1HNWE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnwE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwE02
3F0NA 3H4LA 2UU9E 3HTXA 3ZZTA 2UUBI 4LFCE 1PIEA 2NUFA 4DR2E 2N3GA 3PYEA 2IHR1 4FN5A 2F4VI 4NXNI 3ADGA 2VQEI 4LFAI 2V34A 3D4JA 3J81C 1J5EE 1GQEA 1RREA 2UUCE 4UT4A 4DV6I 1IBKI 1NZ0A 3VYYA 2UXBE 1ZXNA 3K1JA 4DKKA 5A2QC 4DR5I 1MU5A 3T1HE 4M1KA 4JI2E 1I94E 4GKKE 3LLHA 4USMA 1N32E 1H72C 2XEXA 1QZRA 4LF6E 3VYXA 4DR4I 3ADIA 1WHQA 3ADJA 4NXMI 4DV7E 4JI6E 4OOGC 1IBMI 4ED4A 2CZ9A 2V2VA 3QT8A 2LJPA 4JI0I 4AQYE 1FKAE 4JI6I 1HR0E 1KIJA 2HK3A 2DMYA 3B78A 3ZKBA 4DR1E 5IWAE 1XMQE 2L2NA 4DV2I 1Z5CA 2UUBE 1Z0EA 1HNXI 1XMOE 2F4VE 5IT9C 2V2ZA 3J7AM 2VQEE 5LL6R 4DXLA 5LMUE 2GS8A 4LF5I 4LF4E 4LFCI 3LPSA 2JVAA 4DU8A 4NXNE 1B62A 4LFAE 5GMEA 2LUPB 3QT7A 1ZM2A 5BR8I 3GONA 1H7UA 1PVGA 4JYAI 4GKJI 4DR3E 4JI1I 4DR4E 2ZM6E 1YZ9A 4OX9E 2L3CA 4HXZA 1Z0GA 1H74A 4LF6I 1DI2A 2UXDI 4OX9I 4DV5E 3PYFA 4FWGA 4WYQB 4YY3E 2NA2A 4DR7I 1ZM9A 4JI2I 5IT9Q 1IBLI 4DUYE 4DV0I 4JI4I 1HNWI 1XMOI 3JAMQ 1FWKA 3QT6A 1ZBTA 2LTSA 4LF9E 2X36A 4DV2E 4DV7I 4JI8E 4USKA 1N34I 1NHHA 2L2MA 3T1YE 2HKEA 2LRSA 4JI5I 4JI3E 1KKHA 5BR8E 1VISA 4LF8E 3OTOI 3T1YI 4DV1E 1Z0TA 2EFGA 3JAMC 4DUZE 2RTXA 2LUQA 3ZZUA 2R42A 3J7Yp 4PRXA 4K0KE 1XNQE 4X65I 3HULA 3WU3A 2VQFE 1XHKA 1KTVA 4JV5I 4PRVA 1XNRI 1HNZI 2WW4A 3LNUA 2E1RA 3QT5A 5FLXC 5IWAI 4M30A 4HACB 4JV5E 2X7IA 1RR9A 1Z5AA 1Z5BA 3J81Q 3LTOA 1J5EI 4DR3I 1FJGI 3WU4A 1N36E 5LMNE 1A6FA 4P7AA 2HKJA 1WHNA 2UU9I 4B3ME 1I94I 4GKKI 2UUAE 2VF3A 4JI5E 4JI3I 1Z0BA 4JI7E 5L3JA 4LF7I 4B3MI 1WUUA 3J80Q 3J7AG 3J80C 4B3RE 4PU9A 4DV4E 2BM0A 3CWVA 1YYKA 4JI4E 2UXBI 4X66I 4K0KI 2JY9A 2HFUA 1U2RA 4DR5E 4LF9I 3Q1QA 4M2ZA 3V2UC 1S16A 2OI2A 2ZITA 4X66E 1H73A 4DR1I 4X65E 5A2QQ 2ZBKB 1XNQI 2ZM6I 4UTGA 1HNXE 1O0WA 1X47A 2VQFI 4FWDA 1FWLA 4WUCA 2B7TA 4LF5E 1K47A 5LMUI 1FNMA 3B8HA 4DV1I 3PYDA 1XNRE 1RQ0A 2UXDE 2E5LE 1ZM3A 2DB2A 1HR0I 4DPTA 2DEJA 2N3HA 2UUAI 4RPFA 3WU5A 2KHXA 4DR6I 2NUGA 4GKJE 1RC7A 4B3TE 4B3SE 4DV3E 4LFBE 1T4LB 4B3SI 3T1HI 1OJ4A 3ZZ0A 4MYTA 2B3TB 4HACA 1T4NA 5LMNI 3PYGA 2HFSA 2A2CA 4MYUA 1NHIA 3OTOE 4LF8I 4HY1A 4DR7E 2UXCI 2BV3A 4DUZI 1YYWA 3ZM7A 1N0VC 1MX0A 4LF4I 1PKPA 1HNZE 1Z59A 4JI0E 2Q2EB 2NUEA 4YHHI 2AJ4A 4JG4A 1J26A 2HK2A 2J7KA 1X49A 2HHHE 4YHHE 4JYAE 4I3HA 4JI1E 2RSMA 1FI4A 2E5LI 2LJHA 1S4EA 4WUBA 1H7SA 1ZM4A 1IBLE 1FJGE 4DV0E 1HNWE 4DPWA 3M6AA 2YT4A 4DR6E 2BM1A 1N32I 4WFTA 1EA6A 1EKZA 3V5RA 1MG7A 4DR2I 4R1FA 3P1XA 2NPFA 4Z7YA 4ZVIA 1ZXMA 1XMQI 4LF7E 4DUYI 3ADLA 1N33I 4DV6E 1IBKE 4DV4I 4X62E 2L3JA 2RS7A 1ELOA 2LBSB 1YYOA 1B63A 4DU7A 3WU6A 4X64I 4KHPE 1X48A 4X62I 1N34E 4JI8I 2DIXA 1UHZA 1UEKA 4KQVA 5GMDA 2L33A 2L2KB 2R3VA 4X64E 4KHPI 3ZKDA 2UUCI 4NXME 4DPUA 1NHJA 1DARA 1KVKA 2CPNA 4XTJA 1Z0CA 1N0UA 4DPXA 5CFFE 4HYMA 3B82A 1STUA 2MDRA 3C4BA 3C4TA 2UXCE 1QU6A 4B3RI 4P52A 2LTRA 4Z7CA 2V2QA 4EMDA 1D6TA 4FW9A 1N36I 2EZ6A 1T4OA 2DEIA 4DV3I 4LFBI 4DV5I 4URLA 1Z0VA 1UILA 4YY3I 2RS6A 4AQYI 1BKNA 2HHHI 4DPYA 4JI7I 4B3TI 4X8WA 5FLXQ 3K17A 1IBME 1N33E 4WUDA 4FWHA 1EI1A 2V8PA 1Z0WA 2A2DA 2B7VA
chains in the Genus database with same CATH superfamily
1A1JA 2V8QB 2DLQA 4Q35B 5JEAC 1ZR9A 2ENHA 3F0NA 3H4LA 5AE1A 2CG9A 2O1TA 2UU9E 3PS1A 2EPXA 1UBDC 2J65A 3HTXA 5IXMB 2YRMA 1PJTA 1LLMC 3ZZTA 1E3HA 2UUBI 1KJKA 2YU5A 4MLVA 4LFCE 1PIEA 1USVA 2NUFA 4DR2E 2N3GA 3PYEA 2IHR1 4WSGA 2AE8A 4FN5A 2F4VI 4NXNI 3ADGA 3M99B 2VQEI 4LFAI 2V34A 3D4JA 3J81C 5C0XA 1J5EE 1GQEA 2EM3A 1RREA 4BA2A 3Q6MA 5AE2A 2UUCE 4ZYGA 4F6MA 5A6AA 2WBSA 2JXPA 4UT4A 4DV6I 5TSEA 1NZ0A 3OMLA 3VYYA 2UXBE 1ZXNA 1IBKI 3KZYA 4R2CA 3K1JA 4RHBB 4DKKA 4TUIA 3EPLA 5AC4A 3M7ND 2EP3A 5A2QC 4DR5I 2PO1A 1MU5A 4IZJA 3T1HE 4M1KA 4JI2E 2EOIA 2MKDA 1I94E 4GKKE 5K36C 3LLHA 2HGHA 2PO2B 4USMA 2M7QA 4AIDA 5LLQA 2ODRC 1N32E 5F3WA 2L92A 2F8BA 1NEIA 1H72C 2XEXA 2YU8A 1QZRA 4LF6E 3VYXA 4DR4I 3VHTB 3ADIA 5C0XC 3HXLA 1EH7A 1WHQA 3ADJA 2V86A 4NXMI 2BA0D 4DV7E 4JI6E 4OKGA 4OOGC 2EOMA 1IBMI 1ZU1A 3EPKA 2CZ9A 2V2VA 4ED4A 3QT8A 2LJPA 3DJWA 2VESA 4JI0I 4AQYE 1FKAE 4ISAA 2C37B 2ADRA 4JI6I 2R1FA 1HR0E 4RH8A 5DNXA 2KOUA 1KIJA 2HK3A 2DMYA 2JR1A 2V89A 2ELZA 3KRNA 5KL7A 2F1DA 3B78A 2I13A 4J3DA 2EPCA 3ZKBA 2ELYA 2EPOA 4DR1E 5IWAE 1MEYC 3GLLA 2EE8A 1XMQE 1YSAC 2L2NA 3L7ZA 4DV2I 4O4KA 1Z5CA 2UUBE 2EM2A 2LCEA 2YTNA 1Z0EA 2BB8A 2JWOA 1HNXI 2EMZA 1Y4UA 2L6MA 1XMOE 2F4VE 5IT9C 2V2ZA 3J7AM 2YTIA 5LL6R 3BBGA 3H09A 2VQEE 2EM8A 5LMUE 2GS8A 4DXLA 4LF5I 4LF4E 2WP8B 3DD6A 2PO1B 2EPLX 4LFCI 3LPSA 1N34I 2IOPA 2JVAA 4M0VA 4DU8A 4NXNE 2YTDA 1B62A 4LFAE 5GMEA 2LUPB 1A1HA 2K7IA 4OO1F 2GHFA 3QT7A 2YTGA 2YTOA 3IWDA 2EMIA 1UDSA 1ZM2A 2WZOA 3BIDA 3THOB 2V88A 5A6JA 4OO1D 5BR8I 3GONA 2YTFA 1X6FA 2JOXA 3M7NG 3THNA 1H7UA 1PVGA 2EL4A 2YSPA 4GKJI 4JYAI 4DR3E 4OO1C 4JI1I 4DR4E 2IOQA 2ZM6E 4GZNC 2PO2A 2YTQA 2EMCA 2EN2A 1YZ9A 4IZKB 4OX9E 2L3CA 1RHYA 4HXZA 1JK2A 3P3GA 1Z0GA 4KWYA 4R2RA 3F6HA 1H74A 4LF6I 5IV8B 1F2IG 1DI2A 1X6EA 4AIMA 2UXDI 4OX9I 4DV5E 4FK5C 3PYFA 1Y5YA 4FWGA 4FW5A 4R2AA 1EH8A 2FTXB 2EMYA 2EOHA 2E1MA 4BC9A 4WYQB 4YY3E 2DGCA 4F54A 2HC5A 2NA2A 1N3GA 4DR7I 2EN3A 1ZM9A 5FWKA 4JI2I 3L7ZB 2NN6D 5IT9Q 5DROA 1IBLI 3PRYA 4DUYE 4DV0I 4JI4I 1HNWI 4QNKA 1PJSA 1XMOI 4IFDE 2Z5EA 2EMLA 3JAMQ 1FWKA 3QT6A 1ZBTA 2LTSA 1Y60A 4LF9E 2X36A 4DV2E 4DV7I 4FW3A 2VF1A 2YSOA 1WXRA 2GLIA 3UHMA 3NZKA 1X3CA 2EJ4A 4JI8E 1X6HA 5DNYA 2LMZA 3BGHA 2L2MA 2MKNA 3AV0A 1NHHA 3C6KA 3T1YE 2HKEA 5DRPA 2LRSA 2PRTA 4USKA 4JI5I 4JI3E 1KKHA 4BA1B 2RQLA 2EOJA 2EPAA 2LE2A 3K6QA 4NZVA 2JP9A 2RPCA 5BR8E 1VISA 4P7DA 1IQOA 4N3OA 4LF8E 3OTOI 3T1YI 5DNLA 2EM6A 4J8ZA 4DV1E 4MU3A 4R2SA 1Z0TA 3JAMC 2EFGA 1RMDA 2BBGA 4DUZE 2RTXA 2DLKA 4IFDD 2LUQA 2JE6A 3ZZUA 4BS9A 2R42A 2EMWA 3PS2A 3J7Yp 2YZTA 1IQSA 4PRXA 4M9VC 4K0KE 1XNQE 4X65I 4BBYA 3HULA 4U3BA 2CTDA 4U3DA 4GEQB 3WU3A 3MHHC 2VQFE 2PNLA 2Z5BB 2YTEA 2EOSA 1XHKA 4IFDA 1ZBQA 1KTVA 1YHCA 4JV5I 3EPJA 4PRVA 2EMBA 1XNRI 5KL5A 1HNZI 2WW4A 2PNZA 2RSIA 1Y4SA 3LNUA 2EOQA 2E1RA 1SR9A 3QT5A 5K36B 3AUZA 5FLXC 4M30A 2DSYA 1MGTA 4WXCA 2MDGA 4HACB 5IWAI 4JV5E 3LMLA 4BC7A 2BA0G 2X7IA 1RR9A 1Z5AA 1Z5BA 4BMJA 1YUIA 3LTOA 1PDAA 4FW4A 3J81Q 1J5EI 2EM9A 4DR3I 1FJGI 3WU4A 2EPKX 1N36E 2EMKA 5LMNE 1A6FA 4P7AA 2HKJA 2EN7A 4LCGA 4N4RB 1WHNA 5A6KA 1TF3A 4F9AB 2EQ3A 1UN6B 2M4IA 1XXEA 1UDOA 2UU9I 1AH5A 4B3ME 1I94I 4GKKI 2EOYA 2UUAE 2VF3A 2Q8UA 4JI5E 4NBQA 4JI3I 4LTYA 2EPUA 1Z0BA 1QNTA 4JI7E 2JEAA 2IERA 2N8XA 3JU0A 2H36X 5L3JA 4LF7I 4B3MI 1WUUA 3H1CA 2EPRA 4R2PA 3J80Q 2JEAB 3J7AG 4WX9A 3J80C 1A1KA 2JPAA 4B3RE 3GCMA 4PU9A 4DV4E 4BA1A 2NABA 1G2FC 2EM0A 2BM0A 5K36A 3CWVA 1YYKA 5JEAF 3QG5C 5K36D 4JI4E 5JEAD 2UXBI 5C0XE 4X66I 2PO0B 4OO1A 4K0KI 2EN6A 2JY9A 1A1IA 2HFUA 2A25A 2WNRB 1U2RA 4DR5E 2GQ0A 4LF9I 3Q1QA 4M2ZA 2MC6A 2EOFA 1S16A 3HPSA 4X9JA 1P42A 2IESA 2KONA 2O1WA 4MU1A 1TN9A 2OI2A 5AC5A 2CSHA 4X66E 1H73A 2ZITA 4DR1I 4L5NC 2VRDA 3C6MA 4MU0A 4IS1C 2YPNA 4X65E 5A2QQ 2ZBKB 1XNQI 2ZM6I 2CGEA 2GO3A 4UTGA 1PJQA 1TF6A 4IZKA 1HNXE 2PNZB 5JEAB 1O0WA 1X47A 2CVEA 4WXDA 2NN6C 5C0XF 4FWDA 2VQFI 4OO1B 1YPNA 3BF2A 1FWLA 2PO0A 3P3EA 2WBTA 2C39B 4BCAA 1YH8A 2B7TA 4LF5E 1K47A 2EMAA 1FNMA 3B8HA 4WUCA 5LMUI 4DV1I 3PYDA 1XNRE 1RQ0A 2UXDE 3P3CA 4IJDA 2E5LE 5K36F 3JTZA 1ZM3A 3K85A 2NN6F 4TUGA 5JEAE 3M85D 2DB2A 5K36E 1E3PA 1HR0I 1YFHA 2FV4B 2FGGA 4LPFA 1AAYA 4DPTA 1JK1A 3HKMA 4F2JC 3VK6A 3P06A 3CDJA 3IWBA 3Q6NA 4BHCA 2DEJA 2N3HA 2PNMA 1USUA 2EQ0A 2MC5A 2UUAI 2E72A 4RPFA 1X5WA 2EPNA 3WU5A 1DGCA 4MDTA 5EL9A 3ZOQB 2KHXA 4LU9A 2EOZA 2VE7C 5AASA 2YTPA 2NUGA 3V2UC 4DR6I 4GKJE 1RC7A 4B3TE 5ELWA 4AM3A 4B3SE 1WRJA 4MU4A 2O1VA 4Q28A 4DV3E 2LT7A 4LFBE 4LCHA 1T4LB 2M9AA 4WPYA 5KL3A 2EQ1A 1BB8A 4B3SI 3T1HI 1L4SA 1OJ4A 3GMEA 1BBOA 3ZZ0A 3UK3C 3L00A 4MYTA 2B3TB 4HACA 4R8OA 5ADZA 1T4NA 2EMFA 5LMNI 2BA1G 3RMPA 4IZJB 2G7HA 3PYGA 2HFSA 2EPMX 3ECRA 2WBUA 1VI7A 2A2CA 4MYUA 1NHIA 3OTOE 4LF8I 2ENCA 5KL4A 4HY1A 4DR7E 2JT2A 1T39A 2UXCI 3DF6A 2BV3A 4WSPA 4DUZI 1YYWA 3ZM7A 1N0VC 2Z5BA 1MX0A 4LF4I 5C0XB 1PKPA 2CT1A 1HNZE 1Z59A 4JI0E 4R03A 4F9CB 2EPZA 1Y6ZA 2EMGA 2HJJA 1A1GA 4IZJD 5T6JA 5DRRA 2D9HA 2Q2EB 2NUEA 2ENAA 2JE6B 4YHHI 2AJ4A 1J26A 2LO3A 1OYPA 3P76A 2HK2A 2J7KA 4JG4A 2LV2A 1YUJA 3MSWA 1X49A 2HHHE 4QNJA 5A6BA 2DMIA 2YRHA 4P78A 4L8NA 4YHHE 2YWQA 4JYAE 4I3HA 2EN4A 3CDIA 4LOMA 2B9DA 4JI1E 2RSMA 4O24A 1OYRA 1FI4A 2I9IA 2V87A 2E5LI 1P47A 5KL2A 2LJHA 1GZ6A 2J7JA 2GPIA 1S4EA 4WUBA 1H7SA 4R2DA 1ZM4A 4BA2B 1IBLE 1FJGE 4DV0E 1HNWE 2C39A 2V85A 2R76A 4DPWA 1ZAAC 3HPZA 2EOEA 3M6AA 5A69A 2YT4A 4DR6E 4ZYDA 1UDNA 4F6NA 2BM1A 1N32I 4WFTA 1EA6A 1EKZA 3V5RA 4ZYHA 1MG7A 3MHSC 4DR2I 2O3ZA 3EPHA 1Z1BA 4R1FA 3P1XA 4MLQA 3IWCA 2NPFA 2WP8A 4NHRA 4Z7YA 3F6GA 2EM7A 2K4VA 4ZVIA 1ZXMA 4BHBA 1EH6A 4LF7E 1XMQI 2L8TA 2JEBB 4FW7A 3ADLA 4DUYI 1N33I 4DV6E 1IBKE 4IFDB 2NN6B 1WJPA 3KWRA 4DV4I 4X62E 2L3JA 2RS7A 5C0XD 1ELOA 4ZYEA 2EN1A 3FIGA 2LBSB 4HTGA 1YYOA 1B63A 4DU7A 2EMXA 3WU6A 4X64I 4KHPE 4HEIA 2EOOA 3KZZA 1X48A 4X62I 1N34E 4JI8I 2DIXA 1UHZA 4FW6A 1UEKA 4KQVA 2C38B 5GMDA 2JEBA 2L33A 2L2KB 2R3VA 4X64E 2EPPA 4KHPI 3ZKDA 2EORA 4NXME 2UUCI 4DPUA 1UDQA 2EM5A 1NHJA 2LVHA 4IFDF 1R6LA 1G2DC 5KL6A 1B69A 1HK7A 4MQYA 2NN6E 3PS3A 1DARA 3EQ1A 4I8OA 2CPNA 2EN8A 1KVKA 2Z5CB 4XTJA 1A1FA 1Z0CA 1T38A 1N0UA 4DPXA 4O5GA 5CFFE 4HYMA 2EL5A 3B82A 2EOXA 5A6BD 4KZSA 4OO1E 1STUA 2MDRA 4IFDC 3C4BA 3C4TA 2UXCE 2V83A 1QU6A 4B3RI 2EL6A 4P52A 2LTRA 4F9BB 2WCC3 2Z5CA 3B4TA 2V2QA 4Z7CA 3HJCA 2JOBA 4EMDA 2BR2A 4DMIA 1D6TA 4FW9A 1N36I 2EZ6A 1T4OA 4LCFA 2DEIA 4DV3I 2DRPA 4LFBI 4GQUA 3HQ1A 4O43A 1SFEA 1IMUA 2BR2B 1R6MA 2LJUA 4OZEA 1BBGA 4DV5I 4R2EA 4URLA 1Z0VA 1UILA 5DRQA 4YY3I 2RS6A 2EM4A 4AQYI 1BKNA 4R2QA 1OYSA 3M85G 5EKWA 2WNRA 2JYAA 3U1KA 2O1UA 2HHHI 4DPYA 4JI7I 1A1LA 4X8WA 4IS9A 5FLXQ 4B3TI 2EWLA 3K17A 2YRKA 1IBME 1N33E 2BA1D 4WUDA 5AE3A 1NCSA 3TQMA 4FWHA 2NN6A 2ODRD 1KYQA 2GO4A 2EMHA 1DQ3A 1EI1A 2V8PA 2YTJA 3U1YA 2C37A 1Z0WA 1GTKA 2C38A 2M1SA 2A2DA 2B7VA 5JEAA
chains in the Genus database with same CATH topology
2V8QB 3F0NA 3H4LA 5AE1A 2CG9A 2O1TA 2UU9E 3HTXA 3ZZTA 2UUBI 4LFCE 1PIEA 1USVA 2NUFA 4DR2E 2N3GA 3PYEA 2IHR1 4FN5A 2F4VI 4NXNI 3ADGA 2VQEI 4LFAI 2V34A 3D4JA 3J81C 1J5EE 1GQEA 1RREA 3Q6MA 5AE2A 2UUCE 4UT4A 4DV6I 1IBKI 1NZ0A 3OMLA 3VYYA 2UXBE 1ZXNA 3K1JA 4DKKA 4TUIA 5A2QC 4DR5I 1MU5A 4IZJA 3T1HE 4M1KA 4JI2E 1I94E 4GKKE 3LLHA 4USMA 2M7QA 2ODRC 1N32E 1H72C 2L92A 2F8BA 5F3WA 2XEXA 1QZRA 4LF6E 3VYXA 4DR4I 3ADIA 3HXLA 1WHQA 3ADJA 4NXMI 2V86A 4DV7E 4JI6E 4OOGC 1IBMI 4ED4A 2CZ9A 2V2VA 3QT8A 2LJPA 3DJWA 4JI0I 4AQYE 1FKAE 4JI6I 1HR0E 2KOUA 1KIJA 2HK3A 2DMYA 2JR1A 2V89A 3B78A 3ZKBA 4DR1E 5IWAE 1XMQE 2L2NA 4DV2I 1Z5CA 2UUBE 1Z0EA 2JWOA 1HNXI 1Y4UA 2L6MA 1XMOE 2F4VE 5IT9C 2V2ZA 3J7AM 5LL6R 2VQEE 3H09A 4DXLA 5LMUE 2GS8A 4LF5I 4LF4E 4LFCI 3LPSA 2IOPA 2JVAA 4M0VA 4DU8A 4NXNE 1B62A 4LFAE 5GMEA 2LUPB 3QT7A 3IWDA 1ZM2A 2WZOA 2V88A 5BR8I 3GONA 2JOXA 1H7UA 1PVGA 4JYAI 4GKJI 4DR3E 4JI1I 4DR4E 2IOQA 2ZM6E 1YZ9A 4IZKB 4OX9E 2L3CA 4HXZA 1Z0GA 3F6HA 1H74A 4LF6I 1DI2A 2UXDI 4OX9I 4DV5E 3PYFA 4FWGA 2FTXB 2E1MA 4BC9A 4WYQB 4YY3E 4F54A 2NA2A 4DR7I 1ZM9A 5FWKA 4JI2I 5IT9Q 1IBLI 3PRYA 4DUYE 4DV0I 4JI4I 1HNWI 1XMOI 2Z5EA 3JAMQ 1FWKA 3QT6A 1ZBTA 2LTSA 4LF9E 2X36A 4DV2E 4DV7I 2VF1A 1WXRA 4JI8E 4USKA 5DNYA 1N34I 1NHHA 2LMZA 2L2MA 3AV0A 3T1YE 2HKEA 2LRSA 4JI5I 4JI3E 1KKHA 2LE2A 3K6QA 5BR8E 1VISA 4P7DA 4N3OA 4LF8E 3OTOI 3T1YI 4J8ZA 4DV1E 1Z0TA 3JAMC 2EFGA 4DUZE 2RTXA 2LUQA 3ZZUA 4BS9A 2R42A 3J7Yp 2YZTA 4PRXA 4K0KE 1XNQE 4X65I 4BBYA 3HULA 4GEQB 3WU3A 2VQFE 2PNLA 2Z5BB 1XHKA 1ZBQA 1KTVA 4JV5I 4PRVA 1XNRI 1HNZI 2WW4A 1Y4SA 3LNUA 2E1RA 1SR9A 3QT5A 3AUZA 5FLXC 2DSYA 4M30A 5IWAI 4HACB 4JV5E 3LMLA 4BC7A 2X7IA 1RR9A 1Z5AA 1Z5BA 4BMJA 3J81Q 3LTOA 1J5EI 4DR3I 1FJGI 3WU4A 1N36E 5LMNE 1A6FA 4P7AA 2HKJA 1WHNA 4F9AB 2M4IA 2UU9I 4B3ME 1I94I 4GKKI 2UUAE 2VF3A 4JI5E 4JI3I 4LTYA 1Z0BA 4JI7E 3JU0A 2H36X 5L3JA 4LF7I 4B3MI 1WUUA 3J80Q 3J7AG 3J80C 4B3RE 4PU9A 4DV4E 2BM0A 3CWVA 1YYKA 4JI4E 2UXBI 4X66I 4K0KI 2JY9A 2HFUA 1U2RA 4DR5E 2GQ0A 4LF9I 3Q1QA 4M2ZA 2MC6A 1S16A 3V2UC 3HPSA 2KONA 2O1WA 2OI2A 2ZITA 4X66E 1H73A 4DR1I 4L5NC 4X65E 5A2QQ 2ZBKB 1XNQI 2ZM6I 2CGEA 4UTGA 4IZKA 1HNXE 1O0WA 1X47A 2VQFI 4FWDA 1FWLA 4BCAA 4WUCA 2B7TA 4LF5E 1K47A 5LMUI 1FNMA 3B8HA 4DV1I 3PYDA 1XNRE 1RQ0A 2UXDE 2E5LE 3JTZA 1ZM3A 3K85A 4TUGA 2DB2A 1HR0I 2FV4B 2FGGA 4DPTA 3VK6A 3P06A 3IWBA 3Q6NA 2DEJA 2N3HA 2PNMA 1USUA 2MC5A 2UUAI 4RPFA 3WU5A 2KHXA 3ZOQB 4LU9A 4DR6I 2VE7C 5AASA 2NUGA 4GKJE 1RC7A 4B3TE 4B3SE 2O1VA 4Q28A 4DV3E 4LFBE 1T4LB 4WPYA 4B3SI 3T1HI 1OJ4A 3ZZ0A 4MYTA 2B3TB 4HACA 4R8OA 5ADZA 1T4NA 5LMNI 4IZJB 3RMPA 2G7HA 3PYGA 2HFSA 2A2CA 4MYUA 1NHIA 3OTOE 4LF8I 4HY1A 4DR7E 2UXCI 3DF6A 2BV3A 4WSPA 4DUZI 1YYWA 3ZM7A 1N0VC 2Z5BA 1MX0A 4LF4I 1PKPA 1HNZE 1Z59A 4JI0E 4R03A 4F9CB 1Y6ZA 4IZJD 5T6JA 2Q2EB 2NUEA 4YHHI 2AJ4A 1J26A 4JG4A 2HK2A 2J7KA 3MSWA 1X49A 2HHHE 4P78A 4L8NA 4YHHE 4JYAE 4I3HA 2B9DA 4JI1E 2RSMA 1FI4A 2E5LI 2V87A 2LJHA 1GZ6A 1S4EA 4WUBA 1H7SA 1ZM4A 1IBLE 1FJGE 4DV0E 1HNWE 2V85A 4DPWA 3HPZA 3M6AA 2YT4A 4DR6E 2BM1A 1N32I 4WFTA 1EA6A 1EKZA 3V5RA 1MG7A 4DR2I 4R1FA 3P1XA 3IWCA 2NPFA 4Z7YA 3F6GA 2K4VA 4ZVIA 1ZXMA 1XMQI 4LF7E 2L8TA 4DUYI 3ADLA 1N33I 4DV6E 1IBKE 3KWRA 4DV4I 4X62E 2L3JA 2RS7A 1ELOA 3FIGA 2LBSB 1YYOA 1B63A 4DU7A 3WU6A 4X64I 4KHPE 1X48A 4X62I 1N34E 4JI8I 2DIXA 1UHZA 1UEKA 4KQVA 5GMDA 2L33A 2L2KB 2R3VA 4X64E 4KHPI 3ZKDA 2UUCI 4NXME 4DPUA 1NHJA 1HK7A 1DARA 4I8OA 1KVKA 2CPNA 2Z5CB 4XTJA 1Z0CA 1N0UA 4DPXA 5CFFE 4HYMA 3B82A 4KZSA 1STUA 2MDRA 3C4BA 3C4TA 2UXCE 2V83A 1QU6A 4B3RI 4P52A 2LTRA 4F9BB 2Z5CA 4Z7CA 2V2QA 3HJCA 2JOBA 4EMDA 4DMIA 1D6TA 4FW9A 1N36I 2EZ6A 1T4OA 2DEIA 4DV3I 4LFBI 3HQ1A 4DV5I 4URLA 1Z0VA 1UILA 4YY3I 2RS6A 4AQYI 1BKNA 2O1UA 2HHHI 4DPYA 4JI7I 4B3TI 4X8WA 5FLXQ 2EWLA 3K17A 1IBME 1N33E 4WUDA 5AE3A 4FWHA 2ODRD 1DQ3A 1EI1A 2V8PA 1Z0WA 2M1SA 2A2DA 2B7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0N A;  3H4L A;  2UU9 E;  3HTX A;  3ZZT A;  2UUB I;  4LFC E;  1PIE A;  2NUF A;  4DR2 E;  2N3G A;  3PYE A;  2IHR 1;  4FN5 A;  2F4V I;  4NXN I;  3ADG A;  2VQE I;  4LFA I;  2V34 A;  3D4J A;  3J81 C;  1J5E E;  1GQE A;  1RRE A;  2UUC E;  4UT4 A;  4DV6 I;  1IBK I;  1NZ0 A;  3VYY A;  2UXB E;  1ZXN A;  3K1J A;  4DKK A;  5A2Q C;  4DR5 I;  1MU5 A;  3T1H E;  4M1K A;  4JI2 E;  1I94 E;  4GKK E;  3LLH A;  4USM A;  1N32 E;  1H72 C;  2XEX A;  1QZR A;  4LF6 E;  3VYX A;  4DR4 I;  3ADI A;  1WHQ A;  3ADJ A;  4NXM I;  4DV7 E;  4JI6 E;  4OOG C;  1IBM I;  4ED4 A;  2CZ9 A;  2V2V A;  3QT8 A;  2LJP A;  4JI0 I;  4AQY E;  1FKA E;  4JI6 I;  1HR0 E;  1KIJ A;  2HK3 A;  2DMY A;  3B78 A;  3ZKB A;  4DR1 E;  5IWA E;  1XMQ E;  2L2N A;  4DV2 I;  1Z5C A;  2UUB E;  1Z0E A;  1HNX I;  1XMO E;  2F4V E;  5IT9 C;  2V2Z A;  3J7A M;  2VQE E;  5LL6 R;  4DXL A;  5LMU E;  2GS8 A;  4LF5 I;  4LF4 E;  4LFC I;  3LPS A;  2JVA A;  4DU8 A;  4NXN E;  1B62 A;  4LFA E;  5GME A;  2LUP B;  3QT7 A;  1ZM2 A;  5BR8 I;  3GON A;  1H7U A;  1PVG A;  4JYA I;  4GKJ I;  4DR3 E;  4JI1 I;  4DR4 E;  2ZM6 E;  1YZ9 A;  4OX9 E;  2L3C A;  4HXZ A;  1Z0G A;  1H74 A;  4LF6 I;  1DI2 A;  2UXD I;  4OX9 I;  4DV5 E;  3PYF A;  4FWG A;  4WYQ B;  4YY3 E;  2NA2 A;  4DR7 I;  1ZM9 A;  4JI2 I;  5IT9 Q;  1IBL I;  4DUY E;  4DV0 I;  4JI4 I;  1HNW I;  1XMO I;  3JAM Q;  1FWK A;  3QT6 A;  1ZBT A;  2LTS A;  4LF9 E;  2X36 A;  4DV2 E;  4DV7 I;  4JI8 E;  4USK A;  1N34 I;  1NHH A;  2L2M A;  3T1Y E;  2HKE A;  2LRS A;  4JI5 I;  4JI3 E;  1KKH A;  5BR8 E;  1VIS A;  4LF8 E;  3OTO I;  3T1Y I;  4DV1 E;  1Z0T A;  2EFG A;  3JAM C;  4DUZ E;  2RTX A;  2LUQ A;  3ZZU A;  2R42 A;  3J7Y p;  4PRX A;  4K0K E;  1XNQ E;  4X65 I;  3HUL A;  3WU3 A;  2VQF E;  1XHK A;  1KTV A;  4JV5 I;  4PRV A;  1XNR I;  1HNZ I;  2WW4 A;  3LNU A;  2E1R A;  3QT5 A;  5FLX C;  5IWA I;  4M30 A;  4HAC B;  4JV5 E;  2X7I A;  1RR9 A;  1Z5A A;  1Z5B A;  3J81 Q;  3LTO A;  1J5E I;  4DR3 I;  1FJG I;  3WU4 A;  1N36 E;  5LMN E;  1A6F A;  4P7A A;  2HKJ A;  1WHN A;  2UU9 I;  4B3M E;  1I94 I;  4GKK I;  2UUA E;  2VF3 A;  4JI5 E;  4JI3 I;  1Z0B A;  4JI7 E;  5L3J A;  4LF7 I;  4B3M I;  1WUU A;  3J80 Q;  3J7A G;  3J80 C;  4B3R E;  4PU9 A;  4DV4 E;  2BM0 A;  3CWV A;  1YYK A;  4JI4 E;  2UXB I;  4X66 I;  4K0K I;  2JY9 A;  2HFU A;  1U2R A;  4DR5 E;  4LF9 I;  3Q1Q A;  4M2Z A;  3V2U C;  1S16 A;  2OI2 A;  2ZIT A;  4X66 E;  1H73 A;  4DR1 I;  4X65 E;  5A2Q Q;  2ZBK B;  1XNQ I;  2ZM6 I;  4UTG A;  1HNX E;  1O0W A;  1X47 A;  2VQF I;  4FWD A;  1FWL A;  4WUC A;  2B7T A;  4LF5 E;  1K47 A;  5LMU I;  1FNM A;  3B8H A;  4DV1 I;  3PYD A;  1XNR E;  1RQ0 A;  2UXD E;  2E5L E;  1ZM3 A;  2DB2 A;  1HR0 I;  4DPT A;  2DEJ A;  2N3H A;  2UUA I;  4RPF A;  3WU5 A;  2KHX A;  4DR6 I;  2NUG A;  4GKJ E;  1RC7 A;  4B3T E;  4B3S E;  4DV3 E;  4LFB E;  1T4L B;  4B3S I;  3T1H I;  1OJ4 A;  3ZZ0 A;  4MYT A;  2B3T B;  4HAC A;  1T4N A;  5LMN I;  3PYG A;  2HFS A;  2A2C A;  4MYU A;  1NHI A;  3OTO E;  4LF8 I;  4HY1 A;  4DR7 E;  2UXC I;  2BV3 A;  4DUZ I;  1YYW A;  3ZM7 A;  1N0V C;  1MX0 A;  4LF4 I;  1PKP A;  1HNZ E;  1Z59 A;  4JI0 E;  2Q2E B;  2NUE A;  4YHH I;  2AJ4 A;  4JG4 A;  1J26 A;  2HK2 A;  2J7K A;  1X49 A;  2HHH E;  4YHH E;  4JYA E;  4I3H A;  4JI1 E;  2RSM A;  1FI4 A;  2E5L I;  2LJH A;  1S4E A;  4WUB A;  1H7S A;  1ZM4 A;  1IBL E;  1FJG E;  4DV0 E;  1HNW E;  4DPW A;  3M6A A;  2YT4 A;  4DR6 E;  2BM1 A;  1N32 I;  4WFT A;  1EA6 A;  1EKZ A;  3V5R A;  1MG7 A;  4DR2 I;  4R1F A;  3P1X A;  2NPF A;  4Z7Y A;  4ZVI A;  1ZXM A;  1XMQ I;  4LF7 E;  4DUY I;  3ADL A;  1N33 I;  4DV6 E;  1IBK E;  4DV4 I;  4X62 E;  2L3J A;  2RS7 A;  1ELO A;  2LBS B;  1YYO A;  1B63 A;  4DU7 A;  3WU6 A;  4X64 I;  4KHP E;  1X48 A;  4X62 I;  1N34 E;  4JI8 I;  2DIX A;  1UHZ A;  1UEK A;  4KQV A;  5GMD A;  2L33 A;  2L2K B;  2R3V A;  4X64 E;  4KHP I;  3ZKD A;  2UUC I;  4NXM E;  4DPU A;  1NHJ A;  1DAR A;  1KVK A;  2CPN A;  4XTJ A;  1Z0C A;  1N0U A;  4DPX A;  5CFF E;  4HYM A;  3B82 A;  1STU A;  2MDR A;  3C4B A;  3C4T A;  2UXC E;  1QU6 A;  4B3R I;  4P52 A;  2LTR A;  4Z7C A;  2V2Q A;  4EMD A;  1D6T A;  4FW9 A;  1N36 I;  2EZ6 A;  1T4O A;  2DEI A;  4DV3 I;  4LFB I;  4DV5 I;  4URL A;  1Z0V A;  1UIL A;  4YY3 I;  2RS6 A;  4AQY I;  1BKN A;  2HHH I;  4DPY A;  4JI7 I;  4B3T I;  4X8W A;  5FLX Q;  3K17 A;  1IBM E;  1N33 E;  4WUD A;  4FWH A;  1EI1 A;  2V8P A;  1Z0W A;  2A2D A;  2B7V A; 
#chains in the Genus database with same CATH topology
 1A1J A;  2V8Q B;  2DLQ A;  4Q35 B;  5JEA C;  1ZR9 A;  2ENH A;  3F0N A;  3H4L A;  5AE1 A;  2CG9 A;  2O1T A;  2UU9 E;  3PS1 A;  2EPX A;  1UBD C;  2J65 A;  3HTX A;  5IXM B;  2YRM A;  1PJT A;  1LLM C;  3ZZT A;  1E3H A;  2UUB I;  1KJK A;  2YU5 A;  4MLV A;  4LFC E;  1PIE A;  1USV A;  2NUF A;  4DR2 E;  2N3G A;  3PYE A;  2IHR 1;  4WSG A;  2AE8 A;  4FN5 A;  2F4V I;  4NXN I;  3ADG A;  3M99 B;  2VQE I;  4LFA I;  2V34 A;  3D4J A;  3J81 C;  5C0X A;  1J5E E;  1GQE A;  2EM3 A;  1RRE A;  4BA2 A;  3Q6M A;  5AE2 A;  2UUC E;  4ZYG A;  4F6M A;  5A6A A;  2WBS A;  2JXP A;  4UT4 A;  4DV6 I;  5TSE A;  1NZ0 A;  3OML A;  3VYY A;  2UXB E;  1ZXN A;  1IBK I;  3KZY A;  4R2C A;  3K1J A;  4RHB B;  4DKK A;  4TUI A;  3EPL A;  5AC4 A;  3M7N D;  2EP3 A;  5A2Q C;  4DR5 I;  2PO1 A;  1MU5 A;  4IZJ A;  3T1H E;  4M1K A;  4JI2 E;  2EOI A;  2MKD A;  1I94 E;  4GKK E;  5K36 C;  3LLH A;  2HGH A;  2PO2 B;  4USM A;  2M7Q A;  4AID A;  5LLQ A;  2ODR C;  1N32 E;  5F3W A;  2L92 A;  2F8B A;  1NEI A;  1H72 C;  2XEX A;  2YU8 A;  1QZR A;  4LF6 E;  3VYX A;  4DR4 I;  3VHT B;  3ADI A;  5C0X C;  3HXL A;  1EH7 A;  1WHQ A;  3ADJ A;  2V86 A;  4NXM I;  2BA0 D;  4DV7 E;  4JI6 E;  4OKG A;  4OOG C;  2EOM A;  1IBM I;  1ZU1 A;  3EPK A;  2CZ9 A;  2V2V A;  4ED4 A;  3QT8 A;  2LJP A;  3DJW A;  2VES A;  4JI0 I;  4AQY E;  1FKA E;  4ISA A;  2C37 B;  2ADR A;  4JI6 I;  2R1F A;  1HR0 E;  4RH8 A;  5DNX A;  2KOU A;  1KIJ A;  2HK3 A;  2DMY A;  2JR1 A;  2V89 A;  2ELZ A;  3KRN A;  5KL7 A;  2F1D A;  3B78 A;  2I13 A;  4J3D A;  2EPC A;  3ZKB A;  2ELY A;  2EPO A;  4DR1 E;  5IWA E;  1MEY C;  3GLL A;  2EE8 A;  1XMQ E;  1YSA C;  2L2N A;  3L7Z A;  4DV2 I;  4O4K A;  1Z5C A;  2UUB E;  2EM2 A;  2LCE A;  2YTN A;  1Z0E A;  2BB8 A;  2JWO A;  1HNX I;  2EMZ A;  1Y4U A;  2L6M A;  1XMO E;  2F4V E;  5IT9 C;  2V2Z A;  3J7A M;  2YTI A;  5LL6 R;  3BBG A;  3H09 A;  2VQE E;  2EM8 A;  5LMU E;  2GS8 A;  4DXL A;  4LF5 I;  4LF4 E;  2WP8 B;  3DD6 A;  2PO1 B;  2EPL X;  4LFC I;  3LPS A;  1N34 I;  2IOP A;  2JVA A;  4M0V A;  4DU8 A;  4NXN E;  2YTD A;  1B62 A;  4LFA E;  5GME A;  2LUP B;  1A1H A;  2K7I A;  4OO1 F;  2GHF A;  3QT7 A;  2YTG A;  2YTO A;  3IWD A;  2EMI A;  1UDS A;  1ZM2 A;  2WZO A;  3BID A;  3THO B;  2V88 A;  5A6J A;  4OO1 D;  5BR8 I;  3GON A;  2YTF A;  1X6F A;  2JOX A;  3M7N G;  3THN A;  1H7U A;  1PVG A;  2EL4 A;  2YSP A;  4GKJ I;  4JYA I;  4DR3 E;  4OO1 C;  4JI1 I;  4DR4 E;  2IOQ A;  2ZM6 E;  4GZN C;  2PO2 A;  2YTQ A;  2EMC A;  2EN2 A;  1YZ9 A;  4IZK B;  4OX9 E;  2L3C A;  1RHY A;  4HXZ A;  1JK2 A;  3P3G A;  1Z0G A;  4KWY A;  4R2R A;  3F6H A;  1H74 A;  4LF6 I;  5IV8 B;  1F2I G;  1DI2 A;  1X6E A;  4AIM A;  2UXD I;  4OX9 I;  4DV5 E;  4FK5 C;  3PYF A;  1Y5Y A;  4FWG A;  4FW5 A;  4R2A A;  1EH8 A;  2FTX B;  2EMY A;  2EOH A;  2E1M A;  4BC9 A;  4WYQ B;  4YY3 E;  2DGC A;  4F54 A;  2HC5 A;  2NA2 A;  1N3G A;  4DR7 I;  2EN3 A;  1ZM9 A;  5FWK A;  4JI2 I;  3L7Z B;  2NN6 D;  5IT9 Q;  5DRO A;  1IBL I;  3PRY A;  4DUY E;  4DV0 I;  4JI4 I;  1HNW I;  4QNK A;  1PJS A;  1XMO I;  4IFD E;  2Z5E A;  2EML A;  3JAM Q;  1FWK A;  3QT6 A;  1ZBT A;  2LTS A;  1Y60 A;  4LF9 E;  2X36 A;  4DV2 E;  4DV7 I;  4FW3 A;  2VF1 A;  2YSO A;  1WXR A;  2GLI A;  3UHM A;  3NZK A;  1X3C A;  2EJ4 A;  4JI8 E;  1X6H A;  5DNY A;  2LMZ A;  3BGH A;  2L2M A;  2MKN A;  3AV0 A;  1NHH A;  3C6K A;  3T1Y E;  2HKE A;  5DRP A;  2LRS A;  2PRT A;  4USK A;  4JI5 I;  4JI3 E;  1KKH A;  4BA1 B;  2RQL A;  2EOJ A;  2EPA A;  2LE2 A;  3K6Q A;  4NZV A;  2JP9 A;  2RPC A;  5BR8 E;  1VIS A;  4P7D A;  1IQO A;  4N3O A;  4LF8 E;  3OTO I;  3T1Y I;  5DNL A;  2EM6 A;  4J8Z A;  4DV1 E;  4MU3 A;  4R2S A;  1Z0T A;  3JAM C;  2EFG A;  1RMD A;  2BBG A;  4DUZ E;  2RTX A;  2DLK A;  4IFD D;  2LUQ A;  2JE6 A;  3ZZU A;  4BS9 A;  2R42 A;  2EMW A;  3PS2 A;  3J7Y p;  2YZT A;  1IQS A;  4PRX A;  4M9V C;  4K0K E;  1XNQ E;  4X65 I;  4BBY A;  3HUL A;  4U3B A;  2CTD A;  4U3D A;  4GEQ B;  3WU3 A;  3MHH C;  2VQF E;  2PNL A;  2Z5B B;  2YTE A;  2EOS A;  1XHK A;  4IFD A;  1ZBQ A;  1KTV A;  1YHC A;  4JV5 I;  3EPJ A;  4PRV A;  2EMB A;  1XNR I;  5KL5 A;  1HNZ I;  2WW4 A;  2PNZ A;  2RSI A;  1Y4S A;  3LNU A;  2EOQ A;  2E1R A;  1SR9 A;  3QT5 A;  5K36 B;  3AUZ A;  5FLX C;  4M30 A;  2DSY A;  1MGT A;  4WXC A;  2MDG A;  4HAC B;  5IWA I;  4JV5 E;  3LML A;  4BC7 A;  2BA0 G;  2X7I A;  1RR9 A;  1Z5A A;  1Z5B A;  4BMJ A;  1YUI A;  3LTO A;  1PDA A;  4FW4 A;  3J81 Q;  1J5E I;  2EM9 A;  4DR3 I;  1FJG I;  3WU4 A;  2EPK X;  1N36 E;  2EMK A;  5LMN E;  1A6F A;  4P7A A;  2HKJ A;  2EN7 A;  4LCG A;  4N4R B;  1WHN A;  5A6K A;  1TF3 A;  4F9A B;  2EQ3 A;  1UN6 B;  2M4I A;  1XXE A;  1UDO A;  2UU9 I;  1AH5 A;  4B3M E;  1I94 I;  4GKK I;  2EOY A;  2UUA E;  2VF3 A;  2Q8U A;  4JI5 E;  4NBQ A;  4JI3 I;  4LTY A;  2EPU A;  1Z0B A;  1QNT A;  4JI7 E;  2JEA A;  2IER A;  2N8X A;  3JU0 A;  2H36 X;  5L3J A;  4LF7 I;  4B3M I;  1WUU A;  3H1C A;  2EPR A;  4R2P A;  3J80 Q;  2JEA B;  3J7A G;  4WX9 A;  3J80 C;  1A1K A;  2JPA A;  4B3R E;  3GCM A;  4PU9 A;  4DV4 E;  4BA1 A;  2NAB A;  1G2F C;  2EM0 A;  2BM0 A;  5K36 A;  3CWV A;  1YYK A;  5JEA F;  3QG5 C;  5K36 D;  4JI4 E;  5JEA D;  2UXB I;  5C0X E;  4X66 I;  2PO0 B;  4OO1 A;  4K0K I;  2EN6 A;  2JY9 A;  1A1I A;  2HFU A;  2A25 A;  2WNR B;  1U2R A;  4DR5 E;  2GQ0 A;  4LF9 I;  3Q1Q A;  4M2Z A;  2MC6 A;  2EOF A;  1S16 A;  3HPS A;  4X9J A;  1P42 A;  2IES A;  2KON A;  2O1W A;  4MU1 A;  1TN9 A;  2OI2 A;  5AC5 A;  2CSH A;  4X66 E;  1H73 A;  2ZIT A;  4DR1 I;  4L5N C;  2VRD A;  3C6M A;  4MU0 A;  4IS1 C;  2YPN A;  4X65 E;  5A2Q Q;  2ZBK B;  1XNQ I;  2ZM6 I;  2CGE A;  2GO3 A;  4UTG A;  1PJQ A;  1TF6 A;  4IZK A;  1HNX E;  2PNZ B;  5JEA B;  1O0W A;  1X47 A;  2CVE A;  4WXD A;  2NN6 C;  5C0X F;  4FWD A;  2VQF I;  4OO1 B;  1YPN A;  3BF2 A;  1FWL A;  2PO0 A;  3P3E A;  2WBT A;  2C39 B;  4BCA A;  1YH8 A;  2B7T A;  4LF5 E;  1K47 A;  2EMA A;  1FNM A;  3B8H A;  4WUC A;  5LMU I;  4DV1 I;  3PYD A;  1XNR E;  1RQ0 A;  2UXD E;  3P3C A;  4IJD A;  2E5L E;  5K36 F;  3JTZ A;  1ZM3 A;  3K85 A;  2NN6 F;  4TUG A;  5JEA E;  3M85 D;  2DB2 A;  5K36 E;  1E3P A;  1HR0 I;  1YFH A;  2FV4 B;  2FGG A;  4LPF A;  1AAY A;  4DPT A;  1JK1 A;  3HKM A;  4F2J C;  3VK6 A;  3P06 A;  3CDJ A;  3IWB A;  3Q6N A;  4BHC A;  2DEJ A;  2N3H A;  2PNM A;  1USU A;  2EQ0 A;  2MC5 A;  2UUA I;  2E72 A;  4RPF A;  1X5W A;  2EPN A;  3WU5 A;  1DGC A;  4MDT A;  5EL9 A;  3ZOQ B;  2KHX A;  4LU9 A;  2EOZ A;  2VE7 C;  5AAS A;  2YTP A;  2NUG A;  3V2U C;  4DR6 I;  4GKJ E;  1RC7 A;  4B3T E;  5ELW A;  4AM3 A;  4B3S E;  1WRJ A;  4MU4 A;  2O1V A;  4Q28 A;  4DV3 E;  2LT7 A;  4LFB E;  4LCH A;  1T4L B;  2M9A A;  4WPY A;  5KL3 A;  2EQ1 A;  1BB8 A;  4B3S I;  3T1H I;  1L4S A;  1OJ4 A;  3GME A;  1BBO A;  3ZZ0 A;  3UK3 C;  3L00 A;  4MYT A;  2B3T B;  4HAC A;  4R8O A;  5ADZ A;  1T4N A;  2EMF A;  5LMN I;  2BA1 G;  3RMP A;  4IZJ B;  2G7H A;  3PYG A;  2HFS A;  2EPM X;  3ECR A;  2WBU A;  1VI7 A;  2A2C A;  4MYU A;  1NHI A;  3OTO E;  4LF8 I;  2ENC A;  5KL4 A;  4HY1 A;  4DR7 E;  2JT2 A;  1T39 A;  2UXC I;  3DF6 A;  2BV3 A;  4WSP A;  4DUZ I;  1YYW A;  3ZM7 A;  1N0V C;  2Z5B A;  1MX0 A;  4LF4 I;  5C0X B;  1PKP A;  2CT1 A;  1HNZ E;  1Z59 A;  4JI0 E;  4R03 A;  4F9C B;  2EPZ A;  1Y6Z A;  2EMG A;  2HJJ A;  1A1G A;  4IZJ D;  5T6J A;  5DRR A;  2D9H A;  2Q2E B;  2NUE A;  2ENA A;  2JE6 B;  4YHH I;  2AJ4 A;  1J26 A;  2LO3 A;  1OYP A;  3P76 A;  2HK2 A;  2J7K A;  4JG4 A;  2LV2 A;  1YUJ A;  3MSW A;  1X49 A;  2HHH E;  4QNJ A;  5A6B A;  2DMI A;  2YRH A;  4P78 A;  4L8N A;  4YHH E;  2YWQ A;  4JYA E;  4I3H A;  2EN4 A;  3CDI A;  4LOM A;  2B9D A;  4JI1 E;  2RSM A;  4O24 A;  1OYR A;  1FI4 A;  2I9I A;  2V87 A;  2E5L I;  1P47 A;  5KL2 A;  2LJH A;  1GZ6 A;  2J7J A;  2GPI A;  1S4E A;  4WUB A;  1H7S A;  4R2D A;  1ZM4 A;  4BA2 B;  1IBL E;  1FJG E;  4DV0 E;  1HNW E;  2C39 A;  2V85 A;  2R76 A;  4DPW A;  1ZAA C;  3HPZ A;  2EOE A;  3M6A A;  5A69 A;  2YT4 A;  4DR6 E;  4ZYD A;  1UDN A;  4F6N A;  2BM1 A;  1N32 I;  4WFT A;  1EA6 A;  1EKZ A;  3V5R A;  4ZYH A;  1MG7 A;  3MHS C;  4DR2 I;  2O3Z A;  3EPH A;  1Z1B A;  4R1F A;  3P1X A;  4MLQ A;  3IWC A;  2NPF A;  2WP8 A;  4NHR A;  4Z7Y A;  3F6G A;  2EM7 A;  2K4V A;  4ZVI A;  1ZXM A;  4BHB A;  1EH6 A;  4LF7 E;  1XMQ I;  2L8T A;  2JEB B;  4FW7 A;  3ADL A;  4DUY I;  1N33 I;  4DV6 E;  1IBK E;  4IFD B;  2NN6 B;  1WJP A;  3KWR A;  4DV4 I;  4X62 E;  2L3J A;  2RS7 A;  5C0X D;  1ELO A;  4ZYE A;  2EN1 A;  3FIG A;  2LBS B;  4HTG A;  1YYO A;  1B63 A;  4DU7 A;  2EMX A;  3WU6 A;  4X64 I;  4KHP E;  4HEI A;  2EOO A;  3KZZ A;  1X48 A;  4X62 I;  1N34 E;  4JI8 I;  2DIX A;  1UHZ A;  4FW6 A;  1UEK A;  4KQV A;  2C38 B;  5GMD A;  2JEB A;  2L33 A;  2L2K B;  2R3V A;  4X64 E;  2EPP A;  4KHP I;  3ZKD A;  2EOR A;  4NXM E;  2UUC I;  4DPU A;  1UDQ A;  2EM5 A;  1NHJ A;  2LVH A;  4IFD F;  1R6L A;  1G2D C;  5KL6 A;  1B69 A;  1HK7 A;  4MQY A;  2NN6 E;  3PS3 A;  1DAR A;  3EQ1 A;  4I8O A;  2CPN A;  2EN8 A;  1KVK A;  2Z5C B;  4XTJ A;  1A1F A;  1Z0C A;  1T38 A;  1N0U A;  4DPX A;  4O5G A;  5CFF E;  4HYM A;  2EL5 A;  3B82 A;  2EOX A;  5A6B D;  4KZS A;  4OO1 E;  1STU A;  2MDR A;  4IFD C;  3C4B A;  3C4T A;  2UXC E;  2V83 A;  1QU6 A;  4B3R I;  2EL6 A;  4P52 A;  2LTR A;  4F9B B;  2WCC 3;  2Z5C A;  3B4T A;  2V2Q A;  4Z7C A;  3HJC A;  2JOB A;  4EMD A;  2BR2 A;  4DMI A;  1D6T A;  4FW9 A;  1N36 I;  2EZ6 A;  1T4O A;  4LCF A;  2DEI A;  4DV3 I;  2DRP A;  4LFB I;  4GQU A;  3HQ1 A;  4O43 A;  1SFE A;  1IMU A;  2BR2 B;  1R6M A;  2LJU A;  4OZE A;  1BBG A;  4DV5 I;  4R2E A;  4URL A;  1Z0V A;  1UIL A;  5DRQ A;  4YY3 I;  2RS6 A;  2EM4 A;  4AQY I;  1BKN A;  4R2Q A;  1OYS A;  3M85 G;  5EKW A;  2WNR A;  2JYA A;  3U1K A;  2O1U A;  2HHH I;  4DPY A;  4JI7 I;  1A1L A;  4X8W A;  4IS9 A;  5FLX Q;  4B3T I;  2EWL A;  3K17 A;  2YRK A;  1IBM E;  1N33 E;  2BA1 D;  4WUD A;  5AE3 A;  1NCS A;  3TQM A;  4FWH A;  2NN6 A;  2ODR D;  1KYQ A;  2GO4 A;  2EMH A;  1DQ3 A;  1EI1 A;  2V8P A;  2YTJ A;  3U1Y A;  2C37 A;  1Z0W A;  1GTK A;  2C38 A;  2M1S A;  2A2D A;  2B7V A;  5JEA A; 
#chains in the Genus database with same CATH homology
 2V8Q B;  3F0N A;  3H4L A;  5AE1 A;  2CG9 A;  2O1T A;  2UU9 E;  3HTX A;  3ZZT A;  2UUB I;  4LFC E;  1PIE A;  1USV A;  2NUF A;  4DR2 E;  2N3G A;  3PYE A;  2IHR 1;  4FN5 A;  2F4V I;  4NXN I;  3ADG A;  2VQE I;  4LFA I;  2V34 A;  3D4J A;  3J81 C;  1J5E E;  1GQE A;  1RRE A;  3Q6M A;  5AE2 A;  2UUC E;  4UT4 A;  4DV6 I;  1IBK I;  1NZ0 A;  3OML A;  3VYY A;  2UXB E;  1ZXN A;  3K1J A;  4DKK A;  4TUI A;  5A2Q C;  4DR5 I;  1MU5 A;  4IZJ A;  3T1H E;  4M1K A;  4JI2 E;  1I94 E;  4GKK E;  3LLH A;  4USM A;  2M7Q A;  2ODR C;  1N32 E;  1H72 C;  2L92 A;  2F8B A;  5F3W A;  2XEX A;  1QZR A;  4LF6 E;  3VYX A;  4DR4 I;  3ADI A;  3HXL A;  1WHQ A;  3ADJ A;  4NXM I;  2V86 A;  4DV7 E;  4JI6 E;  4OOG C;  1IBM I;  4ED4 A;  2CZ9 A;  2V2V A;  3QT8 A;  2LJP A;  3DJW A;  4JI0 I;  4AQY E;  1FKA E;  4JI6 I;  1HR0 E;  2KOU A;  1KIJ A;  2HK3 A;  2DMY A;  2JR1 A;  2V89 A;  3B78 A;  3ZKB A;  4DR1 E;  5IWA E;  1XMQ E;  2L2N A;  4DV2 I;  1Z5C A;  2UUB E;  1Z0E A;  2JWO A;  1HNX I;  1Y4U A;  2L6M A;  1XMO E;  2F4V E;  5IT9 C;  2V2Z A;  3J7A M;  5LL6 R;  2VQE E;  3H09 A;  4DXL A;  5LMU E;  2GS8 A;  4LF5 I;  4LF4 E;  4LFC I;  3LPS A;  2IOP A;  2JVA A;  4M0V A;  4DU8 A;  4NXN E;  1B62 A;  4LFA E;  5GME A;  2LUP B;  3QT7 A;  3IWD A;  1ZM2 A;  2WZO A;  2V88 A;  5BR8 I;  3GON A;  2JOX A;  1H7U A;  1PVG A;  4JYA I;  4GKJ I;  4DR3 E;  4JI1 I;  4DR4 E;  2IOQ A;  2ZM6 E;  1YZ9 A;  4IZK B;  4OX9 E;  2L3C A;  4HXZ A;  1Z0G A;  3F6H A;  1H74 A;  4LF6 I;  1DI2 A;  2UXD I;  4OX9 I;  4DV5 E;  3PYF A;  4FWG A;  2FTX B;  2E1M A;  4BC9 A;  4WYQ B;  4YY3 E;  4F54 A;  2NA2 A;  4DR7 I;  1ZM9 A;  5FWK A;  4JI2 I;  5IT9 Q;  1IBL I;  3PRY A;  4DUY E;  4DV0 I;  4JI4 I;  1HNW I;  1XMO I;  2Z5E A;  3JAM Q;  1FWK A;  3QT6 A;  1ZBT A;  2LTS A;  4LF9 E;  2X36 A;  4DV2 E;  4DV7 I;  2VF1 A;  1WXR A;  4JI8 E;  4USK A;  5DNY A;  1N34 I;  1NHH A;  2LMZ A;  2L2M A;  3AV0 A;  3T1Y E;  2HKE A;  2LRS A;  4JI5 I;  4JI3 E;  1KKH A;  2LE2 A;  3K6Q A;  5BR8 E;  1VIS A;  4P7D A;  4N3O A;  4LF8 E;  3OTO I;  3T1Y I;  4J8Z A;  4DV1 E;  1Z0T A;  3JAM C;  2EFG A;  4DUZ E;  2RTX A;  2LUQ A;  3ZZU A;  4BS9 A;  2R42 A;  3J7Y p;  2YZT A;  4PRX A;  4K0K E;  1XNQ E;  4X65 I;  4BBY A;  3HUL A;  4GEQ B;  3WU3 A;  2VQF E;  2PNL A;  2Z5B B;  1XHK A;  1ZBQ A;  1KTV A;  4JV5 I;  4PRV A;  1XNR I;  1HNZ I;  2WW4 A;  1Y4S A;  3LNU A;  2E1R A;  1SR9 A;  3QT5 A;  3AUZ A;  5FLX C;  2DSY A;  4M30 A;  5IWA I;  4HAC B;  4JV5 E;  3LML A;  4BC7 A;  2X7I A;  1RR9 A;  1Z5A A;  1Z5B A;  4BMJ A;  3J81 Q;  3LTO A;  1J5E I;  4DR3 I;  1FJG I;  3WU4 A;  1N36 E;  5LMN E;  1A6F A;  4P7A A;  2HKJ A;  1WHN A;  4F9A B;  2M4I A;  2UU9 I;  4B3M E;  1I94 I;  4GKK I;  2UUA E;  2VF3 A;  4JI5 E;  4JI3 I;  4LTY A;  1Z0B A;  4JI7 E;  3JU0 A;  2H36 X;  5L3J A;  4LF7 I;  4B3M I;  1WUU A;  3J80 Q;  3J7A G;  3J80 C;  4B3R E;  4PU9 A;  4DV4 E;  2BM0 A;  3CWV A;  1YYK A;  4JI4 E;  2UXB I;  4X66 I;  4K0K I;  2JY9 A;  2HFU A;  1U2R A;  4DR5 E;  2GQ0 A;  4LF9 I;  3Q1Q A;  4M2Z A;  2MC6 A;  1S16 A;  3V2U C;  3HPS A;  2KON A;  2O1W A;  2OI2 A;  2ZIT A;  4X66 E;  1H73 A;  4DR1 I;  4L5N C;  4X65 E;  5A2Q Q;  2ZBK B;  1XNQ I;  2ZM6 I;  2CGE A;  4UTG A;  4IZK A;  1HNX E;  1O0W A;  1X47 A;  2VQF I;  4FWD A;  1FWL A;  4BCA A;  4WUC A;  2B7T A;  4LF5 E;  1K47 A;  5LMU I;  1FNM A;  3B8H A;  4DV1 I;  3PYD A;  1XNR E;  1RQ0 A;  2UXD E;  2E5L E;  3JTZ A;  1ZM3 A;  3K85 A;  4TUG A;  2DB2 A;  1HR0 I;  2FV4 B;  2FGG A;  4DPT A;  3VK6 A;  3P06 A;  3IWB A;  3Q6N A;  2DEJ A;  2N3H A;  2PNM A;  1USU A;  2MC5 A;  2UUA I;  4RPF A;  3WU5 A;  2KHX A;  3ZOQ B;  4LU9 A;  4DR6 I;  2VE7 C;  5AAS A;  2NUG A;  4GKJ E;  1RC7 A;  4B3T E;  4B3S E;  2O1V A;  4Q28 A;  4DV3 E;  4LFB E;  1T4L B;  4WPY A;  4B3S I;  3T1H I;  1OJ4 A;  3ZZ0 A;  4MYT A;  2B3T B;  4HAC A;  4R8O A;  5ADZ A;  1T4N A;  5LMN I;  4IZJ B;  3RMP A;  2G7H A;  3PYG A;  2HFS A;  2A2C A;  4MYU A;  1NHI A;  3OTO E;  4LF8 I;  4HY1 A;  4DR7 E;  2UXC I;  3DF6 A;  2BV3 A;  4WSP A;  4DUZ I;  1YYW A;  3ZM7 A;  1N0V C;  2Z5B A;  1MX0 A;  4LF4 I;  1PKP A;  1HNZ E;  1Z59 A;  4JI0 E;  4R03 A;  4F9C B;  1Y6Z A;  4IZJ D;  5T6J A;  2Q2E B;  2NUE A;  4YHH I;  2AJ4 A;  1J26 A;  4JG4 A;  2HK2 A;  2J7K A;  3MSW A;  1X49 A;  2HHH E;  4P78 A;  4L8N A;  4YHH E;  4JYA E;  4I3H A;  2B9D A;  4JI1 E;  2RSM A;  1FI4 A;  2E5L I;  2V87 A;  2LJH A;  1GZ6 A;  1S4E A;  4WUB A;  1H7S A;  1ZM4 A;  1IBL E;  1FJG E;  4DV0 E;  1HNW E;  2V85 A;  4DPW A;  3HPZ A;  3M6A A;  2YT4 A;  4DR6 E;  2BM1 A;  1N32 I;  4WFT A;  1EA6 A;  1EKZ A;  3V5R A;  1MG7 A;  4DR2 I;  4R1F A;  3P1X A;  3IWC A;  2NPF A;  4Z7Y A;  3F6G A;  2K4V A;  4ZVI A;  1ZXM A;  1XMQ I;  4LF7 E;  2L8T A;  4DUY I;  3ADL A;  1N33 I;  4DV6 E;  1IBK E;  3KWR A;  4DV4 I;  4X62 E;  2L3J A;  2RS7 A;  1ELO A;  3FIG A;  2LBS B;  1YYO A;  1B63 A;  4DU7 A;  3WU6 A;  4X64 I;  4KHP E;  1X48 A;  4X62 I;  1N34 E;  4JI8 I;  2DIX A;  1UHZ A;  1UEK A;  4KQV A;  5GMD A;  2L33 A;  2L2K B;  2R3V A;  4X64 E;  4KHP I;  3ZKD A;  2UUC I;  4NXM E;  4DPU A;  1NHJ A;  1HK7 A;  1DAR A;  4I8O A;  1KVK A;  2CPN A;  2Z5C B;  4XTJ A;  1Z0C A;  1N0U A;  4DPX A;  5CFF E;  4HYM A;  3B82 A;  4KZS A;  1STU A;  2MDR A;  3C4B A;  3C4T A;  2UXC E;  2V83 A;  1QU6 A;  4B3R I;  4P52 A;  2LTR A;  4F9B B;  2Z5C A;  4Z7C A;  2V2Q A;  3HJC A;  2JOB A;  4EMD A;  4DMI A;  1D6T A;  4FW9 A;  1N36 I;  2EZ6 A;  1T4O A;  2DEI A;  4DV3 I;  4LFB I;  3HQ1 A;  4DV5 I;  4URL A;  1Z0V A;  1UIL A;  4YY3 I;  2RS6 A;  4AQY I;  1BKN A;  2O1U A;  2HHH I;  4DPY A;  4JI7 I;  4B3T I;  4X8W A;  5FLX Q;  2EWL A;  3K17 A;  1IBM E;  1N33 E;  4WUD A;  5AE3 A;  4FWH A;  2ODR D;  1DQ3 A;  1EI1 A;  2V8P A;  1Z0W A;  2M1S A;  2A2D A;  2B7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...