2VQFE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqfE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqfE02
1RR9A 4JI0E 4JYAI 2DMYA 1HNWE 1Z0CA 2E5LE 1Z0VA 1UILA 5A2QC 5IWAI 4AQYE 2UXCI 3ZKDA 4X62I 1EA6A 4WYQB 2UUCE 4KHPI 4DV7I 2HKEA 4HACB 2F4VE 2ZITA 4JI8E 4HXZA 1KIJA 5LMNI 5BR8E 4X65I 2X7IA 4DR3I 4NXNI 3C4BA 2DEJA 1RQ0A 1Z0GA 1VISA 1NZ0A 2JVAA 1J5EI 2LUQA 4JI2E 3T1YI 3LTOA 1HNZI 1N32E 1DARA 3D4JA 2EFGA 2XEXA 2LJPA 2V34A 1D6TA 1Z0WA 3M6AA 1STUA 4GKKI 4LF5E 4DPXA 3B82A 4HY1A 1ZM3A 2B7VA 4DV2E 1A6FA 3QT5A 1QU6A 3V2UC 1Z5BA 2RS6A 4DUZI 2R3VA 2LUPB 5FLXC 2V2VA 1MG7A 3ZZUA 4EMDA 2DB2A 3WU5A 4X66E 4WFTA 4JI4I 5GMDA 4JI3E 2JY9A 2BM1A 1KKHA 1Z0TA 3ADIA 4OOGC 4DR6I 4DR1E 1N34I 1WHNA 3OTOE 3H4LA 1IBKE 3C4TA 1WHQA 4B3SE 2UUAE 4OX9E 1S4EA 3PYGA 2ZBKB 1FNMA 3V5RA 1N0VC 1T4LB 5LMUI 4DV5E 4DUYI 4DR2E 2A2DA 4FW9A 4LF9I 1ELOA 2UUBI 4JI0I 1N0UA 2NUEA 2B7TA 1N33E 2L2NA 1HNWI 1FKAE 1FWLA 1HNXE 4AQYI 4LFBE 2MDRA 3T1HE 5IT9C 1EKZA 2UUCI 2LBSB 1RC7A 4WUBA 1BKNA 2NA2A 4PRVA 1OJ4A 5L3JA 2F4VI 4DV0E 4JI1E 1YZ9A 5BR8I 4PRXA 4DR7E 1XMQI 2HFUA 3WU6A 3B78A 3WU3A 2L2MA 1IBME 4DV3E 4JI2I 3JAMQ 1N32I 3ADJA 1FWKA 3Q1QA 4DV6E 4USKA 1H73A 4B3TE 4JG4A 1YYOA 3ADGA 1IBLE 1K47A 4DR5E 1FJGE 4LF5I 1T4NA 4JI5E 1EI1A 4K0KE 1ZXMA 3PYDA 3QT6A 1XNQE 4DPUA 1PIEA 4DV2I 2UXBE 4JV5E 4DPWA 2BV3A 4FWGA 1N36I 4LF7E 2HFSA 5LL6R 4LF4E 4X66I 3F0NA 2HK3A 4B3ME 4JI6E 3J80C 4JI3I 1FI4A 4DV4E 4P52A 1ZM2A 4JYAE 4WUDA 2V8PA 4YY3E 4URLA 4JI7E 3OTOI 2LTSA 4MYUA 1B62A 1PVGA 2DEIA 2B3TB 4B3SI 2UUAI 1Z0BA 3J81Q 4B3RE 1WUUA 1I94E 1O0WA 1NHHA 1XHKA 4DV5I 4MYTA 4DR2I 1GQEA 3ADLA 2RS7A 1NHJA 1HR0E 2Q2EB 4PU9A 3ZM7A 2UXDE 4YHHE 1N33I 4LF6E 3VYYA 1HNXI 1HNZE 4LFBI 3T1HI 3QT8A 1T4OA 4DXLA 3ZZTA 4GKKE 1KTVA 5FLXQ 4UT4A 1RREA 4I3HA 2LJHA 2ZM6E 4DV0I 4JI1I 2V2QA 2L3CA 2LRSA 4Z7CA 4DR7I 2E1RA 3VYXA 1XMOE 1X47A 2GS8A 4LF8E 1IBMI 4DV3I 4DPTA 2E5LI 1Z5CA 4GKJE 3B8HA 4KQVA 4DV6I 2VQEE 4P7AA 4DKKA 1IBLI 4DR5I 1FJGI 2V2ZA 4LFCE 1MX0A 4JI5I 4JI8I 4DV1E 1J26A 2WW4A 1XNQI 4LFAE 3JAMC 2CPNA 3LNUA 2IHR1 1U2RA 2UXBI 4NXME 5GMEA 4JV5I 1H7UA 4LF7I 2HHHE 1MU5A 4HYMA 4LF4I 3J7AM 4DR4E 2LTRA 4B3MI 3PYFA 2N3HA 4XTJA 1S16A 1XNRE 1H72C 4DV4I 2VQFE 4YY3I 4JI7I 4FWHA 4Z7YA 1UHZA 2R42A 2NUFA 4X64E 2A2CA 4ZVIA 5A2QQ 4B3RI 4FN5A 1I94I 2UU9E 3HTXA 3PYEA 4DU8A 4WUCA 2DIXA 1KVKA 1Z59A 1HR0I 1XMQE 2UXDI 4YHHI 4DR1I 3ZZ0A 4LF6I 1B63A 4M2ZA 1IBKI 3J7Yp 5IWAE 3ZKBA 3J81C 2OI2A 2UXCE 1Z5AA 1NHIA 4X62E 2YT4A 2L3JA 4OX9I 2NUGA 4KHPE 3LPSA 4DV7E 2ZM6I 5LMNE 4X65E 4DR3E 2RSMA 4NXNE 1ZM4A 3GONA 3J80Q 3WU4A 2HK2A 1ZM9A 2L2KB 4FWDA 1XMOI 4DPYA 4LF8I 3K17A 1J5EE 2VF3A 3T1YE 1N36E 4GKJI 2UUBE 4USMA 1X48A 2VQEI 1X49A 3LLHA 2X36A 4UTGA 5CFFE 1Z0EA 4RPFA 4LFCI 4HACA 4DV1I 1ZBTA 2N3GA 3P1XA 3J7AG 4LFAI 1QZRA 3HULA 4R1FA 2EZ6A 4NXMI 4M30A 4DUZE 2HHHI 2CZ9A 1PKPA 3K1JA 2RTXA 1DI2A 4ED4A 4DR4I 4B3TI 4JI4E 1XNRI 4K0KI 1ZXNA 2L33A 4M1KA 2VQFI 1H7SA 2HKJA 4DR6E 1N34E 1UEKA 3CWVA 2NPFA 4X64I 2BM0A 4X8WA 1H74A 5IT9Q 2J7KA 5LMUE 2KHXA 4JI6I 2UU9I 4DUYE 2AJ4A 1YYKA 4DU7A 4LF9E 1YYWA 3QT7A
chains in the Genus database with same CATH superfamily
1RR9A 5C0XB 2EMXA 4JI0E 4MU0A 2DMYA 4JYAI 5K36F 4F9AB 3THNA 2GPIA 1HNWE 1Z0CA 1YH8A 3VK6A 2E5LE 1UILA 5A2QC 1Z0VA 2CVEA 4WPYA 5IWAI 2EN1A 4AQYE 1N3GA 1TN9A 2UXCI 3ZKDA 3UHMA 4X62I 1EA6A 4WYQB 2UUCE 4KHPI 2EN4A 1GTKA 4DV7I 2HKEA 4HACB 2F4VE 2ZITA 4JI8E 4BS9A 4HXZA 4GQUA 1KIJA 4IZJD 1ZR9A 5LMNI 2YSPA 5BR8E 2EL4A 2X7IA 4X65I 4DR3I 4NXNI 3BF2A 3C4BA 3Q6MA 2DSYA 1JK1A 2DEJA 1KJKA 2Z5CB 5AASA 2PO2B 5C0XE 1RQ0A 2YRMA 1Z0GA 4MLVA 4Q28A 3C6MA 1LLMC 4BHBA 2ODRC 2ENHA 2LO3A 1NZ0A 2JVAA 1VISA 2LUQA 5KL7A 1YHCA 4JI2E 4Q35B 3T1YI 1J5EI 3LTOA 2EPNA 2DRPA 1UDOA 2YTDA 5K36D 1HNZI 1N32E 1DARA 3D4JA 2EFGA 3EPKA 2XEXA 3Q6NA 2LJPA 2V34A 2C38B 2BA1G 1D6TA 1Z0WA 4F6MA 3M6AA 1STUA 2EOJA 4GKKI 4IZKB 4BC9A 2L8TA 4IS1C 4LF5E 2EPUA 4L8NA 4DPXA 1R6LA 5IXMB 3B82A 4MDTA 2EPMX 1NEIA 2RSIA 4R2DA 2VESA 2J7JA 2NN6A 4HY1A 4R2EA 1DGCA 3DF6A 2KOUA 2YRKA 2B7VA 1ZM3A 2E72A 2Z5BA 2IERA 4DV2E 1A6FA 4O4KA 5KL2A 1XXEA 2GO4A 2EMYA 3QT5A 3QG5C 1QU6A 2V83A 3V2UC 1Z5BA 1UN6B 2WBUA 2RS6A 1A1JA 4DUZI 2WP8B 2R3VA 1L4SA 2LUPB 4R2CA 5FLXC 2V2VA 5KL4A 1MG7A 3ZZUA 1OYRA 4EMDA 2DB2A 2ELYA 3EPLA 3WU5A 4X66E 4WFTA 1ZU1A 4JI4I 2C39B 2FGGA 2JE6B 2LCEA 5GMDA 2O1TA 1QNTA 2JY9A 4JI3E 1KKHA 2BM1A 2GQ0A 1WXRA 1Z0TA 4L5NC 3ADIA 4O5GA 1UDQA 2NN6B 5F3WA 3MSWA 5AE2A 4OOGC 3GCMA 3M85D 2A25A 2BR2B 4BA1B 4DR6I 1X6FA 4N3OA 4DR1E 4F54A 1N34I 1WHNA 2YU5A 4LTYA 3OTOE 3H4LA 4BC7A 2PO2A 1IBKE 1USVA 2ENAA 3P3CA 2KONA 3C4TA 1USUA 1F2IG 1Y60A 2EMIA 1WHQA 2ODRD 2FTXB 2EM6A 2MKNA 4B3SE 2UUAE 4OX9E 2EPOA 1S4EA 2ZBKB 3PYGA 4OO1F 4QNJA 3B4TA 2I13A 1FNMA 2WBTA 2C38A 2YTNA 3V5RA 3H09A 2VRDA 1T4LB 1N0VC 5LMUI 4DV5E 2JPAA 3M7NG 4DUYI 4DR2E 2A2DA 1B69A 4FW9A 4LF9I 2MC5A 2EM3A 2YTPA 3IWCA 1ELOA 3HKMA 2UUBI 2GLIA 2EM5A 4JI0I 1N0UA 2NUEA 4R2AA 2B7TA 1N33E 2L2NA 1HNWI 5K36C 4U3DA 1FKAE 1FWLA 2EOEA 1HNXE 1SR9A 1WRJA 2EL5A 2V86A 4AQYI 4LFBE 2MDRA 4IFDF 3T1HE 5IT9C 2B9DA 2WP8A 1EKZA 4LCGA 2UUCI 2EQ3A 2M9AA 2LBSB 4BBYA 1RC7A 2BA0G 4NHRA 1BKNA 2NA2A 4FW4A 4PRVA 4WUBA 2JWOA 1OJ4A 5L3JA 2F4VI 5T6JA 2YU8A 3DJWA 4ZYGA 4DV0E 2O3ZA 4JI1E 5DRRA 1YZ9A 5BR8I 4ZYHA 2GO3A 2L6MA 5DROA 4PRXA 2O1UA 1A1LA 3L00A 4DR7E 2YTGA 4FW6A 2EMLA 1VI7A 1XMQI 2HFUA 3WU6A 2EOZA 3F6HA 3B78A 2EPKX 2BR2A 2L2MA 3WU3A 1IBME 4BA1A 4LOMA 4DV3E 1Y5YA 5A6KA 4JI2I 3JAMQ 2EOQA 4GZNC 2JT2A 1N32I 3ADJA 1FWKA 3Q1QA 4DV6E 4USKA 4F2JC 1H73A 2EPRA 1X6HA 2FV4B 2HJJA 4TUGA 1E3HA 2EMKA 1YUIA 1YYOA 4B3TE 3ADGA 3PS1A 2EPXA 2EMCA 1IBLE 2CTDA 1K47A 4LPFA 2EPZA 4IFDD 4DR5E 1FJGE 1ZAAC 2DLKA 4KZSA 1T4NA 4LF5I 4JI5E 2RPCA 1EI1A 4K0KE 1ZXMA 2LJUA 2MDGA 2PNLA 3PYDA 2WZOA 4IZJB 5AC4A 5DRPA 2H36X 4P7DA 1TF6A 1EH6A 1XNQE 3QT6A 4DPUA 1PIEA 4JG4A 5A69A 4QNKA 4DV2I 4WSPA 2UXBE 4JV5E 3H1CA 2BBGA 4DPWA 2BV3A 4FWGA 4NBQA 4WXDA 5LLQA 1N36I 4LF7E 2WNRB 2HFSA 4MLQA 5LL6R 2C37B 4LF4E 2EE8A 3HPZA 2EMZA 2RQLA 2LVHA 2EPPA 2Q8UA 5K36B 4MU3A 4X66I 2CT1A 3F0NA 2HK3A 4DMIA 4B3ME 4JI6E 5JEAC 2V88A 2BB8A 1WJPA 3J80C 4JI3I 1FI4A 4RH8A 4DV4E 2EL6A 2EOFA 3K6QA 5KL6A 4OO1D 4P52A 1ZM2A 2F8BA 1BB8A 5FWKA 4JYAE 4WUDA 2V8PA 2YZTA 3KZYA 1YFHA 4YY3E 3NZKA 4URLA 4JI7E 4FK5C 3OTOI 3AV0A 4FW5A 2LTSA 2LE2A 1B62A 3L7ZB 4MYUA 2LMZA 1A1KA 3EPHA 2PO1A 1PVGA 2DEIA 2B3TB 4I8OA 3P3EA 2EMGA 4NZVA 2L92A 2NABA 2UUAI 4B3SI 4HEIA 1HK7A 1Z0BA 5IV8B 2PNZB 2G7HA 4B3RE 1WUUA 3J81Q 5EL9A 1PJTA 5JEAF 5K36E 1I94E 1O0WA 1KYQA 1NHHA 1XHKA 2YRHA 4DV5I 4MYTA 4DR2I 2MC6A 1GQEA 4R2SA 3ADLA 4WSGA 5ELWA 2V87A 2YTOA 4AIMA 4IFDA 3LMLA 2RS7A 1NHJA 1HR0E 2Q2EB 4PU9A 1PJSA 4F6NA 4IZJA 3ZM7A 3M85G 3OMLA 4J8ZA 4YHHE 2UXDE 1N33I 1A1GA 4LF6E 1A1HA 3JU0A 3VYYA 2EORA 2ADRA 1HNXI 1HNZE 4FW7A 2EMWA 1DQ3A 4LFBI 4R2QA 3T1HI 2JXPA 5KL3A 2CG9A 2PO1B 3QT8A 1T4OA 2EPLX 4DXLA 2EOIA 2WNRA 4IFDC 1OYSA 2C37A 1GZ6A 3ZZTA 4GKKE 1KTVA 5FLXQ 5K36A 4UT4A 1RREA 4I3HA 2LJHA 2ZM6E 4DV0I 4JI1I 2V2QA 2EOXA 4U3BA 3BBGA 4HTGA 2L3CA 1UDNA 2LRSA 2EOOA 4O24A 3P06A 5JEAD 4Z7CA 4DR7I 2I9IA 2EQ1A 2E1RA 4R2RA 2EOYA 3ZOQB 3VYXA 1XMOE 1X47A 3BGHA 3HJCA 2GS8A 4M9VC 5DRQA 4LF8E 1IBMI 4MU4A 2N8XA 4DV3I 4DPTA 2E5LI 1Z5CA 4GKJE 4LU9A 2R1FA 2YTEA 4IJDA 2EN2A 3L7ZA 3B8HA 4KQVA 4DV6I 5A6JA 2VQEE 4O43A 4P7AA 5C0XF 4DKKA 3M7ND 1IBLI 4DR5I 4OO1C 3KRNA 3AUZA 2V2ZA 2PNZA 1FJGI 4LFCE 3HXLA 1MX0A 4JI5I 4JI8I 5DNYA 5AC5A 4F9BB 4DV1E 1T38A 4F9CB 1J26A 2WW4A 3PS3A 1SFEA 1XNQI 4LFAE 1X5WA 3JAMC 2CPNA 5KL5A 3LNUA 2IHR1 1U2RA 2UXBI 4NXME 1Y4SA 5GMEA 4JV5I 2JR1A 2EP3A 4J3DA 1H7UA 2EM7A 3EPJA 2PO0B 4LF7I 2EMHA 4WX9A 2HHHE 4FW3A 1MU5A 4HYMA 1NCSA 4LF4I 3J7AM 3F6GA 3U1YA 2WBSA 2IESA 4DR4E 2EWLA 2LTRA 4B3MI 2EN6A 3PYFA 1EH8A 2N3HA 4XTJA 1S16A 1XNRE 1H72C 3CDIA 2GHFA 5C0XD 2M1SA 4DV4I 4IFDB 2CSHA 1BBOA 2VQFE 2CGEA 1G2DC 2YTIA 1PDAA 4OKGA 4YY3I 2D9HA 2YSOA 4JI7I 2JYAA 1UDSA 1MEYC 4BA2A 5TSEA 4M0VA 5JEAA 4FWHA 4Z7YA 1UHZA 2R42A 2NUFA 4X64E 2A2CA 3U1KA 2MKDA 2V85A 3IWBA 4RHBB 3MHSC 4ZVIA 5A2QQ 4AIDA 4P78A 1RMDA 1ZBQA 1RHYA 2J65A 2NN6C 2JEBA 3JTZA 4B3RI 1EH7A 3PRYA 4FN5A 2JP9A 1I94I 4BCAA 2ELZA 2EOMA 1PJQA 2UU9E 3HTXA 3PYEA 4DU8A 4WUCA 2K4VA 2DIXA 2EMFA 1TF3A 4IFDE 1KVKA 3M99B 1Z59A 1HR0I 4OO1B 1IQSA 1Y6ZA 1XMQE 2ENCA 2EN3A 4LCFA 2UXDI 3GLLA 4YHHI 2DLQA 3ZZ0A 4DR1I 4LF6I 1B63A 4M2ZA 1Z1BA 2YWQA 1A1FA 3VHTB 1IBKI 2VE7C 2JEAA 3J7Yp 5IWAE 3UK3C 3J81C 3ZKBA 3QT7A 2EOSA 4R8OA 2OI2A 2UXCE 2BA1D 1Z5AA 2NN6F 1NHIA 2PO0A 4X62E 2YT4A 2O1WA 2L3JA 4OX9I 4N4RB 3HQ1A 2NUGA 2K7IA 4KHPE 5AE1A 3LPSA 4DV7E 3K85A 4AM3A 2EN7A 1E3PA 1IMUA 2V89A 2ZM6I 2R76A 1X6EA 4WXCA 5LMNE 4X65E 4DR3E 2RSMA 2PNMA 4NXNE 2VF1A 1ZM4A 3GONA 3J80Q 3WU4A 2HK2A 1ZM9A 2L2KB 4FWDA 4LCHA 5C0XA 4OO1E 2EM8A 1YSAC 1XMOI 1YPNA 2LT7A 4DPYA 4LF8I 3K17A 4BMJA 1J5EE 2VF3A 3T1YE 4R2PA 1N36E 2HC5A 4GKJI 5A6BD 1BBGA 4USMA 1X48A 2EM2A 2VQEI 1X49A 3LLHA 3P3GA 2LV2A 2X36A 1YUJA 1OYPA 3P76A 4UTGA 3RMPA 5C0XC 2E1MA 5CFFE 1Z0EA 2EN8A 3MHHC 5AE3A 1P47A 2NN6D 4RPFA 4BHCA 1UBDC 4LFCI 4HACA 3THOB 4ZYEA 2YPNA 4DV1I 5DNXA 2F1DA 1ZBTA 2N3GA 3P1XA 3J7AG 4TUIA 4KWYA 4LFAI 1T39A 1QZRA 4MQYA 3IWDA 3HULA 4R1FA 4BA2B 2Z5CA 2EJ4A 1JK2A 2EZ6A 5JEAB 4NXMI 4GEQB 2EQ0A 5DNLA 4OO1A 2O1VA 1AH5A 3DD6A 3GMEA 4M30A 3C6KA 4X9JA 4DUZE 2EPCA 2HHHI 2CZ9A 1PKPA 3CDJA 4MU1A 2JEBB 3K1JA 3EQ1A 2RTXA 3TQMA 2YTQA 4ZYDA 1MGTA 1DI2A 4IS9A 4ED4A 4DR4I 3KZZA 4JI4E 5EKWA 2DMIA 2YTFA 4B3TI 2EM0A 2EPAA 2IOQA 4OZEA 1XNRI 2HGHA 1X3CA 4IZKA 3BIDA 4K0KI 1ZXNA 2L33A 2NN6E 4M1KA 1G2FC 2VQFI 1H7SA 2HKJA 3HPSA 1A1IA 4DR6E 4ISAA 1P42A 1N34E 5JEAE 4R03A 2JEAB 1IQOA 1UEKA 3CWVA 1R6MA 2IOPA 2EM4A 2NPFA 2PRTA 2BM0A 4X64I 2EOHA 5A6AA 3FIGA 2BA0D 4X8WA 2DGCA 2V8QB 1Y4UA 5A6BA 1H74A 2JOBA 5ADZA 2Z5EA 5IT9Q 2J7KA 2EMAA 2EM9A 2KHXA 5LMUE 3ECRA 2AE8A 2C39A 2JE6A 2JOXA 4DUYE 2UU9I 4JI6I 3KWRA 2YTJA 2AJ4A 1YYKA 4DU7A 4LF9E 2WCC3 2M7QA 1AAYA 1YYWA 2Z5BB 3PS2A 2UUBE 2EMBA 2M4IA
chains in the Genus database with same CATH topology
1RR9A 4JI0E 4JYAI 2DMYA 4F9AB 1HNWE 1Z0CA 3VK6A 2E5LE 1UILA 5A2QC 1Z0VA 4WPYA 5IWAI 4AQYE 2UXCI 3ZKDA 4X62I 1EA6A 4WYQB 2UUCE 4KHPI 4DV7I 2HKEA 4HACB 2F4VE 2ZITA 4JI8E 4BS9A 4HXZA 4IZJD 1KIJA 5LMNI 5BR8E 4X65I 2X7IA 4DR3I 4NXNI 3C4BA 3Q6MA 2DSYA 2DEJA 2Z5CB 5AASA 1RQ0A 1Z0GA 4Q28A 2ODRC 1VISA 1NZ0A 2JVAA 1J5EI 2LUQA 4JI2E 3T1YI 3LTOA 1HNZI 1N32E 1DARA 3D4JA 2EFGA 2XEXA 3Q6NA 2LJPA 2V34A 1D6TA 1Z0WA 3M6AA 1STUA 4GKKI 4IZKB 4BC9A 2L8TA 4LF5E 4DPXA 4L8NA 3B82A 4HY1A 3DF6A 2KOUA 1ZM3A 2B7VA 2Z5BA 4DV2E 1A6FA 3QT5A 1QU6A 2V83A 3V2UC 1Z5BA 2RS6A 4DUZI 2R3VA 2LUPB 5FLXC 2V2VA 1MG7A 3ZZUA 4EMDA 2DB2A 3WU5A 4X66E 4WFTA 4JI4I 2FGGA 5GMDA 2O1TA 4JI3E 2JY9A 2BM1A 1KKHA 2GQ0A 1WXRA 1Z0TA 4L5NC 3ADIA 5F3WA 3MSWA 5AE2A 4OOGC 4DR6I 4N3OA 4DR1E 4F54A 1N34I 1WHNA 4LTYA 3OTOE 3H4LA 4BC7A 1IBKE 1USVA 2KONA 3C4TA 1USUA 1WHQA 2ODRD 2FTXB 4B3SE 2UUAE 4OX9E 1S4EA 3PYGA 2ZBKB 1FNMA 3V5RA 3H09A 1T4LB 1N0VC 5LMUI 4DV5E 4DUYI 4DR2E 2A2DA 4FW9A 4LF9I 2MC5A 3IWCA 1ELOA 2UUBI 4JI0I 1N0UA 2NUEA 2B7TA 1N33E 2L2NA 1HNWI 1FKAE 1FWLA 1HNXE 1SR9A 4AQYI 2V86A 4LFBE 2MDRA 3T1HE 5IT9C 2B9DA 1EKZA 2UUCI 2LBSB 4BBYA 1RC7A 4WUBA 1BKNA 2NA2A 4PRVA 2JWOA 1OJ4A 5L3JA 2F4VI 5T6JA 3DJWA 4DV0E 4JI1E 1YZ9A 5BR8I 2L6MA 4PRXA 2O1UA 4DR7E 1XMQI 2HFUA 3WU6A 3F6HA 3B78A 3WU3A 2L2MA 1IBME 4DV3E 4JI2I 3JAMQ 1N32I 3ADJA 1FWKA 3Q1QA 4DV6E 4USKA 1H73A 2FV4B 4TUGA 4B3TE 4JG4A 1YYOA 3ADGA 1IBLE 1K47A 4DR5E 1FJGE 4KZSA 4LF5I 1T4NA 4JI5E 1EI1A 4K0KE 1ZXMA 2PNLA 3PYDA 2WZOA 4IZJB 2H36X 4P7DA 1XNQE 3QT6A 4DPUA 1PIEA 4DV2I 4WSPA 2UXBE 4JV5E 4DPWA 2BV3A 4FWGA 1N36I 4LF7E 2HFSA 5LL6R 4LF4E 3HPZA 4X66I 3F0NA 2HK3A 4DMIA 4B3ME 4JI6E 2V88A 3J80C 4JI3I 1FI4A 4DV4E 3K6QA 4P52A 1ZM2A 2F8BA 5FWKA 4JYAE 4WUDA 2V8PA 2YZTA 4YY3E 4URLA 4JI7E 3OTOI 3AV0A 2LTSA 2LE2A 1B62A 4MYUA 2LMZA 1PVGA 2DEIA 2B3TB 4I8OA 2L92A 4B3SI 2UUAI 1HK7A 1Z0BA 3J81Q 2G7HA 4B3RE 1WUUA 1I94E 1O0WA 1NHHA 1XHKA 4DV5I 4MYTA 4DR2I 2MC6A 1GQEA 3ADLA 2V87A 3LMLA 2RS7A 1NHJA 1HR0E 2Q2EB 4PU9A 3ZM7A 4IZJA 3OMLA 4J8ZA 4YHHE 2UXDE 1N33I 4LF6E 3JU0A 3VYYA 1HNXI 1HNZE 1DQ3A 4LFBI 3T1HI 2CG9A 3QT8A 1T4OA 4DXLA 1GZ6A 3ZZTA 4GKKE 1KTVA 5FLXQ 4UT4A 1RREA 4I3HA 2LJHA 2ZM6E 4DV0I 4JI1I 2V2QA 2L3CA 2LRSA 3P06A 4Z7CA 4DR7I 2E1RA 3ZOQB 3VYXA 1XMOE 1X47A 3HJCA 2GS8A 4LF8E 1IBMI 4DV3I 4DPTA 2E5LI 1Z5CA 4GKJE 4LU9A 3B8HA 4KQVA 4DV6I 2VQEE 4P7AA 4DKKA 1IBLI 4DR5I 1FJGI 3AUZA 2V2ZA 4LFCE 3HXLA 1MX0A 4JI5I 4JI8I 5DNYA 4F9BB 4DV1E 4F9CB 1J26A 2WW4A 1XNQI 4LFAE 3JAMC 2CPNA 3LNUA 2IHR1 1U2RA 2UXBI 4NXME 1Y4SA 5GMEA 4JV5I 2JR1A 1H7UA 4LF7I 2HHHE 1MU5A 4HYMA 4LF4I 3J7AM 3F6GA 4DR4E 2EWLA 2LTRA 4B3MI 3PYFA 2N3HA 4XTJA 1S16A 1XNRE 1H72C 4DV4I 2M1SA 2VQFE 2CGEA 4YY3I 4JI7I 4M0VA 4FWHA 4Z7YA 1UHZA 2R42A 2NUFA 4X64E 2A2CA 2V85A 3IWBA 4ZVIA 5A2QQ 4P78A 1ZBQA 3JTZA 4B3RI 3PRYA 4FN5A 1I94I 4BCAA 2UU9E 3HTXA 3PYEA 4DU8A 4WUCA 2K4VA 2DIXA 1KVKA 1Z59A 1HR0I 1Y6ZA 1XMQE 2UXDI 4YHHI 4DR1I 3ZZ0A 4LF6I 1B63A 4M2ZA 1IBKI 2VE7C 3J7Yp 5IWAE 3J81C 3ZKBA 3QT7A 4R8OA 2OI2A 2UXCE 1Z5AA 1NHIA 4X62E 2YT4A 2O1WA 2L3JA 4OX9I 3HQ1A 2NUGA 4KHPE 5AE1A 3LPSA 4DV7E 3K85A 2V89A 2ZM6I 5LMNE 4X65E 4DR3E 2RSMA 2PNMA 4NXNE 2VF1A 1ZM4A 3GONA 3J80Q 3WU4A 2HK2A 1ZM9A 2L2KB 4FWDA 1XMOI 4DPYA 4LF8I 3K17A 4BMJA 1J5EE 2VF3A 3T1YE 1N36E 4GKJI 4USMA 1X48A 2VQEI 1X49A 3LLHA 2X36A 4UTGA 3RMPA 2E1MA 5CFFE 1Z0EA 4RPFA 5AE3A 4LFCI 4HACA 4DV1I 1ZBTA 2N3GA 3P1XA 3J7AG 4TUIA 4LFAI 1QZRA 3IWDA 3HULA 4R1FA 2Z5CA 2EZ6A 4NXMI 4GEQB 2O1VA 4M30A 4DUZE 2HHHI 2CZ9A 1PKPA 3K1JA 2RTXA 1DI2A 4ED4A 4DR4I 4B3TI 4JI4E 2IOQA 1XNRI 4IZKA 4K0KI 1ZXNA 2L33A 4M1KA 2VQFI 1H7SA 2HKJA 3HPSA 4DR6E 1N34E 4R03A 1UEKA 3CWVA 2IOPA 2NPFA 4X64I 2BM0A 3FIGA 4X8WA 2V8QB 1Y4UA 1H74A 2JOBA 5ADZA 2Z5EA 5IT9Q 2J7KA 5LMUE 2KHXA 4JI6I 2UU9I 2JOXA 4DUYE 3KWRA 2AJ4A 1YYKA 4DU7A 4LF9E 2M7QA 2Z5BB 1YYWA 2UUBE 2M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RR9 A;  4JI0 E;  4JYA I;  2DMY A;  1HNW E;  1Z0C A;  2E5L E;  1Z0V A;  1UIL A;  5A2Q C;  5IWA I;  4AQY E;  2UXC I;  3ZKD A;  4X62 I;  1EA6 A;  4WYQ B;  2UUC E;  4KHP I;  4DV7 I;  2HKE A;  4HAC B;  2F4V E;  2ZIT A;  4JI8 E;  4HXZ A;  1KIJ A;  5LMN I;  5BR8 E;  4X65 I;  2X7I A;  4DR3 I;  4NXN I;  3C4B A;  2DEJ A;  1RQ0 A;  1Z0G A;  1VIS A;  1NZ0 A;  2JVA A;  1J5E I;  2LUQ A;  4JI2 E;  3T1Y I;  3LTO A;  1HNZ I;  1N32 E;  1DAR A;  3D4J A;  2EFG A;  2XEX A;  2LJP A;  2V34 A;  1D6T A;  1Z0W A;  3M6A A;  1STU A;  4GKK I;  4LF5 E;  4DPX A;  3B82 A;  4HY1 A;  1ZM3 A;  2B7V A;  4DV2 E;  1A6F A;  3QT5 A;  1QU6 A;  3V2U C;  1Z5B A;  2RS6 A;  4DUZ I;  2R3V A;  2LUP B;  5FLX C;  2V2V A;  1MG7 A;  3ZZU A;  4EMD A;  2DB2 A;  3WU5 A;  4X66 E;  4WFT A;  4JI4 I;  5GMD A;  4JI3 E;  2JY9 A;  2BM1 A;  1KKH A;  1Z0T A;  3ADI A;  4OOG C;  4DR6 I;  4DR1 E;  1N34 I;  1WHN A;  3OTO E;  3H4L A;  1IBK E;  3C4T A;  1WHQ A;  4B3S E;  2UUA E;  4OX9 E;  1S4E A;  3PYG A;  2ZBK B;  1FNM A;  3V5R A;  1N0V C;  1T4L B;  5LMU I;  4DV5 E;  4DUY I;  4DR2 E;  2A2D A;  4FW9 A;  4LF9 I;  1ELO A;  2UUB I;  4JI0 I;  1N0U A;  2NUE A;  2B7T A;  1N33 E;  2L2N A;  1HNW I;  1FKA E;  1FWL A;  1HNX E;  4AQY I;  4LFB E;  2MDR A;  3T1H E;  5IT9 C;  1EKZ A;  2UUC I;  2LBS B;  1RC7 A;  4WUB A;  1BKN A;  2NA2 A;  4PRV A;  1OJ4 A;  5L3J A;  2F4V I;  4DV0 E;  4JI1 E;  1YZ9 A;  5BR8 I;  4PRX A;  4DR7 E;  1XMQ I;  2HFU A;  3WU6 A;  3B78 A;  3WU3 A;  2L2M A;  1IBM E;  4DV3 E;  4JI2 I;  3JAM Q;  1N32 I;  3ADJ A;  1FWK A;  3Q1Q A;  4DV6 E;  4USK A;  1H73 A;  4B3T E;  4JG4 A;  1YYO A;  3ADG A;  1IBL E;  1K47 A;  4DR5 E;  1FJG E;  4LF5 I;  1T4N A;  4JI5 E;  1EI1 A;  4K0K E;  1ZXM A;  3PYD A;  3QT6 A;  1XNQ E;  4DPU A;  1PIE A;  4DV2 I;  2UXB E;  4JV5 E;  4DPW A;  2BV3 A;  4FWG A;  1N36 I;  4LF7 E;  2HFS A;  5LL6 R;  4LF4 E;  4X66 I;  3F0N A;  2HK3 A;  4B3M E;  4JI6 E;  3J80 C;  4JI3 I;  1FI4 A;  4DV4 E;  4P52 A;  1ZM2 A;  4JYA E;  4WUD A;  2V8P A;  4YY3 E;  4URL A;  4JI7 E;  3OTO I;  2LTS A;  4MYU A;  1B62 A;  1PVG A;  2DEI A;  2B3T B;  4B3S I;  2UUA I;  1Z0B A;  3J81 Q;  4B3R E;  1WUU A;  1I94 E;  1O0W A;  1NHH A;  1XHK A;  4DV5 I;  4MYT A;  4DR2 I;  1GQE A;  3ADL A;  2RS7 A;  1NHJ A;  1HR0 E;  2Q2E B;  4PU9 A;  3ZM7 A;  2UXD E;  4YHH E;  1N33 I;  4LF6 E;  3VYY A;  1HNX I;  1HNZ E;  4LFB I;  3T1H I;  3QT8 A;  1T4O A;  4DXL A;  3ZZT A;  4GKK E;  1KTV A;  5FLX Q;  4UT4 A;  1RRE A;  4I3H A;  2LJH A;  2ZM6 E;  4DV0 I;  4JI1 I;  2V2Q A;  2L3C A;  2LRS A;  4Z7C A;  4DR7 I;  2E1R A;  3VYX A;  1XMO E;  1X47 A;  2GS8 A;  4LF8 E;  1IBM I;  4DV3 I;  4DPT A;  2E5L I;  1Z5C A;  4GKJ E;  3B8H A;  4KQV A;  4DV6 I;  2VQE E;  4P7A A;  4DKK A;  1IBL I;  4DR5 I;  1FJG I;  2V2Z A;  4LFC E;  1MX0 A;  4JI5 I;  4JI8 I;  4DV1 E;  1J26 A;  2WW4 A;  1XNQ I;  4LFA E;  3JAM C;  2CPN A;  3LNU A;  2IHR 1;  1U2R A;  2UXB I;  4NXM E;  5GME A;  4JV5 I;  1H7U A;  4LF7 I;  2HHH E;  1MU5 A;  4HYM A;  4LF4 I;  3J7A M;  4DR4 E;  2LTR A;  4B3M I;  3PYF A;  2N3H A;  4XTJ A;  1S16 A;  1XNR E;  1H72 C;  4DV4 I;  2VQF E;  4YY3 I;  4JI7 I;  4FWH A;  4Z7Y A;  1UHZ A;  2R42 A;  2NUF A;  4X64 E;  2A2C A;  4ZVI A;  5A2Q Q;  4B3R I;  4FN5 A;  1I94 I;  2UU9 E;  3HTX A;  3PYE A;  4DU8 A;  4WUC A;  2DIX A;  1KVK A;  1Z59 A;  1HR0 I;  1XMQ E;  2UXD I;  4YHH I;  4DR1 I;  3ZZ0 A;  4LF6 I;  1B63 A;  4M2Z A;  1IBK I;  3J7Y p;  5IWA E;  3ZKB A;  3J81 C;  2OI2 A;  2UXC E;  1Z5A A;  1NHI A;  4X62 E;  2YT4 A;  2L3J A;  4OX9 I;  2NUG A;  4KHP E;  3LPS A;  4DV7 E;  2ZM6 I;  5LMN E;  4X65 E;  4DR3 E;  2RSM A;  4NXN E;  1ZM4 A;  3GON A;  3J80 Q;  3WU4 A;  2HK2 A;  1ZM9 A;  2L2K B;  4FWD A;  1XMO I;  4DPY A;  4LF8 I;  3K17 A;  1J5E E;  2VF3 A;  3T1Y E;  1N36 E;  4GKJ I;  2UUB E;  4USM A;  1X48 A;  2VQE I;  1X49 A;  3LLH A;  2X36 A;  4UTG A;  5CFF E;  1Z0E A;  4RPF A;  4LFC I;  4HAC A;  4DV1 I;  1ZBT A;  2N3G A;  3P1X A;  3J7A G;  4LFA I;  1QZR A;  3HUL A;  4R1F A;  2EZ6 A;  4NXM I;  4M30 A;  4DUZ E;  2HHH I;  2CZ9 A;  1PKP A;  3K1J A;  2RTX A;  1DI2 A;  4ED4 A;  4DR4 I;  4B3T I;  4JI4 E;  1XNR I;  4K0K I;  1ZXN A;  2L33 A;  4M1K A;  2VQF I;  1H7S A;  2HKJ A;  4DR6 E;  1N34 E;  1UEK A;  3CWV A;  2NPF A;  4X64 I;  2BM0 A;  4X8W A;  1H74 A;  5IT9 Q;  2J7K A;  5LMU E;  2KHX A;  4JI6 I;  2UU9 I;  4DUY E;  2AJ4 A;  1YYK A;  4DU7 A;  4LF9 E;  1YYW A;  3QT7 A; 
#chains in the Genus database with same CATH topology
 1RR9 A;  5C0X B;  2EMX A;  4JI0 E;  4MU0 A;  2DMY A;  4JYA I;  5K36 F;  4F9A B;  3THN A;  2GPI A;  1HNW E;  1Z0C A;  1YH8 A;  3VK6 A;  2E5L E;  1UIL A;  5A2Q C;  1Z0V A;  2CVE A;  4WPY A;  5IWA I;  2EN1 A;  4AQY E;  1N3G A;  1TN9 A;  2UXC I;  3ZKD A;  3UHM A;  4X62 I;  1EA6 A;  4WYQ B;  2UUC E;  4KHP I;  2EN4 A;  1GTK A;  4DV7 I;  2HKE A;  4HAC B;  2F4V E;  2ZIT A;  4JI8 E;  4BS9 A;  4HXZ A;  4GQU A;  1KIJ A;  4IZJ D;  1ZR9 A;  5LMN I;  2YSP A;  5BR8 E;  2EL4 A;  2X7I A;  4X65 I;  4DR3 I;  4NXN I;  3BF2 A;  3C4B A;  3Q6M A;  2DSY A;  1JK1 A;  2DEJ A;  1KJK A;  2Z5C B;  5AAS A;  2PO2 B;  5C0X E;  1RQ0 A;  2YRM A;  1Z0G A;  4MLV A;  4Q28 A;  3C6M A;  1LLM C;  4BHB A;  2ODR C;  2ENH A;  2LO3 A;  1NZ0 A;  2JVA A;  1VIS A;  2LUQ A;  5KL7 A;  1YHC A;  4JI2 E;  4Q35 B;  3T1Y I;  1J5E I;  3LTO A;  2EPN A;  2DRP A;  1UDO A;  2YTD A;  5K36 D;  1HNZ I;  1N32 E;  1DAR A;  3D4J A;  2EFG A;  3EPK A;  2XEX A;  3Q6N A;  2LJP A;  2V34 A;  2C38 B;  2BA1 G;  1D6T A;  1Z0W A;  4F6M A;  3M6A A;  1STU A;  2EOJ A;  4GKK I;  4IZK B;  4BC9 A;  2L8T A;  4IS1 C;  4LF5 E;  2EPU A;  4L8N A;  4DPX A;  1R6L A;  5IXM B;  3B82 A;  4MDT A;  2EPM X;  1NEI A;  2RSI A;  4R2D A;  2VES A;  2J7J A;  2NN6 A;  4HY1 A;  4R2E A;  1DGC A;  3DF6 A;  2KOU A;  2YRK A;  2B7V A;  1ZM3 A;  2E72 A;  2Z5B A;  2IER A;  4DV2 E;  1A6F A;  4O4K A;  5KL2 A;  1XXE A;  2GO4 A;  2EMY A;  3QT5 A;  3QG5 C;  1QU6 A;  2V83 A;  3V2U C;  1Z5B A;  1UN6 B;  2WBU A;  2RS6 A;  1A1J A;  4DUZ I;  2WP8 B;  2R3V A;  1L4S A;  2LUP B;  4R2C A;  5FLX C;  2V2V A;  5KL4 A;  1MG7 A;  3ZZU A;  1OYR A;  4EMD A;  2DB2 A;  2ELY A;  3EPL A;  3WU5 A;  4X66 E;  4WFT A;  1ZU1 A;  4JI4 I;  2C39 B;  2FGG A;  2JE6 B;  2LCE A;  5GMD A;  2O1T A;  1QNT A;  2JY9 A;  4JI3 E;  1KKH A;  2BM1 A;  2GQ0 A;  1WXR A;  1Z0T A;  4L5N C;  3ADI A;  4O5G A;  1UDQ A;  2NN6 B;  5F3W A;  3MSW A;  5AE2 A;  4OOG C;  3GCM A;  3M85 D;  2A25 A;  2BR2 B;  4BA1 B;  4DR6 I;  1X6F A;  4N3O A;  4DR1 E;  4F54 A;  1N34 I;  1WHN A;  2YU5 A;  4LTY A;  3OTO E;  3H4L A;  4BC7 A;  2PO2 A;  1IBK E;  1USV A;  2ENA A;  3P3C A;  2KON A;  3C4T A;  1USU A;  1F2I G;  1Y60 A;  2EMI A;  1WHQ A;  2ODR D;  2FTX B;  2EM6 A;  2MKN A;  4B3S E;  2UUA E;  4OX9 E;  2EPO A;  1S4E A;  2ZBK B;  3PYG A;  4OO1 F;  4QNJ A;  3B4T A;  2I13 A;  1FNM A;  2WBT A;  2C38 A;  2YTN A;  3V5R A;  3H09 A;  2VRD A;  1T4L B;  1N0V C;  5LMU I;  4DV5 E;  2JPA A;  3M7N G;  4DUY I;  4DR2 E;  2A2D A;  1B69 A;  4FW9 A;  4LF9 I;  2MC5 A;  2EM3 A;  2YTP A;  3IWC A;  1ELO A;  3HKM A;  2UUB I;  2GLI A;  2EM5 A;  4JI0 I;  1N0U A;  2NUE A;  4R2A A;  2B7T A;  1N33 E;  2L2N A;  1HNW I;  5K36 C;  4U3D A;  1FKA E;  1FWL A;  2EOE A;  1HNX E;  1SR9 A;  1WRJ A;  2EL5 A;  2V86 A;  4AQY I;  4LFB E;  2MDR A;  4IFD F;  3T1H E;  5IT9 C;  2B9D A;  2WP8 A;  1EKZ A;  4LCG A;  2UUC I;  2EQ3 A;  2M9A A;  2LBS B;  4BBY A;  1RC7 A;  2BA0 G;  4NHR A;  1BKN A;  2NA2 A;  4FW4 A;  4PRV A;  4WUB A;  2JWO A;  1OJ4 A;  5L3J A;  2F4V I;  5T6J A;  2YU8 A;  3DJW A;  4ZYG A;  4DV0 E;  2O3Z A;  4JI1 E;  5DRR A;  1YZ9 A;  5BR8 I;  4ZYH A;  2GO3 A;  2L6M A;  5DRO A;  4PRX A;  2O1U A;  1A1L A;  3L00 A;  4DR7 E;  2YTG A;  4FW6 A;  2EML A;  1VI7 A;  1XMQ I;  2HFU A;  3WU6 A;  2EOZ A;  3F6H A;  3B78 A;  2EPK X;  2BR2 A;  2L2M A;  3WU3 A;  1IBM E;  4BA1 A;  4LOM A;  4DV3 E;  1Y5Y A;  5A6K A;  4JI2 I;  3JAM Q;  2EOQ A;  4GZN C;  2JT2 A;  1N32 I;  3ADJ A;  1FWK A;  3Q1Q A;  4DV6 E;  4USK A;  4F2J C;  1H73 A;  2EPR A;  1X6H A;  2FV4 B;  2HJJ A;  4TUG A;  1E3H A;  2EMK A;  1YUI A;  1YYO A;  4B3T E;  3ADG A;  3PS1 A;  2EPX A;  2EMC A;  1IBL E;  2CTD A;  1K47 A;  4LPF A;  2EPZ A;  4IFD D;  4DR5 E;  1FJG E;  1ZAA C;  2DLK A;  4KZS A;  1T4N A;  4LF5 I;  4JI5 E;  2RPC A;  1EI1 A;  4K0K E;  1ZXM A;  2LJU A;  2MDG A;  2PNL A;  3PYD A;  2WZO A;  4IZJ B;  5AC4 A;  5DRP A;  2H36 X;  4P7D A;  1TF6 A;  1EH6 A;  1XNQ E;  3QT6 A;  4DPU A;  1PIE A;  4JG4 A;  5A69 A;  4QNK A;  4DV2 I;  4WSP A;  2UXB E;  4JV5 E;  3H1C A;  2BBG A;  4DPW A;  2BV3 A;  4FWG A;  4NBQ A;  4WXD A;  5LLQ A;  1N36 I;  4LF7 E;  2WNR B;  2HFS A;  4MLQ A;  5LL6 R;  2C37 B;  4LF4 E;  2EE8 A;  3HPZ A;  2EMZ A;  2RQL A;  2LVH A;  2EPP A;  2Q8U A;  5K36 B;  4MU3 A;  4X66 I;  2CT1 A;  3F0N A;  2HK3 A;  4DMI A;  4B3M E;  4JI6 E;  5JEA C;  2V88 A;  2BB8 A;  1WJP A;  3J80 C;  4JI3 I;  1FI4 A;  4RH8 A;  4DV4 E;  2EL6 A;  2EOF A;  3K6Q A;  5KL6 A;  4OO1 D;  4P52 A;  1ZM2 A;  2F8B A;  1BB8 A;  5FWK A;  4JYA E;  4WUD A;  2V8P A;  2YZT A;  3KZY A;  1YFH A;  4YY3 E;  3NZK A;  4URL A;  4JI7 E;  4FK5 C;  3OTO I;  3AV0 A;  4FW5 A;  2LTS A;  2LE2 A;  1B62 A;  3L7Z B;  4MYU A;  2LMZ A;  1A1K A;  3EPH A;  2PO1 A;  1PVG A;  2DEI A;  2B3T B;  4I8O A;  3P3E A;  2EMG A;  4NZV A;  2L92 A;  2NAB A;  2UUA I;  4B3S I;  4HEI A;  1HK7 A;  1Z0B A;  5IV8 B;  2PNZ B;  2G7H A;  4B3R E;  1WUU A;  3J81 Q;  5EL9 A;  1PJT A;  5JEA F;  5K36 E;  1I94 E;  1O0W A;  1KYQ A;  1NHH A;  1XHK A;  2YRH A;  4DV5 I;  4MYT A;  4DR2 I;  2MC6 A;  1GQE A;  4R2S A;  3ADL A;  4WSG A;  5ELW A;  2V87 A;  2YTO A;  4AIM A;  4IFD A;  3LML A;  2RS7 A;  1NHJ A;  1HR0 E;  2Q2E B;  4PU9 A;  1PJS A;  4F6N A;  4IZJ A;  3ZM7 A;  3M85 G;  3OML A;  4J8Z A;  4YHH E;  2UXD E;  1N33 I;  1A1G A;  4LF6 E;  1A1H A;  3JU0 A;  3VYY A;  2EOR A;  2ADR A;  1HNX I;  1HNZ E;  4FW7 A;  2EMW A;  1DQ3 A;  4LFB I;  4R2Q A;  3T1H I;  2JXP A;  5KL3 A;  2CG9 A;  2PO1 B;  3QT8 A;  1T4O A;  2EPL X;  4DXL A;  2EOI A;  2WNR A;  4IFD C;  1OYS A;  2C37 A;  1GZ6 A;  3ZZT A;  4GKK E;  1KTV A;  5FLX Q;  5K36 A;  4UT4 A;  1RRE A;  4I3H A;  2LJH A;  2ZM6 E;  4DV0 I;  4JI1 I;  2V2Q A;  2EOX A;  4U3B A;  3BBG A;  4HTG A;  2L3C A;  1UDN A;  2LRS A;  2EOO A;  4O24 A;  3P06 A;  5JEA D;  4Z7C A;  4DR7 I;  2I9I A;  2EQ1 A;  2E1R A;  4R2R A;  2EOY A;  3ZOQ B;  3VYX A;  1XMO E;  1X47 A;  3BGH A;  3HJC A;  2GS8 A;  4M9V C;  5DRQ A;  4LF8 E;  1IBM I;  4MU4 A;  2N8X A;  4DV3 I;  4DPT A;  2E5L I;  1Z5C A;  4GKJ E;  4LU9 A;  2R1F A;  2YTE A;  4IJD A;  2EN2 A;  3L7Z A;  3B8H A;  4KQV A;  4DV6 I;  5A6J A;  2VQE E;  4O43 A;  4P7A A;  5C0X F;  4DKK A;  3M7N D;  1IBL I;  4DR5 I;  4OO1 C;  3KRN A;  3AUZ A;  2V2Z A;  2PNZ A;  1FJG I;  4LFC E;  3HXL A;  1MX0 A;  4JI5 I;  4JI8 I;  5DNY A;  5AC5 A;  4F9B B;  4DV1 E;  1T38 A;  4F9C B;  1J26 A;  2WW4 A;  3PS3 A;  1SFE A;  1XNQ I;  4LFA E;  1X5W A;  3JAM C;  2CPN A;  5KL5 A;  3LNU A;  2IHR 1;  1U2R A;  2UXB I;  4NXM E;  1Y4S A;  5GME A;  4JV5 I;  2JR1 A;  2EP3 A;  4J3D A;  1H7U A;  2EM7 A;  3EPJ A;  2PO0 B;  4LF7 I;  2EMH A;  4WX9 A;  2HHH E;  4FW3 A;  1MU5 A;  4HYM A;  1NCS A;  4LF4 I;  3J7A M;  3F6G A;  3U1Y A;  2WBS A;  2IES A;  4DR4 E;  2EWL A;  2LTR A;  4B3M I;  2EN6 A;  3PYF A;  1EH8 A;  2N3H A;  4XTJ A;  1S16 A;  1XNR E;  1H72 C;  3CDI A;  2GHF A;  5C0X D;  2M1S A;  4DV4 I;  4IFD B;  2CSH A;  1BBO A;  2VQF E;  2CGE A;  1G2D C;  2YTI A;  1PDA A;  4OKG A;  4YY3 I;  2D9H A;  2YSO A;  4JI7 I;  2JYA A;  1UDS A;  1MEY C;  4BA2 A;  5TSE A;  4M0V A;  5JEA A;  4FWH A;  4Z7Y A;  1UHZ A;  2R42 A;  2NUF A;  4X64 E;  2A2C A;  3U1K A;  2MKD A;  2V85 A;  3IWB A;  4RHB B;  3MHS C;  4ZVI A;  5A2Q Q;  4AID A;  4P78 A;  1RMD A;  1ZBQ A;  1RHY A;  2J65 A;  2NN6 C;  2JEB A;  3JTZ A;  4B3R I;  1EH7 A;  3PRY A;  4FN5 A;  2JP9 A;  1I94 I;  4BCA A;  2ELZ A;  2EOM A;  1PJQ A;  2UU9 E;  3HTX A;  3PYE A;  4DU8 A;  4WUC A;  2K4V A;  2DIX A;  2EMF A;  1TF3 A;  4IFD E;  1KVK A;  3M99 B;  1Z59 A;  1HR0 I;  4OO1 B;  1IQS A;  1Y6Z A;  1XMQ E;  2ENC A;  2EN3 A;  4LCF A;  2UXD I;  3GLL A;  4YHH I;  2DLQ A;  3ZZ0 A;  4DR1 I;  4LF6 I;  1B63 A;  4M2Z A;  1Z1B A;  2YWQ A;  1A1F A;  3VHT B;  1IBK I;  2VE7 C;  2JEA A;  3J7Y p;  5IWA E;  3UK3 C;  3J81 C;  3ZKB A;  3QT7 A;  2EOS A;  4R8O A;  2OI2 A;  2UXC E;  2BA1 D;  1Z5A A;  2NN6 F;  1NHI A;  2PO0 A;  4X62 E;  2YT4 A;  2O1W A;  2L3J A;  4OX9 I;  4N4R B;  3HQ1 A;  2NUG A;  2K7I A;  4KHP E;  5AE1 A;  3LPS A;  4DV7 E;  3K85 A;  4AM3 A;  2EN7 A;  1E3P A;  1IMU A;  2V89 A;  2ZM6 I;  2R76 A;  1X6E A;  4WXC A;  5LMN E;  4X65 E;  4DR3 E;  2RSM A;  2PNM A;  4NXN E;  2VF1 A;  1ZM4 A;  3GON A;  3J80 Q;  3WU4 A;  2HK2 A;  1ZM9 A;  2L2K B;  4FWD A;  4LCH A;  5C0X A;  4OO1 E;  2EM8 A;  1YSA C;  1XMO I;  1YPN A;  2LT7 A;  4DPY A;  4LF8 I;  3K17 A;  4BMJ A;  1J5E E;  2VF3 A;  3T1Y E;  4R2P A;  1N36 E;  2HC5 A;  4GKJ I;  5A6B D;  1BBG A;  4USM A;  1X48 A;  2EM2 A;  2VQE I;  1X49 A;  3LLH A;  3P3G A;  2LV2 A;  2X36 A;  1YUJ A;  1OYP A;  3P76 A;  4UTG A;  3RMP A;  5C0X C;  2E1M A;  5CFF E;  1Z0E A;  2EN8 A;  3MHH C;  5AE3 A;  1P47 A;  2NN6 D;  4RPF A;  4BHC A;  1UBD C;  4LFC I;  4HAC A;  3THO B;  4ZYE A;  2YPN A;  4DV1 I;  5DNX A;  2F1D A;  1ZBT A;  2N3G A;  3P1X A;  3J7A G;  4TUI A;  4KWY A;  4LFA I;  1T39 A;  1QZR A;  4MQY A;  3IWD A;  3HUL A;  4R1F A;  4BA2 B;  2Z5C A;  2EJ4 A;  1JK2 A;  2EZ6 A;  5JEA B;  4NXM I;  4GEQ B;  2EQ0 A;  5DNL A;  4OO1 A;  2O1V A;  1AH5 A;  3DD6 A;  3GME A;  4M30 A;  3C6K A;  4X9J A;  4DUZ E;  2EPC A;  2HHH I;  2CZ9 A;  1PKP A;  3CDJ A;  4MU1 A;  2JEB B;  3K1J A;  3EQ1 A;  2RTX A;  3TQM A;  2YTQ A;  4ZYD A;  1MGT A;  1DI2 A;  4IS9 A;  4ED4 A;  4DR4 I;  3KZZ A;  4JI4 E;  5EKW A;  2DMI A;  2YTF A;  4B3T I;  2EM0 A;  2EPA A;  2IOQ A;  4OZE A;  1XNR I;  2HGH A;  1X3C A;  4IZK A;  3BID A;  4K0K I;  1ZXN A;  2L33 A;  2NN6 E;  4M1K A;  1G2F C;  2VQF I;  1H7S A;  2HKJ A;  3HPS A;  1A1I A;  4DR6 E;  4ISA A;  1P42 A;  1N34 E;  5JEA E;  4R03 A;  2JEA B;  1IQO A;  1UEK A;  3CWV A;  1R6M A;  2IOP A;  2EM4 A;  2NPF A;  2PRT A;  2BM0 A;  4X64 I;  2EOH A;  5A6A A;  3FIG A;  2BA0 D;  4X8W A;  2DGC A;  2V8Q B;  1Y4U A;  5A6B A;  1H74 A;  2JOB A;  5ADZ A;  2Z5E A;  5IT9 Q;  2J7K A;  2EMA A;  2EM9 A;  2KHX A;  5LMU E;  3ECR A;  2AE8 A;  2C39 A;  2JE6 A;  2JOX A;  4DUY E;  2UU9 I;  4JI6 I;  3KWR A;  2YTJ A;  2AJ4 A;  1YYK A;  4DU7 A;  4LF9 E;  2WCC 3;  2M7Q A;  1AAY A;  1YYW A;  2Z5B B;  3PS2 A;  2UUB E;  2EMB A;  2M4I A; 
#chains in the Genus database with same CATH homology
 1RR9 A;  4JI0 E;  4JYA I;  2DMY A;  4F9A B;  1HNW E;  1Z0C A;  3VK6 A;  2E5L E;  1UIL A;  5A2Q C;  1Z0V A;  4WPY A;  5IWA I;  4AQY E;  2UXC I;  3ZKD A;  4X62 I;  1EA6 A;  4WYQ B;  2UUC E;  4KHP I;  4DV7 I;  2HKE A;  4HAC B;  2F4V E;  2ZIT A;  4JI8 E;  4BS9 A;  4HXZ A;  4IZJ D;  1KIJ A;  5LMN I;  5BR8 E;  4X65 I;  2X7I A;  4DR3 I;  4NXN I;  3C4B A;  3Q6M A;  2DSY A;  2DEJ A;  2Z5C B;  5AAS A;  1RQ0 A;  1Z0G A;  4Q28 A;  2ODR C;  1VIS A;  1NZ0 A;  2JVA A;  1J5E I;  2LUQ A;  4JI2 E;  3T1Y I;  3LTO A;  1HNZ I;  1N32 E;  1DAR A;  3D4J A;  2EFG A;  2XEX A;  3Q6N A;  2LJP A;  2V34 A;  1D6T A;  1Z0W A;  3M6A A;  1STU A;  4GKK I;  4IZK B;  4BC9 A;  2L8T A;  4LF5 E;  4DPX A;  4L8N A;  3B82 A;  4HY1 A;  3DF6 A;  2KOU A;  1ZM3 A;  2B7V A;  2Z5B A;  4DV2 E;  1A6F A;  3QT5 A;  1QU6 A;  2V83 A;  3V2U C;  1Z5B A;  2RS6 A;  4DUZ I;  2R3V A;  2LUP B;  5FLX C;  2V2V A;  1MG7 A;  3ZZU A;  4EMD A;  2DB2 A;  3WU5 A;  4X66 E;  4WFT A;  4JI4 I;  2FGG A;  5GMD A;  2O1T A;  4JI3 E;  2JY9 A;  2BM1 A;  1KKH A;  2GQ0 A;  1WXR A;  1Z0T A;  4L5N C;  3ADI A;  5F3W A;  3MSW A;  5AE2 A;  4OOG C;  4DR6 I;  4N3O A;  4DR1 E;  4F54 A;  1N34 I;  1WHN A;  4LTY A;  3OTO E;  3H4L A;  4BC7 A;  1IBK E;  1USV A;  2KON A;  3C4T A;  1USU A;  1WHQ A;  2ODR D;  2FTX B;  4B3S E;  2UUA E;  4OX9 E;  1S4E A;  3PYG A;  2ZBK B;  1FNM A;  3V5R A;  3H09 A;  1T4L B;  1N0V C;  5LMU I;  4DV5 E;  4DUY I;  4DR2 E;  2A2D A;  4FW9 A;  4LF9 I;  2MC5 A;  3IWC A;  1ELO A;  2UUB I;  4JI0 I;  1N0U A;  2NUE A;  2B7T A;  1N33 E;  2L2N A;  1HNW I;  1FKA E;  1FWL A;  1HNX E;  1SR9 A;  4AQY I;  2V86 A;  4LFB E;  2MDR A;  3T1H E;  5IT9 C;  2B9D A;  1EKZ A;  2UUC I;  2LBS B;  4BBY A;  1RC7 A;  4WUB A;  1BKN A;  2NA2 A;  4PRV A;  2JWO A;  1OJ4 A;  5L3J A;  2F4V I;  5T6J A;  3DJW A;  4DV0 E;  4JI1 E;  1YZ9 A;  5BR8 I;  2L6M A;  4PRX A;  2O1U A;  4DR7 E;  1XMQ I;  2HFU A;  3WU6 A;  3F6H A;  3B78 A;  3WU3 A;  2L2M A;  1IBM E;  4DV3 E;  4JI2 I;  3JAM Q;  1N32 I;  3ADJ A;  1FWK A;  3Q1Q A;  4DV6 E;  4USK A;  1H73 A;  2FV4 B;  4TUG A;  4B3T E;  4JG4 A;  1YYO A;  3ADG A;  1IBL E;  1K47 A;  4DR5 E;  1FJG E;  4KZS A;  4LF5 I;  1T4N A;  4JI5 E;  1EI1 A;  4K0K E;  1ZXM A;  2PNL A;  3PYD A;  2WZO A;  4IZJ B;  2H36 X;  4P7D A;  1XNQ E;  3QT6 A;  4DPU A;  1PIE A;  4DV2 I;  4WSP A;  2UXB E;  4JV5 E;  4DPW A;  2BV3 A;  4FWG A;  1N36 I;  4LF7 E;  2HFS A;  5LL6 R;  4LF4 E;  3HPZ A;  4X66 I;  3F0N A;  2HK3 A;  4DMI A;  4B3M E;  4JI6 E;  2V88 A;  3J80 C;  4JI3 I;  1FI4 A;  4DV4 E;  3K6Q A;  4P52 A;  1ZM2 A;  2F8B A;  5FWK A;  4JYA E;  4WUD A;  2V8P A;  2YZT A;  4YY3 E;  4URL A;  4JI7 E;  3OTO I;  3AV0 A;  2LTS A;  2LE2 A;  1B62 A;  4MYU A;  2LMZ A;  1PVG A;  2DEI A;  2B3T B;  4I8O A;  2L92 A;  4B3S I;  2UUA I;  1HK7 A;  1Z0B A;  3J81 Q;  2G7H A;  4B3R E;  1WUU A;  1I94 E;  1O0W A;  1NHH A;  1XHK A;  4DV5 I;  4MYT A;  4DR2 I;  2MC6 A;  1GQE A;  3ADL A;  2V87 A;  3LML A;  2RS7 A;  1NHJ A;  1HR0 E;  2Q2E B;  4PU9 A;  3ZM7 A;  4IZJ A;  3OML A;  4J8Z A;  4YHH E;  2UXD E;  1N33 I;  4LF6 E;  3JU0 A;  3VYY A;  1HNX I;  1HNZ E;  1DQ3 A;  4LFB I;  3T1H I;  2CG9 A;  3QT8 A;  1T4O A;  4DXL A;  1GZ6 A;  3ZZT A;  4GKK E;  1KTV A;  5FLX Q;  4UT4 A;  1RRE A;  4I3H A;  2LJH A;  2ZM6 E;  4DV0 I;  4JI1 I;  2V2Q A;  2L3C A;  2LRS A;  3P06 A;  4Z7C A;  4DR7 I;  2E1R A;  3ZOQ B;  3VYX A;  1XMO E;  1X47 A;  3HJC A;  2GS8 A;  4LF8 E;  1IBM I;  4DV3 I;  4DPT A;  2E5L I;  1Z5C A;  4GKJ E;  4LU9 A;  3B8H A;  4KQV A;  4DV6 I;  2VQE E;  4P7A A;  4DKK A;  1IBL I;  4DR5 I;  1FJG I;  3AUZ A;  2V2Z A;  4LFC E;  3HXL A;  1MX0 A;  4JI5 I;  4JI8 I;  5DNY A;  4F9B B;  4DV1 E;  4F9C B;  1J26 A;  2WW4 A;  1XNQ I;  4LFA E;  3JAM C;  2CPN A;  3LNU A;  2IHR 1;  1U2R A;  2UXB I;  4NXM E;  1Y4S A;  5GME A;  4JV5 I;  2JR1 A;  1H7U A;  4LF7 I;  2HHH E;  1MU5 A;  4HYM A;  4LF4 I;  3J7A M;  3F6G A;  4DR4 E;  2EWL A;  2LTR A;  4B3M I;  3PYF A;  2N3H A;  4XTJ A;  1S16 A;  1XNR E;  1H72 C;  4DV4 I;  2M1S A;  2VQF E;  2CGE A;  4YY3 I;  4JI7 I;  4M0V A;  4FWH A;  4Z7Y A;  1UHZ A;  2R42 A;  2NUF A;  4X64 E;  2A2C A;  2V85 A;  3IWB A;  4ZVI A;  5A2Q Q;  4P78 A;  1ZBQ A;  3JTZ A;  4B3R I;  3PRY A;  4FN5 A;  1I94 I;  4BCA A;  2UU9 E;  3HTX A;  3PYE A;  4DU8 A;  4WUC A;  2K4V A;  2DIX A;  1KVK A;  1Z59 A;  1HR0 I;  1Y6Z A;  1XMQ E;  2UXD I;  4YHH I;  4DR1 I;  3ZZ0 A;  4LF6 I;  1B63 A;  4M2Z A;  1IBK I;  2VE7 C;  3J7Y p;  5IWA E;  3J81 C;  3ZKB A;  3QT7 A;  4R8O A;  2OI2 A;  2UXC E;  1Z5A A;  1NHI A;  4X62 E;  2YT4 A;  2O1W A;  2L3J A;  4OX9 I;  3HQ1 A;  2NUG A;  4KHP E;  5AE1 A;  3LPS A;  4DV7 E;  3K85 A;  2V89 A;  2ZM6 I;  5LMN E;  4X65 E;  4DR3 E;  2RSM A;  2PNM A;  4NXN E;  2VF1 A;  1ZM4 A;  3GON A;  3J80 Q;  3WU4 A;  2HK2 A;  1ZM9 A;  2L2K B;  4FWD A;  1XMO I;  4DPY A;  4LF8 I;  3K17 A;  4BMJ A;  1J5E E;  2VF3 A;  3T1Y E;  1N36 E;  4GKJ I;  4USM A;  1X48 A;  2VQE I;  1X49 A;  3LLH A;  2X36 A;  4UTG A;  3RMP A;  2E1M A;  5CFF E;  1Z0E A;  4RPF A;  5AE3 A;  4LFC I;  4HAC A;  4DV1 I;  1ZBT A;  2N3G A;  3P1X A;  3J7A G;  4TUI A;  4LFA I;  1QZR A;  3IWD A;  3HUL A;  4R1F A;  2Z5C A;  2EZ6 A;  4NXM I;  4GEQ B;  2O1V A;  4M30 A;  4DUZ E;  2HHH I;  2CZ9 A;  1PKP A;  3K1J A;  2RTX A;  1DI2 A;  4ED4 A;  4DR4 I;  4B3T I;  4JI4 E;  2IOQ A;  1XNR I;  4IZK A;  4K0K I;  1ZXN A;  2L33 A;  4M1K A;  2VQF I;  1H7S A;  2HKJ A;  3HPS A;  4DR6 E;  1N34 E;  4R03 A;  1UEK A;  3CWV A;  2IOP A;  2NPF A;  4X64 I;  2BM0 A;  3FIG A;  4X8W A;  2V8Q B;  1Y4U A;  1H74 A;  2JOB A;  5ADZ A;  2Z5E A;  5IT9 Q;  2J7K A;  5LMU E;  2KHX A;  4JI6 I;  2UU9 I;  2JOX A;  4DUY E;  3KWR A;  2AJ4 A;  1YYK A;  4DU7 A;  4LF9 E;  2M7Q A;  2Z5B B;  1YYW A;  2UUB E;  2M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...