1HNWE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnwE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwE02
1ZXNA 1YYKA 5FLXQ 2JY9A 3J80C 3J81Q 5BR8I 4B3RI 1Z0CA 3CWVA 4HYMA 4LF7I 4DPXA 1DARA 3HULA 2HKJA 1KIJA 3ZZTA 2HHHI 2GS8A 1FJGE 4OX9I 4UT4A 5A2QC 2L2NA 4ED4A 4DU8A 2B7VA 4NXNI 2LRSA 4LFCI 4JG4A 2UU9E 4LF4I 4DV2E 4DV1E 1XMOI 1OJ4A 2DEIA 4JI6I 1U2RA 1QZRA 2UUAE 2L33A 4JI5E 1DI2A 1PVGA 2NUEA 3PYEA 4X64I 2E1RA 1FI4A 4DR5I 4DR3E 2R3VA 2DB2A 2HFUA 4LF5I 2XEXA 3LTOA 4JI7I 4LF8E 4WUDA 4DUZE 1EA6A 2HFSA 1Z0EA 4JI0I 5CFFE 4I3HA 4DR6E 3VYXA 1FWKA 2DIXA 2LJPA 4WFTA 2E5LI 2YT4A 2DEJA 1MU5A 1T4OA 2BV3A 1J5EE 4YY3I 4YHHE 2V8PA 1T4NA 4DV0I 4DV3E 1BKNA 1RC7A 3ZM7A 4Z7CA 1KTVA 1NHHA 3ADIA 1B62A 2NPFA 3M6AA 5LMUI 4NXME 1K47A 1Z0GA 1XNQE 2L3JA 4HACB 4DPUA 2ZITA 3ZZ0A 2RS6A 1N34I 3C4TA 1T4LB 5IT9Q 4JI8E 2LJHA 4K0KE 2UUCE 4DPTA 2RS7A 1WHQA 1ZXMA 1N33I 2HK3A 4JI1E 3T1HE 1A6FA 1FWLA 1X47A 2A2CA 1UEKA 5GMDA 4DV5E 1H73A 1N36E 4M2ZA 2L2MA 1FJGI 3V2UC 1I94E 4FWHA 2RTXA 3ADLA 2CPNA 4AQYE 4X8WA 4GKKE 2UU9I 3JAMQ 4FWGA 4DV2I 1D6TA 4ZVIA 4DV1I 2N3GA 1Z59A 2NA2A 1XNRE 2UUAI 1KKHA 4P52A 1GQEA 1YZ9A 4WUCA 4JI5I 3V5RA 4DUYE 3J7AG 3B78A 1ZM3A 4DR3I 5LL6R 2UXDE 1X49A 4LF9E 1Z5BA 1NZ0A 4LF8I 2NUGA 1HNWE 1XMQE 4B3SE 4XTJA 4DUZI 1UHZA 5FLXC 4DR6I 1Z0BA 3J81C 1O0WA 3WU4A 1H7SA 1J5EI 4YHHI 1ZM4A 2LUPB 1N0VC 4DV3I 4X62E 2X36A 1S16A 3WU5A 4PU9A 4B3ME 4NXMI 3ZKDA 1XNQI 2ZBKB 1KVKA 2DMYA 2VF3A 2X7IA 1EI1A 1PIEA 4DR2E 1HNZE 2VQEE 4OOGC 4JI8I 2J7KA 4K0KI 2UUCI 5LMNE 4DR4E 1Z5AA 1ZM2A 1RQ0A 2BM0A 1H7UA 4JI1I 3T1HI 4DU7A 2B7TA 4DR7E 1QU6A 3VYYA 4B3TE 4Z7YA 4LFCE 4X66E 4KHPE 4FN5A 4DV5I 1B63A 1N36I 1N32E 2V2ZA 4JI3E 4RPFA 4EMDA 1I94I 2CZ9A 1YYOA 3B82A 3WU3A 2HKEA 4AQYI 1HR0E 1FNMA 4GKKI 1WHNA 2EZ6A 1NHJA 1HNXE 4PRXA 4GKJE 1XNRI 4FW9A 1X48A 4X65E 3PYFA 2UUBE 3PYGA 4DUYI 2UXCE 2KHXA 3QT7A 1IBKE 4USMA 2UXDI 4LF9I 5IT9C 2ZM6E 4DV6E 1J26A 1XMQI 1HNWI 4DR1E 4B3SI 1ELOA 3OTOE 1MG7A 1Z0WA 2LTRA 1VISA 2VQFE 2WW4A 2B3TB 4LFBE 1H74A 4JI4E 3J80Q 1IBME 4WUBA 3J7AM 4LFAE 2NUFA 4PRVA 1WUUA 3P1XA 4HY1A 4X62I 4WYQB 2F4VE 2R42A 5A2QQ 3QT6A 1EKZA 1FKAE 4B3MI 4LF6E 4HACA 4DKKA 3K17A 3JAMC 1PKPA 3HTXA 4JI2E 4DPWA 3WU6A 4DR2I 1HNZI 2VQEI 1IBLE 4DV7E 5IWAE 3T1YE 5L3JA 4DV4E 5LMNI 4DR4I 3ADGA 2BM1A 3LNUA 3B8HA 4JYAE 3LLHA 4URLA 2UXBE 1RR9A 2L2KB 2LBSB 1Z0TA 4DR7I 2L3CA 1N0UA 3QT5A 4B3TI 4X66I 4KHPI 3ZKBA 3K1JA 4JV5E 1N32I 3ADJA 4JI3I 3ZZUA 5BR8E 4B3RE 1H72C 2V2VA 1HR0I 4LF7E 4UTGA 2HHHE 4OX9E 2RSMA 4DXLA 1HNXI 4GKJI 2Q2EB 1Z0VA 4NXNE 5GMEA 4X65I 4MYUA 1RREA 2V2QA 2UUBI 3GONA 4LF4E 2UXCI 3J7Yp 1XMOE 2JVAA 1IBKI 4JI6E 4P7AA 4M30A 2EFGA 2ZM6I 4DV6I 4MYTA 2OI2A 2N3HA 4DR1I 4X64E 3OTOI 4FWDA 4HXZA 4DR5E 3QT8A 1MX0A 1S4EA 2VQFI 4R1FA 4LFBI 4JI4I 4LF5E 4JI7E 3D4JA 1YYWA 1IBMI 3H4LA 1ZM9A 4LFAI 1STUA 4JI0E 3Q1QA 2E5LE 2F4VI 4LF6I 3LPSA 4YY3E 2IHR1 4M1KA 3C4BA 2LUQA 4DV0E 4JI2I 1XHKA 1IBLI 1ZBTA 4DV7I 5IWAI 3F0NA 3T1YI 5LMUE 4KQVA 4DV4I 1UILA 2LTSA 2HK2A 4DPYA 4JYAI 1N34E 2UXBI 2MDRA 2V34A 2AJ4A 4USKA 1Z5CA 4JV5I 2A2DA 3PYDA 1N33E 1NHIA
chains in the Genus database with same CATH superfamily
1MGTA 3DJWA 1ZXNA 5JEAA 2WCC3 3UK3C 4F6MA 1YYKA 5FLXQ 2JY9A 5DNLA 3J80C 1Y4SA 1USUA 4BC7A 3J81Q 2G7HA 1OYPA 1G2DC 5BR8I 1E3PA 4B3RI 2EOMA 1Z0CA 3CWVA 4HYMA 4LF7I 3IWDA 4DPXA 2EM0A 5DNYA 1R6LA 1DARA 3PS1A 3P06A 2JOBA 3HULA 1GZ6A 1KIJA 2HKJA 3ZZTA 2GS8A 1FJGE 2HHHI 1DQ3A 4OX9I 4BA2A 2L92A 4UT4A 2ODRC 5C0XB 2VRDA 5A2QC 2L2NA 3IWBA 2YTDA 4QNJA 4ED4A 1EH6A 4DU8A 2B7VA 3VHTB 4NXNI 2LRSA 4KWYA 1QNTA 1YPNA 4LFCI 1YSAC 4JG4A 4ZYDA 1YUJA 2UU9E 4IFDF 4WXDA 4LF4I 4DV2E 4DV1E 1XMOI 5K36F 4ISAA 5AE3A 3H1CA 1OJ4A 2DEIA 4JI6I 3HXLA 3M7NG 1U2RA 3ECRA 1QZRA 4MU0A 2UUAE 4IFDD 3K6QA 2EPXA 2HGHA 2BA0G 3P3EA 2V85A 2L33A 4JI5E 1DI2A 1PVGA 2NUEA 2EOIA 3L00A 1GTKA 3PYEA 4X64I 4M0VA 2JXPA 2EOZA 2E1RA 4FW5A 4FW7A 1FI4A 1ZR9A 1NEIA 2EPPA 4R03A 2EPOA 4R2EA 4DR3E 4DR5I 2R3VA 2JEBB 2DB2A 2HFUA 1Y60A 4LF5I 2XEXA 3LTOA 4JI7I 2EMIA 4LF8E 4WUDA 4IZJD 4J8ZA 1WRJA 4OO1A 1BBGA 4DUZE 5AE1A 1EA6A 1P42A 2HFSA 4U3BA 1Z0EA 2EOSA 5CFFE 4JI0I 2EMGA 4DR6E 4I3HA 2EMZA 3VYXA 1FWKA 1YUIA 2DIXA 2EN6A 4R2PA 2LJPA 2PO1B 4WFTA 2O1TA 2E5LI 2YT4A 2DEJA 1MU5A 2BR2A 2EP3A 3PS3A 2M9AA 1T4OA 4R2RA 2BV3A 4ZYHA 3PRYA 2YTJA 5AC5A 1J5EE 2C37A 1MEYC 4BMJA 4LOMA 4YHHE 4YY3I 2V8PA 1T4NA 1SFEA 2JPAA 2EPUA 2I9IA 4DV0I 4ZYGA 1PDAA 3UHMA 3M85D 4DV3E 1A1IA 1RC7A 5AE2A 2GPIA 1BKNA 5A6KA 3ZM7A 2CTDA 1WXRA 1BBOA 4Z7CA 1TF3A 5JEAF 2E1MA 1KTVA 1NHHA 2EN7A 3ADIA 2EM8A 2JE6B 5DRRA 2ENHA 1B62A 1BB8A 5A6AA 1UDOA 2N8XA 2NPFA 3M6AA 1YH8A 4NXME 5LMUI 1K47A 1Z0GA 2YWQA 2L3JA 1XNQE 3DD6A 4R2AA 2V8QB 4I8OA 4HACB 4DPUA 2EL6A 2ZITA 1PJTA 2LVHA 3ZZ0A 2LV2A 2RS6A 1N34I 2DSYA 3C4TA 1T4LB 1UDQA 3BF2A 2O1VA 3L7ZA 2NN6F 5IT9Q 4JI8E 4X9JA 2LJHA 2PO2A 3K85A 4K0KE 4J3DA 3HPZA 2UUCE 4N4RB 4DPTA 2RS7A 1WHQA 2PO0B 2EMKA 1ZXMA 1UDSA 2PNZA 2Z5EA 3NZKA 4IZJA 1N33I 4GZNC 2LE2A 2NN6D 2HK3A 2Z5CA 5KL6A 1JK1A 4JI1E 4HEIA 3T1HE 1A6FA 1FWLA 1TN9A 2GO3A 3HQ1A 2YRMA 1X47A 2R1FA 1A1GA 2A2CA 1UEKA 4AIDA 5GMDA 5C0XC 2MKNA 2L8TA 4DV5E 1UN6B 1H73A 1A1JA 1N36E 4M2ZA 2WP8B 2L2MA 5C0XE 3EPHA 1FJGI 3V2UC 1I94E 2EM4A 3LMLA 4O5GA 4FWHA 2RTXA 3ADLA 2EMYA 1AAYA 2CPNA 4AQYE 4X8WA 2ELZA 3HKMA 4GKKE 4OO1F 3GLLA 2UU9I 3JAMQ 2EQ1A 4FWGA 4DV2I 1D6TA 4ZVIA 4DV1I 2N3GA 1OYRA 1Z59A 4FW3A 2NA2A 1XNRE 2EPKX 4OO1D 2EMCA 4F6NA 2UUAI 1KKHA 4P52A 4N3OA 3BIDA 1GQEA 2EMFA 1YZ9A 4IZKB 4WUCA 2K4VA 3B4TA 4JI5I 5K36E 3V5RA 4DUYE 3J7AG 2J65A 3B78A 1ZM3A 4DR3I 5LL6R 2JP9A 1HK7A 3P3GA 1LLMC 3CDIA 2UXDE 1X49A 4LF9E 1XXEA 1NZ0A 1Z5BA 4MU1A 3FIGA 4LF8I 2NUGA 1F2IG 2BR2B 2NN6A 1IMUA 2C39B 3THOB 1XMQE 1HNWE 2EPNA 4B3SE 4IS1C 4XTJA 4DUZI 3PS2A 2FV4B 5KL4A 3F6HA 1UHZA 4F9AB 2NABA 3HPSA 5FLXC 4DR6I 1E3HA 1Y6ZA 1Z0BA 2EQ3A 2YSPA 2DLQA 3U1YA 3OMLA 3J81C 1O0WA 3AUZA 4BC9A 2DRPA 4TUGA 3WU4A 1H7SA 1N3GA 4FK5C 3P76A 1J5EI 4YHHI 1PJSA 2Z5BA 1ZM4A 3BGHA 1EH7A 2D9HA 2EE8A 2LUPB 2EPLX 1T38A 2EN2A 2DMIA 2EQ0A 4IFDB 1N0VC 2MC5A 2JEAB 5EL9A 1UDNA 2V89A 2C38B 4DV3I 5K36B 4X62E 4R2SA 1TF6A 2EMBA 4MU3A 2X36A 1S16A 3WU5A 3M99B 4PU9A 2BB8A 2V86A 2MDGA 4B3ME 1B69A 3P3CA 3MSWA 3ZKDA 4NXMI 2YTPA 3DF6A 3KZYA 2IOPA 2ZBKB 1XNQI 2YTEA 4R2CA 2IESA 2RPCA 1KVKA 2YTIA 5JEAE 2DMYA 5LLQA 2VF3A 2X7IA 1EI1A 1PIEA 2IOQA 2HC5A 4IZJB 4DR2E 1L4SA 2F8BA 2VQEE 1A1FA 1HNZE 2WBSA 2YPNA 4DMIA 4OOGC 2DGCA 2Z5CB 5KL7A 4MU4A 2FGGA 2J7KA 2EN8A 4JI8I 2YTNA 1Z1BA 4K0KI 2WNRA 1WJPA 2L6MA 4BS9A 4MDTA 5LMNE 2UUCI 4DR4E 1Z5AA 1ZM2A 1ZU1A 4AM3A 3EPKA 2R76A 1RQ0A 4FW6A 2BM0A 2BA1G 2ODRD 1H7UA 4JI1I 2LCEA 3T1HI 4DU7A 2B7TA 4DR7E 1QU6A 2O1WA 4MLVA 3VYYA 4B3TE 4Z7YA 2V83A 4LFCE 5KL5A 4X66E 4KHPE 4FN5A 2EORA 1VI7A 3EPLA 4P78A 4DV5I 1B63A 2YTFA 1N36I 2EM7A 4LCHA 1X6HA 1N32E 2V2ZA 3QG5C 4JI3E 4RPFA 4EMDA 2EN3A 1IQSA 2EOEA 2VF1A 2YTGA 1YYOA 2CZ9A 3B82A 4LCGA 1I94I 3AV0A 4OZEA 5JEAB 1KJKA 4TUIA 3WU3A 2EOJA 2HKEA 4AQYI 1HR0E 1FNMA 5IXMB 4GKKI 1WHNA 2EZ6A 1R6MA 3KRNA 4KZSA 2EM9A 1NHJA 2GLIA 2LT7A 2M7QA 2KONA 4WXCA 1HNXE 2H36X 2YU8A 4GKJE 3HJCA 4PRXA 4GEQB 1XNRI 1OYSA 4LU9A 4OO1E 1X6FA 4F2JC 4FW9A 1X48A 4X65E 2NN6B 2EMHA 3PYFA 2RQLA 2Q8UA 2JEBA 2UUBE 2YU5A 2WBUA 3PYGA 4DUYI 4O43A 3GCMA 2V88A 2LMZA 2UXCE 3CDJA 2KHXA 2PRTA 3QT7A 1IBKE 2EMXA 4BCAA 4USMA 2UXDI 4LF9I 2EM5A 5IT9C 2ZM6E 2GQ0A 4DV6E 5FWKA 1J26A 4R2QA 1XMQI 1HNWI 4DR1E 4B3SI 2ELYA 1ELOA 2EPRA 2PO1A 3OTOE 1MG7A 1Z0WA 2Z5BB 2LTRA 1ZAAC 1VISA 2VQFE 2EN1A 2ENAA 2B3TB 2K7IA 2VESA 2WW4A 5T6JA 4LFBE 1H74A 2WBTA 1X5WA 5TSEA 4JI4E 4BA2B 3J80Q 2FTXB 4IFDC 1IBME 2JOXA 4WUBA 5K36C 1X3CA 3J7AM 4LFAE 4IFDE 4WPYA 2NUFA 4R8OA 4OO1B 4PRVA 5DRQA 1WUUA 4F9BB 5A6BA 3P1XA 4HY1A 2RSIA 1JK2A 1G2FC 4Q35B 4X62I 4WYQB 2EPAA 2F4VE 5AC4A 5KL2A 2R42A 5A2QQ 3QT6A 1EKZA 2LJUA 1IQOA 1FKAE 4B3MI 4NZVA 4LF6E 4HACA 4WX9A 3RMPA 4DKKA 4LCFA 3JAMC 3K17A 1PKPA 3HTXA 2VE7C 4JI2E 2C37B 4DPWA 5C0XF 3WU6A 4DR2I 2V87A 3VK6A 2VQEI 1HNZI 2HJJA 2ENCA 2MC6A 1IBLE 4NBQA 2AE8A 4LTYA 4AIMA 4DV7E 2PO0A 5IWAE 2I13A 2KOUA 3T1YE 5L3JA 5C0XD 4DV4E 1T39A 2O1UA 5LMNI 4DR4I 3EPJA 3ADGA 2EPZA 1Y5YA 2EL4A 2EOYA 3F6GA 4BHBA 2BM1A 3LNUA 3B8HA 4JYAE 3LLHA 4URLA 2UXBE 1RR9A 1ZBQA 2L2KB 2LBSB 5DRPA 3JU0A 4L8NA 2J7JA 1Z0TA 1YFHA 4DR7I 2L3CA 1N0UA 3QT5A 4B3TI 4BBYA 2EM3A 2WP8A 1Y4UA 3TQMA 4X66I 4KHPI 1DGCA 3ZKBA 4WSPA 3K1JA 3L7ZB 5JEAC 4JV5E 2PO2B 1N32I 3ADJA 2LO3A 4QNKA 4JI3I 4O24A 2PNZB 3THNA 1A1HA 2WZOA 2CT1A 3GMEA 3EQ1A 3ZZUA 1X6EA 5F3WA 5BR8E 5K36D 4B3RE 1YHCA 1UBDC 1H72C 2V2VA 4BA1A 1USVA 1HR0I 4MQYA 4LF7E 3BBGA 3IWCA 2EOXA 4UTGA 5A6JA 2PNMA 2HHHE 1NCSA 4OX9E 2EOHA 2MKDA 2RSMA 2YTOA 2NN6C 3MHHC 4U3DA 4DXLA 4RHBB 2WNRB 1HNXI 2EOOA 3U1KA 4R2DA 2NN6E 4IZKA 1A1LA 4GKJI 2Q2EB 4NHRA 1Z0VA 1A1KA 4NXNE 4FW4A 4IJDA 5GMEA 4GQUA 4X65I 4MYUA 4MLQA 1RHYA 1RREA 2V2QA 2YRKA 3H09A 2UUBI 2IERA 3C6MA 3GONA 4LF4E 2UXCI 4L5NC 3J7Yp 4M9VC 1XMOE 5C0XA 2B9DA 2JVAA 4IS9A 1IBKI 4JI6E 1RMDA 2C39A 4P7AA 2BBGA 2EOQA 4HTGA 4M30A 2EFGA 2ZM6I 5IV8B 2CSHA 2GHFA 1P47A 4MYTA 2BA0D 2A25A 2OI2A 2N3HA 3M85G 4DV6I 4F54A 4DR1I 4F9CB 3M7ND 4X64E 2YTQA 3OTOI 5A6BD 2EPMX 4FWDA 4HXZA 4DR5E 4Q28A 3QT8A 5ADZA 1MX0A 1S4EA 2VQFI 4R1FA 2CGEA 2M1SA 3MHSC 4LFBI 4JI4I 4LF5E 2EWLA 3KWRA 3C6KA 4OO1C 4JI7E 3D4JA 1YYWA 1IBMI 4O4KA 5ELWA 5JEAD 5DNXA 3H4LA 4IFDA 2JEAA 2ADRA 2EM2A 1ZM9A 1STUA 2C38A 4LFAI 4JI0E 5K36A 5A69A 2YSOA 3Q1QA 3ZOQB 2E5LE 2F4VI 4LF6I 2JWOA 3LPSA 4YY3E 2F1DA 2IHR1 3Q6NA 5KL3A 3JTZA 5DROA 2BA1D 4M1KA 3C4BA 2LUQA 4DV0E 5EKWA 4JI2I 2EMLA 2EOFA 2YZTA 2EN4A 1XHKA 4RH8A 1IBLI 1KYQA 1ZBTA 2CG9A 4ZYEA 4DV7I 5IWAI 3F0NA 2JT2A 3T1YI 2YRHA 5LMUE 5AASA 4KQVA 4DV4I 4LPFA 2EL5A 1UILA 2PNLA 4P7DA 1EH8A 4WSGA 1AH5A 2LTSA 2E72A 2HK2A 1SR9A 2EJ4A 4DPYA 2M4IA 2EPCA 2GO4A 4JYAI 2JE6A 1N34E 2UXBI 2EMWA 2MDRA 2V34A 4BHCA 2O3ZA 2EMAA 1PJQA 3KZZA 2AJ4A 2DLKA 2EM6A 2JYAA 2JR1A 4USKA 4BA1B 1Z5CA 2CVEA 4JV5I 2A2DA 3PYDA 1N33E 4OKGA 3Q6MA 1NHIA
chains in the Genus database with same CATH topology
3DJWA 1ZXNA 1YYKA 5FLXQ 2JY9A 3J80C 1Y4SA 1USUA 4BC7A 3J81Q 2G7HA 5BR8I 4B3RI 1Z0CA 3CWVA 4HYMA 4LF7I 3IWDA 4DPXA 5DNYA 1DARA 3P06A 2JOBA 3HULA 1GZ6A 1KIJA 2HKJA 3ZZTA 2GS8A 1FJGE 2HHHI 1DQ3A 4OX9I 2L92A 4UT4A 2ODRC 5A2QC 2L2NA 3IWBA 4ED4A 4DU8A 2B7VA 4NXNI 2LRSA 4LFCI 4JG4A 2UU9E 4LF4I 4DV2E 4DV1E 1XMOI 5AE3A 1OJ4A 2DEIA 4JI6I 3HXLA 1U2RA 1QZRA 2UUAE 3K6QA 2V85A 2L33A 4JI5E 1DI2A 1PVGA 2NUEA 3PYEA 4X64I 4M0VA 2E1RA 1FI4A 4R03A 4DR5I 4DR3E 2R3VA 2DB2A 2HFUA 4LF5I 2XEXA 3LTOA 4JI7I 4LF8E 4WUDA 4IZJD 4J8ZA 4DUZE 5AE1A 1EA6A 2HFSA 1Z0EA 4JI0I 5CFFE 4I3HA 4DR6E 3VYXA 1FWKA 2DIXA 2LJPA 4WFTA 2O1TA 2E5LI 2YT4A 2DEJA 1MU5A 1T4OA 2BV3A 3PRYA 1J5EE 4BMJA 4YY3I 4YHHE 2V8PA 1T4NA 4DV0I 4DV3E 1BKNA 1RC7A 5AE2A 3ZM7A 4Z7CA 1WXRA 2E1MA 1KTVA 1NHHA 3ADIA 1B62A 2NPFA 3M6AA 5LMUI 4NXME 1K47A 1Z0GA 1XNQE 2L3JA 2V8QB 4I8OA 4HACB 4DPUA 2ZITA 3ZZ0A 2RS6A 1N34I 2DSYA 3C4TA 1T4LB 2O1VA 5IT9Q 4JI8E 2LJHA 3K85A 4K0KE 3HPZA 2UUCE 4DPTA 2RS7A 1WHQA 1ZXMA 2Z5EA 4IZJA 1N33I 2LE2A 2HK3A 2Z5CA 4JI1E 3T1HE 1A6FA 1FWLA 3HQ1A 1X47A 2A2CA 1UEKA 5GMDA 2L8TA 4DV5E 1H73A 1N36E 4M2ZA 2L2MA 1FJGI 3V2UC 1I94E 3LMLA 4FWHA 2RTXA 3ADLA 2CPNA 4AQYE 4X8WA 4GKKE 2UU9I 3JAMQ 4FWGA 4DV2I 1D6TA 4ZVIA 4DV1I 2N3GA 1Z59A 2NA2A 1XNRE 2UUAI 1KKHA 4P52A 4N3OA 1GQEA 4IZKB 1YZ9A 4WUCA 4JI5I 2K4VA 3V5RA 4DUYE 3J7AG 3B78A 1ZM3A 4DR3I 5LL6R 1HK7A 2UXDE 1X49A 4LF9E 1Z5BA 1NZ0A 3FIGA 4LF8I 2NUGA 1HNWE 1XMQE 4B3SE 4XTJA 4DUZI 2FV4B 3F6HA 1UHZA 4F9AB 3HPSA 5FLXC 4DR6I 1Y6ZA 1Z0BA 3OMLA 3J81C 1O0WA 3AUZA 4BC9A 4TUGA 3WU4A 1H7SA 1J5EI 4YHHI 2Z5BA 1ZM4A 2LUPB 1N0VC 2MC5A 4DV3I 2V89A 4X62E 2X36A 1S16A 3WU5A 4PU9A 2V86A 4B3ME 3MSWA 3ZKDA 4NXMI 3DF6A 2IOPA 1XNQI 2ZBKB 1KVKA 2DMYA 2VF3A 2X7IA 1EI1A 1PIEA 2IOQA 4IZJB 4DR2E 1HNZE 2F8BA 2VQEE 4DMIA 4OOGC 2Z5CB 2FGGA 2J7KA 4JI8I 4K0KI 2L6MA 4BS9A 2UUCI 5LMNE 4DR4E 1Z5AA 1ZM2A 1RQ0A 2BM0A 2ODRD 1H7UA 4JI1I 3T1HI 4DU7A 2B7TA 4DR7E 1QU6A 2O1WA 3VYYA 4B3TE 4Z7YA 2V83A 4LFCE 4X66E 4KHPE 4FN5A 4P78A 4DV5I 1B63A 1N36I 1N32E 2V2ZA 4JI3E 4RPFA 4EMDA 1I94I 2VF1A 1YYOA 2CZ9A 3B82A 3AV0A 4TUIA 3WU3A 2HKEA 4AQYI 1HR0E 1FNMA 4GKKI 1WHNA 2EZ6A 4KZSA 1NHJA 2M7QA 2KONA 1HNXE 2H36X 4PRXA 4GKJE 3HJCA 1XNRI 4GEQB 4LU9A 4FW9A 1X48A 4X65E 3PYFA 2UUBE 3PYGA 4DUYI 2V88A 2LMZA 2UXCE 2KHXA 3QT7A 1IBKE 4BCAA 4USMA 2UXDI 4LF9I 5IT9C 2ZM6E 2GQ0A 4DV6E 5FWKA 1J26A 1XMQI 1HNWI 4DR1E 4B3SI 1ELOA 3OTOE 1MG7A 1Z0WA 2Z5BB 2LTRA 1VISA 2VQFE 2WW4A 2B3TB 5T6JA 4LFBE 1H74A 4JI4E 3J80Q 2FTXB 1IBME 2JOXA 4WUBA 3J7AM 4LFAE 4WPYA 2NUFA 4R8OA 4PRVA 1WUUA 4F9BB 3P1XA 4HY1A 4X62I 4WYQB 2F4VE 2R42A 5A2QQ 3QT6A 1EKZA 1FKAE 4B3MI 4LF6E 4HACA 3RMPA 4DKKA 3JAMC 3K17A 1PKPA 3HTXA 2VE7C 4JI2E 4DPWA 3WU6A 4DR2I 2V87A 3VK6A 2VQEI 1HNZI 2MC6A 1IBLE 4LTYA 4DV7E 5IWAE 2KOUA 3T1YE 5L3JA 4DV4E 2O1UA 5LMNI 4DR4I 3ADGA 3F6GA 2BM1A 3LNUA 3B8HA 4JYAE 3LLHA 4URLA 2UXBE 1RR9A 1ZBQA 2L2KB 2LBSB 3JU0A 4L8NA 1Z0TA 4DR7I 2L3CA 1N0UA 3QT5A 4B3TI 4BBYA 1Y4UA 4X66I 4KHPI 3ZKBA 4WSPA 3K1JA 4JV5E 1N32I 3ADJA 4JI3I 2WZOA 3ZZUA 5F3WA 5BR8E 4B3RE 1H72C 2V2VA 1USVA 1HR0I 4LF7E 3IWCA 4UTGA 2PNMA 2HHHE 4OX9E 2RSMA 4DXLA 1HNXI 4IZKA 4GKJI 2Q2EB 1Z0VA 4NXNE 5GMEA 4X65I 4MYUA 1RREA 2V2QA 3H09A 2UUBI 3GONA 4LF4E 2UXCI 4L5NC 3J7Yp 1XMOE 2B9DA 2JVAA 1IBKI 4JI6E 4P7AA 4M30A 2EFGA 2ZM6I 4DV6I 4MYTA 2OI2A 2N3HA 4F54A 4DR1I 4F9CB 4X64E 3OTOI 4FWDA 4HXZA 4DR5E 4Q28A 3QT8A 5ADZA 1MX0A 1S4EA 2VQFI 4R1FA 2CGEA 2M1SA 4LFBI 4JI4I 4LF5E 2EWLA 3KWRA 4JI7E 3D4JA 1YYWA 1IBMI 3H4LA 1ZM9A 4LFAI 1STUA 4JI0E 3Q1QA 3ZOQB 2E5LE 2F4VI 4LF6I 2JWOA 3LPSA 4YY3E 2IHR1 3Q6NA 3JTZA 4M1KA 3C4BA 2LUQA 4DV0E 4JI2I 2YZTA 1XHKA 1IBLI 1ZBTA 2CG9A 4DV7I 5IWAI 3F0NA 3T1YI 5LMUE 5AASA 4KQVA 4DV4I 1UILA 2PNLA 4P7DA 2LTSA 2HK2A 1SR9A 4DPYA 2M4IA 4JYAI 1N34E 2UXBI 2MDRA 2V34A 2AJ4A 2JR1A 4USKA 1Z5CA 4JV5I 2A2DA 3PYDA 1N33E 3Q6MA 1NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXN A;  1YYK A;  5FLX Q;  2JY9 A;  3J80 C;  3J81 Q;  5BR8 I;  4B3R I;  1Z0C A;  3CWV A;  4HYM A;  4LF7 I;  4DPX A;  1DAR A;  3HUL A;  2HKJ A;  1KIJ A;  3ZZT A;  2HHH I;  2GS8 A;  1FJG E;  4OX9 I;  4UT4 A;  5A2Q C;  2L2N A;  4ED4 A;  4DU8 A;  2B7V A;  4NXN I;  2LRS A;  4LFC I;  4JG4 A;  2UU9 E;  4LF4 I;  4DV2 E;  4DV1 E;  1XMO I;  1OJ4 A;  2DEI A;  4JI6 I;  1U2R A;  1QZR A;  2UUA E;  2L33 A;  4JI5 E;  1DI2 A;  1PVG A;  2NUE A;  3PYE A;  4X64 I;  2E1R A;  1FI4 A;  4DR5 I;  4DR3 E;  2R3V A;  2DB2 A;  2HFU A;  4LF5 I;  2XEX A;  3LTO A;  4JI7 I;  4LF8 E;  4WUD A;  4DUZ E;  1EA6 A;  2HFS A;  1Z0E A;  4JI0 I;  5CFF E;  4I3H A;  4DR6 E;  3VYX A;  1FWK A;  2DIX A;  2LJP A;  4WFT A;  2E5L I;  2YT4 A;  2DEJ A;  1MU5 A;  1T4O A;  2BV3 A;  1J5E E;  4YY3 I;  4YHH E;  2V8P A;  1T4N A;  4DV0 I;  4DV3 E;  1BKN A;  1RC7 A;  3ZM7 A;  4Z7C A;  1KTV A;  1NHH A;  3ADI A;  1B62 A;  2NPF A;  3M6A A;  5LMU I;  4NXM E;  1K47 A;  1Z0G A;  1XNQ E;  2L3J A;  4HAC B;  4DPU A;  2ZIT A;  3ZZ0 A;  2RS6 A;  1N34 I;  3C4T A;  1T4L B;  5IT9 Q;  4JI8 E;  2LJH A;  4K0K E;  2UUC E;  4DPT A;  2RS7 A;  1WHQ A;  1ZXM A;  1N33 I;  2HK3 A;  4JI1 E;  3T1H E;  1A6F A;  1FWL A;  1X47 A;  2A2C A;  1UEK A;  5GMD A;  4DV5 E;  1H73 A;  1N36 E;  4M2Z A;  2L2M A;  1FJG I;  3V2U C;  1I94 E;  4FWH A;  2RTX A;  3ADL A;  2CPN A;  4AQY E;  4X8W A;  4GKK E;  2UU9 I;  3JAM Q;  4FWG A;  4DV2 I;  1D6T A;  4ZVI A;  4DV1 I;  2N3G A;  1Z59 A;  2NA2 A;  1XNR E;  2UUA I;  1KKH A;  4P52 A;  1GQE A;  1YZ9 A;  4WUC A;  4JI5 I;  3V5R A;  4DUY E;  3J7A G;  3B78 A;  1ZM3 A;  4DR3 I;  5LL6 R;  2UXD E;  1X49 A;  4LF9 E;  1Z5B A;  1NZ0 A;  4LF8 I;  2NUG A;  1HNW E;  1XMQ E;  4B3S E;  4XTJ A;  4DUZ I;  1UHZ A;  5FLX C;  4DR6 I;  1Z0B A;  3J81 C;  1O0W A;  3WU4 A;  1H7S A;  1J5E I;  4YHH I;  1ZM4 A;  2LUP B;  1N0V C;  4DV3 I;  4X62 E;  2X36 A;  1S16 A;  3WU5 A;  4PU9 A;  4B3M E;  4NXM I;  3ZKD A;  1XNQ I;  2ZBK B;  1KVK A;  2DMY A;  2VF3 A;  2X7I A;  1EI1 A;  1PIE A;  4DR2 E;  1HNZ E;  2VQE E;  4OOG C;  4JI8 I;  2J7K A;  4K0K I;  2UUC I;  5LMN E;  4DR4 E;  1Z5A A;  1ZM2 A;  1RQ0 A;  2BM0 A;  1H7U A;  4JI1 I;  3T1H I;  4DU7 A;  2B7T A;  4DR7 E;  1QU6 A;  3VYY A;  4B3T E;  4Z7Y A;  4LFC E;  4X66 E;  4KHP E;  4FN5 A;  4DV5 I;  1B63 A;  1N36 I;  1N32 E;  2V2Z A;  4JI3 E;  4RPF A;  4EMD A;  1I94 I;  2CZ9 A;  1YYO A;  3B82 A;  3WU3 A;  2HKE A;  4AQY I;  1HR0 E;  1FNM A;  4GKK I;  1WHN A;  2EZ6 A;  1NHJ A;  1HNX E;  4PRX A;  4GKJ E;  1XNR I;  4FW9 A;  1X48 A;  4X65 E;  3PYF A;  2UUB E;  3PYG A;  4DUY I;  2UXC E;  2KHX A;  3QT7 A;  1IBK E;  4USM A;  2UXD I;  4LF9 I;  5IT9 C;  2ZM6 E;  4DV6 E;  1J26 A;  1XMQ I;  1HNW I;  4DR1 E;  4B3S I;  1ELO A;  3OTO E;  1MG7 A;  1Z0W A;  2LTR A;  1VIS A;  2VQF E;  2WW4 A;  2B3T B;  4LFB E;  1H74 A;  4JI4 E;  3J80 Q;  1IBM E;  4WUB A;  3J7A M;  4LFA E;  2NUF A;  4PRV A;  1WUU A;  3P1X A;  4HY1 A;  4X62 I;  4WYQ B;  2F4V E;  2R42 A;  5A2Q Q;  3QT6 A;  1EKZ A;  1FKA E;  4B3M I;  4LF6 E;  4HAC A;  4DKK A;  3K17 A;  3JAM C;  1PKP A;  3HTX A;  4JI2 E;  4DPW A;  3WU6 A;  4DR2 I;  1HNZ I;  2VQE I;  1IBL E;  4DV7 E;  5IWA E;  3T1Y E;  5L3J A;  4DV4 E;  5LMN I;  4DR4 I;  3ADG A;  2BM1 A;  3LNU A;  3B8H A;  4JYA E;  3LLH A;  4URL A;  2UXB E;  1RR9 A;  2L2K B;  2LBS B;  1Z0T A;  4DR7 I;  2L3C A;  1N0U A;  3QT5 A;  4B3T I;  4X66 I;  4KHP I;  3ZKB A;  3K1J A;  4JV5 E;  1N32 I;  3ADJ A;  4JI3 I;  3ZZU A;  5BR8 E;  4B3R E;  1H72 C;  2V2V A;  1HR0 I;  4LF7 E;  4UTG A;  2HHH E;  4OX9 E;  2RSM A;  4DXL A;  1HNX I;  4GKJ I;  2Q2E B;  1Z0V A;  4NXN E;  5GME A;  4X65 I;  4MYU A;  1RRE A;  2V2Q A;  2UUB I;  3GON A;  4LF4 E;  2UXC I;  3J7Y p;  1XMO E;  2JVA A;  1IBK I;  4JI6 E;  4P7A A;  4M30 A;  2EFG A;  2ZM6 I;  4DV6 I;  4MYT A;  2OI2 A;  2N3H A;  4DR1 I;  4X64 E;  3OTO I;  4FWD A;  4HXZ A;  4DR5 E;  3QT8 A;  1MX0 A;  1S4E A;  2VQF I;  4R1F A;  4LFB I;  4JI4 I;  4LF5 E;  4JI7 E;  3D4J A;  1YYW A;  1IBM I;  3H4L A;  1ZM9 A;  4LFA I;  1STU A;  4JI0 E;  3Q1Q A;  2E5L E;  2F4V I;  4LF6 I;  3LPS A;  4YY3 E;  2IHR 1;  4M1K A;  3C4B A;  2LUQ A;  4DV0 E;  4JI2 I;  1XHK A;  1IBL I;  1ZBT A;  4DV7 I;  5IWA I;  3F0N A;  3T1Y I;  5LMU E;  4KQV A;  4DV4 I;  1UIL A;  2LTS A;  2HK2 A;  4DPY A;  4JYA I;  1N34 E;  2UXB I;  2MDR A;  2V34 A;  2AJ4 A;  4USK A;  1Z5C A;  4JV5 I;  2A2D A;  3PYD A;  1N33 E;  1NHI A; 
#chains in the Genus database with same CATH topology
 1MGT A;  3DJW A;  1ZXN A;  5JEA A;  2WCC 3;  3UK3 C;  4F6M A;  1YYK A;  5FLX Q;  2JY9 A;  5DNL A;  3J80 C;  1Y4S A;  1USU A;  4BC7 A;  3J81 Q;  2G7H A;  1OYP A;  1G2D C;  5BR8 I;  1E3P A;  4B3R I;  2EOM A;  1Z0C A;  3CWV A;  4HYM A;  4LF7 I;  3IWD A;  4DPX A;  2EM0 A;  5DNY A;  1R6L A;  1DAR A;  3PS1 A;  3P06 A;  2JOB A;  3HUL A;  1GZ6 A;  1KIJ A;  2HKJ A;  3ZZT A;  2GS8 A;  1FJG E;  2HHH I;  1DQ3 A;  4OX9 I;  4BA2 A;  2L92 A;  4UT4 A;  2ODR C;  5C0X B;  2VRD A;  5A2Q C;  2L2N A;  3IWB A;  2YTD A;  4QNJ A;  4ED4 A;  1EH6 A;  4DU8 A;  2B7V A;  3VHT B;  4NXN I;  2LRS A;  4KWY A;  1QNT A;  1YPN A;  4LFC I;  1YSA C;  4JG4 A;  4ZYD A;  1YUJ A;  2UU9 E;  4IFD F;  4WXD A;  4LF4 I;  4DV2 E;  4DV1 E;  1XMO I;  5K36 F;  4ISA A;  5AE3 A;  3H1C A;  1OJ4 A;  2DEI A;  4JI6 I;  3HXL A;  3M7N G;  1U2R A;  3ECR A;  1QZR A;  4MU0 A;  2UUA E;  4IFD D;  3K6Q A;  2EPX A;  2HGH A;  2BA0 G;  3P3E A;  2V85 A;  2L33 A;  4JI5 E;  1DI2 A;  1PVG A;  2NUE A;  2EOI A;  3L00 A;  1GTK A;  3PYE A;  4X64 I;  4M0V A;  2JXP A;  2EOZ A;  2E1R A;  4FW5 A;  4FW7 A;  1FI4 A;  1ZR9 A;  1NEI A;  2EPP A;  4R03 A;  2EPO A;  4R2E A;  4DR3 E;  4DR5 I;  2R3V A;  2JEB B;  2DB2 A;  2HFU A;  1Y60 A;  4LF5 I;  2XEX A;  3LTO A;  4JI7 I;  2EMI A;  4LF8 E;  4WUD A;  4IZJ D;  4J8Z A;  1WRJ A;  4OO1 A;  1BBG A;  4DUZ E;  5AE1 A;  1EA6 A;  1P42 A;  2HFS A;  4U3B A;  1Z0E A;  2EOS A;  5CFF E;  4JI0 I;  2EMG A;  4DR6 E;  4I3H A;  2EMZ A;  3VYX A;  1FWK A;  1YUI A;  2DIX A;  2EN6 A;  4R2P A;  2LJP A;  2PO1 B;  4WFT A;  2O1T A;  2E5L I;  2YT4 A;  2DEJ A;  1MU5 A;  2BR2 A;  2EP3 A;  3PS3 A;  2M9A A;  1T4O A;  4R2R A;  2BV3 A;  4ZYH A;  3PRY A;  2YTJ A;  5AC5 A;  1J5E E;  2C37 A;  1MEY C;  4BMJ A;  4LOM A;  4YHH E;  4YY3 I;  2V8P A;  1T4N A;  1SFE A;  2JPA A;  2EPU A;  2I9I A;  4DV0 I;  4ZYG A;  1PDA A;  3UHM A;  3M85 D;  4DV3 E;  1A1I A;  1RC7 A;  5AE2 A;  2GPI A;  1BKN A;  5A6K A;  3ZM7 A;  2CTD A;  1WXR A;  1BBO A;  4Z7C A;  1TF3 A;  5JEA F;  2E1M A;  1KTV A;  1NHH A;  2EN7 A;  3ADI A;  2EM8 A;  2JE6 B;  5DRR A;  2ENH A;  1B62 A;  1BB8 A;  5A6A A;  1UDO A;  2N8X A;  2NPF A;  3M6A A;  1YH8 A;  4NXM E;  5LMU I;  1K47 A;  1Z0G A;  2YWQ A;  2L3J A;  1XNQ E;  3DD6 A;  4R2A A;  2V8Q B;  4I8O A;  4HAC B;  4DPU A;  2EL6 A;  2ZIT A;  1PJT A;  2LVH A;  3ZZ0 A;  2LV2 A;  2RS6 A;  1N34 I;  2DSY A;  3C4T A;  1T4L B;  1UDQ A;  3BF2 A;  2O1V A;  3L7Z A;  2NN6 F;  5IT9 Q;  4JI8 E;  4X9J A;  2LJH A;  2PO2 A;  3K85 A;  4K0K E;  4J3D A;  3HPZ A;  2UUC E;  4N4R B;  4DPT A;  2RS7 A;  1WHQ A;  2PO0 B;  2EMK A;  1ZXM A;  1UDS A;  2PNZ A;  2Z5E A;  3NZK A;  4IZJ A;  1N33 I;  4GZN C;  2LE2 A;  2NN6 D;  2HK3 A;  2Z5C A;  5KL6 A;  1JK1 A;  4JI1 E;  4HEI A;  3T1H E;  1A6F A;  1FWL A;  1TN9 A;  2GO3 A;  3HQ1 A;  2YRM A;  1X47 A;  2R1F A;  1A1G A;  2A2C A;  1UEK A;  4AID A;  5GMD A;  5C0X C;  2MKN A;  2L8T A;  4DV5 E;  1UN6 B;  1H73 A;  1A1J A;  1N36 E;  4M2Z A;  2WP8 B;  2L2M A;  5C0X E;  3EPH A;  1FJG I;  3V2U C;  1I94 E;  2EM4 A;  3LML A;  4O5G A;  4FWH A;  2RTX A;  3ADL A;  2EMY A;  1AAY A;  2CPN A;  4AQY E;  4X8W A;  2ELZ A;  3HKM A;  4GKK E;  4OO1 F;  3GLL A;  2UU9 I;  3JAM Q;  2EQ1 A;  4FWG A;  4DV2 I;  1D6T A;  4ZVI A;  4DV1 I;  2N3G A;  1OYR A;  1Z59 A;  4FW3 A;  2NA2 A;  1XNR E;  2EPK X;  4OO1 D;  2EMC A;  4F6N A;  2UUA I;  1KKH A;  4P52 A;  4N3O A;  3BID A;  1GQE A;  2EMF A;  1YZ9 A;  4IZK B;  4WUC A;  2K4V A;  3B4T A;  4JI5 I;  5K36 E;  3V5R A;  4DUY E;  3J7A G;  2J65 A;  3B78 A;  1ZM3 A;  4DR3 I;  5LL6 R;  2JP9 A;  1HK7 A;  3P3G A;  1LLM C;  3CDI A;  2UXD E;  1X49 A;  4LF9 E;  1XXE A;  1NZ0 A;  1Z5B A;  4MU1 A;  3FIG A;  4LF8 I;  2NUG A;  1F2I G;  2BR2 B;  2NN6 A;  1IMU A;  2C39 B;  3THO B;  1XMQ E;  1HNW E;  2EPN A;  4B3S E;  4IS1 C;  4XTJ A;  4DUZ I;  3PS2 A;  2FV4 B;  5KL4 A;  3F6H A;  1UHZ A;  4F9A B;  2NAB A;  3HPS A;  5FLX C;  4DR6 I;  1E3H A;  1Y6Z A;  1Z0B A;  2EQ3 A;  2YSP A;  2DLQ A;  3U1Y A;  3OML A;  3J81 C;  1O0W A;  3AUZ A;  4BC9 A;  2DRP A;  4TUG A;  3WU4 A;  1H7S A;  1N3G A;  4FK5 C;  3P76 A;  1J5E I;  4YHH I;  1PJS A;  2Z5B A;  1ZM4 A;  3BGH A;  1EH7 A;  2D9H A;  2EE8 A;  2LUP B;  2EPL X;  1T38 A;  2EN2 A;  2DMI A;  2EQ0 A;  4IFD B;  1N0V C;  2MC5 A;  2JEA B;  5EL9 A;  1UDN A;  2V89 A;  2C38 B;  4DV3 I;  5K36 B;  4X62 E;  4R2S A;  1TF6 A;  2EMB A;  4MU3 A;  2X36 A;  1S16 A;  3WU5 A;  3M99 B;  4PU9 A;  2BB8 A;  2V86 A;  2MDG A;  4B3M E;  1B69 A;  3P3C A;  3MSW A;  3ZKD A;  4NXM I;  2YTP A;  3DF6 A;  3KZY A;  2IOP A;  2ZBK B;  1XNQ I;  2YTE A;  4R2C A;  2IES A;  2RPC A;  1KVK A;  2YTI A;  5JEA E;  2DMY A;  5LLQ A;  2VF3 A;  2X7I A;  1EI1 A;  1PIE A;  2IOQ A;  2HC5 A;  4IZJ B;  4DR2 E;  1L4S A;  2F8B A;  2VQE E;  1A1F A;  1HNZ E;  2WBS A;  2YPN A;  4DMI A;  4OOG C;  2DGC A;  2Z5C B;  5KL7 A;  4MU4 A;  2FGG A;  2J7K A;  2EN8 A;  4JI8 I;  2YTN A;  1Z1B A;  4K0K I;  2WNR A;  1WJP A;  2L6M A;  4BS9 A;  4MDT A;  5LMN E;  2UUC I;  4DR4 E;  1Z5A A;  1ZM2 A;  1ZU1 A;  4AM3 A;  3EPK A;  2R76 A;  1RQ0 A;  4FW6 A;  2BM0 A;  2BA1 G;  2ODR D;  1H7U A;  4JI1 I;  2LCE A;  3T1H I;  4DU7 A;  2B7T A;  4DR7 E;  1QU6 A;  2O1W A;  4MLV A;  3VYY A;  4B3T E;  4Z7Y A;  2V83 A;  4LFC E;  5KL5 A;  4X66 E;  4KHP E;  4FN5 A;  2EOR A;  1VI7 A;  3EPL A;  4P78 A;  4DV5 I;  1B63 A;  2YTF A;  1N36 I;  2EM7 A;  4LCH A;  1X6H A;  1N32 E;  2V2Z A;  3QG5 C;  4JI3 E;  4RPF A;  4EMD A;  2EN3 A;  1IQS A;  2EOE A;  2VF1 A;  2YTG A;  1YYO A;  2CZ9 A;  3B82 A;  4LCG A;  1I94 I;  3AV0 A;  4OZE A;  5JEA B;  1KJK A;  4TUI A;  3WU3 A;  2EOJ A;  2HKE A;  4AQY I;  1HR0 E;  1FNM A;  5IXM B;  4GKK I;  1WHN A;  2EZ6 A;  1R6M A;  3KRN A;  4KZS A;  2EM9 A;  1NHJ A;  2GLI A;  2LT7 A;  2M7Q A;  2KON A;  4WXC A;  1HNX E;  2H36 X;  2YU8 A;  4GKJ E;  3HJC A;  4PRX A;  4GEQ B;  1XNR I;  1OYS A;  4LU9 A;  4OO1 E;  1X6F A;  4F2J C;  4FW9 A;  1X48 A;  4X65 E;  2NN6 B;  2EMH A;  3PYF A;  2RQL A;  2Q8U A;  2JEB A;  2UUB E;  2YU5 A;  2WBU A;  3PYG A;  4DUY I;  4O43 A;  3GCM A;  2V88 A;  2LMZ A;  2UXC E;  3CDJ A;  2KHX A;  2PRT A;  3QT7 A;  1IBK E;  2EMX A;  4BCA A;  4USM A;  2UXD I;  4LF9 I;  2EM5 A;  5IT9 C;  2ZM6 E;  2GQ0 A;  4DV6 E;  5FWK A;  1J26 A;  4R2Q A;  1XMQ I;  1HNW I;  4DR1 E;  4B3S I;  2ELY A;  1ELO A;  2EPR A;  2PO1 A;  3OTO E;  1MG7 A;  1Z0W A;  2Z5B B;  2LTR A;  1ZAA C;  1VIS A;  2VQF E;  2EN1 A;  2ENA A;  2B3T B;  2K7I A;  2VES A;  2WW4 A;  5T6J A;  4LFB E;  1H74 A;  2WBT A;  1X5W A;  5TSE A;  4JI4 E;  4BA2 B;  3J80 Q;  2FTX B;  4IFD C;  1IBM E;  2JOX A;  4WUB A;  5K36 C;  1X3C A;  3J7A M;  4LFA E;  4IFD E;  4WPY A;  2NUF A;  4R8O A;  4OO1 B;  4PRV A;  5DRQ A;  1WUU A;  4F9B B;  5A6B A;  3P1X A;  4HY1 A;  2RSI A;  1JK2 A;  1G2F C;  4Q35 B;  4X62 I;  4WYQ B;  2EPA A;  2F4V E;  5AC4 A;  5KL2 A;  2R42 A;  5A2Q Q;  3QT6 A;  1EKZ A;  2LJU A;  1IQO A;  1FKA E;  4B3M I;  4NZV A;  4LF6 E;  4HAC A;  4WX9 A;  3RMP A;  4DKK A;  4LCF A;  3JAM C;  3K17 A;  1PKP A;  3HTX A;  2VE7 C;  4JI2 E;  2C37 B;  4DPW A;  5C0X F;  3WU6 A;  4DR2 I;  2V87 A;  3VK6 A;  2VQE I;  1HNZ I;  2HJJ A;  2ENC A;  2MC6 A;  1IBL E;  4NBQ A;  2AE8 A;  4LTY A;  4AIM A;  4DV7 E;  2PO0 A;  5IWA E;  2I13 A;  2KOU A;  3T1Y E;  5L3J A;  5C0X D;  4DV4 E;  1T39 A;  2O1U A;  5LMN I;  4DR4 I;  3EPJ A;  3ADG A;  2EPZ A;  1Y5Y A;  2EL4 A;  2EOY A;  3F6G A;  4BHB A;  2BM1 A;  3LNU A;  3B8H A;  4JYA E;  3LLH A;  4URL A;  2UXB E;  1RR9 A;  1ZBQ A;  2L2K B;  2LBS B;  5DRP A;  3JU0 A;  4L8N A;  2J7J A;  1Z0T A;  1YFH A;  4DR7 I;  2L3C A;  1N0U A;  3QT5 A;  4B3T I;  4BBY A;  2EM3 A;  2WP8 A;  1Y4U A;  3TQM A;  4X66 I;  4KHP I;  1DGC A;  3ZKB A;  4WSP A;  3K1J A;  3L7Z B;  5JEA C;  4JV5 E;  2PO2 B;  1N32 I;  3ADJ A;  2LO3 A;  4QNK A;  4JI3 I;  4O24 A;  2PNZ B;  3THN A;  1A1H A;  2WZO A;  2CT1 A;  3GME A;  3EQ1 A;  3ZZU A;  1X6E A;  5F3W A;  5BR8 E;  5K36 D;  4B3R E;  1YHC A;  1UBD C;  1H72 C;  2V2V A;  4BA1 A;  1USV A;  1HR0 I;  4MQY A;  4LF7 E;  3BBG A;  3IWC A;  2EOX A;  4UTG A;  5A6J A;  2PNM A;  2HHH E;  1NCS A;  4OX9 E;  2EOH A;  2MKD A;  2RSM A;  2YTO A;  2NN6 C;  3MHH C;  4U3D A;  4DXL A;  4RHB B;  2WNR B;  1HNX I;  2EOO A;  3U1K A;  4R2D A;  2NN6 E;  4IZK A;  1A1L A;  4GKJ I;  2Q2E B;  4NHR A;  1Z0V A;  1A1K A;  4NXN E;  4FW4 A;  4IJD A;  5GME A;  4GQU A;  4X65 I;  4MYU A;  4MLQ A;  1RHY A;  1RRE A;  2V2Q A;  2YRK A;  3H09 A;  2UUB I;  2IER A;  3C6M A;  3GON A;  4LF4 E;  2UXC I;  4L5N C;  3J7Y p;  4M9V C;  1XMO E;  5C0X A;  2B9D A;  2JVA A;  4IS9 A;  1IBK I;  4JI6 E;  1RMD A;  2C39 A;  4P7A A;  2BBG A;  2EOQ A;  4HTG A;  4M30 A;  2EFG A;  2ZM6 I;  5IV8 B;  2CSH A;  2GHF A;  1P47 A;  4MYT A;  2BA0 D;  2A25 A;  2OI2 A;  2N3H A;  3M85 G;  4DV6 I;  4F54 A;  4DR1 I;  4F9C B;  3M7N D;  4X64 E;  2YTQ A;  3OTO I;  5A6B D;  2EPM X;  4FWD A;  4HXZ A;  4DR5 E;  4Q28 A;  3QT8 A;  5ADZ A;  1MX0 A;  1S4E A;  2VQF I;  4R1F A;  2CGE A;  2M1S A;  3MHS C;  4LFB I;  4JI4 I;  4LF5 E;  2EWL A;  3KWR A;  3C6K A;  4OO1 C;  4JI7 E;  3D4J A;  1YYW A;  1IBM I;  4O4K A;  5ELW A;  5JEA D;  5DNX A;  3H4L A;  4IFD A;  2JEA A;  2ADR A;  2EM2 A;  1ZM9 A;  1STU A;  2C38 A;  4LFA I;  4JI0 E;  5K36 A;  5A69 A;  2YSO A;  3Q1Q A;  3ZOQ B;  2E5L E;  2F4V I;  4LF6 I;  2JWO A;  3LPS A;  4YY3 E;  2F1D A;  2IHR 1;  3Q6N A;  5KL3 A;  3JTZ A;  5DRO A;  2BA1 D;  4M1K A;  3C4B A;  2LUQ A;  4DV0 E;  5EKW A;  4JI2 I;  2EML A;  2EOF A;  2YZT A;  2EN4 A;  1XHK A;  4RH8 A;  1IBL I;  1KYQ A;  1ZBT A;  2CG9 A;  4ZYE A;  4DV7 I;  5IWA I;  3F0N A;  2JT2 A;  3T1Y I;  2YRH A;  5LMU E;  5AAS A;  4KQV A;  4DV4 I;  4LPF A;  2EL5 A;  1UIL A;  2PNL A;  4P7D A;  1EH8 A;  4WSG A;  1AH5 A;  2LTS A;  2E72 A;  2HK2 A;  1SR9 A;  2EJ4 A;  4DPY A;  2M4I A;  2EPC A;  2GO4 A;  4JYA I;  2JE6 A;  1N34 E;  2UXB I;  2EMW A;  2MDR A;  2V34 A;  4BHC A;  2O3Z A;  2EMA A;  1PJQ A;  3KZZ A;  2AJ4 A;  2DLK A;  2EM6 A;  2JYA A;  2JR1 A;  4USK A;  4BA1 B;  1Z5C A;  2CVE A;  4JV5 I;  2A2D A;  3PYD A;  1N33 E;  4OKG A;  3Q6M A;  1NHI A; 
#chains in the Genus database with same CATH homology
 3DJW A;  1ZXN A;  1YYK A;  5FLX Q;  2JY9 A;  3J80 C;  1Y4S A;  1USU A;  4BC7 A;  3J81 Q;  2G7H A;  5BR8 I;  4B3R I;  1Z0C A;  3CWV A;  4HYM A;  4LF7 I;  3IWD A;  4DPX A;  5DNY A;  1DAR A;  3P06 A;  2JOB A;  3HUL A;  1GZ6 A;  1KIJ A;  2HKJ A;  3ZZT A;  2GS8 A;  1FJG E;  2HHH I;  1DQ3 A;  4OX9 I;  2L92 A;  4UT4 A;  2ODR C;  5A2Q C;  2L2N A;  3IWB A;  4ED4 A;  4DU8 A;  2B7V A;  4NXN I;  2LRS A;  4LFC I;  4JG4 A;  2UU9 E;  4LF4 I;  4DV2 E;  4DV1 E;  1XMO I;  5AE3 A;  1OJ4 A;  2DEI A;  4JI6 I;  3HXL A;  1U2R A;  1QZR A;  2UUA E;  3K6Q A;  2V85 A;  2L33 A;  4JI5 E;  1DI2 A;  1PVG A;  2NUE A;  3PYE A;  4X64 I;  4M0V A;  2E1R A;  1FI4 A;  4R03 A;  4DR5 I;  4DR3 E;  2R3V A;  2DB2 A;  2HFU A;  4LF5 I;  2XEX A;  3LTO A;  4JI7 I;  4LF8 E;  4WUD A;  4IZJ D;  4J8Z A;  4DUZ E;  5AE1 A;  1EA6 A;  2HFS A;  1Z0E A;  4JI0 I;  5CFF E;  4I3H A;  4DR6 E;  3VYX A;  1FWK A;  2DIX A;  2LJP A;  4WFT A;  2O1T A;  2E5L I;  2YT4 A;  2DEJ A;  1MU5 A;  1T4O A;  2BV3 A;  3PRY A;  1J5E E;  4BMJ A;  4YY3 I;  4YHH E;  2V8P A;  1T4N A;  4DV0 I;  4DV3 E;  1BKN A;  1RC7 A;  5AE2 A;  3ZM7 A;  4Z7C A;  1WXR A;  2E1M A;  1KTV A;  1NHH A;  3ADI A;  1B62 A;  2NPF A;  3M6A A;  5LMU I;  4NXM E;  1K47 A;  1Z0G A;  1XNQ E;  2L3J A;  2V8Q B;  4I8O A;  4HAC B;  4DPU A;  2ZIT A;  3ZZ0 A;  2RS6 A;  1N34 I;  2DSY A;  3C4T A;  1T4L B;  2O1V A;  5IT9 Q;  4JI8 E;  2LJH A;  3K85 A;  4K0K E;  3HPZ A;  2UUC E;  4DPT A;  2RS7 A;  1WHQ A;  1ZXM A;  2Z5E A;  4IZJ A;  1N33 I;  2LE2 A;  2HK3 A;  2Z5C A;  4JI1 E;  3T1H E;  1A6F A;  1FWL A;  3HQ1 A;  1X47 A;  2A2C A;  1UEK A;  5GMD A;  2L8T A;  4DV5 E;  1H73 A;  1N36 E;  4M2Z A;  2L2M A;  1FJG I;  3V2U C;  1I94 E;  3LML A;  4FWH A;  2RTX A;  3ADL A;  2CPN A;  4AQY E;  4X8W A;  4GKK E;  2UU9 I;  3JAM Q;  4FWG A;  4DV2 I;  1D6T A;  4ZVI A;  4DV1 I;  2N3G A;  1Z59 A;  2NA2 A;  1XNR E;  2UUA I;  1KKH A;  4P52 A;  4N3O A;  1GQE A;  4IZK B;  1YZ9 A;  4WUC A;  4JI5 I;  2K4V A;  3V5R A;  4DUY E;  3J7A G;  3B78 A;  1ZM3 A;  4DR3 I;  5LL6 R;  1HK7 A;  2UXD E;  1X49 A;  4LF9 E;  1Z5B A;  1NZ0 A;  3FIG A;  4LF8 I;  2NUG A;  1HNW E;  1XMQ E;  4B3S E;  4XTJ A;  4DUZ I;  2FV4 B;  3F6H A;  1UHZ A;  4F9A B;  3HPS A;  5FLX C;  4DR6 I;  1Y6Z A;  1Z0B A;  3OML A;  3J81 C;  1O0W A;  3AUZ A;  4BC9 A;  4TUG A;  3WU4 A;  1H7S A;  1J5E I;  4YHH I;  2Z5B A;  1ZM4 A;  2LUP B;  1N0V C;  2MC5 A;  4DV3 I;  2V89 A;  4X62 E;  2X36 A;  1S16 A;  3WU5 A;  4PU9 A;  2V86 A;  4B3M E;  3MSW A;  3ZKD A;  4NXM I;  3DF6 A;  2IOP A;  1XNQ I;  2ZBK B;  1KVK A;  2DMY A;  2VF3 A;  2X7I A;  1EI1 A;  1PIE A;  2IOQ A;  4IZJ B;  4DR2 E;  1HNZ E;  2F8B A;  2VQE E;  4DMI A;  4OOG C;  2Z5C B;  2FGG A;  2J7K A;  4JI8 I;  4K0K I;  2L6M A;  4BS9 A;  2UUC I;  5LMN E;  4DR4 E;  1Z5A A;  1ZM2 A;  1RQ0 A;  2BM0 A;  2ODR D;  1H7U A;  4JI1 I;  3T1H I;  4DU7 A;  2B7T A;  4DR7 E;  1QU6 A;  2O1W A;  3VYY A;  4B3T E;  4Z7Y A;  2V83 A;  4LFC E;  4X66 E;  4KHP E;  4FN5 A;  4P78 A;  4DV5 I;  1B63 A;  1N36 I;  1N32 E;  2V2Z A;  4JI3 E;  4RPF A;  4EMD A;  1I94 I;  2VF1 A;  1YYO A;  2CZ9 A;  3B82 A;  3AV0 A;  4TUI A;  3WU3 A;  2HKE A;  4AQY I;  1HR0 E;  1FNM A;  4GKK I;  1WHN A;  2EZ6 A;  4KZS A;  1NHJ A;  2M7Q A;  2KON A;  1HNX E;  2H36 X;  4PRX A;  4GKJ E;  3HJC A;  1XNR I;  4GEQ B;  4LU9 A;  4FW9 A;  1X48 A;  4X65 E;  3PYF A;  2UUB E;  3PYG A;  4DUY I;  2V88 A;  2LMZ A;  2UXC E;  2KHX A;  3QT7 A;  1IBK E;  4BCA A;  4USM A;  2UXD I;  4LF9 I;  5IT9 C;  2ZM6 E;  2GQ0 A;  4DV6 E;  5FWK A;  1J26 A;  1XMQ I;  1HNW I;  4DR1 E;  4B3S I;  1ELO A;  3OTO E;  1MG7 A;  1Z0W A;  2Z5B B;  2LTR A;  1VIS A;  2VQF E;  2WW4 A;  2B3T B;  5T6J A;  4LFB E;  1H74 A;  4JI4 E;  3J80 Q;  2FTX B;  1IBM E;  2JOX A;  4WUB A;  3J7A M;  4LFA E;  4WPY A;  2NUF A;  4R8O A;  4PRV A;  1WUU A;  4F9B B;  3P1X A;  4HY1 A;  4X62 I;  4WYQ B;  2F4V E;  2R42 A;  5A2Q Q;  3QT6 A;  1EKZ A;  1FKA E;  4B3M I;  4LF6 E;  4HAC A;  3RMP A;  4DKK A;  3JAM C;  3K17 A;  1PKP A;  3HTX A;  2VE7 C;  4JI2 E;  4DPW A;  3WU6 A;  4DR2 I;  2V87 A;  3VK6 A;  2VQE I;  1HNZ I;  2MC6 A;  1IBL E;  4LTY A;  4DV7 E;  5IWA E;  2KOU A;  3T1Y E;  5L3J A;  4DV4 E;  2O1U A;  5LMN I;  4DR4 I;  3ADG A;  3F6G A;  2BM1 A;  3LNU A;  3B8H A;  4JYA E;  3LLH A;  4URL A;  2UXB E;  1RR9 A;  1ZBQ A;  2L2K B;  2LBS B;  3JU0 A;  4L8N A;  1Z0T A;  4DR7 I;  2L3C A;  1N0U A;  3QT5 A;  4B3T I;  4BBY A;  1Y4U A;  4X66 I;  4KHP I;  3ZKB A;  4WSP A;  3K1J A;  4JV5 E;  1N32 I;  3ADJ A;  4JI3 I;  2WZO A;  3ZZU A;  5F3W A;  5BR8 E;  4B3R E;  1H72 C;  2V2V A;  1USV A;  1HR0 I;  4LF7 E;  3IWC A;  4UTG A;  2PNM A;  2HHH E;  4OX9 E;  2RSM A;  4DXL A;  1HNX I;  4IZK A;  4GKJ I;  2Q2E B;  1Z0V A;  4NXN E;  5GME A;  4X65 I;  4MYU A;  1RRE A;  2V2Q A;  3H09 A;  2UUB I;  3GON A;  4LF4 E;  2UXC I;  4L5N C;  3J7Y p;  1XMO E;  2B9D A;  2JVA A;  1IBK I;  4JI6 E;  4P7A A;  4M30 A;  2EFG A;  2ZM6 I;  4DV6 I;  4MYT A;  2OI2 A;  2N3H A;  4F54 A;  4DR1 I;  4F9C B;  4X64 E;  3OTO I;  4FWD A;  4HXZ A;  4DR5 E;  4Q28 A;  3QT8 A;  5ADZ A;  1MX0 A;  1S4E A;  2VQF I;  4R1F A;  2CGE A;  2M1S A;  4LFB I;  4JI4 I;  4LF5 E;  2EWL A;  3KWR A;  4JI7 E;  3D4J A;  1YYW A;  1IBM I;  3H4L A;  1ZM9 A;  4LFA I;  1STU A;  4JI0 E;  3Q1Q A;  3ZOQ B;  2E5L E;  2F4V I;  4LF6 I;  2JWO A;  3LPS A;  4YY3 E;  2IHR 1;  3Q6N A;  3JTZ A;  4M1K A;  3C4B A;  2LUQ A;  4DV0 E;  4JI2 I;  2YZT A;  1XHK A;  1IBL I;  1ZBT A;  2CG9 A;  4DV7 I;  5IWA I;  3F0N A;  3T1Y I;  5LMU E;  5AAS A;  4KQV A;  4DV4 I;  1UIL A;  2PNL A;  4P7D A;  2LTS A;  2HK2 A;  1SR9 A;  4DPY A;  2M4I A;  4JYA I;  1N34 E;  2UXB I;  2MDR A;  2V34 A;  2AJ4 A;  2JR1 A;  4USK A;  1Z5C A;  4JV5 I;  2A2D A;  3PYD A;  1N33 E;  3Q6M A;  1NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...