A;  1S16 A;  1QZR A;  4K0K I;  2JEA B;  1Z0W A;  2CGE A;  2UUA I;  4PU9 A;  4OO1 B;  1S4E A;  4JI5 E;  1Z0B A;  4HY1 A;  4QNJ A;  4GKJ E;  3PS1 A;  3V5R A;  5K36 E;  3J7A M;  3T1Y E;  4B3M E;  2R42 A;  4P7A A;  2Z5B A;  3L7Z B;  1UDS A;  3QT6 A;  3JAM Q;  1VI7 A;  4JI5 I;  1N0V C;  4GKJ I;  2UXD E;  2IES A;  4OO1 F;  1MU5 A;  5K36 D;  3T1Y I;  2ZIT A;  3JAM C;  4B3M I;  1XNR E;  1NZ0 A;  2PO0 A;  1B62 A;  2UXD I;  3H1C A;  1RR9 A;  2VES A;  2F1D A;  4IZK A;  3UHM A;  3ZKB A;  4IZJ B;  4U3D A;  2UUC E;  4LF8 E;  3P3C A;  3P76 A;  1HR0 E;  2PO2 A;  1N36 E;  2V2V A;  3WU3 A;  2WNR A;  2WP8 B;  2NN6 E;  4JI4 E;  4DV6 E;  2DEJ A;  2IER A;  4B3T E;  2PNM A;  4M1K A;  3K17 A;  4B3R I;  4LF8 I;  1H74 A;  1HR0 I;  4FWD A;  1XMO I;  1H7U A;  3LTO A;  3J80 C;  4OZE A;  1N36 I;  1MG7 A;  4DV3 E;  2DEI A;  4ISA A;  2HHH E;  2O1T A;  4MU3 A;  4YHH E;  1EI1 A;  4JI4 I;  5K36 F;  4DV6 I;  4IFD C;  2NN6 D;  3GLL A;  4B3T I;  2O1V A;  5DRO A;  4AID A;  1OJ4 A;  4LCG A;  4IFD A;  4PRV A;  4JI3 E;  1Z5B A;  1J5E E;  3LPS A;  4DV3 I;  5JEA E;  3ZZ0 A;  2HHH I;  4JI0 E;  3OTO E;  2CG9 A;  5FWK A;  4JI8 E;  2E5L I;  1ZM3 A;  2OI2 A;  2O3Z A;  3ZKD A;  1KKH A;  5IWA I;  2J65 A;  3WU5 A;  4DUZ E;  4OO1 C;  2IOQ A;  4DV1 E;  4JI3 I;  3GME A;  4OO1 A;  4LPF A;  2UXC E;  3ZZT A;  4XTJ A;  4DV0 E;  4JI0 I;  4OX9 E;  2NN6 B;  3OTO I;  5JEA D;  2JEB A;  4JI8 I;  4BA1 B;  4DUZ I;  2R3V A;  5GMD A;  3M7N G;  1KVK A;  3L7Z A;  3ZM7 A;  2UXC I;  4LOM A;  5FLX Q;  2UXB E;  4IS9 A;  4K0K E;  4R1F A;  4MQY A;  4JI2 E;  1ZXM A;  1YHC A;  4DR5 E;  4DR3 E;  4LF6 E;  4HYM A;  1Y5Y A;  3J81 Q;  1H7S A;  4EMD A;  5ELW A;  5JEA B;  3T1H E;  2HFU A;  4AQY I;  2UXB I;  4DPY A;  2HKE A;  4DU7 A;  4ZVI A;  4I3H A;  3J81 C;  4JI2 I;  4P52 A;  4DR5 I;  4DR7 E;  4DR3 I;  4IZJ A;  4LF6 I;  2C37 A;  4IFD F;  4DV7 E;  3ZZU A;  3PYE A;  5K36 C;  3T1H I;  1H73 A;  1E3H A;  1UEK A;  5K36 A;  1FWL A;  3P06 A;  4LCF A;  1FI4 A;  2WP8 A;  4IZJ D;  2X36 A;  4DR7 I;  3F0N A;  4MDT A;  1ZM4 A;  4USM A;  4DV7 I;  2IOP A;  4LF5 E;  4BA2 B;  4MU1 A;  5L3J A;  4X66 I;  1XNQ I;  1K47 A;  1PKP A;  1Z0T A;  4JI1 E;  5LL6 R;  4Z7C A;  3QT5 A;  1KIJ A;  4Z7Y A;  5LMN E;  1VIS A;  4LF5 I;  1H72 C;  1ZM9 A;  1USU A;  1FNM A;  2GQ0 A;  4GQU A;  1Z0V A;  4URL A;  1USV A;  5C0X E;  4JI1 I;  4KHP E;  2BR2 A;  4AM3 A;  2JT2 A;  2EFG A;  4DR6 E;  4RPF A;  5DNX A;  4B3R E;  5LMN I;  1Z0E A;  2GO3 A;  3PYF A;  1I94 I;  1XMO E;  2BA1 D;  2VF3 A;  2F4V E;  2NN6 C;  2BM1 A;  1R6M A;  2CZ9 A;  2PNZ B;  4ED4 A;  2HFS A;  4UTG A;  4KHP I;  5C0X D;  2NN6 A;  4DR6 I;  4MU4 A;  3CDI A;  4MU0 A;  4BA1 A;  3HJC A;  3QT8 A;  3V2U C;  2X7I A;  2GS8 A;  4JG4 A;  1BKN A;  1HNX I;  4FWG A;  3H4L A;  4HAC B;  2F4V I;  2V34 A;  2A2C A;  2E5L E;  2Z5C A;  3PS3 A;  5IWA E;  4PRX A;  3CDJ A;  3GCM A;  2Z5B B;  2LJP A;  4J3D A;  3WU4 A;  2AE8 A;  5JEA C;  1NHJ A;  2VQE E;  4FW9 A;  3QT7 A;  5C0X B;  4FW7 A;  1N32 E;  5JEA A;  2C38 B;  1R6L A;  2JEA A;  2BM0 A;  2UU9 I;  3B4T A;  3M85 D;  3GON A;  2PO1 B;  4LFA I;  5LMU E;  4DPX A;  2VQE I;  4DXL A;  1N32 I;  4B3S E;  4IZK B;  5IT9 Q;  1UDO A;  2HKJ A;  4DV5 I;  4JI7 E;  2BA0 D;  1WUU A;  1UDN A;  2HK2 A;  3PRY A;  3WU6 A;  4DUY I;  2PO2 B;  2UUB E;  4AQY E;  4LF9 I;  2WNR B;  5LMU I;  5IT9 C;  3PYG A;  4BA2 A;  1Z0G A;  1EA6 A;  1IBK E;  4B3S I;  2NN6 F;  2V2Z A;  4LFC E;  4DPT A;  2NPF A;  3Q1Q A;  4JI7 I;  1N33 E;  5FLX C;  2CVE A;  4LFB E;  1N0U A;  2BV3 A;  2UUB I;  4FW3 A;  4FW4 A;  1OYP A;  1XHK A;  1FKA E;  3B8H A;  1IBK I;  4NBQ A;  4LFC I;  4DPU A;  5DRP A;  1N33 I;  4JYA I; 
#chains in the Genus database with same CATH homology
 3LNU A;  4UT4 A;  4LFB I;  2V8P A;  4WUB A;  4X66 E;  1XNQ E;  4LF7 E;  1XMQ E;  2Z5E A;  4NXM E;  4GKK I;  4KQV A;  1Y4S A;  1ZXN A;  1Y4U A;  4DR1 I;  4DR2 E;  1MX0 A;  2O1U A;  4LF7 I;  4WUC A;  1XMQ I;  1A6F A;  5A2Q Q;  4HAC A;  4NXN E;  4NXM I;  3D4J A;  1I94 E;  4DV4 E;  1HNZ E;  4DR2 I;  1FWK A;  5A2Q C;  2WW4 A;  4MYU A;  2E1R A;  2ZBK B;  1ZM2 A;  1Z0C A;  4NXN I;  1KTV A;  1PVG A;  2HK3 A;  4DU8 A;  1Z5A A;  4DV4 I;  1HNZ I;  3K1J A;  3Q6M A;  1B63 A;  4X64 E;  4DV2 E;  2XEX A;  1HNX E;  4DPW A;  1FJG E;  3J7A G;  1DAR A;  4JV5 E;  4X64 I;  4DV2 I;  1XNR I;  2ZM6 E;  4LF4 E;  1FJG I;  2VQF E;  1U2R A;  4X62 E;  3HUL A;  1HNW E;  2AJ4 A;  2UU9 E;  3J80 Q;  2PNL A;  2O1W A;  1Z5C A;  4FN5 A;  4JV5 I;  4X65 E;  4LFA E;  2ZM6 I;  1ELO A;  2UUC I;  4LF4 I;  4WUD A;  2VQF I;  4X62 I;  1HNW I;  3M6A A;  4DV5 E;  1RRE A;  4DUY E;  1N34 E;  2J7K A;  4X65 I;  3B78 A;  4LF9 E;  4JI6 E;  4USK A;  4YY3 E;  4YHH I;  4DR4 E;  1IBM E;  1N34 I;  2V2Q A;  1NHI A;  2A2D A;  4FWH A;  1IBL E;  4JI6 I;  3K85 A;  1J5E I;  4YY3 I;  1PIE A;  5BR8 E;  4DR4 I;  3B82 A;  4JYA E;  1NHH A;  1IBM I;  4N3O A;  5GME A;  1IBL I;  4DV1 I;  4GKK E;  1Y6Z A;  3CWV A;  2Z5C B;  4DV0 I;  3Q6N A;  4DR1 E;  4OX9 I;  1HK7 A;  5BR8 I;  1Z59 A;  2UUA E;  4HXZ A;  3PYD A;  2Q2E B;  1D6T A;  4MYT A;  1S16 A;  1QZR A;  4K0K I;  1Z0W A;  2CGE A;  2UUA I;  4PU9 A;  1S4E A;  4JI5 E;  1Z0B A;  4HY1 A;  4GKJ E;  3V5R A;  3J7A M;  3T1Y E;  4B3M E;  2R42 A;  4P7A A;  2Z5B A;  3QT6 A;  3JAM Q;  4JI5 I;  1N0V C;  4GKJ I;  2UXD E;  1MU5 A;  3T1Y I;  2ZIT A;  3JAM C;  4B3M I;  1XNR E;  1NZ0 A;  1B62 A;  2UXD I;  1RR9 A;  4IZK A;  3ZKB A;  4IZJ B;  2UUC E;  4LF8 E;  1HR0 E;  1N36 E;  2V2V A;  3WU3 A;  4JI4 E;  4DV6 E;  2DEJ A;  4B3T E;  2PNM A;  4M1K A;  3K17 A;  4B3R I;  4LF8 I;  1H74 A;  1HR0 I;  4FWD A;  1XMO I;  1H7U A;  3LTO A;  3J80 C;  1N36 I;  1MG7 A;  4DV3 E;  2DEI A;  2HHH E;  2O1T A;  4YHH E;  1EI1 A;  4JI4 I;  4DV6 I;  4B3T I;  2O1V A;  1OJ4 A;  4PRV A;  4JI3 E;  1Z5B A;  1J5E E;  3LPS A;  4DV3 I;  3ZZ0 A;  2HHH I;  4JI0 E;  3OTO E;  2CG9 A;  5FWK A;  4JI8 E;  2E5L I;  1ZM3 A;  2OI2 A;  3ZKD A;  1KKH A;  5IWA I;  3WU5 A;  4DUZ E;  2IOQ A;  4DV1 E;  4JI3 I;  2UXC E;  3ZZT A;  4XTJ A;  4DV0 E;  4JI0 I;  4OX9 E;  3OTO I;  4JI8 I;  4DUZ I;  2R3V A;  5GMD A;  1KVK A;  3ZM7 A;  2UXC I;  5FLX Q;  2UXB E;  4K0K E;  4R1F A;  4JI2 E;  1ZXM A;  4DR5 E;  4DR3 E;  4LF6 E;  4HYM A;  3J81 Q;  1H7S A;  4EMD A;  3T1H E;  2HFU A;  4AQY I;  2UXB I;  4DPY A;  2HKE A;  4DU7 A;  4ZVI A;  4I3H A;  3J81 C;  4JI2 I;  4P52 A;  4DR5 I;  4DR7 E;  4DR3 I;  4IZJ A;  4LF6 I;  4DV7 E;  3ZZU A;  3PYE A;  3T1H I;  1H73 A;  1UEK A;  1FWL A;  3P06 A;  1FI4 A;  4IZJ D;  2X36 A;  4DR7 I;  3F0N A;  1ZM4 A;  4USM A;  4DV7 I;  2IOP A;  4LF5 E;  5L3J A;  4X66 I;  1XNQ I;  1K47 A;  1PKP A;  1Z0T A;  4JI1 E;  5LL6 R;  4Z7C A;  3QT5 A;  1KIJ A;  4Z7Y A;  5LMN E;  1VIS A;  4LF5 I;  1H72 C;  1ZM9 A;  1USU A;  1FNM A;  2GQ0 A;  4URL A;  1Z0V A;  1USV A;  4JI1 I;  4KHP E;  2EFG A;  4DR6 E;  4RPF A;  4B3R E;  5LMN I;  1Z0E A;  3PYF A;  1I94 I;  1XMO E;  2VF3 A;  2F4V E;  2BM1 A;  2CZ9 A;  4ED4 A;  2HFS A;  4UTG A;  4KHP I;  4DR6 I;  3HJC A;  3QT8 A;  3V2U C;  2X7I A;  2GS8 A;  4JG4 A;  1BKN A;  1HNX I;  4FWG A;  3H4L A;  4HAC B;  2F4V I;  2V34 A;  2A2C A;  2E5L E;  2Z5C A;  5IWA E;  4PRX A;  2Z5B B;  2LJP A;  3WU4 A;  1NHJ A;  2VQE E;  4FW9 A;  3QT7 A;  1N32 E;  2BM0 A;  2UU9 I;  3GON A;  4LFA I;  5LMU E;  4DPX A;  2VQE I;  4DXL A;  1N32 I;  4B3S E;  4IZK B;  5IT9 Q;  2HKJ A;  4DV5 I;  4JI7 E;  1WUU A;  2HK2 A;  3PRY A;  3WU6 A;  4DUY I;  2UUB E;  4AQY E;  4LF9 I;  5IT9 C;  5LMU I;  3PYG A;  1Z0G A;  1EA6 A;  1IBK E;  4B3S I;  2V2Z A;  4LFC E;  4DPT A;  2NPF A;  3Q1Q A;  4JI7 I;  1N33 E;  5FLX C;  4LFB E;  1N0U A;  2BV3 A;  2UUB I;  1XHK A;  1FKA E;  3B8H A;  1IBK I;  4LFC I;  4DPU A;  1N33 I;  4JYA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...