1HNWE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnwE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwE02
4LFAI 4LF5I 4KHPI 4ZVIA 4B3TI 2A2DA 3WU4A 4AQYI 5A2QC 3WU6A 1XNRI 4YY3I 4M2ZA 3M6AA 1U2RA 4WYQB 1Z5AA 2DIXA 2JY9A 2L3CA 4PRVA 4PU9A 4HACA 2NUGA 3JAMQ 4JI3E 1Z0WA 2ZITA 2UUBE 4PRXA 1N33E 2V2QA 3F0NA 2UXCE 1FJGE 3ZZ0A 4USKA 3WU5A 2VF3A 4JV5I 2BM1A 1FKAE 2KHXA 4DV7E 4DUYI 1KIJA 1EA6A 1XMQE 5BR8E 4K0KI 2VQFE 1KKHA 1N0VC 1XNQE 2N3HA 3GONA 4DPXA 1PKPA 4LFBI 5LMNI 4DR1E 2LRSA 1VISA 4OX9I 4X64E 3J7Yp 1DI2A 2L3JA 4JI7I 4HACB 1PVGA 1N0UA 1GQEA 2UU9I 4DV1E 4DV0E 4YHHI 2AJ4A 2NUEA 1HNXI 2CPNA 4KHPE 4DXLA 4LF8I 4X64I 1IBKI 2IHR1 1X49A 1XHKA 1N33I 3ZKDA 1IBMI 4NXMI 1J5EE 1BKNA 1NZ0A 4OOGC 4B3MI 1RR9A 4JI2E 4ED4A 3LTOA 1MG7A 2UUCE 3B82A 2HK2A 2MDRA 3T1YE 5LMUE 1ZM3A 3ADIA 1YYKA 4K0KE 5BR8I 4LF4I 1B63A 3ADLA 4Z7YA 4M30A 5IWAI 2RS7A 1QZRA 5GMEA 4LF8E 4JI5I 2LTSA 3VYXA 2LUPB 4B3RE 4JI1E 4X62E 1J5EI 2L2MA 2UXCI 4DR7E 4MYTA 4DKKA 1KTVA 2UXBE 1Z59A 2UXDE 4JI5E 3V5RA 1N32E 2XEXA 2V8PA 1HNZI 1IBLE 2LJPA 3VYYA 1Z0CA 4FWGA 4JV5E 2UXDI 4WUCA 2HFSA 1RC7A 2YT4A 2RTXA 3OTOI 1YYWA 2LUQA 4JI3I 1A6FA 3J7AG 1ZM2A 2V34A 1IBLI 2E1RA 2B3TB 3QT7A 2NPFA 1HR0I 2Q2EB 4DV1I 1H7SA 1KVKA 5FLXQ 2B7TA 1NHJA 4X65I 4B3RI 2WW4A 3HTXA 2EZ6A 4JYAE 1Z5CA 4YY3E 2UUBI 1HNWE 3JAMC 2DEIA 3T1HI 4FW9A 4LF4E 2HK3A 3J81C 3J7AM 4LFCI 1IBKE 1NHIA 4UT4A 1ELOA 3T1YI 4JI8E 4JI0E 1NHHA 4WFTA 1STUA 4DPTA 4DV6E 3V2UC 4B3TE 2LJHA 4FWDA 4LF6I 3ZKBA 1XMOI 4DR6E 4LFBE 3K1JA 2ZM6E 3ADJA 1I94E 1Z0VA 3PYFA 2VQEE 4OX9E 2UUAI 4X65E 4FN5A 3J81Q 3C4BA 2HHHE 1FWKA 2V2VA 2J7KA 1T4NA 2L2NA 2UXBI 1H73A 4DUZI 1RREA 4LF9I 3PYDA 2ZBKB 2E5LE 1WUUA 1X47A 1EI1A 4DR5E 3ZZUA 3CWVA 5LL6R 4X66E 4DR7I 4LF7E 1DARA 1N34I 1K47A 4GKJE 4WUDA 1HNZE 4P52A 1XMQI 2ZM6I 4URLA 1FJGI 2DMYA 5IWAE 4DV2I 4DR3I 1D6TA 2R42A 4USMA 3Q1QA 1H74A 1UHZA 4DPWA 3K17A 4DU8A 4DV5E 1S4EA 4DUZE 4LF9E 5FLXC 2V2ZA 3J80C 1Z0GA 4JG4A 3QT6A 2UU9E 4I3HA 4R1FA 4JI4E 5LMNE 2BM0A 1X48A 3QT5A 3H4LA 4DU7A 4X66I 3PYEA 4JYAI 4XTJA 1QU6A 2VQFI 5IT9Q 1N36E 4GKKE 4DR2E 1J26A 1UILA 1H72C 2EFGA 4GKJI 2HKJA 4JI6E 1Z0EA 1XNQI 4DUYE 4MYUA 5A2QQ 3P1XA 3OTOE 1EKZA 4DR4E 1YYOA 3ZM7A 4YHHE 4DV0I 4KQVA 2LTRA 2UUAE 4HY1A 4DV6I 4DR2I 4UTGA 4FWHA 2F4VE 4M1KA 3QT8A 4DV4E 4LFAE 2OI2A 3D4JA 4B3ME 1I94I 2NA2A 4HYMA 2HKEA 4NXME 4LF7I 2HHHI 2JVAA 2B7VA 1XMOE 4DV5I 1Z5BA 1T4LB 2RSMA 5GMDA 4DPYA 3LPSA 1WHQA 4JI7E 2GS8A 1HR0E 3PYGA 1RQ0A 1HNWI 4DV4I 4JI4I 1XNRE 1MX0A 2VQEI 4LFCE 2NUFA 4B3SE 1H7UA 1FNMA 4JI2I 2LBSB 4DR1I 4DV3I 2BV3A 2CZ9A 5LMUI 1ZBTA 4DV7I 4JI0I 5CFFE 2L33A 4LF5E 4DR4I 1N34E 1PIEA 1ZM9A 4RPFA 4WUBA 1ZM4A 4DV2E 2E5LI 2L2KB 4DR5I 1FI4A 1B62A 1MU5A 1UEKA 4DR3E 1OJ4A 3B78A 3ZZTA 2F4VI 1N32I 4Z7CA 2N3GA 2R3VA 3J80Q 4JI6I 1S16A 4GKKI 2X36A 5L3JA 1ZXMA 4DPUA 2RS6A 3C4TA 4NXNI 2DB2A 3ADGA 3HULA 2X7IA 4DV3E 4EMDA 3LLHA 4HXZA 3B8HA 2UUCI 2HFUA 1N36I 1Z0TA 1YZ9A 5IT9C 4X8WA 4LF6E 4AQYE 2DEJA 4X62I 4JI8I 4B3SI 1WHNA 4P7AA 1T4OA 1HNXE 1ZXNA 1Z0BA 2A2CA 4NXNE 4DR6I 1O0WA 1IBME 3LNUA 4JI1I 3T1HE 3WU3A 1FWLA
chains in the Genus database with same CATH superfamily
4LFAI 2NN6A 3M7NG 4LF5I 2EM5A 2F8BA 2BB8A 3KZYA 4ZVIA 4B3TI 4KHPI 1UBDC 2A2DA 3WU4A 3MHSC 4LOMA 4AQYI 2EPCA 4O4KA 2EMIA 4Q28A 2ODRC 2C37B 1LLMC 3WU6A 1XNRI 4YY3I 4M2ZA 2EM0A 3PS3A 3M6AA 3QG5C 2BA1G 1U2RA 2NN6C 4WYQB 3RMPA 4IFDF 1TF6A 1Z5AA 2DIXA 2JY9A 2L3CA 4PRVA 4PU9A 3VHTB 2JT2A 4HACA 2GO4A 2NUGA 4LCGA 3JAMQ 4JI3E 2O1TA 5IXMB 1Z0WA 2ZITA 2UUBE 5DRRA 5EKWA 4PRXA 2EOQA 1N33E 2V2QA 3F0NA 1A1LA 2UXCE 1PJSA 3IWBA 4MLQA 2G7HA 1FJGE 4BA1A 1QNTA 3ZZ0A 1EH8A 2I9IA 1HK7A 4USKA 3WU5A 2EM4A 2VF3A 4JV5I 2BM1A 2YRMA 2KHXA 4DV7E 1FKAE 4DUYI 2EMBA 3TQMA 3JTZA 1KIJA 4R2QA 1EA6A 2YTOA 3KZZA 5IV8B 5BR8E 1XMQE 2VQFE 4K0KI 2Q8UA 2LJUA 2LMZA 1KKHA 4TUGA 5KL5A 3B4TA 1N0VC 3HXLA 4BMJA 4F54A 3BBGA 1XNQE 2EM3A 2PNZB 4J8ZA 4OO1F 2JXPA 2N3HA 3GONA 2JEAA 4DPXA 1PKPA 2V83A 4LFBI 2C37A 1G2DC 4FW3A 5LMNI 5K36E 2F1DA 2EMFA 4DR1E 1YSAC 2LRSA 1P42A 1VISA 4OX9I 4U3DA 4X64E 1EH7A 1OYPA 1BBOA 1YH8A 3J7Yp 1X3CA 2EL6A 2YPNA 1T38A 1DI2A 5AE3A 2L3JA 3THOB 4JI7I 4HACB 2H36X 1N0UA 1GQEA 1PVGA 5KL4A 4DV1E 2PNMA 2UU9I 2EPRA 5JEAC 3CDIA 4R2SA 2GHFA 4DV0E 4YHHI 2EL5A 2DGCA 2AJ4A 4OO1E 2YTGA 2NUEA 2A25A 2EPOA 2CPNA 2YWQA 4KHPE 4DXLA 4KWYA 1NEIA 4X64I 2IOQA 1A1IA 2GLIA 1IBKI 4LF8I 1IQSA 1WJPA 2IHR1 4KZSA 4RH8A 1X49A 1XHKA 1N33I 3ZKDA 2EN4A 1IBMI 4NXMI 1J5EE 1BKNA 2JOXA 2MKDA 5C0XB 5DRQA 2DLKA 1NZ0A 1Z1BA 1JK2A 4OOGC 4B3MI 1RR9A 4JI2E 2EOSA 3LTOA 4ISAA 5KL2A 4ED4A 1MG7A 2UUCE 4P7DA 1Y5YA 3B82A 2HK2A 1WXRA 2MDRA 2KONA 2LV2A 3T1YE 2EOHA 5LMUE 3OMLA 1X5WA 2WBUA 3ADIA 1ZM3A 2IERA 1YYKA 4K0KE 5BR8I 5K36D 4WXDA 4LF4I 2EN7A 1B63A 3ADLA 4Z7YA 4M30A 5IWAI 2RS7A 2N8XA 1QZRA 5GMEA 4LF8E 1WRJA 4R2RA 4JI5I 2EPLX 2LTSA 4F9AB 3VYXA 2LUPB 2M1SA 3IWCA 5ADZA 4B3RE 4L8NA 4JI1E 4X62E 1J5EI 4R03A 2L2MA 1USVA 2UXCI 2C38A 3Q6NA 4OO1B 1X6HA 3DF6A 3THNA 4DKKA 4DR7E 1KTVA 4MYTA 5K36C 2MC5A 2UXBE 2EE8A 1Z59A 2L6MA 2EMHA 2FTXB 2R1FA 2UXDE 4JI5E 3V5RA 3Q6MA 2EM8A 2BA1D 2EQ3A 4ZYHA 4BC9A 4F6NA 1N32E 2XEXA 1VI7A 3F6HA 5TSEA 2V8PA 1HNZI 1IBLE 2AE8A 2YTPA 2LJPA 4HEIA 3VYYA 2YSOA 1Z0CA 4FWGA 4JV5E 5C0XE 4WUCA 2UXDI 2HFSA 1RC7A 2YT4A 2EMXA 2RTXA 3OTOI 1YYWA 2LUQA 4JI3I 1PDAA 1B69A 5JEAD 1A6FA 2PO0A 3J7AG 5JEAA 1ZM2A 2EN8A 2V34A 1IBLI 2E1RA 2MC6A 2B3TB 2YSPA 2EPXA 1YFHA 2PNLA 3GLLA 3QT7A 3HPSA 2BR2A 1E3HA 2GO3A 2NPFA 1A1HA 1HR0I 5A6BD 3EPLA 3MHHC 2V85A 2PRTA 2Q2EB 4DV1I 2Z5CB 2VF1A 1H7SA 1KVKA 5FLXQ 2B7TA 2Z5CA 2LO3A 3C6MA 1R6LA 1NHJA 4FW6A 4X65I 4B3RI 1UN6B 2WW4A 2YTQA 3HTXA 4FW5A 2EZ6A 3WU3A 4JYAE 1Z5CA 3HQ1A 4YY3E 2UUBI 1HNWE 4MLVA 5T6JA 3JAMC 2DEIA 3T1HI 4FW9A 4LF4E 4BBYA 3J81C 2HK3A 3GCMA 2EOFA 4LFCI 3J7AM 1IBKE 5A69A 4WXCA 2EMAA 2EWLA 3PRYA 3BGHA 1NHIA 4UT4A 1ELOA 4LPFA 3AUZA 3T1YI 2FGGA 4JI8E 4JI0E 2JOBA 2PO1B 1NHHA 2K7IA 3BF2A 4WFTA 1STUA 2VE7C 3P3EA 4DPTA 2RPCA 5K36A 4DV6E 5AC5A 3V2UC 2PNZA 3ECRA 2EPUA 4B3TE 2LJHA 1USUA 2FV4B 4MQYA 4FWDA 4LF6I 2EPMX 4GQUA 3M85D 1OYRA 3ZKBA 3K85A 1XMOI 4GEQB 1AAYA 4DR6E 2EPKX 1NCSA 4IZJA 4LFBE 2JYAA 2V89A 2ZM6E 3K1JA 4IZJD 3ADJA 2ODRD 1I94E 1Z0VA 1GZ6A 2JEBA 2HGHA 2B9DA 2VQEE 4OX9E 3GMEA 3PYFA 1ZBQA 4X65E 4FN5A 4LCFA 2UUAI 3J81Q 3UK3C 5KL7A 3C4BA 3JU0A 2HHHE 2Z5BA 4IJDA 1FWKA 3EPHA 4R8OA 2V2VA 2J7KA 1T4NA 4M0VA 2L2NA 2UXBI 5DROA 1H73A 2WCC3 2D9HA 2EM6A 2EN2A 1RREA 2EPNA 2O3ZA 3PYDA 4DUZI 4LF9I 2ZBKB 2E5LE 5AC4A 2DSYA 1PJQA 1A1GA 1WUUA 4U3BA 2LE2A 2MDGA 1X47A 2WP8A 5DRPA 1Y60A 2NABA 2EOOA 1EI1A 4DR5E 3ZZUA 3CWVA 2EM7A 4IFDE 5LL6R 4X66E 2NN6B 4DR7I 4LF7E 3U1YA 2ELZA 3BIDA 1DARA 1UDOA 1N34I 2RQLA 1RMDA 2J7JA 1SFEA 4IFDC 4ZYEA 2EP3A 2NN6F 1MEYC 3P3GA 5EL9A 1EH6A 1K47A 3H1CA 4GKJE 4Q35B 1ZR9A 4WUDA 1HNZE 2CG9A 4P52A 1X6FA 2ZM6I 4URLA 1XMQI 2CVEA 2DMYA 3HPZA 2GPIA 4R2AA 2JEAB 1FJGI 5IWAE 2Z5BB 5A6BA 2YTIA 4MU3A 4DV2I 4DR3I 4R2DA 1D6TA 2R42A 5C0XF 4USMA 3Q1QA 4M9VC 4LU9A 1H74A 1UHZA 4DPWA 4LCHA 3K17A 4DU8A 4DV5E 2WNRA 1S4EA 3M85G 4DUZE 4LF9E 3HJCA 4IS1C 5FLXC 2EOZA 2C39A 2O1UA 2V2ZA 5A6AA 4GZNC 3J80C 1Z0GA 4JG4A 1IMUA 3FIGA 3QT6A 2Z5EA 2UU9E 2V88A 4R1FA 4I3HA 4JI4E 5LMNE 4IZKB 2BM0A 3UHMA 1X48A 1F2IG 4BHCA 1IQOA 2PO2B 2CSHA 2WBTA 3QT5A 3H4LA 4DU7A 4X66I 4F9BB 2PO2A 2NN6D 3PYEA 4JYAI 4XTJA 1QU6A 2ENAA 2EN1A 4AM3A 4MDTA 2VQFI 3P06A 2ENCA 4AIMA 5C0XC 5IT9Q 4IZJB 1N36E 4GKKE 3M7ND 4DR2E 2CTDA 4R2PA 1UILA 1J26A 1UDSA 2BA0D 4RHBB 2EMLA 1H72C 2IESA 2C38B 2JWOA 4OO1A 2EFGA 5JEAE 4GKJI 2HKJA 3LMLA 2V86A 2LVHA 1ZAAC 2O1VA 4JI6E 1YHCA 2K4VA 4O24A 2BA0G 2WNRB 1A1FA 2HJJA 2DMIA 1YUJA 1Z0EA 1XNQI 1E3PA 3U1KA 2CGEA 5DNLA 4DUYE 4MYUA 3F6GA 4IZKA 5A2QQ 3P1XA 2M7QA 3OTOE 2ADRA 1EKZA 3K6QA 4WX9A 4DR4E 1TN9A 4QNJA 1YYOA 3ZM7A 4YHHE 2M4IA 4DV0I 2EN6A 1A1KA 4KQVA 3C6KA 2LTRA 4DMIA 1X6EA 2UUAE 4HY1A 4NHRA 1RHYA 4DV6I 4DR2I 1PJTA 2J65A 4BCAA 4UTGA 1HNXI 4FWHA 2F4VE 2YTFA 4AIDA 4WSPA 5A6KA 4M1KA 5K36B 3QT8A 2GQ0A 4DV4E 4LFAE 2OI2A 2EOMA 2E72A 1UDNA 3D4JA 4I8OA 2EOXA 4B3ME 1I94I 5JEAB 1G2FC 1OYSA 2NA2A 4HYMA 2HKEA 4NXME 4LF7I 2HHHI 2JVAA 2V87A 2B7VA 2EORA 1XMOE 2BR2B 5ELWA 4DV5I 1Z5BA 1BBGA 3MSWA 1Y6ZA 4OZEA 4BA2B 1T4LB 2JEBB 3VK6A 2I13A 1GTKA 2EMYA 1R6MA 2RSMA 1KYQA 4MU1A 4WPYA 5GMDA 4DPYA 2KOUA 2DRPA 1YUIA 2JR1A 3LPSA 1WHQA 2R76A 5A6JA 1XXEA 2WZOA 4JI7E 2YZTA 2GS8A 1HR0E 3PYGA 5F3WA 1RQ0A 1TF3A 1Y4UA 3PS2A 4DV4I 1HNWI 4JI4I 2JPAA 2EOEA 2ENHA 4TUIA 1XNRE 2WBSA 4FW7A 5JEAF 1MX0A 2EN3A 2VQEI 2E1MA 5C0XA 1A1JA 4LFCE 2IOPA 5DNXA 2NUFA 2EMWA 4N4RB 4B3SE 2V8QB 2LT7A 3NZKA 1H7UA 2YU8A 1T39A 4X9JA 2VESA 4N3OA 1FNMA 4JI2I 2LBSB 4DR1I 2PO1A 2EQ0A 4DV3I 4MU0A 4IS9A 2YTNA 2JE6A 1AH5A 1DGCA 2BV3A 3ZOQB 2CZ9A 4QNKA 5DNYA 4IFDB 4OO1C 4OO1D 3KWRA 5LMUI 4LTYA 5C0XD 1ZBTA 4DV7I 4JI0I 2EQ1A 5CFFE 4L5NC 2L33A 4MU4A 5LLQA 1DQ3A 4LF5E 4BC7A 4DR4I 1SR9A 2EMCA 1N34E 3L00A 1PIEA 1ZM9A 4RPFA 1Y4SA 4WUBA 4BA2A 1ZM4A 4DV2E 2E5LI 1MGTA 2L2KB 4R2CA 1N3GA 1YPNA 2CT1A 2EJ4A 2BBGA 4ZYGA 2EM2A 3EPKA 2YU5A 4DR5I 1FI4A 1B62A 2EOJA 1BB8A 3KRNA 3PS1A 3AV0A 5KL3A 1MU5A 1UEKA 1KJKA 4F9CB 4DR3E 2WP8B 1OJ4A 4OKGA 2HC5A 2YTDA 3B78A 3DJWA 3M99B 4HTGA 3ZZTA 2F4VI 2JP9A 4ZYDA 1N32I 2ELYA 4J3DA 4Z7CA 2N3GA 2R3VA 1L4SA 3J80Q 4JI6I 2NN6E 5FWKA 2YTEA 2EOIA 2PO0B 4R2EA 4P78A 1S16A 4FK5C 2DLQA 4GKKI 2X36A 5L3JA 4NZVA 5KL6A 1ZXMA 1UDQA 2JE6B 3CDJA 5AE1A 2RS6A 4DPUA 3C4TA 2L8TA 4IFDA 4NXNI 5K36F 2DB2A 3ADGA 2EPAA 4O43A 1ZU1A 3HKMA 4BHBA 2YRHA 4O5GA 2X7IA 3HULA 4DV3E 2EOYA 2EMGA 4EMDA 3LLHA 3L7ZA 4WSGA 1P47A 4HXZA 3B8HA 2UUCI 4IFDD 2HFUA 1N36I 1Z0TA 1YZ9A 5IT9C 4X8WA 4LF6E 2EMZA 2L92A 4AQYE 3L7ZB 2EPPA 2DEJA 2MKNA 4X62I 4JI8I 4B3SI 1WHNA 4P7AA 1JK1A 3P3CA 2EPZA 3H09A 4NBQA 5AASA 2YRKA 1T4OA 4FW4A 3IWDA 3DD6A 2LCEA 2VRDA 4F2JC 4F6MA 2EMKA 1HNXE 5AE2A 1Z0BA 1ZXNA 3P76A 4BA1B 2A2CA 2O1WA 4NXNE 2EM9A 2YTJA 4DR6I 2M9AA 1O0WA 1IBME 4BS9A 3EPJA 2RSIA 3EQ1A 3T1HE 2C39B 3LNUA 2EL4A 4JI1I 5A2QC 1FWLA
chains in the Genus database with same CATH topology
4LFAI 4LF5I 2F8BA 4KHPI 4ZVIA 4B3TI 2A2DA 3WU4A 4AQYI 4Q28A 2ODRC 3WU6A 1XNRI 4YY3I 4M2ZA 3M6AA 1U2RA 4WYQB 3RMPA 1Z5AA 2DIXA 2JY9A 2L3CA 4PRVA 4PU9A 4HACA 2NUGA 3JAMQ 4JI3E 2O1TA 1Z0WA 2ZITA 2UUBE 4PRXA 1N33E 2V2QA 3F0NA 2UXCE 3IWBA 2G7HA 1FJGE 3ZZ0A 1HK7A 4USKA 3WU5A 2VF3A 4JV5I 2BM1A 1FKAE 2KHXA 4DV7E 4DUYI 3JTZA 1KIJA 1EA6A 1XMQE 5BR8E 4K0KI 2VQFE 2LMZA 1KKHA 4TUGA 1N0VC 3HXLA 4BMJA 4F54A 1XNQE 4J8ZA 2N3HA 3GONA 4DPXA 1PKPA 2V83A 4LFBI 5LMNI 4DR1E 2LRSA 1VISA 4OX9I 4X64E 3J7Yp 1DI2A 5AE3A 2L3JA 4JI7I 4HACB 2H36X 1N0UA 1GQEA 1PVGA 2PNMA 4DV1E 2UU9I 4DV0E 4YHHI 2AJ4A 2NUEA 1HNXI 2CPNA 4KHPE 4DXLA 4LF8I 4X64I 2IOQA 1IBKI 2IHR1 4KZSA 1X49A 1XHKA 1N33I 3ZKDA 1IBMI 4NXMI 1J5EE 1BKNA 2JOXA 1NZ0A 4OOGC 4B3MI 1RR9A 4JI2E 4ED4A 3LTOA 1MG7A 2UUCE 4P7DA 3B82A 2HK2A 1WXRA 2MDRA 2KONA 3T1YE 5LMUE 1ZM3A 3OMLA 3ADIA 1YYKA 4K0KE 5BR8I 4LF4I 1B63A 3ADLA 4Z7YA 4M30A 5IWAI 2RS7A 1QZRA 5GMEA 4LF8E 4JI5I 2LTSA 4F9AB 3VYXA 2LUPB 2M1SA 3IWCA 5ADZA 4B3RE 4L8NA 4JI1E 4X62E 1J5EI 4R03A 2L2MA 1USVA 2UXCI 3Q6NA 4DR7E 4DKKA 3DF6A 1KTVA 4MYTA 2MC5A 2UXBE 1Z59A 2L6MA 2FTXB 2UXDE 4JI5E 3V5RA 3Q6MA 4BC9A 1N32E 2XEXA 3F6HA 2V8PA 1HNZI 1IBLE 2LJPA 3VYYA 1Z0CA 4FWGA 4JV5E 2UXDI 4WUCA 2HFSA 1RC7A 2YT4A 2RTXA 3OTOI 1YYWA 2LUQA 4JI3I 1A6FA 3J7AG 1ZM2A 2V34A 1IBLI 2E1RA 2MC6A 2B3TB 2PNLA 3QT7A 3HPSA 2NPFA 1HR0I 2V85A 2Q2EB 4DV1I 2Z5CB 2VF1A 1H7SA 1KVKA 5FLXQ 2B7TA 2Z5CA 1NHJA 4X65I 4B3RI 2WW4A 3HTXA 2EZ6A 3WU3A 4JYAE 1Z5CA 3HQ1A 4YY3E 2UUBI 1HNWE 5T6JA 3JAMC 2DEIA 3T1HI 4FW9A 4LF4E 4BBYA 3J81C 2HK3A 3J7AM 4LFCI 1IBKE 2EWLA 3PRYA 1NHIA 4UT4A 1ELOA 3T1YI 3AUZA 2FGGA 4JI8E 4JI0E 2JOBA 1NHHA 4WFTA 1STUA 2VE7C 4DPTA 4DV6E 3V2UC 1USUA 4B3TE 2LJHA 2FV4B 4FWDA 4LF6I 3ZKBA 3K85A 1XMOI 4GEQB 4DR6E 4IZJA 4LFBE 3K1JA 2V89A 2ZM6E 4IZJD 3ADJA 2ODRD 1I94E 1Z0VA 1GZ6A 3PYFA 2B9DA 2VQEE 4OX9E 2UUAI 1ZBQA 4X65E 4FN5A 3J81Q 2Z5BA 3C4BA 3JU0A 2HHHE 1FWKA 4R8OA 2V2VA 2J7KA 1T4NA 4M0VA 2L2NA 2UXBI 1H73A 4DUZI 1RREA 4LF9I 3PYDA 2ZBKB 2E5LE 2DSYA 1WUUA 2LE2A 1X47A 1EI1A 4DR5E 3ZZUA 3CWVA 5LL6R 4X66E 4DR7I 4LF7E 1DARA 1N34I 1K47A 4GKJE 4WUDA 1HNZE 2CG9A 4P52A 1XMQI 2ZM6I 4URLA 1FJGI 2DMYA 3HPZA 5IWAE 2Z5BB 4DV2I 4DR3I 1D6TA 2R42A 4USMA 3Q1QA 1H74A 4LU9A 1UHZA 4DPWA 3K17A 4DU8A 4DV5E 1S4EA 4DUZE 4LF9E 3HJCA 5FLXC 2O1UA 2V2ZA 3J80C 1Z0GA 4JG4A 3FIGA 3QT6A 2Z5EA 2UU9E 2V88A 4R1FA 4I3HA 4JI4E 5LMNE 4IZKB 2BM0A 1X48A 3QT5A 3H4LA 4DU7A 4X66I 4F9BB 3PYEA 4JYAI 4XTJA 1QU6A 2VQFI 3P06A 5IT9Q 4IZJB 1N36E 4GKKE 4DR2E 1J26A 1UILA 1H72C 2JWOA 2EFGA 4GKJI 2HKJA 3LMLA 2V86A 2O1VA 4JI6E 2K4VA 1Z0EA 1XNQI 2CGEA 4DUYE 4MYUA 3F6GA 4IZKA 5A2QQ 3P1XA 2M7QA 3OTOE 1EKZA 3K6QA 4DR4E 1YYOA 3ZM7A 4YHHE 2M4IA 4DV0I 4KQVA 4DMIA 2LTRA 2UUAE 4HY1A 4DV6I 4DR2I 4BCAA 4UTGA 4FWHA 2F4VE 4WSPA 4M1KA 3QT8A 2GQ0A 4DV4E 4LFAE 2OI2A 3D4JA 4I8OA 4B3ME 1I94I 2NA2A 4HYMA 2HKEA 4NXME 4LF7I 2HHHI 2JVAA 2V87A 2B7VA 1XMOE 4DV5I 1Z5BA 1Y6ZA 3MSWA 1T4LB 3VK6A 2RSMA 5GMDA 4WPYA 4DPYA 2KOUA 2JR1A 3LPSA 1WHQA 2WZOA 4JI7E 2YZTA 2GS8A 1HR0E 3PYGA 5F3WA 1RQ0A 1Y4UA 4DV4I 1HNWI 4JI4I 4TUIA 1XNRE 1MX0A 2VQEI 2E1MA 4LFCE 2IOPA 2NUFA 4B3SE 2V8QB 1H7UA 4N3OA 1FNMA 4JI2I 2LBSB 4DR1I 4DV3I 2BV3A 3ZOQB 2CZ9A 5DNYA 3KWRA 5LMUI 4LTYA 1ZBTA 4DV7I 4JI0I 5CFFE 4L5NC 2L33A 1DQ3A 4LF5E 4BC7A 4DR4I 1SR9A 1N34E 1PIEA 1ZM9A 4RPFA 1Y4SA 4WUBA 1ZM4A 4DV2E 2E5LI 2L2KB 4DR5I 1FI4A 1B62A 3AV0A 1MU5A 1UEKA 4F9CB 4DR3E 1OJ4A 3B78A 3DJWA 3ZZTA 2F4VI 1N32I 4Z7CA 2N3GA 2R3VA 3J80Q 4JI6I 5FWKA 4P78A 1S16A 4GKKI 2X36A 5L3JA 1ZXMA 4DPUA 5AE1A 2RS6A 3C4TA 2L8TA 4NXNI 2DB2A 3ADGA 2X7IA 3HULA 4DV3E 4EMDA 3LLHA 4HXZA 3B8HA 2UUCI 2HFUA 1N36I 1Z0TA 1YZ9A 5IT9C 4X8WA 4LF6E 2L92A 4AQYE 2DEJA 4X62I 4JI8I 4B3SI 1WHNA 4P7AA 3H09A 5AASA 1T4OA 3IWDA 1HNXE 1ZXNA 5AE2A 1Z0BA 2A2CA 2O1WA 4NXNE 4DR6I 1O0WA 1IBME 4BS9A 3LNUA 4JI1I 3T1HE 5A2QC 1FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA I;  4LF5 I;  4KHP I;  4ZVI A;  4B3T I;  2A2D A;  3WU4 A;  4AQY I;  5A2Q C;  3WU6 A;  1XNR I;  4YY3 I;  4M2Z A;  3M6A A;  1U2R A;  4WYQ B;  1Z5A A;  2DIX A;  2JY9 A;  2L3C A;  4PRV A;  4PU9 A;  4HAC A;  2NUG A;  3JAM Q;  4JI3 E;  1Z0W A;  2ZIT A;  2UUB E;  4PRX A;  1N33 E;  2V2Q A;  3F0N A;  2UXC E;  1FJG E;  3ZZ0 A;  4USK A;  3WU5 A;  2VF3 A;  4JV5 I;  2BM1 A;  1FKA E;  2KHX A;  4DV7 E;  4DUY I;  1KIJ A;  1EA6 A;  1XMQ E;  5BR8 E;  4K0K I;  2VQF E;  1KKH A;  1N0V C;  1XNQ E;  2N3H A;  3GON A;  4DPX A;  1PKP A;  4LFB I;  5LMN I;  4DR1 E;  2LRS A;  1VIS A;  4OX9 I;  4X64 E;  3J7Y p;  1DI2 A;  2L3J A;  4JI7 I;  4HAC B;  1PVG A;  1N0U A;  1GQE A;  2UU9 I;  4DV1 E;  4DV0 E;  4YHH I;  2AJ4 A;  2NUE A;  1HNX I;  2CPN A;  4KHP E;  4DXL A;  4LF8 I;  4X64 I;  1IBK I;  2IHR 1;  1X49 A;  1XHK A;  1N33 I;  3ZKD A;  1IBM I;  4NXM I;  1J5E E;  1BKN A;  1NZ0 A;  4OOG C;  4B3M I;  1RR9 A;  4JI2 E;  4ED4 A;  3LTO A;  1MG7 A;  2UUC E;  3B82 A;  2HK2 A;  2MDR A;  3T1Y E;  5LMU E;  1ZM3 A;  3ADI A;  1YYK A;  4K0K E;  5BR8 I;  4LF4 I;  1B63 A;  3ADL A;  4Z7Y A;  4M30 A;  5IWA I;  2RS7 A;  1QZR A;  5GME A;  4LF8 E;  4JI5 I;  2LTS A;  3VYX A;  2LUP B;  4B3R E;  4JI1 E;  4X62 E;  1J5E I;  2L2M A;  2UXC I;  4DR7 E;  4MYT A;  4DKK A;  1KTV A;  2UXB E;  1Z59 A;  2UXD E;  4JI5 E;  3V5R A;  1N32 E;  2XEX A;  2V8P A;  1HNZ I;  1IBL E;  2LJP A;  3VYY A;  1Z0C A;  4FWG A;  4JV5 E;  2UXD I;  4WUC A;  2HFS A;  1RC7 A;  2YT4 A;  2RTX A;  3OTO I;  1YYW A;  2LUQ A;  4JI3 I;  1A6F A;  3J7A G;  1ZM2 A;  2V34 A;  1IBL I;  2E1R A;  2B3T B;  3QT7 A;  2NPF A;  1HR0 I;  2Q2E B;  4DV1 I;  1H7S A;  1KVK A;  5FLX Q;  2B7T A;  1NHJ A;  4X65 I;  4B3R I;  2WW4 A;  3HTX A;  2EZ6 A;  4JYA E;  1Z5C A;  4YY3 E;  2UUB I;  1HNW E;  3JAM C;  2DEI A;  3T1H I;  4FW9 A;  4LF4 E;  2HK3 A;  3J81 C;  3J7A M;  4LFC I;  1IBK E;  1NHI A;  4UT4 A;  1ELO A;  3T1Y I;  4JI8 E;  4JI0 E;  1NHH A;  4WFT A;  1STU A;  4DPT A;  4DV6 E;  3V2U C;  4B3T E;  2LJH A;  4FWD A;  4LF6 I;  3ZKB A;  1XMO I;  4DR6 E;  4LFB E;  3K1J A;  2ZM6 E;  3ADJ A;  1I94 E;  1Z0V A;  3PYF A;  2VQE E;  4OX9 E;  2UUA I;  4X65 E;  4FN5 A;  3J81 Q;  3C4B A;  2HHH E;  1FWK A;  2V2V A;  2J7K A;  1T4N A;  2L2N A;  2UXB I;  1H73 A;  4DUZ I;  1RRE A;  4LF9 I;  3PYD A;  2ZBK B;  2E5L E;  1WUU A;  1X47 A;  1EI1 A;  4DR5 E;  3ZZU A;  3CWV A;  5LL6 R;  4X66 E;  4DR7 I;  4LF7 E;  1DAR A;  1N34 I;  1K47 A;  4GKJ E;  4WUD A;  1HNZ E;  4P52 A;  1XMQ I;  2ZM6 I;  4URL A;  1FJG I;  2DMY A;  5IWA E;  4DV2 I;  4DR3 I;  1D6T A;  2R42 A;  4USM A;  3Q1Q A;  1H74 A;  1UHZ A;  4DPW A;  3K17 A;  4DU8 A;  4DV5 E;  1S4E A;  4DUZ E;  4LF9 E;  5FLX C;  2V2Z A;  3J80 C;  1Z0G A;  4JG4 A;  3QT6 A;  2UU9 E;  4I3H A;  4R1F A;  4JI4 E;  5LMN E;  2BM0 A;  1X48 A;  3QT5 A;  3H4L A;  4DU7 A;  4X66 I;  3PYE A;  4JYA I;  4XTJ A;  1QU6 A;  2VQF I;  5IT9 Q;  1N36 E;  4GKK E;  4DR2 E;  1J26 A;  1UIL A;  1H72 C;  2EFG A;  4GKJ I;  2HKJ A;  4JI6 E;  1Z0E A;  1XNQ I;  4DUY E;  4MYU A;  5A2Q Q;  3P1X A;  3OTO E;  1EKZ A;  4DR4 E;  1YYO A;  3ZM7 A;  4YHH E;  4DV0 I;  4KQV A;  2LTR A;  2UUA E;  4HY1 A;  4DV6 I;  4DR2 I;  4UTG A;  4FWH A;  2F4V E;  4M1K A;  3QT8 A;  4DV4 E;  4LFA E;  2OI2 A;  3D4J A;  4B3M E;  1I94 I;  2NA2 A;  4HYM A;  2HKE A;  4NXM E;  4LF7 I;  2HHH I;  2JVA A;  2B7V A;  1XMO E;  4DV5 I;  1Z5B A;  1T4L B;  2RSM A;  5GMD A;  4DPY A;  3LPS A;  1WHQ A;  4JI7 E;  2GS8 A;  1HR0 E;  3PYG A;  1RQ0 A;  1HNW I;  4DV4 I;  4JI4 I;  1XNR E;  1MX0 A;  2VQE I;  4LFC E;  2NUF A;  4B3S E;  1H7U A;  1FNM A;  4JI2 I;  2LBS B;  4DR1 I;  4DV3 I;  2BV3 A;  2CZ9 A;  5LMU I;  1ZBT A;  4DV7 I;  4JI0 I;  5CFF E;  2L33 A;  4LF5 E;  4DR4 I;  1N34 E;  1PIE A;  1ZM9 A;  4RPF A;  4WUB A;  1ZM4 A;  4DV2 E;  2E5L I;  2L2K B;  4DR5 I;  1FI4 A;  1B62 A;  1MU5 A;  1UEK A;  4DR3 E;  1OJ4 A;  3B78 A;  3ZZT A;  2F4V I;  1N32 I;  4Z7C A;  2N3G A;  2R3V A;  3J80 Q;  4JI6 I;  1S16 A;  4GKK I;  2X36 A;  5L3J A;  1ZXM A;  4DPU A;  2RS6 A;  3C4T A;  4NXN I;  2DB2 A;  3ADG A;  3HUL A;  2X7I A;  4DV3 E;  4EMD A;  3LLH A;  4HXZ A;  3B8H A;  2UUC I;  2HFU A;  1N36 I;  1Z0T A;  1YZ9 A;  5IT9 C;  4X8W A;  4LF6 E;  4AQY E;  2DEJ A;  4X62 I;  4JI8 I;  4B3S I;  1WHN A;  4P7A A;  1T4O A;  1HNX E;  1ZXN A;  1Z0B A;  2A2C A;  4NXN E;  4DR6 I;  1O0W A;  1IBM E;  3LNU A;  4JI1 I;  3T1H E;  3WU3 A;  1FWL A; 
#chains in the Genus database with same CATH topology
 4LFA I;  2NN6 A;  3M7N G;  4LF5 I;  2EM5 A;  2F8B A;  2BB8 A;  3KZY A;  4ZVI A;  4B3T I;  4KHP I;  1UBD C;  2A2D A;  3WU4 A;  3MHS C;  4LOM A;  4AQY I;  2EPC A;  4O4K A;  2EMI A;  4Q28 A;  2ODR C;  2C37 B;  1LLM C;  3WU6 A;  1XNR I;  4YY3 I;  4M2Z A;  2EM0 A;  3PS3 A;  3M6A A;  3QG5 C;  2BA1 G;  1U2R A;  2NN6 C;  4WYQ B;  3RMP A;  4IFD F;  1TF6 A;  1Z5A A;  2DIX A;  2JY9 A;  2L3C A;  4PRV A;  4PU9 A;  3VHT B;  2JT2 A;  4HAC A;  2GO4 A;  2NUG A;  4LCG A;  3JAM Q;  4JI3 E;  2O1T A;  5IXM B;  1Z0W A;  2ZIT A;  2UUB E;  5DRR A;  5EKW A;  4PRX A;  2EOQ A;  1N33 E;  2V2Q A;  3F0N A;  1A1L A;  2UXC E;  1PJS A;  3IWB A;  4MLQ A;  2G7H A;  1FJG E;  4BA1 A;  1QNT A;  3ZZ0 A;  1EH8 A;  2I9I A;  1HK7 A;  4USK A;  3WU5 A;  2EM4 A;  2VF3 A;  4JV5 I;  2BM1 A;  2YRM A;  2KHX A;  4DV7 E;  1FKA E;  4DUY I;  2EMB A;  3TQM A;  3JTZ A;  1KIJ A;  4R2Q A;  1EA6 A;  2YTO A;  3KZZ A;  5IV8 B;  5BR8 E;  1XMQ E;  2VQF E;  4K0K I;  2Q8U A;  2LJU A;  2LMZ A;  1KKH A;  4TUG A;  5KL5 A;  3B4T A;  1N0V C;  3HXL A;  4BMJ A;  4F54 A;  3BBG A;  1XNQ E;  2EM3 A;  2PNZ B;  4J8Z A;  4OO1 F;  2JXP A;  2N3H A;  3GON A;  2JEA A;  4DPX A;  1PKP A;  2V83 A;  4LFB I;  2C37 A;  1G2D C;  4FW3 A;  5LMN I;  5K36 E;  2F1D A;  2EMF A;  4DR1 E;  1YSA C;  2LRS A;  1P42 A;  1VIS A;  4OX9 I;  4U3D A;  4X64 E;  1EH7 A;  1OYP A;  1BBO A;  1YH8 A;  3J7Y p;  1X3C A;  2EL6 A;  2YPN A;  1T38 A;  1DI2 A;  5AE3 A;  2L3J A;  3THO B;  4JI7 I;  4HAC B;  2H36 X;  1N0U A;  1GQE A;  1PVG A;  5KL4 A;  4DV1 E;  2PNM A;  2UU9 I;  2EPR A;  5JEA C;  3CDI A;  4R2S A;  2GHF A;  4DV0 E;  4YHH I;  2EL5 A;  2DGC A;  2AJ4 A;  4OO1 E;  2YTG A;  2NUE A;  2A25 A;  2EPO A;  2CPN A;  2YWQ A;  4KHP E;  4DXL A;  4KWY A;  1NEI A;  4X64 I;  2IOQ A;  1A1I A;  2GLI A;  1IBK I;  4LF8 I;  1IQS A;  1WJP A;  2IHR 1;  4KZS A;  4RH8 A;  1X49 A;  1XHK A;  1N33 I;  3ZKD A;  2EN4 A;  1IBM I;  4NXM I;  1J5E E;  1BKN A;  2JOX A;  2MKD A;  5C0X B;  5DRQ A;  2DLK A;  1NZ0 A;  1Z1B A;  1JK2 A;  4OOG C;  4B3M I;  1RR9 A;  4JI2 E;  2EOS A;  3LTO A;  4ISA A;  5KL2 A;  4ED4 A;  1MG7 A;  2UUC E;  4P7D A;  1Y5Y A;  3B82 A;  2HK2 A;  1WXR A;  2MDR A;  2KON A;  2LV2 A;  3T1Y E;  2EOH A;  5LMU E;  3OML A;  1X5W A;  2WBU A;  3ADI A;  1ZM3 A;  2IER A;  1YYK A;  4K0K E;  5BR8 I;  5K36 D;  4WXD A;  4LF4 I;  2EN7 A;  1B63 A;  3ADL A;  4Z7Y A;  4M30 A;  5IWA I;  2RS7 A;  2N8X A;  1QZR A;  5GME A;  4LF8 E;  1WRJ A;  4R2R A;  4JI5 I;  2EPL X;  2LTS A;  4F9A B;  3VYX A;  2LUP B;  2M1S A;  3IWC A;  5ADZ A;  4B3R E;  4L8N A;  4JI1 E;  4X62 E;  1J5E I;  4R03 A;  2L2M A;  1USV A;  2UXC I;  2C38 A;  3Q6N A;  4OO1 B;  1X6H A;  3DF6 A;  3THN A;  4DKK A;  4DR7 E;  1KTV A;  4MYT A;  5K36 C;  2MC5 A;  2UXB E;  2EE8 A;  1Z59 A;  2L6M A;  2EMH A;  2FTX B;  2R1F A;  2UXD E;  4JI5 E;  3V5R A;  3Q6M A;  2EM8 A;  2BA1 D;  2EQ3 A;  4ZYH A;  4BC9 A;  4F6N A;  1N32 E;  2XEX A;  1VI7 A;  3F6H A;  5TSE A;  2V8P A;  1HNZ I;  1IBL E;  2AE8 A;  2YTP A;  2LJP A;  4HEI A;  3VYY A;  2YSO A;  1Z0C A;  4FWG A;  4JV5 E;  5C0X E;  4WUC A;  2UXD I;  2HFS A;  1RC7 A;  2YT4 A;  2EMX A;  2RTX A;  3OTO I;  1YYW A;  2LUQ A;  4JI3 I;  1PDA A;  1B69 A;  5JEA D;  1A6F A;  2PO0 A;  3J7A G;  5JEA A;  1ZM2 A;  2EN8 A;  2V34 A;  1IBL I;  2E1R A;  2MC6 A;  2B3T B;  2YSP A;  2EPX A;  1YFH A;  2PNL A;  3GLL A;  3QT7 A;  3HPS A;  2BR2 A;  1E3H A;  2GO3 A;  2NPF A;  1A1H A;  1HR0 I;  5A6B D;  3EPL A;  3MHH C;  2V85 A;  2PRT A;  2Q2E B;  4DV1 I;  2Z5C B;  2VF1 A;  1H7S A;  1KVK A;  5FLX Q;  2B7T A;  2Z5C A;  2LO3 A;  3C6M A;  1R6L A;  1NHJ A;  4FW6 A;  4X65 I;  4B3R I;  1UN6 B;  2WW4 A;  2YTQ A;  3HTX A;  4FW5 A;  2EZ6 A;  3WU3 A;  4JYA E;  1Z5C A;  3HQ1 A;  4YY3 E;  2UUB I;  1HNW E;  4MLV A;  5T6J A;  3JAM C;  2DEI A;  3T1H I;  4FW9 A;  4LF4 E;  4BBY A;  3J81 C;  2HK3 A;  3GCM A;  2EOF A;  4LFC I;  3J7A M;  1IBK E;  5A69 A;  4WXC A;  2EMA A;  2EWL A;  3PRY A;  3BGH A;  1NHI A;  4UT4 A;  1ELO A;  4LPF A;  3AUZ A;  3T1Y I;  2FGG A;  4JI8 E;  4JI0 E;  2JOB A;  2PO1 B;  1NHH A;  2K7I A;  3BF2 A;  4WFT A;  1STU A;  2VE7 C;  3P3E A;  4DPT A;  2RPC A;  5K36 A;  4DV6 E;  5AC5 A;  3V2U C;  2PNZ A;  3ECR A;  2EPU A;  4B3T E;  2LJH A;  1USU A;  2FV4 B;  4MQY A;  4FWD A;  4LF6 I;  2EPM X;  4GQU A;  3M85 D;  1OYR A;  3ZKB A;  3K85 A;  1XMO I;  4GEQ B;  1AAY A;  4DR6 E;  2EPK X;  1NCS A;  4IZJ A;  4LFB E;  2JYA A;  2V89 A;  2ZM6 E;  3K1J A;  4IZJ D;  3ADJ A;  2ODR D;  1I94 E;  1Z0V A;  1GZ6 A;  2JEB A;  2HGH A;  2B9D A;  2VQE E;  4OX9 E;  3GME A;  3PYF A;  1ZBQ A;  4X65 E;  4FN5 A;  4LCF A;  2UUA I;  3J81 Q;  3UK3 C;  5KL7 A;  3C4B A;  3JU0 A;  2HHH E;  2Z5B A;  4IJD A;  1FWK A;  3EPH A;  4R8O A;  2V2V A;  2J7K A;  1T4N A;  4M0V A;  2L2N A;  2UXB I;  5DRO A;  1H73 A;  2WCC 3;  2D9H A;  2EM6 A;  2EN2 A;  1RRE A;  2EPN A;  2O3Z A;  3PYD A;  4DUZ I;  4LF9 I;  2ZBK B;  2E5L E;  5AC4 A;  2DSY A;  1PJQ A;  1A1G A;  1WUU A;  4U3B A;  2LE2 A;  2MDG A;  1X47 A;  2WP8 A;  5DRP A;  1Y60 A;  2NAB A;  2EOO A;  1EI1 A;  4DR5 E;  3ZZU A;  3CWV A;  2EM7 A;  4IFD E;  5LL6 R;  4X66 E;  2NN6 B;  4DR7 I;  4LF7 E;  3U1Y A;  2ELZ A;  3BID A;  1DAR A;  1UDO A;  1N34 I;  2RQL A;  1RMD A;  2J7J A;  1SFE A;  4IFD C;  4ZYE A;  2EP3 A;  2NN6 F;  1MEY C;  3P3G A;  5EL9 A;  1EH6 A;  1K47 A;  3H1C A;  4GKJ E;  4Q35 B;  1ZR9 A;  4WUD A;  1HNZ E;  2CG9 A;  4P52 A;  1X6F A;  2ZM6 I;  4URL A;  1XMQ I;  2CVE A;  2DMY A;  3HPZ A;  2GPI A;  4R2A A;  2JEA B;  1FJG I;  5IWA E;  2Z5B B;  5A6B A;  2YTI A;  4MU3 A;  4DV2 I;  4DR3 I;  4R2D A;  1D6T A;  2R42 A;  5C0X F;  4USM A;  3Q1Q A;  4M9V C;  4LU9 A;  1H74 A;  1UHZ A;  4DPW A;  4LCH A;  3K17 A;  4DU8 A;  4DV5 E;  2WNR A;  1S4E A;  3M85 G;  4DUZ E;  4LF9 E;  3HJC A;  4IS1 C;  5FLX C;  2EOZ A;  2C39 A;  2O1U A;  2V2Z A;  5A6A A;  4GZN C;  3J80 C;  1Z0G A;  4JG4 A;  1IMU A;  3FIG A;  3QT6 A;  2Z5E A;  2UU9 E;  2V88 A;  4R1F A;  4I3H A;  4JI4 E;  5LMN E;  4IZK B;  2BM0 A;  3UHM A;  1X48 A;  1F2I G;  4BHC A;  1IQO A;  2PO2 B;  2CSH A;  2WBT A;  3QT5 A;  3H4L A;  4DU7 A;  4X66 I;  4F9B B;  2PO2 A;  2NN6 D;  3PYE A;  4JYA I;  4XTJ A;  1QU6 A;  2ENA A;  2EN1 A;  4AM3 A;  4MDT A;  2VQF I;  3P06 A;  2ENC A;  4AIM A;  5C0X C;  5IT9 Q;  4IZJ B;  1N36 E;  4GKK E;  3M7N D;  4DR2 E;  2CTD A;  4R2P A;  1UIL A;  1J26 A;  1UDS A;  2BA0 D;  4RHB B;  2EML A;  1H72 C;  2IES A;  2C38 B;  2JWO A;  4OO1 A;  2EFG A;  5JEA E;  4GKJ I;  2HKJ A;  3LML A;  2V86 A;  2LVH A;  1ZAA C;  2O1V A;  4JI6 E;  1YHC A;  2K4V A;  4O24 A;  2BA0 G;  2WNR B;  1A1F A;  2HJJ A;  2DMI A;  1YUJ A;  1Z0E A;  1XNQ I;  1E3P A;  3U1K A;  2CGE A;  5DNL A;  4DUY E;  4MYU A;  3F6G A;  4IZK A;  5A2Q Q;  3P1X A;  2M7Q A;  3OTO E;  2ADR A;  1EKZ A;  3K6Q A;  4WX9 A;  4DR4 E;  1TN9 A;  4QNJ A;  1YYO A;  3ZM7 A;  4YHH E;  2M4I A;  4DV0 I;  2EN6 A;  1A1K A;  4KQV A;  3C6K A;  2LTR A;  4DMI A;  1X6E A;  2UUA E;  4HY1 A;  4NHR A;  1RHY A;  4DV6 I;  4DR2 I;  1PJT A;  2J65 A;  4BCA A;  4UTG A;  1HNX I;  4FWH A;  2F4V E;  2YTF A;  4AID A;  4WSP A;  5A6K A;  4M1K A;  5K36 B;  3QT8 A;  2GQ0 A;  4DV4 E;  4LFA E;  2OI2 A;  2EOM A;  2E72 A;  1UDN A;  3D4J A;  4I8O A;  2EOX A;  4B3M E;  1I94 I;  5JEA B;  1G2F C;  1OYS A;  2NA2 A;  4HYM A;  2HKE A;  4NXM E;  4LF7 I;  2HHH I;  2JVA A;  2V87 A;  2B7V A;  2EOR A;  1XMO E;  2BR2 B;  5ELW A;  4DV5 I;  1Z5B A;  1BBG A;  3MSW A;  1Y6Z A;  4OZE A;  4BA2 B;  1T4L B;  2JEB B;  3VK6 A;  2I13 A;  1GTK A;  2EMY A;  1R6M A;  2RSM A;  1KYQ A;  4MU1 A;  4WPY A;  5GMD A;  4DPY A;  2KOU A;  2DRP A;  1YUI A;  2JR1 A;  3LPS A;  1WHQ A;  2R76 A;  5A6J A;  1XXE A;  2WZO A;  4JI7 E;  2YZT A;  2GS8 A;  1HR0 E;  3PYG A;  5F3W A;  1RQ0 A;  1TF3 A;  1Y4U A;  3PS2 A;  4DV4 I;  1HNW I;  4JI4 I;  2JPA A;  2EOE A;  2ENH A;  4TUI A;  1XNR E;  2WBS A;  4FW7 A;  5JEA F;  1MX0 A;  2EN3 A;  2VQE I;  2E1M A;  5C0X A;  1A1J A;  4LFC E;  2IOP A;  5DNX A;  2NUF A;  2EMW A;  4N4R B;  4B3S E;  2V8Q B;  2LT7 A;  3NZK A;  1H7U A;  2YU8 A;  1T39 A;  4X9J A;  2VES A;  4N3O A;  1FNM A;  4JI2 I;  2LBS B;  4DR1 I;  2PO1 A;  2EQ0 A;  4DV3 I;  4MU0 A;  4IS9 A;  2YTN A;  2JE6 A;  1AH5 A;  1DGC A;  2BV3 A;  3ZOQ B;  2CZ9 A;  4QNK A;  5DNY A;  4IFD B;  4OO1 C;  4OO1 D;  3KWR A;  5LMU I;  4LTY A;  5C0X D;  1ZBT A;  4DV7 I;  4JI0 I;  2EQ1 A;  5CFF E;  4L5N C;  2L33 A;  4MU4 A;  5LLQ A;  1DQ3 A;  4LF5 E;  4BC7 A;  4DR4 I;  1SR9 A;  2EMC A;  1N34 E;  3L00 A;  1PIE A;  1ZM9 A;  4RPF A;  1Y4S A;  4WUB A;  4BA2 A;  1ZM4 A;  4DV2 E;  2E5L I;  1MGT A;  2L2K B;  4R2C A;  1N3G A;  1YPN A;  2CT1 A;  2EJ4 A;  2BBG A;  4ZYG A;  2EM2 A;  3EPK A;  2YU5 A;  4DR5 I;  1FI4 A;  1B62 A;  2EOJ A;  1BB8 A;  3KRN A;  3PS1 A;  3AV0 A;  5KL3 A;  1MU5 A;  1UEK A;  1KJK A;  4F9C B;  4DR3 E;  2WP8 B;  1OJ4 A;  4OKG A;  2HC5 A;  2YTD A;  3B78 A;  3DJW A;  3M99 B;  4HTG A;  3ZZT A;  2F4V I;  2JP9 A;  4ZYD A;  1N32 I;  2ELY A;  4J3D A;  4Z7C A;  2N3G A;  2R3V A;  1L4S A;  3J80 Q;  4JI6 I;  2NN6 E;  5FWK A;  2YTE A;  2EOI A;  2PO0 B;  4R2E A;  4P78 A;  1S16 A;  4FK5 C;  2DLQ A;  4GKK I;  2X36 A;  5L3J A;  4NZV A;  5KL6 A;  1ZXM A;  1UDQ A;  2JE6 B;  3CDJ A;  5AE1 A;  2RS6 A;  4DPU A;  3C4T A;  2L8T A;  4IFD A;  4NXN I;  5K36 F;  2DB2 A;  3ADG A;  2EPA A;  4O43 A;  1ZU1 A;  3HKM A;  4BHB A;  2YRH A;  4O5G A;  2X7I A;  3HUL A;  4DV3 E;  2EOY A;  2EMG A;  4EMD A;  3LLH A;  3L7Z A;  4WSG A;  1P47 A;  4HXZ A;  3B8H A;  2UUC I;  4IFD D;  2HFU A;  1N36 I;  1Z0T A;  1YZ9 A;  5IT9 C;  4X8W A;  4LF6 E;  2EMZ A;  2L92 A;  4AQY E;  3L7Z B;  2EPP A;  2DEJ A;  2MKN A;  4X62 I;  4JI8 I;  4B3S I;  1WHN A;  4P7A A;  1JK1 A;  3P3C A;  2EPZ A;  3H09 A;  4NBQ A;  5AAS A;  2YRK A;  1T4O A;  4FW4 A;  3IWD A;  3DD6 A;  2LCE A;  2VRD A;  4F2J C;  4F6M A;  2EMK A;  1HNX E;  5AE2 A;  1Z0B A;  1ZXN A;  3P76 A;  4BA1 B;  2A2C A;  2O1W A;  4NXN E;  2EM9 A;  2YTJ A;  4DR6 I;  2M9A A;  1O0W A;  1IBM E;  4BS9 A;  3EPJ A;  2RSI A;  3EQ1 A;  3T1H E;  2C39 B;  3LNU A;  2EL4 A;  4JI1 I;  5A2Q C;  1FWL A; 
#chains in the Genus database with same CATH homology
 4LFA I;  4LF5 I;  2F8B A;  4KHP I;  4ZVI A;  4B3T I;  2A2D A;  3WU4 A;  4AQY I;  4Q28 A;  2ODR C;  3WU6 A;  1XNR I;  4YY3 I;  4M2Z A;  3M6A A;  1U2R A;  4WYQ B;  3RMP A;  1Z5A A;  2DIX A;  2JY9 A;  2L3C A;  4PRV A;  4PU9 A;  4HAC A;  2NUG A;  3JAM Q;  4JI3 E;  2O1T A;  1Z0W A;  2ZIT A;  2UUB E;  4PRX A;  1N33 E;  2V2Q A;  3F0N A;  2UXC E;  3IWB A;  2G7H A;  1FJG E;  3ZZ0 A;  1HK7 A;  4USK A;  3WU5 A;  2VF3 A;  4JV5 I;  2BM1 A;  1FKA E;  2KHX A;  4DV7 E;  4DUY I;  3JTZ A;  1KIJ A;  1EA6 A;  1XMQ E;  5BR8 E;  4K0K I;  2VQF E;  2LMZ A;  1KKH A;  4TUG A;  1N0V C;  3HXL A;  4BMJ A;  4F54 A;  1XNQ E;  4J8Z A;  2N3H A;  3GON A;  4DPX A;  1PKP A;  2V83 A;  4LFB I;  5LMN I;  4DR1 E;  2LRS A;  1VIS A;  4OX9 I;  4X64 E;  3J7Y p;  1DI2 A;  5AE3 A;  2L3J A;  4JI7 I;  4HAC B;  2H36 X;  1N0U A;  1GQE A;  1PVG A;  2PNM A;  4DV1 E;  2UU9 I;  4DV0 E;  4YHH I;  2AJ4 A;  2NUE A;  1HNX I;  2CPN A;  4KHP E;  4DXL A;  4LF8 I;  4X64 I;  2IOQ A;  1IBK I;  2IHR 1;  4KZS A;  1X49 A;  1XHK A;  1N33 I;  3ZKD A;  1IBM I;  4NXM I;  1J5E E;  1BKN A;  2JOX A;  1NZ0 A;  4OOG C;  4B3M I;  1RR9 A;  4JI2 E;  4ED4 A;  3LTO A;  1MG7 A;  2UUC E;  4P7D A;  3B82 A;  2HK2 A;  1WXR A;  2MDR A;  2KON A;  3T1Y E;  5LMU E;  1ZM3 A;  3OML A;  3ADI A;  1YYK A;  4K0K E;  5BR8 I;  4LF4 I;  1B63 A;  3ADL A;  4Z7Y A;  4M30 A;  5IWA I;  2RS7 A;  1QZR A;  5GME A;  4LF8 E;  4JI5 I;  2LTS A;  4F9A B;  3VYX A;  2LUP B;  2M1S A;  3IWC A;  5ADZ A;  4B3R E;  4L8N A;  4JI1 E;  4X62 E;  1J5E I;  4R03 A;  2L2M A;  1USV A;  2UXC I;  3Q6N A;  4DR7 E;  4DKK A;  3DF6 A;  1KTV A;  4MYT A;  2MC5 A;  2UXB E;  1Z59 A;  2L6M A;  2FTX B;  2UXD E;  4JI5 E;  3V5R A;  3Q6M A;  4BC9 A;  1N32 E;  2XEX A;  3F6H A;  2V8P A;  1HNZ I;  1IBL E;  2LJP A;  3VYY A;  1Z0C A;  4FWG A;  4JV5 E;  2UXD I;  4WUC A;  2HFS A;  1RC7 A;  2YT4 A;  2RTX A;  3OTO I;  1YYW A;  2LUQ A;  4JI3 I;  1A6F A;  3J7A G;  1ZM2 A;  2V34 A;  1IBL I;  2E1R A;  2MC6 A;  2B3T B;  2PNL A;  3QT7 A;  3HPS A;  2NPF A;  1HR0 I;  2V85 A;  2Q2E B;  4DV1 I;  2Z5C B;  2VF1 A;  1H7S A;  1KVK A;  5FLX Q;  2B7T A;  2Z5C A;  1NHJ A;  4X65 I;  4B3R I;  2WW4 A;  3HTX A;  2EZ6 A;  3WU3 A;  4JYA E;  1Z5C A;  3HQ1 A;  4YY3 E;  2UUB I;  1HNW E;  5T6J A;  3JAM C;  2DEI A;  3T1H I;  4FW9 A;  4LF4 E;  4BBY A;  3J81 C;  2HK3 A;  3J7A M;  4LFC I;  1IBK E;  2EWL A;  3PRY A;  1NHI A;  4UT4 A;  1ELO A;  3T1Y I;  3AUZ A;  2FGG A;  4JI8 E;  4JI0 E;  2JOB A;  1NHH A;  4WFT A;  1STU A;  2VE7 C;  4DPT A;  4DV6 E;  3V2U C;  1USU A;  4B3T E;  2LJH A;  2FV4 B;  4FWD A;  4LF6 I;  3ZKB A;  3K85 A;  1XMO I;  4GEQ B;  4DR6 E;  4IZJ A;  4LFB E;  3K1J A;  2V89 A;  2ZM6 E;  4IZJ D;  3ADJ A;  2ODR D;  1I94 E;  1Z0V A;  1GZ6 A;  3PYF A;  2B9D A;  2VQE E;  4OX9 E;  2UUA I;  1ZBQ A;  4X65 E;  4FN5 A;  3J81 Q;  2Z5B A;  3C4B A;  3JU0 A;  2HHH E;  1FWK A;  4R8O A;  2V2V A;  2J7K A;  1T4N A;  4M0V A;  2L2N A;  2UXB I;  1H73 A;  4DUZ I;  1RRE A;  4LF9 I;  3PYD A;  2ZBK B;  2E5L E;  2DSY A;  1WUU A;  2LE2 A;  1X47 A;  1EI1 A;  4DR5 E;  3ZZU A;  3CWV A;  5LL6 R;  4X66 E;  4DR7 I;  4LF7 E;  1DAR A;  1N34 I;  1K47 A;  4GKJ E;  4WUD A;  1HNZ E;  2CG9 A;  4P52 A;  1XMQ I;  2ZM6 I;  4URL A;  1FJG I;  2DMY A;  3HPZ A;  5IWA E;  2Z5B B;  4DV2 I;  4DR3 I;  1D6T A;  2R42 A;  4USM A;  3Q1Q A;  1H74 A;  4LU9 A;  1UHZ A;  4DPW A;  3K17 A;  4DU8 A;  4DV5 E;  1S4E A;  4DUZ E;  4LF9 E;  3HJC A;  5FLX C;  2O1U A;  2V2Z A;  3J80 C;  1Z0G A;  4JG4 A;  3FIG A;  3QT6 A;  2Z5E A;  2UU9 E;  2V88 A;  4R1F A;  4I3H A;  4JI4 E;  5LMN E;  4IZK B;  2BM0 A;  1X48 A;  3QT5 A;  3H4L A;  4DU7 A;  4X66 I;  4F9B B;  3PYE A;  4JYA I;  4XTJ A;  1QU6 A;  2VQF I;  3P06 A;  5IT9 Q;  4IZJ B;  1N36 E;  4GKK E;  4DR2 E;  1J26 A;  1UIL A;  1H72 C;  2JWO A;  2EFG A;  4GKJ I;  2HKJ A;  3LML A;  2V86 A;  2O1V A;  4JI6 E;  2K4V A;  1Z0E A;  1XNQ I;  2CGE A;  4DUY E;  4MYU A;  3F6G A;  4IZK A;  5A2Q Q;  3P1X A;  2M7Q A;  3OTO E;  1EKZ A;  3K6Q A;  4DR4 E;  1YYO A;  3ZM7 A;  4YHH E;  2M4I A;  4DV0 I;  4KQV A;  4DMI A;  2LTR A;  2UUA E;  4HY1 A;  4DV6 I;  4DR2 I;  4BCA A;  4UTG A;  4FWH A;  2F4V E;  4WSP A;  4M1K A;  3QT8 A;  2GQ0 A;  4DV4 E;  4LFA E;  2OI2 A;  3D4J A;  4I8O A;  4B3M E;  1I94 I;  2NA2 A;  4HYM A;  2HKE A;  4NXM E;  4LF7 I;  2HHH I;  2JVA A;  2V87 A;  2B7V A;  1XMO E;  4DV5 I;  1Z5B A;  1Y6Z A;  3MSW A;  1T4L B;  3VK6 A;  2RSM A;  5GMD A;  4WPY A;  4DPY A;  2KOU A;  2JR1 A;  3LPS A;  1WHQ A;  2WZO A;  4JI7 E;  2YZT A;  2GS8 A;  1HR0 E;  3PYG A;  5F3W A;  1RQ0 A;  1Y4U A;  4DV4 I;  1HNW I;  4JI4 I;  4TUI A;  1XNR E;  1MX0 A;  2VQE I;  2E1M A;  4LFC E;  2IOP A;  2NUF A;  4B3S E;  2V8Q B;  1H7U A;  4N3O A;  1FNM A;  4JI2 I;  2LBS B;  4DR1 I;  4DV3 I;  2BV3 A;  3ZOQ B;  2CZ9 A;  5DNY A;  3KWR A;  5LMU I;  4LTY A;  1ZBT A;  4DV7 I;  4JI0 I;  5CFF E;  4L5N C;  2L33 A;  1DQ3 A;  4LF5 E;  4BC7 A;  4DR4 I;  1SR9 A;  1N34 E;  1PIE A;  1ZM9 A;  4RPF A;  1Y4S A;  4WUB A;  1ZM4 A;  4DV2 E;  2E5L I;  2L2K B;  4DR5 I;  1FI4 A;  1B62 A;  3AV0 A;  1MU5 A;  1UEK A;  4F9C B;  4DR3 E;  1OJ4 A;  3B78 A;  3DJW A;  3ZZT A;  2F4V I;  1N32 I;  4Z7C A;  2N3G A;  2R3V A;  3J80 Q;  4JI6 I;  5FWK A;  4P78 A;  1S16 A;  4GKK I;  2X36 A;  5L3J A;  1ZXM A;  4DPU A;  5AE1 A;  2RS6 A;  3C4T A;  2L8T A;  4NXN I;  2DB2 A;  3ADG A;  2X7I A;  3HUL A;  4DV3 E;  4EMD A;  3LLH A;  4HXZ A;  3B8H A;  2UUC I;  2HFU A;  1N36 I;  1Z0T A;  1YZ9 A;  5IT9 C;  4X8W A;  4LF6 E;  2L92 A;  4AQY E;  2DEJ A;  4X62 I;  4JI8 I;  4B3S I;  1WHN A;  4P7A A;  3H09 A;  5AAS A;  1T4O A;  3IWD A;  1HNX E;  1ZXN A;  5AE2 A;  1Z0B A;  2A2C A;  2O1W A;  4NXN E;  4DR6 I;  1O0W A;  1IBM E;  4BS9 A;  3LNU A;  4JI1 I;  3T1H E;  5A2Q C;  1FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...