2VQFE

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2vqfE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2vqfE02
1KKHA 2E1RA 1S4EA 1RC7A 5IWAE 4HACB 3V2UC 1X49A 4KHPE 2X7IA 3H4LA 5LMNI 2V34A 4LFCI 2UXCE 1UHZA 4DUZI 4JI2I 1MG7A 3WU4A 2KHXA 1XMOE 4K0KE 2MDRA 4YHHE 2DMYA 1HNZE 5LMUE 5A2QC 4LF7I 1QU6A 4B3TE 4LF9E 4YY3I 5BR8E 1N33E 4LFAE 3V5RA 4JI3E 2VQEE 1K47A 5LL6R 4AQYE 4DR6E 1Z0EA 3LNUA 1XNRE 2X36A 1RQ0A 1XHKA 4FWDA 4UTGA 2HHHE 1XMQI 2UXBI 2L2NA 2NUEA 1NZ0A 5FLXQ 4LFBE 4JI4I 3JAMQ 1ZM4A 1IBLI 4LF8E 4URLA 4X8WA 3ZZTA 3QT8A 1YYOA 3VYXA 4DV3E 4DR1E 4P52A 2UXDE 1NHJA 2HFUA 1XNQI 4OOGC 4OX9I 2NA2A 1H7UA 3B82A 1Z5CA 5GMDA 2LRSA 4DV6I 1J5EE 4NXME 3PYFA 1QZRA 4FN5A 4Z7CA 4X65I 4DR4E 1PIEA 1I94I 1D6TA 1Z0CA 1KTVA 4DPXA 1N32I 2Q2EB 3D4JA 1IBKI 4DV7I 5LMNE 4LFCE 1EKZA 4X64I 4DR2E 4DV0E 1N34I 1EI1A 4X62I 4JI2E 2L3JA 5FLXC 3JAMC 4LF7E 4JI5I 2E5LI 1RREA 4YY3E 3ZKBA 3WU5A 2NUGA 1U2RA 4WYQB 3CWVA 4NXNI 3T1HI 1B63A 1XMQE 2UXBE 3LPSA 3GONA 1Z0TA 4B3MI 3QT5A 1EA6A 4JI4E 1N36I 1IBLE 4X66I 2CPNA 3HTXA 3PYEA 4WUBA 1HR0I 4HY1A 2VF3A 3HULA 4M2ZA 4DU7A 1S16A 1UILA 1XNQE 3LLHA 2AJ4A 3ADGA 2A2DA 3ZZUA 1WHQA 4USKA 1X48A 4DPTA 3F0NA 4X65E 1DI2A 2BV3A 2HK3A 4JI8I 4DV1I 2LJPA 3B78A 4DPUA 4GKJI 1ZM2A 1ZM3A 1I94E 2F4VI 2ZM6E 4B3RI 2RS6A 2RS7A 1N32E 2NUFA 1YZ9A 3WU6A 4DXLA 1IBKE 2UUCI 4DV7E 1H74A 1ZXMA 2BM1A 1N34E 2V2ZA 4X62E 2N3GA 4DR3I 1FNMA 2L2MA 1BKNA 4DPWA 2XEXA 1YYKA 2LBSB 2B7TA 4DV2I 1KVKA 4LF6I 4RPFA 2DIXA 4GKKI 4JI5E 3OTOE 2E5LE 1ZXNA 2L2KB 1Z5AA 1HNWI 4JV5I 4NXNE 3T1HE 3J80Q 1T4OA 3J7Yp 2LUQA 4P7AA 1ELOA 3ADJA 4B3ME 2OI2A 4R1FA 4JI1I 1Z0WA 5GMEA 3Q1QA 2R3VA 4DR7I 4JI7I 5IWAI 4Z7YA 4JYAI 2L33A 4X66E 4DV5I 4KHPI 4WFTA 1HR0E 4DR5I 3VYYA 1O0WA 2B3TB 2ZITA 2HFSA 4DUYI 2ZBKB 1XMOI 4DUZE 4YHHI 2HKEA 1Z5BA 1HNZI 3ZM7A 4LF4I 2UUAI 5CFFE 2V2VA 4DV1E 4DV4I 4GKJE 5BR8I 2V2QA 2RSMA 3J81Q 1B62A 3QT7A 1XNRI 2UUCE 3J80C 3PYGA 3C4TA 2DEIA 2CZ9A 4JG4A 1YYWA 4LFBI 1Z0GA 2UUBI 4LF5I 2VQFI 4DV2E 4LF6E 4FW9A 2J7KA 4GKKE 1MU5A 4UT4A 4ED4A 4MYTA 1FWLA 4JV5E 1X47A 4FWGA 4OX9E 3C4BA 4DV6E 1IBMI 2B7VA 1Z59A 4JI1E 4USMA 4DR7E 4JI7E 2LJHA 4DKKA 2RTXA 4JYAE 4DV5E 3K1JA 2A2CA 3J81C 2BM0A 2N3HA 4DR5E 4I3HA 3ADLA 4ZVIA 2NPFA 3P1XA 1Z0BA 4DV0I 4DR2I 3K17A 4HXZA 4X64E 2UU9I 4JI6I 4DUYE 4PRXA 2HK2A 1ZBTA 4B3SI 4LF4E 3T1YI 2UUAE 4JI0I 4PRVA 4M30A 2DB2A 2EFGA 2R42A 4DV4E 1VISA 1T4LB 4KQVA 5L3JA 4DU8A 2HKJA 1MX0A 1T4NA 4FWHA 1FJGI 1OJ4A 3J7AM 4DPYA 3QT6A 3B8HA 1H72C 1ZM9A 1NHHA 1PVGA 3M6AA 4HACA 2UUBE 4LF5E 1HNXI 2VQFE 1FI4A 2L3CA 5IT9Q 2GS8A 3LTOA 1WHNA 3ZKDA 1N36E 1DARA 3ADIA 4EMDA 2EZ6A 1FWKA 4M1KA 1FKAE 2JY9A 2V8PA 2UXCI 2LUPB 4XTJA 1H73A 4WUDA 1GQEA 4K0KI 2YT4A 1IBME 4PU9A 1PKPA 5LMUI 4JI8E 1KIJA 4B3TI 4HYMA 4LF9I 2ZM6I 2IHR1 1NHIA 1N33I 2F4VE 4LFAI 4JI3I 2VQEI 4B3RE 2DEJA 4AQYI 4DR6I 3ZZ0A 1STUA 2HHHI 4JI6E 2UU9E 2WW4A 1WUUA 3PYDA 1Z0VA 2LTRA 4MYUA 4DR3E 4B3SE 1UEKA 3T1YE 5IT9C 4JI0E 1H7SA 4LF8I 2LTSA 3OTOI 5A2QQ 3WU3A 1J26A 4DV3I 4DR1I 3J7AG 2UXDI 1RR9A 1N0VC 1HNWE 2JVAA 1FJGE 1J5EI 1N0UA 4NXMI 1A6FA 4DR4I 4WUCA 1HNXE
chains in the Genus database with same CATH superfamily
3C6KA 1GTKA 1KKHA 4BS9A 3P3EA 3IWDA 2EMXA 2E1RA 1S4EA 1RC7A 5IWAE 1Y60A 4HACB 3M85G 1PDAA 5KL7A 3V2UC 2I9IA 1X49A 1UN6B 5JEAB 3DD6A 4KHPE 2X7IA 4MU3A 2YU5A 4WSPA 1OYPA 4ZYHA 4NZVA 2LMZA 3H4LA 3U1KA 5LMNI 2Z5CA 2V34A 4LFCI 2GO3A 2UXCE 5AC4A 1UHZA 4DUZI 4JI2I 5K36E 4BMJA 5AE2A 1T38A 1MG7A 3WU4A 3M7ND 2KHXA 3MHHC 2YTJA 3MHSC 1XMOE 4K0KE 2MDRA 4YHHE 2DMYA 2L6MA 4IFDA 4OO1C 1HNZE 4LU9A 4KZSA 4LCHA 2JPAA 5LMUE 1N3GA 2JOXA 2WNRA 5C0XC 5A2QC 4LF7I 1QU6A 4B3TE 2EJ4A 5A6AA 2EL6A 5TSEA 4LF9E 3Q6NA 4MU4A 4QNJA 4YY3I 4BA2A 5BR8E 4ZYGA 1N33E 4LFAE 3KZYA 3V5RA 4JI3E 2VQEE 4GEQB 5LL6R 1K47A 4AQYE 4DR6E 1Z0EA 3LNUA 2MKNA 3EPLA 1XNRE 1SFEA 4R2PA 2X36A 3PS3A 1RQ0A 1XHKA 4FWDA 4UTGA 2HHHE 1XMQI 2UXBI 5A6JA 2VRDA 2V87A 2L2NA 2JEBB 1X6FA 2EN6A 3P3CA 2NUEA 2PNZB 1A1KA 1NZ0A 5C0XD 5FLXQ 3KWRA 4LFBE 4JI4I 2LT7A 3JAMQ 3JTZA 3H09A 1ZM4A 1IBLI 4LF8E 1UDNA 4BCAA 4URLA 4X8WA 3ZZTA 2YSOA 2LE2A 3KZZA 3QT8A 2NN6F 1YYOA 2YSPA 2EM6A 1EH7A 4DV3E 4F54A 4DR1E 3VYXA 1IQOA 2CT1A 2UXDE 4P52A 1NHJA 2RQLA 2HFUA 4LF8I 1XNQI 4OOGC 4OX9I 2NA2A 2EL5A 2CVEA 2EMFA 1H7UA 1YUIA 3GMEA 4ZYDA 1Z5CA 3B82A 2A25A 2F8BA 2LRSA 5GMDA 4DV6I 5AE3A 1J5EE 4NXME 2LCEA 2MKDA 3VHTB 1USVA 2EOQA 2EPCA 2CGEA 2PO2B 2C39B 1QZRA 2WP8B 4FN5A 3VK6A 2R76A 3UHMA 4Z7CA 4X65I 2E72A 5JEAE 4DR4E 2YU8A 2DSYA 1PIEA 2YRMA 1HK7A 3F6HA 1Z1BA 1I94I 2E1MA 2EPPA 3GLLA 1D6TA 2DLKA 1Z0CA 2RPCA 2K7IA 2EOSA 2EOIA 1KTVA 4IZJD 4DPXA 2Q2EB 2FGGA 1N32I 3D4JA 1IBKI 1MGTA 2NABA 4DV7I 5LMNE 2EQ3A 4FK5C 4LFCE 2EPKX 1EKZA 4X64I 2YRHA 4DV0E 4DR2E 1EI1A 1N34I 4X62I 3HPZA 4LCFA 4JI2E 4O43A 4WXCA 1E3HA 2Z5CB 2L3JA 1A1GA 2BA1G 5FLXC 4OO1F 2ADRA 4MU0A 5KL5A 2JE6B 3JAMC 4IFDB 4BHCA 4LF7E 2EN3A 5AE1A 1WXRA 3U1YA 4JI5I 1NEIA 2EQ1A 4M9VC 2E5LI 2G7HA 4LTYA 1RREA 1F2IG 4YY3E 3ZKBA 2ODRC 3WU5A 4FW6A 2NUGA 1U2RA 5EKWA 4WYQB 2ELZA 2IESA 1Y5YA 3CWVA 4P78A 4NXNI 3T1HI 2PO2A 2V86A 3GCMA 2EMHA 5IXMB 2LVHA 2YTQA 1XMQE 2UXBE 1B63A 3LPSA 1EH6A 3GONA 1Z0TA 4LOMA 1X3CA 5K36C 3NZKA 1WRJA 3QT5A 4B3MI 2EMKA 1EA6A 2V85A 1DQ3A 1TF6A 2EL4A 2EMYA 4JI4E 2EWLA 2DGCA 3F6GA 5DRPA 1N36I 2ODRD 1IBLE 4X66I 2CPNA 3HTXA 3PYEA 4Q35B 2CTDA 2EE8A 1PJTA 2VF3A 4F9BB 4O5GA 3HULA 4HY1A 4WUBA 4M2ZA 4DU7A 4U3DA 1S16A 5DRQA 3BIDA 1UILA 1YPNA 1XNQE 1G2DC 2ELYA 1AH5A 3LLHA 5K36D 4R2QA 1XXEA 4BBYA 2YRKA 2AJ4A 3ADGA 2A2DA 2JE6A 1WHQA 3ZZUA 4USKA 1X48A 2KONA 4DPTA 2CG9A 2YTPA 3EPJA 4NBQA 1BB8A 1IMUA 2R1FA 1YUJA 2PNMA 4X65E 3F0NA 4M0VA 4U3BA 1DI2A 2BV3A 2HK3A 4JI8I 2WBTA 5ADZA 4DV1I 2LJPA 2YTDA 3CDJA 3B78A 1USUA 4DPUA 4GKJI 1ZM2A 2GLIA 1ZM3A 1I94E 3L00A 3P06A 2F4VI 1BBGA 2LJUA 2ZM6E 1DGCA 4B3RI 2EPRA 4QNKA 2RS6A 2RS7A 5DNYA 1N32E 2NUFA 2LO3A 2LV2A 1YZ9A 1IBKE 3WU6A 4DXLA 2UUCI 1A1FA 1WJPA 3AV0A 4DV7E 2EMBA 2EM8A 4N4RB 1H74A 1ZXMA 5KL2A 1MEYC 2BM1A 1N34E 2EOFA 4X62E 2V2ZA 4OO1A 2N3GA 2DRPA 4DR3I 2O1VA 4L5NC 1YHCA 3THOB 4IFDE 1FNMA 2L2MA 1BKNA 4DPWA 2PO0B 2XEXA 1YYKA 2LBSB 2B7TA 4DV2I 2EMCA 1KVKA 5JEAC 4LF6I 4RPFA 4KWYA 2DIXA 3HQ1A 4F9AB 4JI5E 3OTOE 1UDSA 4GKKI 1KJKA 2E5LE 5KL4A 2V88A 1YFHA 1ZXNA 2BA0G 2Z5EA 2EM7A 1TN9A 4R8OA 2L2KB 1Z5AA 4BA1A 2MC5A 4N3OA 1HNWI 1NCSA 4JV5I 4ZYEA 4NXNE 5A69A 3FIGA 3EPHA 3T1HE 3J80Q 4R2DA 1T4OA 4OO1E 5A6BD 2Z5BA 3J7Yp 2PNLA 2LUQA 4P7AA 1ELOA 3UK3C 4O24A 3ADJA 5JEAD 5K36F 2IERA 4B3ME 3EPKA 2OI2A 4R1FA 4JI1I 2C38A 4F2JC 1Z0WA 5GMEA 3Q1QA 2R3VA 4DR7I 4JI7I 5IWAI 2VESA 2O3ZA 2EN1A 1A1LA 4Z7YA 4JYAI 2ENCA 2L33A 4X66E 4DV5I 4KHPI 4LCGA 4WFTA 2EMZA 2YTIA 2WBSA 1HR0E 2M4IA 2JT2A 4O4KA 3ZOQB 4DR5I 5AC5A 2NN6B 3VYYA 2NN6D 5DROA 1O0WA 4R2AA 1PJQA 3PYFA 2B9DA 2B3TB 2M1SA 4X9JA 2ZITA 1P42A 1BBOA 3M7NG 2HFSA 4TUIA 1UDQA 4DUYI 2JWOA 2PO0A 2ZBKB 2EMAA 4DUZE 1P47A 4YHHI 2HKEA 1XMOI 2YTNA 4I8OA 1Z5BA 1HNZI 2EMGA 3ZM7A 4LF4I 1HNXE 2UUAI 2JEAB 4AM3A 2V89A 4R2SA 5CFFE 2V2VA 3HJCA 4DV1E 4TUGA 4DV4I 2EPAA 2YTOA 2WCC3 4F9CB 4GKJE 5C0XF 2V83A 5BR8I 3EQ1A 2GHFA 2EOMA 1ZR9A 2V2QA 2BB8A 2RSMA 3K6QA 2BBGA 3J81Q 4FW4A 2D9HA 1B62A 3QT7A 3HKMA 2EN7A 2UUCE 3J80C 2EMWA 4WXDA 4AIDA 3JU0A 1XNRI 2PO1B 3B4TA 3PYGA 3C4TA 4IZKA 3OMLA 2DEIA 2JXPA 2CZ9A 2FV4B 2MC6A 1IQSA 4JG4A 2YZTA 5AASA 4MU1A 2K4VA 1YYWA 1HR0I 4LFBI 5EL9A 4IS1C 1Z0GA 2UUBI 4LF5I 4OO1B 4WX9A 2VQFI 2Q8UA 4DV2E 5JEAF 4LF6E 2GQ0A 4FW9A 2O1UA 2J7KA 2NN6A 1KYQA 4GKKE 5C0XB 1MU5A 4UT4A 4BC7A 2O1TA 1QNTA 2HC5A 4ED4A 1PJSA 4MYTA 1FWLA 3DJWA 2O1WA 4JV5E 1X47A 4FWGA 4OX9E 5DNXA 3AUZA 4BA1B 4WPYA 4MQYA 2JEAA 5K36A 3C4BA 4DV6E 3TQMA 1IBMI 2EOYA 2V8QB 2B7VA 4R03A 1Z59A 4JI1E 2Z5BB 4IFDC 4USMA 2C37A 4R2EA 4DR7E 1RMDA 4L8NA 2JOBA 3P76A 4JI7E 2LJHA 4DKKA 4WSGA 2NN6E 1ZU1A 3BBGA 4F6NA 2RTXA 4JYAE 2KOUA 2C38B 4DV5E 2EN2A 4BHBA 3K1JA 3J81C 2A2CA 2BM0A 2PO1A 2N3HA 4DR5E 4I3HA 2EP3A 3P3GA 3ADLA 4FW3A 4ZVIA 2NPFA 2VF1A 3P1XA 5IV8B 2AE8A 4NHRA 2JP9A 2VE7C 1Z0BA 4DV0I 4DR2I 3K17A 2PRTA 4HXZA 4X64E 2UU9I 4JI6I 4DUYE 4IFDD 2N8XA 4PRXA 4IZJB 5KL3A 2HK2A 4RHBB 1ZBTA 2EOOA 3HXLA 4B3SI 4J3DA 1X6HA 4LF4E 4Q28A 3T1YI 4GZNC 2UUAE 4JI0I 2DLQA 4PRVA 2BA1D 4M30A 2DB2A 2EFGA 2R42A 5C0XA 2EM2A 3L7ZB 1YH8A 4DV4E 2EOEA 1SR9A 1VISA 1T4LB 5T6JA 3CDIA 1EH8A 4KQVA 5DRRA 5L3JA 4DU8A 2HKJA 2YTFA 1MX0A 4OZEA 2EM5A 2M7QA 4DMIA 1T4NA 2HJJA 4OO1D 4FWHA 2F1DA 3ECRA 4AIMA 1FJGI 1JK1A 2YTGA 4IJDA 2J7JA 1OJ4A 1AAYA 3J7AM 2GO4A 2EN8A 2EPZA 5A6BA 1A1JA 3B8HA 3QT6A 4DPYA 1H72C 1ZM9A 1NHHA 1PVGA 3M6AA 2BR2B 4HACA 2UUBE 4LF5E 4IZKB 5JEAA 5C0XE 1HNXI 2VQFE 2EM4A 4F6MA 3DF6A 2L3CA 1G2FC 1FI4A 5IT9Q 1T39A 2GS8A 3LTOA 1WHNA 3ZKDA 1N36E 1X6EA 1DARA 1L4SA 2ENAA 3ADIA 3M85D 4OKGA 4EMDA 1LLMC 2EPMX 1ZAAC 1E3PA 5LLQA 2EOHA 4IZJA 2EZ6A 1FWKA 4M1KA 3IWCA 2JY9A 1FKAE 1UDOA 2V8PA 2UXCI 2LUPB 2RSIA 4IS9A 4XTJA 1UBDC 1H73A 3C6MA 4WUDA 1GQEA 4RH8A 5DNLA 5F3WA 4FW5A 2EPNA 2YT4A 4K0KI 3L7ZA 2EOXA 1IBME 4PU9A 3MSWA 1PKPA 5K36B 3M99B 4P7DA 4IFDF 5LMUI 1VI7A 3PS2A 3PRYA 4JI8E 1R6MA 4MLQA 2YWQA 1KIJA 4HYMA 4B3TI 3HPSA 5ELWA 2C37B 4LF9I 2M9AA 1RHYA 2ZM6I 2IHR1 3THNA 3RMPA 1NHIA 2DMIA 2ENHA 3IWBA 2EM9A 1YSAC 2F4VE 4LFAI 1N33I 1GZ6A 2EN4A 4LPFA 4JI3I 2VQEI 4B3RE 2DEJA 2MDGA 4AQYI 2L92A 4DR6I 3ZZ0A 4MLVA 1STUA 2EORA 2GPIA 2EPUA 2WBUA 2JEBA 2EPLX 2PNZA 4BC9A 5A6KA 2HHHI 4R2RA 2UU9E 4JI6E 2EPXA 1WUUA 2BR2A 2WW4A 3PYDA 2YPNA 3Q6MA 1Z0VA 2LTRA 1X5WA 4ISAA 4MYUA 4DR3E 1Y4UA 3QG5C 4B3SE 4FW7A 1UEKA 3T1YE 4HEIA 5IT9C 1JK2A 4JI0E 1R6LA 4GQUA 2JR1A 1H7SA 2L8TA 1OYSA 2EM3A 2EM0A 2CSHA 3BF2A 1A1HA 2I13A 2LTSA 4R2CA 1B69A 2IOQA 2J65A 3KRNA 5A2QQ 3OTOI 2HGHA 3K85A 3WU3A 2NN6C 2WNRB 1J26A 2FTXB 4DV3I 2EMIA 4DR1I 3J7AG 2EOZA 2UXDI 3BGHA 1RR9A 5KL6A 5FWKA 1N0VC 4MDTA 3LMLA 1HNWE 1OYRA 2BA0D 4BA2B 2WP8A 1ZBQA 4J8ZA 2C39A 2JVAA 2YTEA 3PS1A 1A1IA 1FJGE 1Y4SA 1N0UA 1J5EI 2EOJA 4NXMI 1Y6ZA 1TF3A 3H1CA 2H36X 2EQ0A 2WZOA 2EPOA 4HTGA 1A6FA 4DR4I 4WUCA 2EMLA 2JYAA 2IOPA
chains in the Genus database with same CATH topology
1KKHA 4BS9A 3IWDA 2E1RA 1S4EA 1RC7A 5IWAE 4HACB 3V2UC 1X49A 4KHPE 2X7IA 4WSPA 3H4LA 2LMZA 5LMNI 2Z5CA 2V34A 4LFCI 2UXCE 1UHZA 4DUZI 4JI2I 4BMJA 5AE2A 1MG7A 3WU4A 2KHXA 1XMOE 4K0KE 2MDRA 4YHHE 2DMYA 2L6MA 1HNZE 4LU9A 4KZSA 5LMUE 2JOXA 5A2QC 4LF7I 1QU6A 4B3TE 4LF9E 3Q6NA 4YY3I 5BR8E 1N33E 4LFAE 3V5RA 4JI3E 2VQEE 4GEQB 5LL6R 1K47A 4AQYE 4DR6E 1Z0EA 3LNUA 1XNRE 2X36A 1RQ0A 1XHKA 4FWDA 4UTGA 2HHHE 1XMQI 2UXBI 2V87A 2L2NA 2NUEA 1NZ0A 5FLXQ 3KWRA 4LFBE 4JI4I 3JAMQ 3JTZA 3H09A 1ZM4A 1IBLI 4LF8E 4BCAA 4URLA 4X8WA 3ZZTA 2LE2A 3QT8A 1YYOA 3VYXA 4DV3E 4F54A 4DR1E 4P52A 2UXDE 1NHJA 2HFUA 1XNQI 4OOGC 4OX9I 2NA2A 1H7UA 3B82A 1Z5CA 5GMDA 2F8BA 2LRSA 4DV6I 5AE3A 1J5EE 4NXME 1USVA 3PYFA 2CGEA 1QZRA 4FN5A 4Z7CA 3VK6A 4X65I 4DR4E 2DSYA 1PIEA 1HK7A 3F6HA 1I94I 2E1MA 1D6TA 1Z0CA 1KTVA 4DPXA 4IZJD 1N32I 2Q2EB 2FGGA 3D4JA 1IBKI 4DV7I 5LMNE 4LFCE 1EKZA 4X64I 4DR2E 4DV0E 1N34I 1EI1A 4X62I 3HPZA 4JI2E 2Z5CB 2L3JA 5FLXC 3JAMC 4LF7E 5AE1A 1WXRA 4JI5I 2E5LI 2G7HA 4LTYA 1RREA 4YY3E 3ZKBA 2ODRC 3WU5A 2NUGA 1U2RA 4WYQB 3CWVA 4NXNI 4P78A 3T1HI 2V86A 1B63A 1XMQE 2UXBE 3LPSA 3GONA 1Z0TA 4B3MI 3QT5A 1EA6A 2V85A 1DQ3A 4JI4E 2EWLA 3F6GA 1N36I 2ODRD 1IBLE 4X66I 2CPNA 3HTXA 3PYEA 4WUBA 1HR0I 4HY1A 2VF3A 4F9BB 3HULA 4M2ZA 4DU7A 1S16A 1UILA 1XNQE 3LLHA 4BBYA 2AJ4A 3ADGA 2A2DA 3ZZUA 1WHQA 4USKA 1X48A 2KONA 4DPTA 2CG9A 3F0NA 2PNMA 4X65E 4M0VA 1DI2A 2BV3A 2HK3A 4JI8I 5ADZA 4DV1I 2LJPA 3B78A 1USUA 4DPUA 4GKJI 1ZM2A 1ZM3A 1I94E 3P06A 2F4VI 2ZM6E 4B3RI 2RS6A 2RS7A 5DNYA 1N32E 2NUFA 1YZ9A 3WU6A 4DXLA 1IBKE 2UUCI 3AV0A 4DV7E 1H74A 1ZXMA 2BM1A 1N34E 2V2ZA 4X62E 2N3GA 4DR3I 2O1VA 4L5NC 1FNMA 2L2MA 1BKNA 4DPWA 2XEXA 1YYKA 2LBSB 2B7TA 4DV2I 1KVKA 4LF6I 4RPFA 2DIXA 3HQ1A 4F9AB 4JI5E 3OTOE 4GKKI 2E5LE 2V88A 1ZXNA 2Z5EA 4R8OA 2L2KB 1Z5AA 1HNWI 2MC5A 4N3OA 4JV5I 4NXNE 3FIGA 3T1HE 3J80Q 1T4OA 2Z5BA 3J7Yp 2PNLA 2LUQA 4P7AA 1ELOA 3ADJA 4B3ME 2OI2A 4R1FA 4JI1I 1Z0WA 5GMEA 3Q1QA 2R3VA 4DR7I 4JI7I 5IWAI 4Z7YA 4JYAI 2L33A 4X66E 4DV5I 4KHPI 4WFTA 1HR0E 2M4IA 3ZOQB 4DR5I 3VYYA 1O0WA 2B9DA 2B3TB 2M1SA 2ZITA 2HFSA 4TUIA 4DUYI 2JWOA 2ZBKB 1XMOI 4DUZE 4YHHI 2HKEA 4I8OA 1Z5BA 1HNZI 3ZM7A 4LF4I 2UUAI 2V89A 5CFFE 2V2VA 3HJCA 4DV1E 4TUGA 4DV4I 4F9CB 4GKJE 2V83A 5BR8I 2V2QA 2RSMA 3K6QA 3J81Q 1B62A 3QT7A 1XNRI 2UUCE 3J80C 3JU0A 3PYGA 3C4TA 4IZKA 3OMLA 2DEIA 2CZ9A 2FV4B 2MC6A 4JG4A 2YZTA 5AASA 2K4VA 1YYWA 4LFBI 1Z0GA 2UUBI 4LF5I 2VQFI 4DV2E 4LF6E 2GQ0A 4FW9A 2O1UA 2J7KA 4GKKE 1MU5A 4UT4A 4BC7A 2O1TA 4ED4A 4MYTA 1FWLA 3DJWA 2O1WA 4JV5E 1X47A 4FWGA 4OX9E 3AUZA 4WPYA 3C4BA 4DV6E 1IBMI 2V8QB 2B7VA 4R03A 1Z59A 4JI1E 2Z5BB 4USMA 4DR7E 2JOBA 4L8NA 4JI7E 2LJHA 4DKKA 2RTXA 4JYAE 2KOUA 4DV5E 3K1JA 3J81C 2A2CA 2BM0A 2N3HA 4DR5E 4I3HA 3ADLA 4ZVIA 2NPFA 2VF1A 3P1XA 2VE7C 1Z0BA 4DV0I 4DR2I 3K17A 4HXZA 4X64E 2UU9I 4JI6I 4DUYE 4PRXA 4IZJB 2HK2A 1ZBTA 3HXLA 4B3SI 4LF4E 3T1YI 4Q28A 2UUAE 4JI0I 4PRVA 4M30A 2DB2A 2EFGA 2R42A 4DV4E 1SR9A 1VISA 1T4LB 5T6JA 4KQVA 5L3JA 4DU8A 2HKJA 1MX0A 2M7QA 4DMIA 1T4NA 4FWHA 1FJGI 1OJ4A 3J7AM 4DPYA 3QT6A 3B8HA 1H72C 1ZM9A 1NHHA 1PVGA 3M6AA 4HACA 2UUBE 4LF5E 4IZKB 1HNXI 2VQFE 3DF6A 2L3CA 1FI4A 5IT9Q 2GS8A 3LTOA 1WHNA 3ZKDA 1N36E 1DARA 3ADIA 4EMDA 4IZJA 2EZ6A 1FWKA 4M1KA 3IWCA 2JY9A 1FKAE 2V8PA 2UXCI 2LUPB 4XTJA 1H73A 4WUDA 1GQEA 5F3WA 4K0KI 2YT4A 1IBME 4PU9A 3MSWA 1PKPA 4P7DA 5LMUI 3PRYA 4JI8E 1KIJA 4B3TI 4HYMA 3HPSA 4LF9I 2ZM6I 2IHR1 3RMPA 1NHIA 3IWBA 1N33I 2F4VE 4LFAI 1GZ6A 4JI3I 2VQEI 4B3RE 2DEJA 4AQYI 2L92A 4DR6I 3ZZ0A 1STUA 4BC9A 2HHHI 4JI6E 2UU9E 2WW4A 1WUUA 3PYDA 3Q6MA 1Z0VA 2LTRA 4MYUA 4DR3E 1Y4UA 4B3SE 1UEKA 3T1YE 5IT9C 4JI0E 2JR1A 1H7SA 2L8TA 4LF8I 2LTSA 2IOQA 3OTOI 5A2QQ 3K85A 3WU3A 1J26A 2FTXB 4DV3I 4DR1I 3J7AG 2UXDI 1RR9A 5FWKA 1N0VC 3LMLA 1HNWE 1ZBQA 4J8ZA 2JVAA 1FJGE 1Y4SA 1J5EI 1N0UA 4NXMI 1Y6ZA 2H36X 2WZOA 1A6FA 4DR4I 4WUCA 1HNXE 2IOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKH A;  2E1R A;  1S4E A;  1RC7 A;  5IWA E;  4HAC B;  3V2U C;  1X49 A;  4KHP E;  2X7I A;  3H4L A;  5LMN I;  2V34 A;  4LFC I;  2UXC E;  1UHZ A;  4DUZ I;  4JI2 I;  1MG7 A;  3WU4 A;  2KHX A;  1XMO E;  4K0K E;  2MDR A;  4YHH E;  2DMY A;  1HNZ E;  5LMU E;  5A2Q C;  4LF7 I;  1QU6 A;  4B3T E;  4LF9 E;  4YY3 I;  5BR8 E;  1N33 E;  4LFA E;  3V5R A;  4JI3 E;  2VQE E;  1K47 A;  5LL6 R;  4AQY E;  4DR6 E;  1Z0E A;  3LNU A;  1XNR E;  2X36 A;  1RQ0 A;  1XHK A;  4FWD A;  4UTG A;  2HHH E;  1XMQ I;  2UXB I;  2L2N A;  2NUE A;  1NZ0 A;  5FLX Q;  4LFB E;  4JI4 I;  3JAM Q;  1ZM4 A;  1IBL I;  4LF8 E;  4URL A;  4X8W A;  3ZZT A;  3QT8 A;  1YYO A;  3VYX A;  4DV3 E;  4DR1 E;  4P52 A;  2UXD E;  1NHJ A;  2HFU A;  1XNQ I;  4OOG C;  4OX9 I;  2NA2 A;  1H7U A;  3B82 A;  1Z5C A;  5GMD A;  2LRS A;  4DV6 I;  1J5E E;  4NXM E;  3PYF A;  1QZR A;  4FN5 A;  4Z7C A;  4X65 I;  4DR4 E;  1PIE A;  1I94 I;  1D6T A;  1Z0C A;  1KTV A;  4DPX A;  1N32 I;  2Q2E B;  3D4J A;  1IBK I;  4DV7 I;  5LMN E;  4LFC E;  1EKZ A;  4X64 I;  4DR2 E;  4DV0 E;  1N34 I;  1EI1 A;  4X62 I;  4JI2 E;  2L3J A;  5FLX C;  3JAM C;  4LF7 E;  4JI5 I;  2E5L I;  1RRE A;  4YY3 E;  3ZKB A;  3WU5 A;  2NUG A;  1U2R A;  4WYQ B;  3CWV A;  4NXN I;  3T1H I;  1B63 A;  1XMQ E;  2UXB E;  3LPS A;  3GON A;  1Z0T A;  4B3M I;  3QT5 A;  1EA6 A;  4JI4 E;  1N36 I;  1IBL E;  4X66 I;  2CPN A;  3HTX A;  3PYE A;  4WUB A;  1HR0 I;  4HY1 A;  2VF3 A;  3HUL A;  4M2Z A;  4DU7 A;  1S16 A;  1UIL A;  1XNQ E;  3LLH A;  2AJ4 A;  3ADG A;  2A2D A;  3ZZU A;  1WHQ A;  4USK A;  1X48 A;  4DPT A;  3F0N A;  4X65 E;  1DI2 A;  2BV3 A;  2HK3 A;  4JI8 I;  4DV1 I;  2LJP A;  3B78 A;  4DPU A;  4GKJ I;  1ZM2 A;  1ZM3 A;  1I94 E;  2F4V I;  2ZM6 E;  4B3R I;  2RS6 A;  2RS7 A;  1N32 E;  2NUF A;  1YZ9 A;  3WU6 A;  4DXL A;  1IBK E;  2UUC I;  4DV7 E;  1H74 A;  1ZXM A;  2BM1 A;  1N34 E;  2V2Z A;  4X62 E;  2N3G A;  4DR3 I;  1FNM A;  2L2M A;  1BKN A;  4DPW A;  2XEX A;  1YYK A;  2LBS B;  2B7T A;  4DV2 I;  1KVK A;  4LF6 I;  4RPF A;  2DIX A;  4GKK I;  4JI5 E;  3OTO E;  2E5L E;  1ZXN A;  2L2K B;  1Z5A A;  1HNW I;  4JV5 I;  4NXN E;  3T1H E;  3J80 Q;  1T4O A;  3J7Y p;  2LUQ A;  4P7A A;  1ELO A;  3ADJ A;  4B3M E;  2OI2 A;  4R1F A;  4JI1 I;  1Z0W A;  5GME A;  3Q1Q A;  2R3V A;  4DR7 I;  4JI7 I;  5IWA I;  4Z7Y A;  4JYA I;  2L33 A;  4X66 E;  4DV5 I;  4KHP I;  4WFT A;  1HR0 E;  4DR5 I;  3VYY A;  1O0W A;  2B3T B;  2ZIT A;  2HFS A;  4DUY I;  2ZBK B;  1XMO I;  4DUZ E;  4YHH I;  2HKE A;  1Z5B A;  1HNZ I;  3ZM7 A;  4LF4 I;  2UUA I;  5CFF E;  2V2V A;  4DV1 E;  4DV4 I;  4GKJ E;  5BR8 I;  2V2Q A;  2RSM A;  3J81 Q;  1B62 A;  3QT7 A;  1XNR I;  2UUC E;  3J80 C;  3PYG A;  3C4T A;  2DEI A;  2CZ9 A;  4JG4 A;  1YYW A;  4LFB I;  1Z0G A;  2UUB I;  4LF5 I;  2VQF I;  4DV2 E;  4LF6 E;  4FW9 A;  2J7K A;  4GKK E;  1MU5 A;  4UT4 A;  4ED4 A;  4MYT A;  1FWL A;  4JV5 E;  1X47 A;  4FWG A;  4OX9 E;  3C4B A;  4DV6 E;  1IBM I;  2B7V A;  1Z59 A;  4JI1 E;  4USM A;  4DR7 E;  4JI7 E;  2LJH A;  4DKK A;  2RTX A;  4JYA E;  4DV5 E;  3K1J A;  2A2C A;  3J81 C;  2BM0 A;  2N3H A;  4DR5 E;  4I3H A;  3ADL A;  4ZVI A;  2NPF A;  3P1X A;  1Z0B A;  4DV0 I;  4DR2 I;  3K17 A;  4HXZ A;  4X64 E;  2UU9 I;  4JI6 I;  4DUY E;  4PRX A;  2HK2 A;  1ZBT A;  4B3S I;  4LF4 E;  3T1Y I;  2UUA E;  4JI0 I;  4PRV A;  4M30 A;  2DB2 A;  2EFG A;  2R42 A;  4DV4 E;  1VIS A;  1T4L B;  4KQV A;  5L3J A;  4DU8 A;  2HKJ A;  1MX0 A;  1T4N A;  4FWH A;  1FJG I;  1OJ4 A;  3J7A M;  4DPY A;  3QT6 A;  3B8H A;  1H72 C;  1ZM9 A;  1NHH A;  1PVG A;  3M6A A;  4HAC A;  2UUB E;  4LF5 E;  1HNX I;  2VQF E;  1FI4 A;  2L3C A;  5IT9 Q;  2GS8 A;  3LTO A;  1WHN A;  3ZKD A;  1N36 E;  1DAR A;  3ADI A;  4EMD A;  2EZ6 A;  1FWK A;  4M1K A;  1FKA E;  2JY9 A;  2V8P A;  2UXC I;  2LUP B;  4XTJ A;  1H73 A;  4WUD A;  1GQE A;  4K0K I;  2YT4 A;  1IBM E;  4PU9 A;  1PKP A;  5LMU I;  4JI8 E;  1KIJ A;  4B3T I;  4HYM A;  4LF9 I;  2ZM6 I;  2IHR 1;  1NHI A;  1N33 I;  2F4V E;  4LFA I;  4JI3 I;  2VQE I;  4B3R E;  2DEJ A;  4AQY I;  4DR6 I;  3ZZ0 A;  1STU A;  2HHH I;  4JI6 E;  2UU9 E;  2WW4 A;  1WUU A;  3PYD A;  1Z0V A;  2LTR A;  4MYU A;  4DR3 E;  4B3S E;  1UEK A;  3T1Y E;  5IT9 C;  4JI0 E;  1H7S A;  4LF8 I;  2LTS A;  3OTO I;  5A2Q Q;  3WU3 A;  1J26 A;  4DV3 I;  4DR1 I;  3J7A G;  2UXD I;  1RR9 A;  1N0V C;  1HNW E;  2JVA A;  1FJG E;  1J5E I;  1N0U A;  4NXM I;  1A6F A;  4DR4 I;  4WUC A;  1HNX E; 
#chains in the Genus database with same CATH topology
 3C6K A;  1GTK A;  1KKH A;  4BS9 A;  3P3E A;  3IWD A;  2EMX A;  2E1R A;  1S4E A;  1RC7 A;  5IWA E;  1Y60 A;  4HAC B;  3M85 G;  1PDA A;  5KL7 A;  3V2U C;  2I9I A;  1X49 A;  1UN6 B;  5JEA B;  3DD6 A;  4KHP E;  2X7I A;  4MU3 A;  2YU5 A;  4WSP A;  1OYP A;  4ZYH A;  4NZV A;  2LMZ A;  3H4L A;  3U1K A;  5LMN I;  2Z5C A;  2V34 A;  4LFC I;  2GO3 A;  2UXC E;  5AC4 A;  1UHZ A;  4DUZ I;  4JI2 I;  5K36 E;  4BMJ A;  5AE2 A;  1T38 A;  1MG7 A;  3WU4 A;  3M7N D;  2KHX A;  3MHH C;  2YTJ A;  3MHS C;  1XMO E;  4K0K E;  2MDR A;  4YHH E;  2DMY A;  2L6M A;  4IFD A;  4OO1 C;  1HNZ E;  4LU9 A;  4KZS A;  4LCH A;  2JPA A;  5LMU E;  1N3G A;  2JOX A;  2WNR A;  5C0X C;  5A2Q C;  4LF7 I;  1QU6 A;  4B3T E;  2EJ4 A;  5A6A A;  2EL6 A;  5TSE A;  4LF9 E;  3Q6N A;  4MU4 A;  4QNJ A;  4YY3 I;  4BA2 A;  5BR8 E;  4ZYG A;  1N33 E;  4LFA E;  3KZY A;  3V5R A;  4JI3 E;  2VQE E;  4GEQ B;  5LL6 R;  1K47 A;  4AQY E;  4DR6 E;  1Z0E A;  3LNU A;  2MKN A;  3EPL A;  1XNR E;  1SFE A;  4R2P A;  2X36 A;  3PS3 A;  1RQ0 A;  1XHK A;  4FWD A;  4UTG A;  2HHH E;  1XMQ I;  2UXB I;  5A6J A;  2VRD A;  2V87 A;  2L2N A;  2JEB B;  1X6F A;  2EN6 A;  3P3C A;  2NUE A;  2PNZ B;  1A1K A;  1NZ0 A;  5C0X D;  5FLX Q;  3KWR A;  4LFB E;  4JI4 I;  2LT7 A;  3JAM Q;  3JTZ A;  3H09 A;  1ZM4 A;  1IBL I;  4LF8 E;  1UDN A;  4BCA A;  4URL A;  4X8W A;  3ZZT A;  2YSO A;  2LE2 A;  3KZZ A;  3QT8 A;  2NN6 F;  1YYO A;  2YSP A;  2EM6 A;  1EH7 A;  4DV3 E;  4F54 A;  4DR1 E;  3VYX A;  1IQO A;  2CT1 A;  2UXD E;  4P52 A;  1NHJ A;  2RQL A;  2HFU A;  4LF8 I;  1XNQ I;  4OOG C;  4OX9 I;  2NA2 A;  2EL5 A;  2CVE A;  2EMF A;  1H7U A;  1YUI A;  3GME A;  4ZYD A;  1Z5C A;  3B82 A;  2A25 A;  2F8B A;  2LRS A;  5GMD A;  4DV6 I;  5AE3 A;  1J5E E;  4NXM E;  2LCE A;  2MKD A;  3VHT B;  1USV A;  2EOQ A;  2EPC A;  2CGE A;  2PO2 B;  2C39 B;  1QZR A;  2WP8 B;  4FN5 A;  3VK6 A;  2R76 A;  3UHM A;  4Z7C A;  4X65 I;  2E72 A;  5JEA E;  4DR4 E;  2YU8 A;  2DSY A;  1PIE A;  2YRM A;  1HK7 A;  3F6H A;  1Z1B A;  1I94 I;  2E1M A;  2EPP A;  3GLL A;  1D6T A;  2DLK A;  1Z0C A;  2RPC A;  2K7I A;  2EOS A;  2EOI A;  1KTV A;  4IZJ D;  4DPX A;  2Q2E B;  2FGG A;  1N32 I;  3D4J A;  1IBK I;  1MGT A;  2NAB A;  4DV7 I;  5LMN E;  2EQ3 A;  4FK5 C;  4LFC E;  2EPK X;  1EKZ A;  4X64 I;  2YRH A;  4DV0 E;  4DR2 E;  1EI1 A;  1N34 I;  4X62 I;  3HPZ A;  4LCF A;  4JI2 E;  4O43 A;  4WXC A;  1E3H A;  2Z5C B;  2L3J A;  1A1G A;  2BA1 G;  5FLX C;  4OO1 F;  2ADR A;  4MU0 A;  5KL5 A;  2JE6 B;  3JAM C;  4IFD B;  4BHC A;  4LF7 E;  2EN3 A;  5AE1 A;  1WXR A;  3U1Y A;  4JI5 I;  1NEI A;  2EQ1 A;  4M9V C;  2E5L I;  2G7H A;  4LTY A;  1RRE A;  1F2I G;  4YY3 E;  3ZKB A;  2ODR C;  3WU5 A;  4FW6 A;  2NUG A;  1U2R A;  5EKW A;  4WYQ B;  2ELZ A;  2IES A;  1Y5Y A;  3CWV A;  4P78 A;  4NXN I;  3T1H I;  2PO2 A;  2V86 A;  3GCM A;  2EMH A;  5IXM B;  2LVH A;  2YTQ A;  1XMQ E;  2UXB E;  1B63 A;  3LPS A;  1EH6 A;  3GON A;  1Z0T A;  4LOM A;  1X3C A;  5K36 C;  3NZK A;  1WRJ A;  3QT5 A;  4B3M I;  2EMK A;  1EA6 A;  2V85 A;  1DQ3 A;  1TF6 A;  2EL4 A;  2EMY A;  4JI4 E;  2EWL A;  2DGC A;  3F6G A;  5DRP A;  1N36 I;  2ODR D;  1IBL E;  4X66 I;  2CPN A;  3HTX A;  3PYE A;  4Q35 B;  2CTD A;  2EE8 A;  1PJT A;  2VF3 A;  4F9B B;  4O5G A;  3HUL A;  4HY1 A;  4WUB A;  4M2Z A;  4DU7 A;  4U3D A;  1S16 A;  5DRQ A;  3BID A;  1UIL A;  1YPN A;  1XNQ E;  1G2D C;  2ELY A;  1AH5 A;  3LLH A;  5K36 D;  4R2Q A;  1XXE A;  4BBY A;  2YRK A;  2AJ4 A;  3ADG A;  2A2D A;  2JE6 A;  1WHQ A;  3ZZU A;  4USK A;  1X48 A;  2KON A;  4DPT A;  2CG9 A;  2YTP A;  3EPJ A;  4NBQ A;  1BB8 A;  1IMU A;  2R1F A;  1YUJ A;  2PNM A;  4X65 E;  3F0N A;  4M0V A;  4U3B A;  1DI2 A;  2BV3 A;  2HK3 A;  4JI8 I;  2WBT A;  5ADZ A;  4DV1 I;  2LJP A;  2YTD A;  3CDJ A;  3B78 A;  1USU A;  4DPU A;  4GKJ I;  1ZM2 A;  2GLI A;  1ZM3 A;  1I94 E;  3L00 A;  3P06 A;  2F4V I;  1BBG A;  2LJU A;  2ZM6 E;  1DGC A;  4B3R I;  2EPR A;  4QNK A;  2RS6 A;  2RS7 A;  5DNY A;  1N32 E;  2NUF A;  2LO3 A;  2LV2 A;  1YZ9 A;  1IBK E;  3WU6 A;  4DXL A;  2UUC I;  1A1F A;  1WJP A;  3AV0 A;  4DV7 E;  2EMB A;  2EM8 A;  4N4R B;  1H74 A;  1ZXM A;  5KL2 A;  1MEY C;  2BM1 A;  1N34 E;  2EOF A;  4X62 E;  2V2Z A;  4OO1 A;  2N3G A;  2DRP A;  4DR3 I;  2O1V A;  4L5N C;  1YHC A;  3THO B;  4IFD E;  1FNM A;  2L2M A;  1BKN A;  4DPW A;  2PO0 B;  2XEX A;  1YYK A;  2LBS B;  2B7T A;  4DV2 I;  2EMC A;  1KVK A;  5JEA C;  4LF6 I;  4RPF A;  4KWY A;  2DIX A;  3HQ1 A;  4F9A B;  4JI5 E;  3OTO E;  1UDS A;  4GKK I;  1KJK A;  2E5L E;  5KL4 A;  2V88 A;  1YFH A;  1ZXN A;  2BA0 G;  2Z5E A;  2EM7 A;  1TN9 A;  4R8O A;  2L2K B;  1Z5A A;  4BA1 A;  2MC5 A;  4N3O A;  1HNW I;  1NCS A;  4JV5 I;  4ZYE A;  4NXN E;  5A69 A;  3FIG A;  3EPH A;  3T1H E;  3J80 Q;  4R2D A;  1T4O A;  4OO1 E;  5A6B D;  2Z5B A;  3J7Y p;  2PNL A;  2LUQ A;  4P7A A;  1ELO A;  3UK3 C;  4O24 A;  3ADJ A;  5JEA D;  5K36 F;  2IER A;  4B3M E;  3EPK A;  2OI2 A;  4R1F A;  4JI1 I;  2C38 A;  4F2J C;  1Z0W A;  5GME A;  3Q1Q A;  2R3V A;  4DR7 I;  4JI7 I;  5IWA I;  2VES A;  2O3Z A;  2EN1 A;  1A1L A;  4Z7Y A;  4JYA I;  2ENC A;  2L33 A;  4X66 E;  4DV5 I;  4KHP I;  4LCG A;  4WFT A;  2EMZ A;  2YTI A;  2WBS A;  1HR0 E;  2M4I A;  2JT2 A;  4O4K A;  3ZOQ B;  4DR5 I;  5AC5 A;  2NN6 B;  3VYY A;  2NN6 D;  5DRO A;  1O0W A;  4R2A A;  1PJQ A;  3PYF A;  2B9D A;  2B3T B;  2M1S A;  4X9J A;  2ZIT A;  1P42 A;  1BBO A;  3M7N G;  2HFS A;  4TUI A;  1UDQ A;  4DUY I;  2JWO A;  2PO0 A;  2ZBK B;  2EMA A;  4DUZ E;  1P47 A;  4YHH I;  2HKE A;  1XMO I;  2YTN A;  4I8O A;  1Z5B A;  1HNZ I;  2EMG A;  3ZM7 A;  4LF4 I;  1HNX E;  2UUA I;  2JEA B;  4AM3 A;  2V89 A;  4R2S A;  5CFF E;  2V2V A;  3HJC A;  4DV1 E;  4TUG A;  4DV4 I;  2EPA A;  2YTO A;  2WCC 3;  4F9C B;  4GKJ E;  5C0X F;  2V83 A;  5BR8 I;  3EQ1 A;  2GHF A;  2EOM A;  1ZR9 A;  2V2Q A;  2BB8 A;  2RSM A;  3K6Q A;  2BBG A;  3J81 Q;  4FW4 A;  2D9H A;  1B62 A;  3QT7 A;  3HKM A;  2EN7 A;  2UUC E;  3J80 C;  2EMW A;  4WXD A;  4AID A;  3JU0 A;  1XNR I;  2PO1 B;  3B4T A;  3PYG A;  3C4T A;  4IZK A;  3OML A;  2DEI A;  2JXP A;  2CZ9 A;  2FV4 B;  2MC6 A;  1IQS A;  4JG4 A;  2YZT A;  5AAS A;  4MU1 A;  2K4V A;  1YYW A;  1HR0 I;  4LFB I;  5EL9 A;  4IS1 C;  1Z0G A;  2UUB I;  4LF5 I;  4OO1 B;  4WX9 A;  2VQF I;  2Q8U A;  4DV2 E;  5JEA F;  4LF6 E;  2GQ0 A;  4FW9 A;  2O1U A;  2J7K A;  2NN6 A;  1KYQ A;  4GKK E;  5C0X B;  1MU5 A;  4UT4 A;  4BC7 A;  2O1T A;  1QNT A;  2HC5 A;  4ED4 A;  1PJS A;  4MYT A;  1FWL A;  3DJW A;  2O1W A;  4JV5 E;  1X47 A;  4FWG A;  4OX9 E;  5DNX A;  3AUZ A;  4BA1 B;  4WPY A;  4MQY A;  2JEA A;  5K36 A;  3C4B A;  4DV6 E;  3TQM A;  1IBM I;  2EOY A;  2V8Q B;  2B7V A;  4R03 A;  1Z59 A;  4JI1 E;  2Z5B B;  4IFD C;  4USM A;  2C37 A;  4R2E A;  4DR7 E;  1RMD A;  4L8N A;  2JOB A;  3P76 A;  4JI7 E;  2LJH A;  4DKK A;  4WSG A;  2NN6 E;  1ZU1 A;  3BBG A;  4F6N A;  2RTX A;  4JYA E;  2KOU A;  2C38 B;  4DV5 E;  2EN2 A;  4BHB A;  3K1J A;  3J81 C;  2A2C A;  2BM0 A;  2PO1 A;  2N3H A;  4DR5 E;  4I3H A;  2EP3 A;  3P3G A;  3ADL A;  4FW3 A;  4ZVI A;  2NPF A;  2VF1 A;  3P1X A;  5IV8 B;  2AE8 A;  4NHR A;  2JP9 A;  2VE7 C;  1Z0B A;  4DV0 I;  4DR2 I;  3K17 A;  2PRT A;  4HXZ A;  4X64 E;  2UU9 I;  4JI6 I;  4DUY E;  4IFD D;  2N8X A;  4PRX A;  4IZJ B;  5KL3 A;  2HK2 A;  4RHB B;  1ZBT A;  2EOO A;  3HXL A;  4B3S I;  4J3D A;  1X6H A;  4LF4 E;  4Q28 A;  3T1Y I;  4GZN C;  2UUA E;  4JI0 I;  2DLQ A;  4PRV A;  2BA1 D;  4M30 A;  2DB2 A;  2EFG A;  2R42 A;  5C0X A;  2EM2 A;  3L7Z B;  1YH8 A;  4DV4 E;  2EOE A;  1SR9 A;  1VIS A;  1T4L B;  5T6J A;  3CDI A;  1EH8 A;  4KQV A;  5DRR A;  5L3J A;  4DU8 A;  2HKJ A;  2YTF A;  1MX0 A;  4OZE A;  2EM5 A;  2M7Q A;  4DMI A;  1T4N A;  2HJJ A;  4OO1 D;  4FWH A;  2F1D A;  3ECR A;  4AIM A;  1FJG I;  1JK1 A;  2YTG A;  4IJD A;  2J7J A;  1OJ4 A;  1AAY A;  3J7A M;  2GO4 A;  2EN8 A;  2EPZ A;  5A6B A;  1A1J A;  3B8H A;  3QT6 A;  4DPY A;  1H72 C;  1ZM9 A;  1NHH A;  1PVG A;  3M6A A;  2BR2 B;  4HAC A;  2UUB E;  4LF5 E;  4IZK B;  5JEA A;  5C0X E;  1HNX I;  2VQF E;  2EM4 A;  4F6M A;  3DF6 A;  2L3C A;  1G2F C;  1FI4 A;  5IT9 Q;  1T39 A;  2GS8 A;  3LTO A;  1WHN A;  3ZKD A;  1N36 E;  1X6E A;  1DAR A;  1L4S A;  2ENA A;  3ADI A;  3M85 D;  4OKG A;  4EMD A;  1LLM C;  2EPM X;  1ZAA C;  1E3P A;  5LLQ A;  2EOH A;  4IZJ A;  2EZ6 A;  1FWK A;  4M1K A;  3IWC A;  2JY9 A;  1FKA E;  1UDO A;  2V8P A;  2UXC I;  2LUP B;  2RSI A;  4IS9 A;  4XTJ A;  1UBD C;  1H73 A;  3C6M A;  4WUD A;  1GQE A;  4RH8 A;  5DNL A;  5F3W A;  4FW5 A;  2EPN A;  2YT4 A;  4K0K I;  3L7Z A;  2EOX A;  1IBM E;  4PU9 A;  3MSW A;  1PKP A;  5K36 B;  3M99 B;  4P7D A;  4IFD F;  5LMU I;  1VI7 A;  3PS2 A;  3PRY A;  4JI8 E;  1R6M A;  4MLQ A;  2YWQ A;  1KIJ A;  4HYM A;  4B3T I;  3HPS A;  5ELW A;  2C37 B;  4LF9 I;  2M9A A;  1RHY A;  2ZM6 I;  2IHR 1;  3THN A;  3RMP A;  1NHI A;  2DMI A;  2ENH A;  3IWB A;  2EM9 A;  1YSA C;  2F4V E;  4LFA I;  1N33 I;  1GZ6 A;  2EN4 A;  4LPF A;  4JI3 I;  2VQE I;  4B3R E;  2DEJ A;  2MDG A;  4AQY I;  2L92 A;  4DR6 I;  3ZZ0 A;  4MLV A;  1STU A;  2EOR A;  2GPI A;  2EPU A;  2WBU A;  2JEB A;  2EPL X;  2PNZ A;  4BC9 A;  5A6K A;  2HHH I;  4R2R A;  2UU9 E;  4JI6 E;  2EPX A;  1WUU A;  2BR2 A;  2WW4 A;  3PYD A;  2YPN A;  3Q6M A;  1Z0V A;  2LTR A;  1X5W A;  4ISA A;  4MYU A;  4DR3 E;  1Y4U A;  3QG5 C;  4B3S E;  4FW7 A;  1UEK A;  3T1Y E;  4HEI A;  5IT9 C;  1JK2 A;  4JI0 E;  1R6L A;  4GQU A;  2JR1 A;  1H7S A;  2L8T A;  1OYS A;  2EM3 A;  2EM0 A;  2CSH A;  3BF2 A;  1A1H A;  2I13 A;  2LTS A;  4R2C A;  1B69 A;  2IOQ A;  2J65 A;  3KRN A;  5A2Q Q;  3OTO I;  2HGH A;  3K85 A;  3WU3 A;  2NN6 C;  2WNR B;  1J26 A;  2FTX B;  4DV3 I;  2EMI A;  4DR1 I;  3J7A G;  2EOZ A;  2UXD I;  3BGH A;  1RR9 A;  5KL6 A;  5FWK A;  1N0V C;  4MDT A;  3LML A;  1HNW E;  1OYR A;  2BA0 D;  4BA2 B;  2WP8 A;  1ZBQ A;  4J8Z A;  2C39 A;  2JVA A;  2YTE A;  3PS1 A;  1A1I A;  1FJG E;  1Y4S A;  1N0U A;  1J5E I;  2EOJ A;  4NXM I;  1Y6Z A;  1TF3 A;  3H1C A;  2H36 X;  2EQ0 A;  2WZO A;  2EPO A;  4HTG A;  1A6F A;  4DR4 I;  4WUC A;  2EML A;  2JYA A;  2IOP A; 
#chains in the Genus database with same CATH homology
 1KKH A;  4BS9 A;  3IWD A;  2E1R A;  1S4E A;  1RC7 A;  5IWA E;  4HAC B;  3V2U C;  1X49 A;  4KHP E;  2X7I A;  4WSP A;  3H4L A;  2LMZ A;  5LMN I;  2Z5C A;  2V34 A;  4LFC I;  2UXC E;  1UHZ A;  4DUZ I;  4JI2 I;  4BMJ A;  5AE2 A;  1MG7 A;  3WU4 A;  2KHX A;  1XMO E;  4K0K E;  2MDR A;  4YHH E;  2DMY A;  2L6M A;  1HNZ E;  4LU9 A;  4KZS A;  5LMU E;  2JOX A;  5A2Q C;  4LF7 I;  1QU6 A;  4B3T E;  4LF9 E;  3Q6N A;  4YY3 I;  5BR8 E;  1N33 E;  4LFA E;  3V5R A;  4JI3 E;  2VQE E;  4GEQ B;  5LL6 R;  1K47 A;  4AQY E;  4DR6 E;  1Z0E A;  3LNU A;  1XNR E;  2X36 A;  1RQ0 A;  1XHK A;  4FWD A;  4UTG A;  2HHH E;  1XMQ I;  2UXB I;  2V87 A;  2L2N A;  2NUE A;  1NZ0 A;  5FLX Q;  3KWR A;  4LFB E;  4JI4 I;  3JAM Q;  3JTZ A;  3H09 A;  1ZM4 A;  1IBL I;  4LF8 E;  4BCA A;  4URL A;  4X8W A;  3ZZT A;  2LE2 A;  3QT8 A;  1YYO A;  3VYX A;  4DV3 E;  4F54 A;  4DR1 E;  4P52 A;  2UXD E;  1NHJ A;  2HFU A;  1XNQ I;  4OOG C;  4OX9 I;  2NA2 A;  1H7U A;  3B82 A;  1Z5C A;  5GMD A;  2F8B A;  2LRS A;  4DV6 I;  5AE3 A;  1J5E E;  4NXM E;  1USV A;  3PYF A;  2CGE A;  1QZR A;  4FN5 A;  4Z7C A;  3VK6 A;  4X65 I;  4DR4 E;  2DSY A;  1PIE A;  1HK7 A;  3F6H A;  1I94 I;  2E1M A;  1D6T A;  1Z0C A;  1KTV A;  4DPX A;  4IZJ D;  1N32 I;  2Q2E B;  2FGG A;  3D4J A;  1IBK I;  4DV7 I;  5LMN E;  4LFC E;  1EKZ A;  4X64 I;  4DR2 E;  4DV0 E;  1N34 I;  1EI1 A;  4X62 I;  3HPZ A;  4JI2 E;  2Z5C B;  2L3J A;  5FLX C;  3JAM C;  4LF7 E;  5AE1 A;  1WXR A;  4JI5 I;  2E5L I;  2G7H A;  4LTY A;  1RRE A;  4YY3 E;  3ZKB A;  2ODR C;  3WU5 A;  2NUG A;  1U2R A;  4WYQ B;  3CWV A;  4NXN I;  4P78 A;  3T1H I;  2V86 A;  1B63 A;  1XMQ E;  2UXB E;  3LPS A;  3GON A;  1Z0T A;  4B3M I;  3QT5 A;  1EA6 A;  2V85 A;  1DQ3 A;  4JI4 E;  2EWL A;  3F6G A;  1N36 I;  2ODR D;  1IBL E;  4X66 I;  2CPN A;  3HTX A;  3PYE A;  4WUB A;  1HR0 I;  4HY1 A;  2VF3 A;  4F9B B;  3HUL A;  4M2Z A;  4DU7 A;  1S16 A;  1UIL A;  1XNQ E;  3LLH A;  4BBY A;  2AJ4 A;  3ADG A;  2A2D A;  3ZZU A;  1WHQ A;  4USK A;  1X48 A;  2KON A;  4DPT A;  2CG9 A;  3F0N A;  2PNM A;  4X65 E;  4M0V A;  1DI2 A;  2BV3 A;  2HK3 A;  4JI8 I;  5ADZ A;  4DV1 I;  2LJP A;  3B78 A;  1USU A;  4DPU A;  4GKJ I;  1ZM2 A;  1ZM3 A;  1I94 E;  3P06 A;  2F4V I;  2ZM6 E;  4B3R I;  2RS6 A;  2RS7 A;  5DNY A;  1N32 E;  2NUF A;  1YZ9 A;  3WU6 A;  4DXL A;  1IBK E;  2UUC I;  3AV0 A;  4DV7 E;  1H74 A;  1ZXM A;  2BM1 A;  1N34 E;  2V2Z A;  4X62 E;  2N3G A;  4DR3 I;  2O1V A;  4L5N C;  1FNM A;  2L2M A;  1BKN A;  4DPW A;  2XEX A;  1YYK A;  2LBS B;  2B7T A;  4DV2 I;  1KVK A;  4LF6 I;  4RPF A;  2DIX A;  3HQ1 A;  4F9A B;  4JI5 E;  3OTO E;  4GKK I;  2E5L E;  2V88 A;  1ZXN A;  2Z5E A;  4R8O A;  2L2K B;  1Z5A A;  1HNW I;  2MC5 A;  4N3O A;  4JV5 I;  4NXN E;  3FIG A;  3T1H E;  3J80 Q;  1T4O A;  2Z5B A;  3J7Y p;  2PNL A;  2LUQ A;  4P7A A;  1ELO A;  3ADJ A;  4B3M E;  2OI2 A;  4R1F A;  4JI1 I;  1Z0W A;  5GME A;  3Q1Q A;  2R3V A;  4DR7 I;  4JI7 I;  5IWA I;  4Z7Y A;  4JYA I;  2L33 A;  4X66 E;  4DV5 I;  4KHP I;  4WFT A;  1HR0 E;  2M4I A;  3ZOQ B;  4DR5 I;  3VYY A;  1O0W A;  2B9D A;  2B3T B;  2M1S A;  2ZIT A;  2HFS A;  4TUI A;  4DUY I;  2JWO A;  2ZBK B;  1XMO I;  4DUZ E;  4YHH I;  2HKE A;  4I8O A;  1Z5B A;  1HNZ I;  3ZM7 A;  4LF4 I;  2UUA I;  2V89 A;  5CFF E;  2V2V A;  3HJC A;  4DV1 E;  4TUG A;  4DV4 I;  4F9C B;  4GKJ E;  2V83 A;  5BR8 I;  2V2Q A;  2RSM A;  3K6Q A;  3J81 Q;  1B62 A;  3QT7 A;  1XNR I;  2UUC E;  3J80 C;  3JU0 A;  3PYG A;  3C4T A;  4IZK A;  3OML A;  2DEI A;  2CZ9 A;  2FV4 B;  2MC6 A;  4JG4 A;  2YZT A;  5AAS A;  2K4V A;  1YYW A;  4LFB I;  1Z0G A;  2UUB I;  4LF5 I;  2VQF I;  4DV2 E;  4LF6 E;  2GQ0 A;  4FW9 A;  2O1U A;  2J7K A;  4GKK E;  1MU5 A;  4UT4 A;  4BC7 A;  2O1T A;  4ED4 A;  4MYT A;  1FWL A;  3DJW A;  2O1W A;  4JV5 E;  1X47 A;  4FWG A;  4OX9 E;  3AUZ A;  4WPY A;  3C4B A;  4DV6 E;  1IBM I;  2V8Q B;  2B7V A;  4R03 A;  1Z59 A;  4JI1 E;  2Z5B B;  4USM A;  4DR7 E;  2JOB A;  4L8N A;  4JI7 E;  2LJH A;  4DKK A;  2RTX A;  4JYA E;  2KOU A;  4DV5 E;  3K1J A;  3J81 C;  2A2C A;  2BM0 A;  2N3H A;  4DR5 E;  4I3H A;  3ADL A;  4ZVI A;  2NPF A;  2VF1 A;  3P1X A;  2VE7 C;  1Z0B A;  4DV0 I;  4DR2 I;  3K17 A;  4HXZ A;  4X64 E;  2UU9 I;  4JI6 I;  4DUY E;  4PRX A;  4IZJ B;  2HK2 A;  1ZBT A;  3HXL A;  4B3S I;  4LF4 E;  3T1Y I;  4Q28 A;  2UUA E;  4JI0 I;  4PRV A;  4M30 A;  2DB2 A;  2EFG A;  2R42 A;  4DV4 E;  1SR9 A;  1VIS A;  1T4L B;  5T6J A;  4KQV A;  5L3J A;  4DU8 A;  2HKJ A;  1MX0 A;  2M7Q A;  4DMI A;  1T4N A;  4FWH A;  1FJG I;  1OJ4 A;  3J7A M;  4DPY A;  3QT6 A;  3B8H A;  1H72 C;  1ZM9 A;  1NHH A;  1PVG A;  3M6A A;  4HAC A;  2UUB E;  4LF5 E;  4IZK B;  1HNX I;  2VQF E;  3DF6 A;  2L3C A;  1FI4 A;  5IT9 Q;  2GS8 A;  3LTO A;  1WHN A;  3ZKD A;  1N36 E;  1DAR A;  3ADI A;  4EMD A;  4IZJ A;  2EZ6 A;  1FWK A;  4M1K A;  3IWC A;  2JY9 A;  1FKA E;  2V8P A;  2UXC I;  2LUP B;  4XTJ A;  1H73 A;  4WUD A;  1GQE A;  5F3W A;  4K0K I;  2YT4 A;  1IBM E;  4PU9 A;  3MSW A;  1PKP A;  4P7D A;  5LMU I;  3PRY A;  4JI8 E;  1KIJ A;  4B3T I;  4HYM A;  3HPS A;  4LF9 I;  2ZM6 I;  2IHR 1;  3RMP A;  1NHI A;  3IWB A;  1N33 I;  2F4V E;  4LFA I;  1GZ6 A;  4JI3 I;  2VQE I;  4B3R E;  2DEJ A;  4AQY I;  2L92 A;  4DR6 I;  3ZZ0 A;  1STU A;  4BC9 A;  2HHH I;  4JI6 E;  2UU9 E;  2WW4 A;  1WUU A;  3PYD A;  3Q6M A;  1Z0V A;  2LTR A;  4MYU A;  4DR3 E;  1Y4U A;  4B3S E;  1UEK A;  3T1Y E;  5IT9 C;  4JI0 E;  2JR1 A;  1H7S A;  2L8T A;  4LF8 I;  2LTS A;  2IOQ A;  3OTO I;  5A2Q Q;  3K85 A;  3WU3 A;  1J26 A;  2FTX B;  4DV3 I;  4DR1 I;  3J7A G;  2UXD I;  1RR9 A;  5FWK A;  1N0V C;  3LML A;  1HNW E;  1ZBQ A;  4J8Z A;  2JVA A;  1FJG E;  1Y4S A;  1J5E I;  1N0U A;  4NXM I;  1Y6Z A;  2H36 X;  2WZO A;  1A6F A;  4DR4 I;  4WUC A;  1HNX E;  2IOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...