2VQFE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqfE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqfE02
4B3RI 4DV4E 1Z0EA 1ZXMA 1N0UA 2ZM6I 5LMNE 4NXME 2E5LI 2HK3A 2V34A 1I94I 1GQEA 4DR1I 1HNWE 3JAMC 2VQFI 2DIXA 2L2MA 4DKKA 2UUAE 4PU9A 3B82A 4LF5I 4JI2I 4XTJA 4KHPE 3ZKDA 4X8WA 4OX9I 4DR5I 4DR3E 1MG7A 5A2QC 4JI0I 1T4NA 2UXBI 1K47A 1H7SA 2HFUA 2V2ZA 4LF6I 4M2ZA 3LTOA 4DV6I 1WUUA 4B3TE 3J7AG 1U2RA 1N0VC 4JI7I 4PRVA 4K0KE 1ZM4A 2L3CA 1UILA 4HXZA 2RTXA 1J5EE 3PYEA 1FKAE 2RSMA 4P52A 1Z0GA 3ZM7A 3J81C 4P7AA 4DU7A 2RS7A 2BM0A 4DU8A 4FW9A 3ADGA 4UT4A 2JY9A 4Z7YA 4DUYI 1RC7A 4LF7I 1PIEA 4B3MI 4DV0I 4JI6E 3WU6A 3ADJA 4DXLA 3QT5A 1ZM3A 2J7KA 4USMA 3LPSA 2RS6A 1KIJA 1KVKA 4JI8E 4YHHE 1RR9A 4URLA 4JI3I 3QT6A 3QT7A 4DV7I 1FJGI 4JI1E 2UUCE 4PRXA 1ZBTA 3GONA 3WU3A 3J80Q 1EKZA 1NHJA 2HK2A 5BR8I 2UUBE 1HR0I 1D6TA 4DV1I 1Z5CA 1QZRA 3ZZTA 2IHR1 1Z5BA 1EI1A 3HULA 1IBMI 4LF4E 2V8PA 4DR6E 2WW4A 4USKA 4DV5I 1N34E 3T1HI 1OJ4A 4OOGC 4WUDA 5LMUI 5IWAI 2L3JA 1Z59A 4B3RE 4JG4A 4X66I 4AQYE 2N3HA 2UXDE 3LNUA 2KHXA 2E5LE 2UU9E 4ZVIA 4R1FA 4LFBE 3T1YI 1XHKA 2B7TA 4DR1E 4LF8I 2VQFE 1T4LB 2VQEI 1H74A 3V2UC 1N33I 2F4VE 1KKHA 4LF5E 2AJ4A 2V2VA 1RQ0A 4YY3I 1H73A 4OX9E 4DR5E 2LUPB 4LF9E 1X49A 4WUCA 4X65I 1B62A 2UXBE 4DV3I 2N3GA 2NUEA 4DR7I 4LF6E 4DV6E 3LLHA 2LTRA 4KQVA 2L33A 3K17A 1NHIA 4JI7E 1X48A 2HFSA 1Z0CA 1Z5AA 1UEKA 4JV5I 2DEIA 2DMYA 4DPUA 1QU6A 1XMQE 1Z0VA 2ZITA 3K1JA 2HHHI 2UXCE 1IBLI 4JYAI 4NXNI 4I3HA 5CFFE 4DUYE 4Z7CA 2OI2A 4LF7E 1UHZA 2DB2A 3HTXA 2UUAI 4M30A 4X64I 4HACA 4DR3I 1MX0A 4DV2E 1EA6A 3PYDA 1FWLA 2YT4A 4B3SI 1BKNA 2VF3A 4GKKI 4DV7E 4DR4E 1FJGE 1Z0TA 3ADLA 1KTVA 4B3TI 1FWKA 3PYGA 2B3TB 4M1KA 4FN5A 3WU4A 4EMDA 4K0KI 1N32E 3F0NA 4DV1E 4JI5E 4DPXA 1IBME 1J5EI 2BV3A 2HKJA 2CPNA 5IT9Q 3T1HE 5IWAE 4DUZI 1YYWA 2XEXA 3C4BA 4JI4I 1XNRI 5FLXQ 1YZ9A 1HNZI 3Q1QA 4HY1A 4LFAI 1Z0WA 1ZM2A 2LRSA 3T1YE 2LJPA 4DR2I 4JI6I 4LF8E 2L2NA 1PKPA 1XNQI 2VQEE 3ZKBA 2E1RA 2HKEA 5IT9C 4GKJI 2ZM6E 4YY3E 3VYXA 1DARA 3ZZ0A 3J80C 3WU5A 4FWDA 1I94E 4JI1I 2UUCI 1XMOI 1ZXNA 1H7UA 1IBKI 1HNXI 3OTOI 5L3JA 2R42A 4JI2E 3ZZUA 2UUBI 4JI0E 4JV5E 3JAMQ 4LF4I 4DR6I 3P1XA 5LL6R 2HHHE 1N34I 4JYAE 4WUBA 3V5RA 4LFCI 4MYUA 4FWHA 5A2QQ 2A2CA 4NXNE 4ED4A 3M6AA 4AQYI 2UXDI 2EFGA 2UU9I 1S16A 4X62I 4LFBI 1N36I 1NZ0A 2NUFA 4DV4I 2F4VI 4X64E 5LMNI 4LF9I 4NXMI 3CWVA 4B3SE 3J81Q 2X7IA 4GKKE 1HNWI 4B3ME 4DV0E 3C4TA 4FWGA 2MDRA 2BM1A 4KHPI 4HYMA 4DPWA 1B63A 4JI3E 2Q2EB 3QT8A 1H72C 1PVGA 1XMQI 2NA2A 1YYOA 2UXCI 1FI4A 1WHNA 2NPFA 2LTSA 4DUZE 1MU5A 3VYYA 5GMEA 3J7AM 5BR8E 1HR0E 1ELOA 2L2KB 4JI4E 1XNRE 1DI2A 4MYTA 2LBSB 1HNZE 4LFAE 1YYKA 3H4LA 4DV5E 1A6FA 4RPFA 5LMUE 4DR2E 1FNMA 2DEJA 4DPYA 1XNQE 1T4OA 1NHHA 4GKJE 1J26A 3D4JA 4WYQB 4X66E 4DV2I 2EZ6A 4DR4I 4UTGA 1XMOE 1IBKE 1N33E 1HNXE 2LJHA 3OTOE 2V2QA 1N32I 4JI8I 1S4EA 4YHHI 2X36A 4DPTA 2B7VA 4JI5I 4X65E 1O0WA 2GS8A 4HACB 4DV3E 1X47A 1WHQA 4WFTA 3ADIA 5FLXC 3B78A 4DR7E 2JVAA 1ZM9A 4LFCE 1VISA 2LUQA 1STUA 2ZBKB 2CZ9A 3PYFA 3J7Yp 1Z0BA 2NUGA 2R3VA 3B8HA 1RREA 4X62E 2A2DA 1N36E 1IBLE 5GMDA
chains in the Genus database with same CATH superfamily
3ECRA 4B3RI 4DV4E 3VK6A 1Z0EA 1ZXMA 1N0UA 2ZM6I 4ZYHA 2EPZA 2EOYA 5LMNE 2NABA 4NXME 2EMGA 2E5LI 2HK3A 2NN6C 2V34A 2JOBA 4ZYEA 1I94I 1GQEA 3M7NG 3GMEA 3DJWA 4WXDA 3BIDA 2EP3A 4DR1I 3JAMC 1HNWE 2VQFI 2Z5EA 2DIXA 3CDIA 2L2MA 4DKKA 2UUAE 3PS2A 4AIMA 1EH7A 4PU9A 3B82A 4KZSA 2FGGA 2BA0D 4JI2I 4LF5I 4XTJA 4KHPE 3ZKDA 3C6MA 2ENAA 4X8WA 2YTQA 5JEAD 4DR5I 4OX9I 2EMLA 4DR3E 2EL4A 3THNA 1LLMC 4BC7A 5A2QC 1MG7A 4JI0I 3F6HA 5EKWA 2EPXA 2YTEA 2WBUA 1T4NA 2UXBI 1K47A 3H09A 1H7SA 2C39A 2C37A 2HFUA 5KL2A 2V2ZA 4ISAA 4BA2A 2EMCA 2EORA 4LF6I 5T6JA 4M2ZA 3LTOA 4DV6I 1WUUA 4B3TE 2EM9A 2EN6A 1EH6A 3J7AG 1U2RA 5DROA 1N0VC 4JI7I 4PRVA 4K0KE 4HTGA 1ZM4A 2L3CA 1PJTA 1UILA 4HXZA 5DRPA 2BB8A 1JK1A 4R8OA 2RTXA 1J5EE 3PYEA 1FKAE 2RSMA 4IZJB 2O1VA 4LOMA 4NBQA 2EL5A 2WBTA 1YPNA 2L6MA 4Q35B 4R2CA 1Z0GA 4P52A 3ZM7A 3J81C 2EOSA 4P7AA 4DU7A 1BBGA 3EPHA 2VE7C 2F1DA 2JE6B 4O4KA 2RS7A 2BM0A 2BR2A 4DU8A 4BHBA 2E1MA 2BA1D 2BA1G 4F6NA 3ADGA 2F8BA 4FW9A 4UT4A 2JY9A 3EPKA 4R2RA 4ZYGA 4Z7YA 4DUYI 1RC7A 4LF7I 2GPIA 1PIEA 4MU3A 2EN3A 5EL9A 2VF1A 3L7ZA 2KOUA 5C0XB 1X6FA 2EOEA 3AUZA 2EOFA 2V86A 4B3MI 4DV0I 1Y4SA 1A1IA 4JI6E 3WU6A 2VESA 3ADJA 2WP8B 4DXLA 2YTFA 1RMDA 4WXCA 3QT5A 1ZM3A 2J7KA 5K36C 2LMZA 5AE3A 1UDSA 4USMA 3LPSA 2RS6A 1KIJA 1KVKA 4JI8E 4YHHE 4TUGA 1T38A 1RR9A 2NN6F 3QT6A 4URLA 3QT7A 4JI3I 3FIGA 4J8ZA 2NN6A 4WSGA 4DV7I 3GCMA 1FJGI 4JI1E 1A1KA 2UUCE 4PRXA 1ZBTA 3GONA 4IS1C 1PJQA 2J7JA 3WU3A 3J80Q 2ODRD 3DF6A 1EKZA 1NHJA 4LU9A 2HK2A 4F54A 5BR8I 2UUBE 1HR0I 1D6TA 4LCFA 1Z5CA 4DV1I 4IFDC 2EMIA 2EPNA 1QZRA 1WXRA 5DRRA 3ZZTA 2IHR1 1Z5BA 4GZNC 4FW5A 1EI1A 3HULA 2EPLX 5JEAE 1IBMI 2N8XA 4U3DA 4LF4E 1YSAC 5AE1A 4NHRA 1XXEA 4DR6E 2V8PA 4OO1C 2WW4A 4USKA 4DV5I 3B4TA 1N34E 2EPKX 5DRQA 3T1HI 1OJ4A 4OOGC 3KRNA 4WUDA 5LMUI 4TUIA 5IWAI 2L3JA 4WPYA 1Z59A 2LE2A 2EOZA 2DLQA 4B3RE 4JG4A 2JEBA 2JEAB 2WNRB 2CSHA 4X66I 4AQYE 2N3HA 2UXDE 3LNUA 2EOQA 4MLVA 2KHXA 2E5LE 2UU9E 2EM8A 2M9AA 2L8TA 3OMLA 3P06A 4ZVIA 5A6AA 4R1FA 1SR9A 1F2IG 4LFBE 2E72A 2B7TA 5AC5A 4DR1E 1XHKA 3T1YI 3MSWA 4LF8I 2VQFE 1T4LB 2Z5CA 2VQEI 1H74A 3V2UC 1N33I 2IOQA 2R1FA 2F4VE 1KKHA 2IOPA 2WCC3 1X5WA 4LF5E 4FW6A 3Q6NA 2LT7A 2AJ4A 4O43A 2V2VA 1RQ0A 4YY3I 1H73A 4OX9E 2ENHA 2YTJA 4DR5E 4O5GA 2LUPB 4LF9E 3HQ1A 1X49A 1AH5A 4WUCA 3UHMA 4X65I 1B62A 1Y5YA 2PO2B 2UXBE 4OO1F 2YSPA 2PO1B 2Q8UA 4DV3I 1JK2A 4OZEA 5JEAB 5IV8B 2N3GA 2JP9A 1DQ3A 2CGEA 4DMIA 2NUEA 4DR7I 3UK3C 2JT2A 4LF6E 5K36F 4DV6E 3LLHA 2GO3A 2LTRA 4KQVA 2L33A 3K17A 1NHIA 2BA0G 2EPAA 2YU5A 4JI7E 1A1GA 3P3CA 5K36A 1X48A 5A6JA 2CVEA 4F6MA 2HFSA 2V8QB 1Y60A 1X6EA 3HPZA 2JOXA 3EPLA 2NN6D 1Z0CA 1Z5AA 1UEKA 2O1TA 4JV5I 2DEIA 3P3GA 4GQUA 2DMYA 3K85A 5C0XA 4DPUA 2M4IA 2PNZA 1PJSA 4GEQB 1QU6A 2EN1A 2EPRA 1XMQE 4IZKA 1Z0VA 2ZITA 3K1JA 4LTYA 3NZKA 2UXCE 2HJJA 2HHHI 2GHFA 1IBLI 2LV2A 2FV4B 4JYAI 4F9BB 4QNKA 4QNJA 4R2EA 3KZZA 1IMUA 2EMHA 4P7DA 4IFDF 4L5NC 4NXNI 4MU1A 4BS9A 1BBOA 4I3HA 1MGTA 3ZOQB 2EMFA 2RQLA 4P78A 4IFDA 2YZTA 3BF2A 5CFFE 4DUYE 4F2JC 1N3GA 2OI2A 4BA1A 4X9JA 4LF7E 4Z7CA 2M7QA 2EM2A 2EOHA 1UHZA 2JYAA 3C6KA 4OO1A 1KJKA 3M85D 2DB2A 2EM6A 2EE8A 1BB8A 1MEYC 3DD6A 2MC6A 3KZYA 5KL6A 3HTXA 2YRMA 2UUAI 3TQMA 2YPNA 2C38A 2L92A 4M30A 5A6KA 4X64I 2PO0B 4HACA 5TSEA 4DR3I 1MX0A 4DV2E 2YU8A 1EA6A 3THOB 2YTDA 3PYDA 2Z5BA 1FWLA 2YT4A 4B3SI 1BKNA 2VF3A 4L8NA 1T39A 4DV7E 4GKKI 1P47A 1FJGE 4DR4E 1TF6A 3ADLA 1Z0TA 4FK5C 1YHCA 1TN9A 4BMJA 2MKNA 1X3CA 1KTVA 2YTIA 4B3TI 1FWKA 3PYGA 2B3TB 4M1KA 4FN5A 3WU4A 5FWKA 4EMDA 2D9HA 4ZYDA 2A25A 4MLQA 1QNTA 4K0KI 1N32E 3BBGA 4BBYA 3F0NA 2FTXB 4DV1E 2EM7A 2PRTA 2K4VA 4JI5E 1Z1BA 1UBDC 5A69A 4DPXA 4M9VC 5C0XC 1L4SA 2V88A 2WZOA 2PNLA 4I8OA 1IBME 1ZAAC 4MU4A 1J5EI 2YSOA 1OYSA 2EMZA 2HC5A 2BV3A 2O3ZA 4J3DA 2HKJA 2CPNA 3PS1A 2H36X 5IT9Q 3VHTB 2C37B 3T1HE 5F3WA 2EM5A 5K36D 4BA2B 5IWAE 2EM3A 5KL4A 4DUZI 2EQ0A 1YYWA 2EOIA 2XEXA 2HGHA 1ZBQA 4F9AB 2CT1A 1UDOA 3C4BA 4JI4I 4R2DA 1XNRI 5FLXQ 1YZ9A 1HNZI 3JTZA 3Q1QA 2EWLA 4HY1A 2NN6E 5KL5A 4LFAI 1Z0WA 2G7HA 1ZM2A 2LRSA 3T1YE 4R2SA 4FW7A 2PNMA 2LJPA 4DR2I 4JI6I 2EQ3A 2L2NA 4LF8E 1PKPA 1XNQI 2VQEE 3ZKBA 2E1RA 3EQ1A 2HKEA 4IFDD 5IT9C 1UDNA 1WJPA 4GKJI 2V87A 3K6QA 2ZM6E 4YY3E 4AM3A 3J80C 3VYXA 1DARA 3ZZ0A 1SFEA 4AIDA 5AASA 3WU5A 2YTNA 2EPCA 4OO1D 2GLIA 1I94E 2IESA 4FWDA 2EMYA 2EOXA 2V85A 4JI1I 3HXLA 2EN8A 2DMIA 2EN2A 1XMOI 2UUCI 1A1FA 2GQ0A 1ZXNA 1H7UA 3L7ZB 1OYPA 1IBKI 1HNXI 3OTOI 5L3JA 2EPPA 2R42A 4JI2E 3U1YA 1EH8A 3MHHC 3ZZUA 2UUBI 2EL6A 2EN4A 2KONA 5DNYA 4Q28A 4JI0E 4JV5E 4R03A 4IZJA 2I9IA 4WSPA 4MQYA 3JAMQ 4LF4I 4DR6I 2EM4A 3P1XA 3P3EA 5LL6R 1AAYA 2HHHE 1IQOA 2NN6B 1N34I 2JE6A 4JYAE 4WUBA 3V5RA 4LFCI 4MYUA 4FWHA 3PRYA 5A2QQ 2A2CA 4NXNE 4ED4A 2V89A 5C0XF 1YFHA 3M6AA 4AQYI 2UXDI 2MDGA 2EFGA 3PS3A 4R2PA 5JEAC 4KWYA 3IWBA 2UU9I 3IWCA 5A6BA 1S16A 4X62I 3M7ND 1B69A 2WP8A 4LFBI 1N36I 2YTOA 4LCGA 1NZ0A 2NUFA 4LCHA 4DV4I 2F4VI 2YTGA 4X64E 2DLKA 5K36E 5LMNI 5KL3A 4LF9I 4NXMI 1OYRA 1A1JA 2JEBB 4BC9A 1Y6ZA 2EPUA 3HKMA 3CWVA 2CG9A 1X6HA 4NZVA 1VI7A 5C0XE 4B3SE 3J81Q 2DRPA 2EN7A 3EPJA 2X7IA 4GKKE 2EOJA 2JR1A 3M85G 2EM0A 5DNLA 4B3ME 1P42A 3Q6MA 1HNWI 4DV0E 3C4TA 1WRJA 2MDRA 2BM1A 4FWGA 3BGHA 4U3BA 4KHPI 2Z5CB 4RH8A 4HYMA 5ELWA 2YWQA 3KWRA 3QG5C 4DPWA 1A1LA 1B63A 4N4RB 1UN6B 4JI3E 2Q2EB 4IFDE 3HPSA 3QT8A 4FW3A 1YUJA 2EMXA 1UDQA 4IS9A 1H72C 1PVGA 1XMQI 2NA2A 1E3PA 1YYOA 4BHCA 2UXCI 1FI4A 1WHNA 4OO1E 4HEIA 5AC4A 2LCEA 2NPFA 2JEAA 2LTSA 2WNRA 4DUZE 1MU5A 3VYYA 4IJDA 5GMEA 3J7AM 5BR8E 2EMAA 1HR0E 2BBGA 1R6MA 1ELOA 2JWOA 4IZJD 2EOMA 2MKDA 2L2KB 5K36B 3AV0A 2K7IA 2DSYA 4JI4E 1XNRE 1DI2A 2ELYA 2EPMX 2GO4A 4MYTA 2EQ1A 2LBSB 1HNZE 1E3HA 2JXPA 2VRDA 3L00A 2O1WA 1USVA 4LFAE 1YYKA 2RPCA 3H1CA 4DV5E 1DGCA 3H4LA 1G2FC 1A6FA 2C39B 2PNZB 4M0VA 4IZKB 4RPFA 4F9CB 1PDAA 2CTDA 5LMUE 4DR2E 1FNMA 2DEJA 4MU0A 4DPYA 1XNQE 3F6GA 1T4OA 1NCSA 5JEAF 2ODRC 1NHHA 4GKJE 5C0XD 1J26A 2J65A 4WYQB 5A6BD 4X66E 2PO2A 4R2AA 1R6LA 3D4JA 2EZ6A 4DV2I 2PO1A 5JEAA 2IERA 2ADRA 4WX9A 1A1HA 4IFDB 3JU0A 2MC5A 2RSIA 4DR4I 2DGCA 1USUA 4BA1B 1G2DC 4UTGA 2EOOA 1XMOE 1YUIA 3RMPA 4RHBB 3HJCA 4O24A 4OO1B 1IBKE 1N33E 1HNXE 2LJHA 3OTOE 5DNXA 2V2QA 3LMLA 4FW4A 3CDJA 1N32I 2JPAA 4JI8I 1S4EA 2C38B 2X36A 4DPTA 5ADZA 4YHHI 2B7VA 4JI5I 2EJ4A 2BR2B 2M1SA 4X65E 1O0WA 2GS8A 4HACB 2LJUA 4DV3E 1X47A 1WHQA 2YTPA 5LLQA 4WFTA 4OKGA 3ADIA 3IWDA 5FLXC 2WBSA 4R2QA 4BCAA 1TF3A 2EPOA 2JVAA 2YRHA 4DR7E 1ZM9A 2Z5BB 3B78A 1ZU1A 1RHYA 2EMBA 2B9DA 4LFCE 1Y4UA 1IQSA 5IXMB 1ZR9A 2EMKA 1GTKA 2ELZA 1VISA 2LO3A 1NEIA 1STUA 2LUQA 2R76A 1YH8A 2ZBKB 3P76A 2CZ9A 2ENCA 2LVHA 3PYFA 5KL7A 3MHSC 2V83A 4MDTA 3J7Yp 1Z0BA 2NUGA 2R3VA 3B8HA 3M99B 1RREA 2I13A 2O1UA 4N3OA 4X62E 2AE8A 5AE2A 1KYQA 2A2DA 1HK7A 1GZ6A 1N36E 1IBLE 2YRKA 5GMDA 2EMWA 4LPFA 3U1KA 2PO0A 3GLLA
chains in the Genus database with same CATH topology
4B3RI 4DV4E 3VK6A 1Z0EA 1ZXMA 1N0UA 2ZM6I 5LMNE 4NXME 2E5LI 2HK3A 2V34A 2JOBA 1I94I 1GQEA 3DJWA 4DR1I 3JAMC 1HNWE 2VQFI 2Z5EA 2DIXA 2L2MA 4DKKA 2UUAE 4PU9A 3B82A 4KZSA 2FGGA 4LF5I 4JI2I 4XTJA 4KHPE 3ZKDA 4X8WA 4OX9I 4DR5I 4DR3E 1MG7A 4BC7A 5A2QC 4JI0I 3F6HA 1T4NA 2UXBI 1K47A 3H09A 1H7SA 2HFUA 2V2ZA 4LF6I 5T6JA 4M2ZA 3LTOA 4DV6I 1WUUA 4B3TE 3J7AG 1U2RA 1N0VC 4JI7I 4PRVA 4K0KE 1ZM4A 2L3CA 1UILA 4HXZA 4R8OA 2RTXA 1J5EE 3PYEA 1FKAE 2RSMA 4IZJB 2O1VA 2L6MA 1Z0GA 4P52A 3ZM7A 3J81C 4P7AA 4DU7A 2VE7C 2RS7A 2BM0A 4DU8A 2E1MA 4FW9A 3ADGA 2F8BA 4UT4A 2JY9A 4Z7YA 4DUYI 1RC7A 4LF7I 1PIEA 2VF1A 2KOUA 3AUZA 2V86A 4B3MI 4DV0I 1Y4SA 4JI6E 3WU6A 3ADJA 4DXLA 3QT5A 1ZM3A 2J7KA 2LMZA 5AE3A 4USMA 3LPSA 2RS6A 1KIJA 1KVKA 4JI8E 4YHHE 4TUGA 1RR9A 4URLA 4JI3I 3QT6A 3QT7A 3FIGA 4J8ZA 4DV7I 1FJGI 4JI1E 2UUCE 4PRXA 1ZBTA 3GONA 3WU3A 3J80Q 2ODRD 3DF6A 1EKZA 1NHJA 4LU9A 2HK2A 4F54A 5BR8I 2UUBE 1HR0I 1D6TA 4DV1I 1Z5CA 1QZRA 1WXRA 3ZZTA 2IHR1 1Z5BA 1EI1A 3HULA 1IBMI 4LF4E 5AE1A 2V8PA 4DR6E 2WW4A 4USKA 4DV5I 1N34E 3T1HI 1OJ4A 4OOGC 4WUDA 5LMUI 4TUIA 5IWAI 2L3JA 4WPYA 1Z59A 2LE2A 4B3RE 4JG4A 4X66I 4AQYE 2N3HA 2UXDE 3LNUA 2KHXA 2E5LE 2UU9E 2L8TA 3OMLA 3P06A 4ZVIA 4R1FA 1SR9A 4LFBE 3T1YI 1XHKA 2B7TA 4DR1E 3MSWA 4LF8I 2VQFE 1T4LB 2Z5CA 2VQEI 1H74A 3V2UC 1N33I 2IOQA 2F4VE 1KKHA 2IOPA 4LF5E 3Q6NA 2AJ4A 2V2VA 1RQ0A 4YY3I 1H73A 4OX9E 4DR5E 2LUPB 4LF9E 3HQ1A 1X49A 4WUCA 4X65I 1B62A 2UXBE 4DV3I 2N3GA 1DQ3A 2CGEA 4DMIA 2NUEA 4DR7I 4LF6E 4DV6E 3LLHA 2LTRA 4KQVA 2L33A 3K17A 1NHIA 4JI7E 1X48A 2HFSA 2V8QB 3HPZA 2JOXA 1Z0CA 1Z5AA 1UEKA 2O1TA 4JV5I 2DEIA 2DMYA 3K85A 4DPUA 2M4IA 4GEQB 1QU6A 1XMQE 4IZKA 1Z0VA 2ZITA 3K1JA 4LTYA 2HHHI 2UXCE 1IBLI 4JYAI 2FV4B 4F9BB 4P7DA 4L5NC 4NXNI 4BS9A 4I3HA 3ZOQB 4P78A 2YZTA 5CFFE 4DUYE 4Z7CA 2OI2A 4LF7E 2M7QA 1UHZA 2DB2A 2MC6A 3HTXA 2UUAI 2L92A 4M30A 4X64I 4HACA 4DR3I 1MX0A 4DV2E 1EA6A 3PYDA 2Z5BA 1FWLA 2YT4A 4B3SI 1BKNA 2VF3A 4L8NA 4GKKI 4DV7E 4DR4E 1FJGE 1Z0TA 3ADLA 4BMJA 1KTVA 4B3TI 1FWKA 3PYGA 2B3TB 4M1KA 4FN5A 3WU4A 5FWKA 4EMDA 4K0KI 1N32E 4BBYA 3F0NA 2FTXB 4DV1E 2K4VA 4JI5E 4DPXA 2V88A 2WZOA 2PNLA 4I8OA 1IBME 1J5EI 2BV3A 2HKJA 2CPNA 2H36X 5IT9Q 3T1HE 5F3WA 5IWAE 4DUZI 1YYWA 2XEXA 1ZBQA 4F9AB 3C4BA 4JI4I 1XNRI 5FLXQ 1YZ9A 1HNZI 3JTZA 3Q1QA 2EWLA 4HY1A 4LFAI 1Z0WA 2G7HA 1ZM2A 2LRSA 3T1YE 2PNMA 2LJPA 4DR2I 4JI6I 4LF8E 2L2NA 1PKPA 1XNQI 2VQEE 3ZKBA 2E1RA 2HKEA 5IT9C 4GKJI 2V87A 3K6QA 2ZM6E 4YY3E 3J80C 1DARA 3VYXA 3ZZ0A 5AASA 3WU5A 4FWDA 1I94E 2V85A 4JI1I 3HXLA 2UUCI 1XMOI 2GQ0A 1ZXNA 1H7UA 1IBKI 1HNXI 3OTOI 5L3JA 2R42A 4JI2E 3ZZUA 2UUBI 5DNYA 2KONA 4Q28A 4JI0E 4JV5E 4R03A 4IZJA 4WSPA 3JAMQ 4LF4I 4DR6I 3P1XA 5LL6R 2HHHE 1N34I 4JYAE 4WUBA 3V5RA 4LFCI 4MYUA 4FWHA 3PRYA 5A2QQ 2A2CA 4NXNE 4ED4A 2V89A 3M6AA 4AQYI 2UXDI 2EFGA 3IWBA 2UU9I 3IWCA 1S16A 4X62I 4LFBI 1N36I 1NZ0A 2NUFA 4DV4I 2F4VI 4X64E 5LMNI 4LF9I 4NXMI 4BC9A 1Y6ZA 3CWVA 2CG9A 4B3SE 3J81Q 2X7IA 4GKKE 2JR1A 1HNWI 4B3ME 3Q6MA 4DV0E 3C4TA 4FWGA 2MDRA 2BM1A 4KHPI 2Z5CB 4HYMA 3KWRA 4DPWA 1B63A 4JI3E 2Q2EB 3HPSA 3QT8A 1H72C 1PVGA 1XMQI 2NA2A 1YYOA 2UXCI 1FI4A 1WHNA 2NPFA 2LTSA 4DUZE 1MU5A 3VYYA 5GMEA 3J7AM 5BR8E 1HR0E 1ELOA 2JWOA 4IZJD 2L2KB 3AV0A 2DSYA 4JI4E 1XNRE 1DI2A 4MYTA 2LBSB 1HNZE 2O1WA 1USVA 4LFAE 1YYKA 3H4LA 4DV5E 1A6FA 4M0VA 4IZKB 4RPFA 4F9CB 5LMUE 4DR2E 1FNMA 2DEJA 4DPYA 1XNQE 3F6GA 1T4OA 2ODRC 1NHHA 4GKJE 1J26A 3D4JA 4WYQB 4X66E 4DV2I 2EZ6A 3JU0A 2MC5A 4DR4I 1USUA 4UTGA 1XMOE 3RMPA 3HJCA 1IBKE 1N33E 1HNXE 2LJHA 3OTOE 2V2QA 3LMLA 1N32I 4JI8I 1S4EA 4YHHI 2X36A 4DPTA 5ADZA 2B7VA 4JI5I 2M1SA 4X65E 1O0WA 2GS8A 4HACB 4DV3E 1X47A 1WHQA 4WFTA 3ADIA 3IWDA 5FLXC 2Z5BB 4BCAA 3B78A 4DR7E 2JVAA 1ZM9A 2B9DA 4LFCE 1Y4UA 1VISA 2LUQA 1STUA 2ZBKB 2CZ9A 3PYFA 2V83A 3J7Yp 1Z0BA 2NUGA 2R3VA 3B8HA 2O1UA 1RREA 4N3OA 4X62E 5AE2A 2A2DA 1HK7A 1GZ6A 1N36E 1IBLE 5GMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R I;  4DV4 E;  1Z0E A;  1ZXM A;  1N0U A;  2ZM6 I;  5LMN E;  4NXM E;  2E5L I;  2HK3 A;  2V34 A;  1I94 I;  1GQE A;  4DR1 I;  1HNW E;  3JAM C;  2VQF I;  2DIX A;  2L2M A;  4DKK A;  2UUA E;  4PU9 A;  3B82 A;  4LF5 I;  4JI2 I;  4XTJ A;  4KHP E;  3ZKD A;  4X8W A;  4OX9 I;  4DR5 I;  4DR3 E;  1MG7 A;  5A2Q C;  4JI0 I;  1T4N A;  2UXB I;  1K47 A;  1H7S A;  2HFU A;  2V2Z A;  4LF6 I;  4M2Z A;  3LTO A;  4DV6 I;  1WUU A;  4B3T E;  3J7A G;  1U2R A;  1N0V C;  4JI7 I;  4PRV A;  4K0K E;  1ZM4 A;  2L3C A;  1UIL A;  4HXZ A;  2RTX A;  1J5E E;  3PYE A;  1FKA E;  2RSM A;  4P52 A;  1Z0G A;  3ZM7 A;  3J81 C;  4P7A A;  4DU7 A;  2RS7 A;  2BM0 A;  4DU8 A;  4FW9 A;  3ADG A;  4UT4 A;  2JY9 A;  4Z7Y A;  4DUY I;  1RC7 A;  4LF7 I;  1PIE A;  4B3M I;  4DV0 I;  4JI6 E;  3WU6 A;  3ADJ A;  4DXL A;  3QT5 A;  1ZM3 A;  2J7K A;  4USM A;  3LPS A;  2RS6 A;  1KIJ A;  1KVK A;  4JI8 E;  4YHH E;  1RR9 A;  4URL A;  4JI3 I;  3QT6 A;  3QT7 A;  4DV7 I;  1FJG I;  4JI1 E;  2UUC E;  4PRX A;  1ZBT A;  3GON A;  3WU3 A;  3J80 Q;  1EKZ A;  1NHJ A;  2HK2 A;  5BR8 I;  2UUB E;  1HR0 I;  1D6T A;  4DV1 I;  1Z5C A;  1QZR A;  3ZZT A;  2IHR 1;  1Z5B A;  1EI1 A;  3HUL A;  1IBM I;  4LF4 E;  2V8P A;  4DR6 E;  2WW4 A;  4USK A;  4DV5 I;  1N34 E;  3T1H I;  1OJ4 A;  4OOG C;  4WUD A;  5LMU I;  5IWA I;  2L3J A;  1Z59 A;  4B3R E;  4JG4 A;  4X66 I;  4AQY E;  2N3H A;  2UXD E;  3LNU A;  2KHX A;  2E5L E;  2UU9 E;  4ZVI A;  4R1F A;  4LFB E;  3T1Y I;  1XHK A;  2B7T A;  4DR1 E;  4LF8 I;  2VQF E;  1T4L B;  2VQE I;  1H74 A;  3V2U C;  1N33 I;  2F4V E;  1KKH A;  4LF5 E;  2AJ4 A;  2V2V A;  1RQ0 A;  4YY3 I;  1H73 A;  4OX9 E;  4DR5 E;  2LUP B;  4LF9 E;  1X49 A;  4WUC A;  4X65 I;  1B62 A;  2UXB E;  4DV3 I;  2N3G A;  2NUE A;  4DR7 I;  4LF6 E;  4DV6 E;  3LLH A;  2LTR A;  4KQV A;  2L33 A;  3K17 A;  1NHI A;  4JI7 E;  1X48 A;  2HFS A;  1Z0C A;  1Z5A A;  1UEK A;  4JV5 I;  2DEI A;  2DMY A;  4DPU A;  1QU6 A;  1XMQ E;  1Z0V A;  2ZIT A;  3K1J A;  2HHH I;  2UXC E;  1IBL I;  4JYA I;  4NXN I;  4I3H A;  5CFF E;  4DUY E;  4Z7C A;  2OI2 A;  4LF7 E;  1UHZ A;  2DB2 A;  3HTX A;  2UUA I;  4M30 A;  4X64 I;  4HAC A;  4DR3 I;  1MX0 A;  4DV2 E;  1EA6 A;  3PYD A;  1FWL A;  2YT4 A;  4B3S I;  1BKN A;  2VF3 A;  4GKK I;  4DV7 E;  4DR4 E;  1FJG E;  1Z0T A;  3ADL A;  1KTV A;  4B3T I;  1FWK A;  3PYG A;  2B3T B;  4M1K A;  4FN5 A;  3WU4 A;  4EMD A;  4K0K I;  1N32 E;  3F0N A;  4DV1 E;  4JI5 E;  4DPX A;  1IBM E;  1J5E I;  2BV3 A;  2HKJ A;  2CPN A;  5IT9 Q;  3T1H E;  5IWA E;  4DUZ I;  1YYW A;  2XEX A;  3C4B A;  4JI4 I;  1XNR I;  5FLX Q;  1YZ9 A;  1HNZ I;  3Q1Q A;  4HY1 A;  4LFA I;  1Z0W A;  1ZM2 A;  2LRS A;  3T1Y E;  2LJP A;  4DR2 I;  4JI6 I;  4LF8 E;  2L2N A;  1PKP A;  1XNQ I;  2VQE E;  3ZKB A;  2E1R A;  2HKE A;  5IT9 C;  4GKJ I;  2ZM6 E;  4YY3 E;  3VYX A;  1DAR A;  3ZZ0 A;  3J80 C;  3WU5 A;  4FWD A;  1I94 E;  4JI1 I;  2UUC I;  1XMO I;  1ZXN A;  1H7U A;  1IBK I;  1HNX I;  3OTO I;  5L3J A;  2R42 A;  4JI2 E;  3ZZU A;  2UUB I;  4JI0 E;  4JV5 E;  3JAM Q;  4LF4 I;  4DR6 I;  3P1X A;  5LL6 R;  2HHH E;  1N34 I;  4JYA E;  4WUB A;  3V5R A;  4LFC I;  4MYU A;  4FWH A;  5A2Q Q;  2A2C A;  4NXN E;  4ED4 A;  3M6A A;  4AQY I;  2UXD I;  2EFG A;  2UU9 I;  1S16 A;  4X62 I;  4LFB I;  1N36 I;  1NZ0 A;  2NUF A;  4DV4 I;  2F4V I;  4X64 E;  5LMN I;  4LF9 I;  4NXM I;  3CWV A;  4B3S E;  3J81 Q;  2X7I A;  4GKK E;  1HNW I;  4B3M E;  4DV0 E;  3C4T A;  4FWG A;  2MDR A;  2BM1 A;  4KHP I;  4HYM A;  4DPW A;  1B63 A;  4JI3 E;  2Q2E B;  3QT8 A;  1H72 C;  1PVG A;  1XMQ I;  2NA2 A;  1YYO A;  2UXC I;  1FI4 A;  1WHN A;  2NPF A;  2LTS A;  4DUZ E;  1MU5 A;  3VYY A;  5GME A;  3J7A M;  5BR8 E;  1HR0 E;  1ELO A;  2L2K B;  4JI4 E;  1XNR E;  1DI2 A;  4MYT A;  2LBS B;  1HNZ E;  4LFA E;  1YYK A;  3H4L A;  4DV5 E;  1A6F A;  4RPF A;  5LMU E;  4DR2 E;  1FNM A;  2DEJ A;  4DPY A;  1XNQ E;  1T4O A;  1NHH A;  4GKJ E;  1J26 A;  3D4J A;  4WYQ B;  4X66 E;  4DV2 I;  2EZ6 A;  4DR4 I;  4UTG A;  1XMO E;  1IBK E;  1N33 E;  1HNX E;  2LJH A;  3OTO E;  2V2Q A;  1N32 I;  4JI8 I;  1S4E A;  4YHH I;  2X36 A;  4DPT A;  2B7V A;  4JI5 I;  4X65 E;  1O0W A;  2GS8 A;  4HAC B;  4DV3 E;  1X47 A;  1WHQ A;  4WFT A;  3ADI A;  5FLX C;  3B78 A;  4DR7 E;  2JVA A;  1ZM9 A;  4LFC E;  1VIS A;  2LUQ A;  1STU A;  2ZBK B;  2CZ9 A;  3PYF A;  3J7Y p;  1Z0B A;  2NUG A;  2R3V A;  3B8H A;  1RRE A;  4X62 E;  2A2D A;  1N36 E;  1IBL E;  5GMD A; 
#chains in the Genus database with same CATH topology
 3ECR A;  4B3R I;  4DV4 E;  3VK6 A;  1Z0E A;  1ZXM A;  1N0U A;  2ZM6 I;  4ZYH A;  2EPZ A;  2EOY A;  5LMN E;  2NAB A;  4NXM E;  2EMG A;  2E5L I;  2HK3 A;  2NN6 C;  2V34 A;  2JOB A;  4ZYE A;  1I94 I;  1GQE A;  3M7N G;  3GME A;  3DJW A;  4WXD A;  3BID A;  2EP3 A;  4DR1 I;  3JAM C;  1HNW E;  2VQF I;  2Z5E A;  2DIX A;  3CDI A;  2L2M A;  4DKK A;  2UUA E;  3PS2 A;  4AIM A;  1EH7 A;  4PU9 A;  3B82 A;  4KZS A;  2FGG A;  2BA0 D;  4JI2 I;  4LF5 I;  4XTJ A;  4KHP E;  3ZKD A;  3C6M A;  2ENA A;  4X8W A;  2YTQ A;  5JEA D;  4DR5 I;  4OX9 I;  2EML A;  4DR3 E;  2EL4 A;  3THN A;  1LLM C;  4BC7 A;  5A2Q C;  1MG7 A;  4JI0 I;  3F6H A;  5EKW A;  2EPX A;  2YTE A;  2WBU A;  1T4N A;  2UXB I;  1K47 A;  3H09 A;  1H7S A;  2C39 A;  2C37 A;  2HFU A;  5KL2 A;  2V2Z A;  4ISA A;  4BA2 A;  2EMC A;  2EOR A;  4LF6 I;  5T6J A;  4M2Z A;  3LTO A;  4DV6 I;  1WUU A;  4B3T E;  2EM9 A;  2EN6 A;  1EH6 A;  3J7A G;  1U2R A;  5DRO A;  1N0V C;  4JI7 I;  4PRV A;  4K0K E;  4HTG A;  1ZM4 A;  2L3C A;  1PJT A;  1UIL A;  4HXZ A;  5DRP A;  2BB8 A;  1JK1 A;  4R8O A;  2RTX A;  1J5E E;  3PYE A;  1FKA E;  2RSM A;  4IZJ B;  2O1V A;  4LOM A;  4NBQ A;  2EL5 A;  2WBT A;  1YPN A;  2L6M A;  4Q35 B;  4R2C A;  1Z0G A;  4P52 A;  3ZM7 A;  3J81 C;  2EOS A;  4P7A A;  4DU7 A;  1BBG A;  3EPH A;  2VE7 C;  2F1D A;  2JE6 B;  4O4K A;  2RS7 A;  2BM0 A;  2BR2 A;  4DU8 A;  4BHB A;  2E1M A;  2BA1 D;  2BA1 G;  4F6N A;  3ADG A;  2F8B A;  4FW9 A;  4UT4 A;  2JY9 A;  3EPK A;  4R2R A;  4ZYG A;  4Z7Y A;  4DUY I;  1RC7 A;  4LF7 I;  2GPI A;  1PIE A;  4MU3 A;  2EN3 A;  5EL9 A;  2VF1 A;  3L7Z A;  2KOU A;  5C0X B;  1X6F A;  2EOE A;  3AUZ A;  2EOF A;  2V86 A;  4B3M I;  4DV0 I;  1Y4S A;  1A1I A;  4JI6 E;  3WU6 A;  2VES A;  3ADJ A;  2WP8 B;  4DXL A;  2YTF A;  1RMD A;  4WXC A;  3QT5 A;  1ZM3 A;  2J7K A;  5K36 C;  2LMZ A;  5AE3 A;  1UDS A;  4USM A;  3LPS A;  2RS6 A;  1KIJ A;  1KVK A;  4JI8 E;  4YHH E;  4TUG A;  1T38 A;  1RR9 A;  2NN6 F;  3QT6 A;  4URL A;  3QT7 A;  4JI3 I;  3FIG A;  4J8Z A;  2NN6 A;  4WSG A;  4DV7 I;  3GCM A;  1FJG I;  4JI1 E;  1A1K A;  2UUC E;  4PRX A;  1ZBT A;  3GON A;  4IS1 C;  1PJQ A;  2J7J A;  3WU3 A;  3J80 Q;  2ODR D;  3DF6 A;  1EKZ A;  1NHJ A;  4LU9 A;  2HK2 A;  4F54 A;  5BR8 I;  2UUB E;  1HR0 I;  1D6T A;  4LCF A;  1Z5C A;  4DV1 I;  4IFD C;  2EMI A;  2EPN A;  1QZR A;  1WXR A;  5DRR A;  3ZZT A;  2IHR 1;  1Z5B A;  4GZN C;  4FW5 A;  1EI1 A;  3HUL A;  2EPL X;  5JEA E;  1IBM I;  2N8X A;  4U3D A;  4LF4 E;  1YSA C;  5AE1 A;  4NHR A;  1XXE A;  4DR6 E;  2V8P A;  4OO1 C;  2WW4 A;  4USK A;  4DV5 I;  3B4T A;  1N34 E;  2EPK X;  5DRQ A;  3T1H I;  1OJ4 A;  4OOG C;  3KRN A;  4WUD A;  5LMU I;  4TUI A;  5IWA I;  2L3J A;  4WPY A;  1Z59 A;  2LE2 A;  2EOZ A;  2DLQ A;  4B3R E;  4JG4 A;  2JEB A;  2JEA B;  2WNR B;  2CSH A;  4X66 I;  4AQY E;  2N3H A;  2UXD E;  3LNU A;  2EOQ A;  4MLV A;  2KHX A;  2E5L E;  2UU9 E;  2EM8 A;  2M9A A;  2L8T A;  3OML A;  3P06 A;  4ZVI A;  5A6A A;  4R1F A;  1SR9 A;  1F2I G;  4LFB E;  2E72 A;  2B7T A;  5AC5 A;  4DR1 E;  1XHK A;  3T1Y I;  3MSW A;  4LF8 I;  2VQF E;  1T4L B;  2Z5C A;  2VQE I;  1H74 A;  3V2U C;  1N33 I;  2IOQ A;  2R1F A;  2F4V E;  1KKH A;  2IOP A;  2WCC 3;  1X5W A;  4LF5 E;  4FW6 A;  3Q6N A;  2LT7 A;  2AJ4 A;  4O43 A;  2V2V A;  1RQ0 A;  4YY3 I;  1H73 A;  4OX9 E;  2ENH A;  2YTJ A;  4DR5 E;  4O5G A;  2LUP B;  4LF9 E;  3HQ1 A;  1X49 A;  1AH5 A;  4WUC A;  3UHM A;  4X65 I;  1B62 A;  1Y5Y A;  2PO2 B;  2UXB E;  4OO1 F;  2YSP A;  2PO1 B;  2Q8U A;  4DV3 I;  1JK2 A;  4OZE A;  5JEA B;  5IV8 B;  2N3G A;  2JP9 A;  1DQ3 A;  2CGE A;  4DMI A;  2NUE A;  4DR7 I;  3UK3 C;  2JT2 A;  4LF6 E;  5K36 F;  4DV6 E;  3LLH A;  2GO3 A;  2LTR A;  4KQV A;  2L33 A;  3K17 A;  1NHI A;  2BA0 G;  2EPA A;  2YU5 A;  4JI7 E;  1A1G A;  3P3C A;  5K36 A;  1X48 A;  5A6J A;  2CVE A;  4F6M A;  2HFS A;  2V8Q B;  1Y60 A;  1X6E A;  3HPZ A;  2JOX A;  3EPL A;  2NN6 D;  1Z0C A;  1Z5A A;  1UEK A;  2O1T A;  4JV5 I;  2DEI A;  3P3G A;  4GQU A;  2DMY A;  3K85 A;  5C0X A;  4DPU A;  2M4I A;  2PNZ A;  1PJS A;  4GEQ B;  1QU6 A;  2EN1 A;  2EPR A;  1XMQ E;  4IZK A;  1Z0V A;  2ZIT A;  3K1J A;  4LTY A;  3NZK A;  2UXC E;  2HJJ A;  2HHH I;  2GHF A;  1IBL I;  2LV2 A;  2FV4 B;  4JYA I;  4F9B B;  4QNK A;  4QNJ A;  4R2E A;  3KZZ A;  1IMU A;  2EMH A;  4P7D A;  4IFD F;  4L5N C;  4NXN I;  4MU1 A;  4BS9 A;  1BBO A;  4I3H A;  1MGT A;  3ZOQ B;  2EMF A;  2RQL A;  4P78 A;  4IFD A;  2YZT A;  3BF2 A;  5CFF E;  4DUY E;  4F2J C;  1N3G A;  2OI2 A;  4BA1 A;  4X9J A;  4LF7 E;  4Z7C A;  2M7Q A;  2EM2 A;  2EOH A;  1UHZ A;  2JYA A;  3C6K A;  4OO1 A;  1KJK A;  3M85 D;  2DB2 A;  2EM6 A;  2EE8 A;  1BB8 A;  1MEY C;  3DD6 A;  2MC6 A;  3KZY A;  5KL6 A;  3HTX A;  2YRM A;  2UUA I;  3TQM A;  2YPN A;  2C38 A;  2L92 A;  4M30 A;  5A6K A;  4X64 I;  2PO0 B;  4HAC A;  5TSE A;  4DR3 I;  1MX0 A;  4DV2 E;  2YU8 A;  1EA6 A;  3THO B;  2YTD A;  3PYD A;  2Z5B A;  1FWL A;  2YT4 A;  4B3S I;  1BKN A;  2VF3 A;  4L8N A;  1T39 A;  4DV7 E;  4GKK I;  1P47 A;  1FJG E;  4DR4 E;  1TF6 A;  3ADL A;  1Z0T A;  4FK5 C;  1YHC A;  1TN9 A;  4BMJ A;  2MKN A;  1X3C A;  1KTV A;  2YTI A;  4B3T I;  1FWK A;  3PYG A;  2B3T B;  4M1K A;  4FN5 A;  3WU4 A;  5FWK A;  4EMD A;  2D9H A;  4ZYD A;  2A25 A;  4MLQ A;  1QNT A;  4K0K I;  1N32 E;  3BBG A;  4BBY A;  3F0N A;  2FTX B;  4DV1 E;  2EM7 A;  2PRT A;  2K4V A;  4JI5 E;  1Z1B A;  1UBD C;  5A69 A;  4DPX A;  4M9V C;  5C0X C;  1L4S A;  2V88 A;  2WZO A;  2PNL A;  4I8O A;  1IBM E;  1ZAA C;  4MU4 A;  1J5E I;  2YSO A;  1OYS A;  2EMZ A;  2HC5 A;  2BV3 A;  2O3Z A;  4J3D A;  2HKJ A;  2CPN A;  3PS1 A;  2H36 X;  5IT9 Q;  3VHT B;  2C37 B;  3T1H E;  5F3W A;  2EM5 A;  5K36 D;  4BA2 B;  5IWA E;  2EM3 A;  5KL4 A;  4DUZ I;  2EQ0 A;  1YYW A;  2EOI A;  2XEX A;  2HGH A;  1ZBQ A;  4F9A B;  2CT1 A;  1UDO A;  3C4B A;  4JI4 I;  4R2D A;  1XNR I;  5FLX Q;  1YZ9 A;  1HNZ I;  3JTZ A;  3Q1Q A;  2EWL A;  4HY1 A;  2NN6 E;  5KL5 A;  4LFA I;  1Z0W A;  2G7H A;  1ZM2 A;  2LRS A;  3T1Y E;  4R2S A;  4FW7 A;  2PNM A;  2LJP A;  4DR2 I;  4JI6 I;  2EQ3 A;  2L2N A;  4LF8 E;  1PKP A;  1XNQ I;  2VQE E;  3ZKB A;  2E1R A;  3EQ1 A;  2HKE A;  4IFD D;  5IT9 C;  1UDN A;  1WJP A;  4GKJ I;  2V87 A;  3K6Q A;  2ZM6 E;  4YY3 E;  4AM3 A;  3J80 C;  3VYX A;  1DAR A;  3ZZ0 A;  1SFE A;  4AID A;  5AAS A;  3WU5 A;  2YTN A;  2EPC A;  4OO1 D;  2GLI A;  1I94 E;  2IES A;  4FWD A;  2EMY A;  2EOX A;  2V85 A;  4JI1 I;  3HXL A;  2EN8 A;  2DMI A;  2EN2 A;  1XMO I;  2UUC I;  1A1F A;  2GQ0 A;  1ZXN A;  1H7U A;  3L7Z B;  1OYP A;  1IBK I;  1HNX I;  3OTO I;  5L3J A;  2EPP A;  2R42 A;  4JI2 E;  3U1Y A;  1EH8 A;  3MHH C;  3ZZU A;  2UUB I;  2EL6 A;  2EN4 A;  2KON A;  5DNY A;  4Q28 A;  4JI0 E;  4JV5 E;  4R03 A;  4IZJ A;  2I9I A;  4WSP A;  4MQY A;  3JAM Q;  4LF4 I;  4DR6 I;  2EM4 A;  3P1X A;  3P3E A;  5LL6 R;  1AAY A;  2HHH E;  1IQO A;  2NN6 B;  1N34 I;  2JE6 A;  4JYA E;  4WUB A;  3V5R A;  4LFC I;  4MYU A;  4FWH A;  3PRY A;  5A2Q Q;  2A2C A;  4NXN E;  4ED4 A;  2V89 A;  5C0X F;  1YFH A;  3M6A A;  4AQY I;  2UXD I;  2MDG A;  2EFG A;  3PS3 A;  4R2P A;  5JEA C;  4KWY A;  3IWB A;  2UU9 I;  3IWC A;  5A6B A;  1S16 A;  4X62 I;  3M7N D;  1B69 A;  2WP8 A;  4LFB I;  1N36 I;  2YTO A;  4LCG A;  1NZ0 A;  2NUF A;  4LCH A;  4DV4 I;  2F4V I;  2YTG A;  4X64 E;  2DLK A;  5K36 E;  5LMN I;  5KL3 A;  4LF9 I;  4NXM I;  1OYR A;  1A1J A;  2JEB B;  4BC9 A;  1Y6Z A;  2EPU A;  3HKM A;  3CWV A;  2CG9 A;  1X6H A;  4NZV A;  1VI7 A;  5C0X E;  4B3S E;  3J81 Q;  2DRP A;  2EN7 A;  3EPJ A;  2X7I A;  4GKK E;  2EOJ A;  2JR1 A;  3M85 G;  2EM0 A;  5DNL A;  4B3M E;  1P42 A;  3Q6M A;  1HNW I;  4DV0 E;  3C4T A;  1WRJ A;  2MDR A;  2BM1 A;  4FWG A;  3BGH A;  4U3B A;  4KHP I;  2Z5C B;  4RH8 A;  4HYM A;  5ELW A;  2YWQ A;  3KWR A;  3QG5 C;  4DPW A;  1A1L A;  1B63 A;  4N4R B;  1UN6 B;  4JI3 E;  2Q2E B;  4IFD E;  3HPS A;  3QT8 A;  4FW3 A;  1YUJ A;  2EMX A;  1UDQ A;  4IS9 A;  1H72 C;  1PVG A;  1XMQ I;  2NA2 A;  1E3P A;  1YYO A;  4BHC A;  2UXC I;  1FI4 A;  1WHN A;  4OO1 E;  4HEI A;  5AC4 A;  2LCE A;  2NPF A;  2JEA A;  2LTS A;  2WNR A;  4DUZ E;  1MU5 A;  3VYY A;  4IJD A;  5GME A;  3J7A M;  5BR8 E;  2EMA A;  1HR0 E;  2BBG A;  1R6M A;  1ELO A;  2JWO A;  4IZJ D;  2EOM A;  2MKD A;  2L2K B;  5K36 B;  3AV0 A;  2K7I A;  2DSY A;  4JI4 E;  1XNR E;  1DI2 A;  2ELY A;  2EPM X;  2GO4 A;  4MYT A;  2EQ1 A;  2LBS B;  1HNZ E;  1E3H A;  2JXP A;  2VRD A;  3L00 A;  2O1W A;  1USV A;  4LFA E;  1YYK A;  2RPC A;  3H1C A;  4DV5 E;  1DGC A;  3H4L A;  1G2F C;  1A6F A;  2C39 B;  2PNZ B;  4M0V A;  4IZK B;  4RPF A;  4F9C B;  1PDA A;  2CTD A;  5LMU E;  4DR2 E;  1FNM A;  2DEJ A;  4MU0 A;  4DPY A;  1XNQ E;  3F6G A;  1T4O A;  1NCS A;  5JEA F;  2ODR C;  1NHH A;  4GKJ E;  5C0X D;  1J26 A;  2J65 A;  4WYQ B;  5A6B D;  4X66 E;  2PO2 A;  4R2A A;  1R6L A;  3D4J A;  2EZ6 A;  4DV2 I;  2PO1 A;  5JEA A;  2IER A;  2ADR A;  4WX9 A;  1A1H A;  4IFD B;  3JU0 A;  2MC5 A;  2RSI A;  4DR4 I;  2DGC A;  1USU A;  4BA1 B;  1G2D C;  4UTG A;  2EOO A;  1XMO E;  1YUI A;  3RMP A;  4RHB B;  3HJC A;  4O24 A;  4OO1 B;  1IBK E;  1N33 E;  1HNX E;  2LJH A;  3OTO E;  5DNX A;  2V2Q A;  3LML A;  4FW4 A;  3CDJ A;  1N32 I;  2JPA A;  4JI8 I;  1S4E A;  2C38 B;  2X36 A;  4DPT A;  5ADZ A;  4YHH I;  2B7V A;  4JI5 I;  2EJ4 A;  2BR2 B;  2M1S A;  4X65 E;  1O0W A;  2GS8 A;  4HAC B;  2LJU A;  4DV3 E;  1X47 A;  1WHQ A;  2YTP A;  5LLQ A;  4WFT A;  4OKG A;  3ADI A;  3IWD A;  5FLX C;  2WBS A;  4R2Q A;  4BCA A;  1TF3 A;  2EPO A;  2JVA A;  2YRH A;  4DR7 E;  1ZM9 A;  2Z5B B;  3B78 A;  1ZU1 A;  1RHY A;  2EMB A;  2B9D A;  4LFC E;  1Y4U A;  1IQS A;  5IXM B;  1ZR9 A;  2EMK A;  1GTK A;  2ELZ A;  1VIS A;  2LO3 A;  1NEI A;  1STU A;  2LUQ A;  2R76 A;  1YH8 A;  2ZBK B;  3P76 A;  2CZ9 A;  2ENC A;  2LVH A;  3PYF A;  5KL7 A;  3MHS C;  2V83 A;  4MDT A;  3J7Y p;  1Z0B A;  2NUG A;  2R3V A;  3B8H A;  3M99 B;  1RRE A;  2I13 A;  2O1U A;  4N3O A;  4X62 E;  2AE8 A;  5AE2 A;  1KYQ A;  2A2D A;  1HK7 A;  1GZ6 A;  1N36 E;  1IBL E;  2YRK A;  5GMD A;  2EMW A;  4LPF A;  3U1K A;  2PO0 A;  3GLL A; 
#chains in the Genus database with same CATH homology
 4B3R I;  4DV4 E;  3VK6 A;  1Z0E A;  1ZXM A;  1N0U A;  2ZM6 I;  5LMN E;  4NXM E;  2E5L I;  2HK3 A;  2V34 A;  2JOB A;  1I94 I;  1GQE A;  3DJW A;  4DR1 I;  3JAM C;  1HNW E;  2VQF I;  2Z5E A;  2DIX A;  2L2M A;  4DKK A;  2UUA E;  4PU9 A;  3B82 A;  4KZS A;  2FGG A;  4LF5 I;  4JI2 I;  4XTJ A;  4KHP E;  3ZKD A;  4X8W A;  4OX9 I;  4DR5 I;  4DR3 E;  1MG7 A;  4BC7 A;  5A2Q C;  4JI0 I;  3F6H A;  1T4N A;  2UXB I;  1K47 A;  3H09 A;  1H7S A;  2HFU A;  2V2Z A;  4LF6 I;  5T6J A;  4M2Z A;  3LTO A;  4DV6 I;  1WUU A;  4B3T E;  3J7A G;  1U2R A;  1N0V C;  4JI7 I;  4PRV A;  4K0K E;  1ZM4 A;  2L3C A;  1UIL A;  4HXZ A;  4R8O A;  2RTX A;  1J5E E;  3PYE A;  1FKA E;  2RSM A;  4IZJ B;  2O1V A;  2L6M A;  1Z0G A;  4P52 A;  3ZM7 A;  3J81 C;  4P7A A;  4DU7 A;  2VE7 C;  2RS7 A;  2BM0 A;  4DU8 A;  2E1M A;  4FW9 A;  3ADG A;  2F8B A;  4UT4 A;  2JY9 A;  4Z7Y A;  4DUY I;  1RC7 A;  4LF7 I;  1PIE A;  2VF1 A;  2KOU A;  3AUZ A;  2V86 A;  4B3M I;  4DV0 I;  1Y4S A;  4JI6 E;  3WU6 A;  3ADJ A;  4DXL A;  3QT5 A;  1ZM3 A;  2J7K A;  2LMZ A;  5AE3 A;  4USM A;  3LPS A;  2RS6 A;  1KIJ A;  1KVK A;  4JI8 E;  4YHH E;  4TUG A;  1RR9 A;  4URL A;  4JI3 I;  3QT6 A;  3QT7 A;  3FIG A;  4J8Z A;  4DV7 I;  1FJG I;  4JI1 E;  2UUC E;  4PRX A;  1ZBT A;  3GON A;  3WU3 A;  3J80 Q;  2ODR D;  3DF6 A;  1EKZ A;  1NHJ A;  4LU9 A;  2HK2 A;  4F54 A;  5BR8 I;  2UUB E;  1HR0 I;  1D6T A;  4DV1 I;  1Z5C A;  1QZR A;  1WXR A;  3ZZT A;  2IHR 1;  1Z5B A;  1EI1 A;  3HUL A;  1IBM I;  4LF4 E;  5AE1 A;  2V8P A;  4DR6 E;  2WW4 A;  4USK A;  4DV5 I;  1N34 E;  3T1H I;  1OJ4 A;  4OOG C;  4WUD A;  5LMU I;  4TUI A;  5IWA I;  2L3J A;  4WPY A;  1Z59 A;  2LE2 A;  4B3R E;  4JG4 A;  4X66 I;  4AQY E;  2N3H A;  2UXD E;  3LNU A;  2KHX A;  2E5L E;  2UU9 E;  2L8T A;  3OML A;  3P06 A;  4ZVI A;  4R1F A;  1SR9 A;  4LFB E;  3T1Y I;  1XHK A;  2B7T A;  4DR1 E;  3MSW A;  4LF8 I;  2VQF E;  1T4L B;  2Z5C A;  2VQE I;  1H74 A;  3V2U C;  1N33 I;  2IOQ A;  2F4V E;  1KKH A;  2IOP A;  4LF5 E;  3Q6N A;  2AJ4 A;  2V2V A;  1RQ0 A;  4YY3 I;  1H73 A;  4OX9 E;  4DR5 E;  2LUP B;  4LF9 E;  3HQ1 A;  1X49 A;  4WUC A;  4X65 I;  1B62 A;  2UXB E;  4DV3 I;  2N3G A;  1DQ3 A;  2CGE A;  4DMI A;  2NUE A;  4DR7 I;  4LF6 E;  4DV6 E;  3LLH A;  2LTR A;  4KQV A;  2L33 A;  3K17 A;  1NHI A;  4JI7 E;  1X48 A;  2HFS A;  2V8Q B;  3HPZ A;  2JOX A;  1Z0C A;  1Z5A A;  1UEK A;  2O1T A;  4JV5 I;  2DEI A;  2DMY A;  3K85 A;  4DPU A;  2M4I A;  4GEQ B;  1QU6 A;  1XMQ E;  4IZK A;  1Z0V A;  2ZIT A;  3K1J A;  4LTY A;  2HHH I;  2UXC E;  1IBL I;  4JYA I;  2FV4 B;  4F9B B;  4P7D A;  4L5N C;  4NXN I;  4BS9 A;  4I3H A;  3ZOQ B;  4P78 A;  2YZT A;  5CFF E;  4DUY E;  4Z7C A;  2OI2 A;  4LF7 E;  2M7Q A;  1UHZ A;  2DB2 A;  2MC6 A;  3HTX A;  2UUA I;  2L92 A;  4M30 A;  4X64 I;  4HAC A;  4DR3 I;  1MX0 A;  4DV2 E;  1EA6 A;  3PYD A;  2Z5B A;  1FWL A;  2YT4 A;  4B3S I;  1BKN A;  2VF3 A;  4L8N A;  4GKK I;  4DV7 E;  4DR4 E;  1FJG E;  1Z0T A;  3ADL A;  4BMJ A;  1KTV A;  4B3T I;  1FWK A;  3PYG A;  2B3T B;  4M1K A;  4FN5 A;  3WU4 A;  5FWK A;  4EMD A;  4K0K I;  1N32 E;  4BBY A;  3F0N A;  2FTX B;  4DV1 E;  2K4V A;  4JI5 E;  4DPX A;  2V88 A;  2WZO A;  2PNL A;  4I8O A;  1IBM E;  1J5E I;  2BV3 A;  2HKJ A;  2CPN A;  2H36 X;  5IT9 Q;  3T1H E;  5F3W A;  5IWA E;  4DUZ I;  1YYW A;  2XEX A;  1ZBQ A;  4F9A B;  3C4B A;  4JI4 I;  1XNR I;  5FLX Q;  1YZ9 A;  1HNZ I;  3JTZ A;  3Q1Q A;  2EWL A;  4HY1 A;  4LFA I;  1Z0W A;  2G7H A;  1ZM2 A;  2LRS A;  3T1Y E;  2PNM A;  2LJP A;  4DR2 I;  4JI6 I;  4LF8 E;  2L2N A;  1PKP A;  1XNQ I;  2VQE E;  3ZKB A;  2E1R A;  2HKE A;  5IT9 C;  4GKJ I;  2V87 A;  3K6Q A;  2ZM6 E;  4YY3 E;  3J80 C;  1DAR A;  3VYX A;  3ZZ0 A;  5AAS A;  3WU5 A;  4FWD A;  1I94 E;  2V85 A;  4JI1 I;  3HXL A;  2UUC I;  1XMO I;  2GQ0 A;  1ZXN A;  1H7U A;  1IBK I;  1HNX I;  3OTO I;  5L3J A;  2R42 A;  4JI2 E;  3ZZU A;  2UUB I;  5DNY A;  2KON A;  4Q28 A;  4JI0 E;  4JV5 E;  4R03 A;  4IZJ A;  4WSP A;  3JAM Q;  4LF4 I;  4DR6 I;  3P1X A;  5LL6 R;  2HHH E;  1N34 I;  4JYA E;  4WUB A;  3V5R A;  4LFC I;  4MYU A;  4FWH A;  3PRY A;  5A2Q Q;  2A2C A;  4NXN E;  4ED4 A;  2V89 A;  3M6A A;  4AQY I;  2UXD I;  2EFG A;  3IWB A;  2UU9 I;  3IWC A;  1S16 A;  4X62 I;  4LFB I;  1N36 I;  1NZ0 A;  2NUF A;  4DV4 I;  2F4V I;  4X64 E;  5LMN I;  4LF9 I;  4NXM I;  4BC9 A;  1Y6Z A;  3CWV A;  2CG9 A;  4B3S E;  3J81 Q;  2X7I A;  4GKK E;  2JR1 A;  1HNW I;  4B3M E;  3Q6M A;  4DV0 E;  3C4T A;  4FWG A;  2MDR A;  2BM1 A;  4KHP I;  2Z5C B;  4HYM A;  3KWR A;  4DPW A;  1B63 A;  4JI3 E;  2Q2E B;  3HPS A;  3QT8 A;  1H72 C;  1PVG A;  1XMQ I;  2NA2 A;  1YYO A;  2UXC I;  1FI4 A;  1WHN A;  2NPF A;  2LTS A;  4DUZ E;  1MU5 A;  3VYY A;  5GME A;  3J7A M;  5BR8 E;  1HR0 E;  1ELO A;  2JWO A;  4IZJ D;  2L2K B;  3AV0 A;  2DSY A;  4JI4 E;  1XNR E;  1DI2 A;  4MYT A;  2LBS B;  1HNZ E;  2O1W A;  1USV A;  4LFA E;  1YYK A;  3H4L A;  4DV5 E;  1A6F A;  4M0V A;  4IZK B;  4RPF A;  4F9C B;  5LMU E;  4DR2 E;  1FNM A;  2DEJ A;  4DPY A;  1XNQ E;  3F6G A;  1T4O A;  2ODR C;  1NHH A;  4GKJ E;  1J26 A;  3D4J A;  4WYQ B;  4X66 E;  4DV2 I;  2EZ6 A;  3JU0 A;  2MC5 A;  4DR4 I;  1USU A;  4UTG A;  1XMO E;  3RMP A;  3HJC A;  1IBK E;  1N33 E;  1HNX E;  2LJH A;  3OTO E;  2V2Q A;  3LML A;  1N32 I;  4JI8 I;  1S4E A;  4YHH I;  2X36 A;  4DPT A;  5ADZ A;  2B7V A;  4JI5 I;  2M1S A;  4X65 E;  1O0W A;  2GS8 A;  4HAC B;  4DV3 E;  1X47 A;  1WHQ A;  4WFT A;  3ADI A;  3IWD A;  5FLX C;  2Z5B B;  4BCA A;  3B78 A;  4DR7 E;  2JVA A;  1ZM9 A;  2B9D A;  4LFC E;  1Y4U A;  1VIS A;  2LUQ A;  1STU A;  2ZBK B;  2CZ9 A;  3PYF A;  2V83 A;  3J7Y p;  1Z0B A;  2NUG A;  2R3V A;  3B8H A;  2O1U A;  1RRE A;  4N3O A;  4X62 E;  5AE2 A;  2A2D A;  1HK7 A;  1GZ6 A;  1N36 E;  1IBL E;  5GMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...