1HNWE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnwE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwE02
1N36E 2WW4A 4HY1A 1D6TA 1HNWI 1N36I 1IBKI 4JI0E 1EA6A 1HNXE 1NHIA 4DR3E 1HNZE 5IT9Q 4DR3I 4FWHA 4DPWA 1T4NA 2LTSA 1S4EA 4PRVA 3P1XA 2L33A 3QT8A 1N33E 3ADIA 4X64E 1ZM2A 1N33I 3PYEA 1FWKA 3K1JA 3ZKDA 3QT5A 3PYDA 4GKKI 4LFCE 4LFCI 3T1HI 1YYWA 2LJHA 2VQFE 4GKJE 4OOGC 2VQFI 4WYQB 1H74A 2DIXA 4GKJI 4JI3I 4LF6E 1Z0BA 5GMEA 2EFGA 4DR4E 4Z7YA 4X65I 4AQYI 4LFAE 4DR4I 4UT4A 4FWDA 4LFAI 2LUQA 2HK3A 4ED4A 1XHKA 4LF8E 2V2ZA 2HHHE 2E1RA 3B8HA 2RSMA 3CWVA 2HKEA 2HHHI 3D4JA 1Z0VA 4MYUA 3ZZTA 3ADJA 1EI1A 4XTJA 3WU3A 1B62A 1ZXMA 2CPNA 4DUZI 1Z0GA 3J7AM 4DU8A 1XMQE 2LUPB 4DV4I 4USMA 2UXBE 4USKA 4DUYE 3C4TA 3ZM7A 2UXBI 4DUYI 1WUUA 1ZM9A 1N32E 3WU6A 1KVKA 2UUAE 4DU7A 3QT6A 4DV7I 2UUAI 4K0KE 1STUA 4DR7I 1Z5BA 1X47A 4K0KI 1DI2A 1ELOA 3F0NA 2IHR1 4LF5I 4MYTA 3WU5A 4JI1E 2KHXA 1EKZA 4JI1I 2B7TA 4JI4E 4JI2I 1IBLE 2ZITA 2RS6A 1KKHA 1PKPA 1IBLI 2UU9E 4B3SE 2UU9I 1FWLA 2L2NA 2BV3A 4DPXA 4B3SI 4X62I 3VYYA 4YHHI 1HNWE 2OI2A 1IBKE 4JI6I 2N3GA 4LF9E 3B78A 4LF9I 1PIEA 3J7AG 2UUCE 3C4BA 5FLXQ 4OX9E 3T1YE 2UUCI 3V5RA 4OX9I 3T1YI 4DV0E 3M6AA 4JYAI 4DV0I 5IT9C 4M1KA 3ZZ0A 3VYXA 2UXCE 5IWAI 3OTOE 1DARA 2UXCI 2X36A 4ZVIA 3HTXA 4GKKE 3OTOI 1YYKA 4WUCA 3T1HE 3PYFA 4B3TI 2YT4A 4DPYA 4KQVA 1T4OA 2JY9A 1Z5AA 4HACB 4HXZA 4DXLA 3V2UC 4JI3E 1XNRI 4X65E 4AQYE 1RR9A 2J7KA 3ADLA 4JI5I 2LBSB 2DEJA 4P7AA 2L2KB 4WUBA 4HACA 2E5LI 1A6FA 4B3RI 1MU5A 3K17A 2N3HA 4LF4E 2NUGA 1J26A 2HK2A 1B63A 4LF4I 1Z0WA 4DUZE 1YYOA 2VQEE 4PU9A 1XMOE 5L3JA 5GMDA 1HR0E 4DV4E 2VQEI 1WHNA 1XMOI 5LL6R 1HR0I 4M30A 3HULA 1FI4A 1O0WA 3J80Q 4X8WA 2BM1A 2EZ6A 2NPFA 5A2QQ 4JI8E 1KTVA 2DB2A 4NXNI 4DV7E 4JI8I 3LNUA 3LLHA 2RS7A 1OJ4A 4LFBE 4DR7E 2B3TB 1N34I 4JV5I 1X48A 4DV5E 4JG4A 4LFBI 1QU6A 5LMNI 4DV5I 4HYMA 4LF5E 1H73A 1NHHA 1J5EI 4NXMI 4KHPE 2ZM6I 3J7Yp 1MG7A 4KHPI 2L2MA 1ZM3A 5BR8E 4DKKA 4DV2I 1Z0CA 5LMUE 4JI2E 1H72C 5BR8I 1BKNA 5LMUI 1XNQI 1H7UA 1Z5CA 2F4VI 4UTGA 1NZ0A 2DEIA 1GQEA 1S16A 4X62E 4Z7CA 1VISA 2L3JA 4YHHE 4WFTA 4YY3E 4DPTA 4JI6E 1ZM4A 4YY3I 1FJGI 4DV3I 4B3MI 3ZZUA 3LTOA 2A2CA 1N0VC 1K47A 4DR2E 2R42A 4DR2I 4FW9A 1U2RA 2V2VA 4FWGA 1RC7A 4JYAE 4DV6E 4LF7E 4X66E 4DV6I 4LF7I 4DV1E 2NA2A 4X66I 5IWAE 5FLXC 4RPFA 1UILA 4DV1I 2R3VA 1T4LB 3PYGA 4FN5A 4JI0I 1WHQA 1IBME 1HNXI 1Z0TA 2HFUA 1IBMI 2V34A 3LPSA 1HNZI 4R1FA 4B3TE 2V8PA 3ZKBA 2A2DA 4WUDA 4EMDA 1XNRE 1ZXNA 2AJ4A 2JVAA 2LRSA 2HKJA 4X64I 2GS8A 4JI5E 1N0UA 2UUBE 2E5LE 2NUFA 4URLA 1H7SA 1FKAE 4B3RE 3JAMQ 4DPUA 2UUBI 2CZ9A 4M2ZA 2B7VA 3JAMC 4DR5E 4JI7E 4DR6E 2X7IA 2LJPA 4DR5I 4JI7I 4DR6I 2ZBKB 2MDRA 4LF6I 4PRXA 3WU4A 3H4LA 2V2QA 3ADGA 1NHJA 3Q1QA 4NXNE 4LF8I 4JV5E 2HFSA 1N34E 1Z0EA 1UEKA 3J80C 3J81Q 3B82A 4P52A 5LMNE 5A2QC 2LTRA 1J5EE 4NXME 3QT7A 1XMQI 2ZM6E 3GONA 3J81C 2L3CA 1ZBTA 4DV2E 2BM0A 1RREA 1XNQE 2UXDE 1X49A 1N32I 2F4VE 2UXDI 5CFFE 2DMYA 1MX0A 1Z59A 2XEXA 1FJGE 1I94E 1QZRA 4DV3E 4B3ME 1I94I 1UHZA 2RTXA 1YZ9A 4JI4I 4DR1E 1KIJA 2NUEA 4DR1I 2VF3A 4I3HA 1FNMA 1RQ0A 2Q2EB 1PVGA
chains in the Genus database with same CATH superfamily
2V87A 1N36E 2WW4A 4HY1A 2EN7A 1D6TA 1HNWI 1N3GA 1N36I 3PRYA 4JI0E 1EA6A 2PRTA 1IBKI 1OYRA 2YTPA 1P42A 1HNXE 1NHIA 2EL6A 4DR3E 2EOQA 3L7ZA 2EMLA 2LCEA 4QNKA 1HNZE 5IT9Q 2Q8UA 4DR3I 2DMIA 2YZTA 3BIDA 4HEIA 1LLMC 4FWHA 4DPWA 3HJCA 4LU9A 1T4NA 2EPZA 2J7JA 2LTSA 2BR2A 1R6MA 2CG9A 5DNLA 1RMDA 1S4EA 4PRVA 3P1XA 1KJKA 2L33A 2YSPA 4WSPA 2WCC3 1L4SA 1N33E 3QT8A 3M7ND 5C0XB 4BA1A 3ADIA 4X64E 2BB8A 2HJJA 3RMPA 1ZM2A 3P3GA 3OMLA 3PYEA 1N33I 2V8QB 2YTOA 4BC9A 1FWKA 3IWDA 3K1JA 4FW5A 2Z5BA 1PJTA 4BA2B 3ZKDA 2EPRA 3QT5A 2JOXA 5A6AA 4FW6A 2EMAA 3PYDA 2YTIA 2Z5CB 5IXMB 1P47A 4GKKI 3Q6NA 4LFCE 1GZ6A 2RQLA 2C38B 4MQYA 2PNZB 5C0XD 4LFCI 3T1HI 2N8XA 5AE2A 1YYWA 2PO1B 2LJHA 4R2DA 4IS1C 2WZOA 2EN2A 2V89A 4P7DA 2VQFE 4R2CA 2WNRB 2EL4A 4FK5C 4GKJE 4OOGC 2VQFI 4WYQB 1H74A 2DIXA 4GKJI 2EOIA 2EOMA 4JI3I 3HPZA 4LF6E 1Z0BA 2ODRD 2EFGA 4DR4E 4Z7YA 5GMEA 4AIDA 2DLKA 4N3OA 4X65I 4AQYI 4LFAE 5JEAC 4DR4I 1YH8A 2EM2A 1R6LA 4UT4A 2IERA 2CSHA 4FWDA 4LFAI 2NN6F 2LUQA 2GO4A 2HK3A 4ED4A 3QG5C 1NEIA 1XHKA 4LF8E 2V2ZA 2EOXA 5KL6A 2HHHE 2E1RA 1RHYA 3B8HA 2RSMA 2LV2A 3CWVA 1SR9A 3F6GA 2V86A 2HKEA 2HHHI 3D4JA 1Z0VA 4MYUA 3ZZTA 4F2JC 3ADJA 1WJPA 1EI1A 1GTKA 4XTJA 3WU3A 1B62A 2B9DA 4J8ZA 1ZXMA 4U3DA 2CPNA 4M9VC 4IFDC 4DUZI 2R76A 3MHHC 2LT7A 1Z0GA 3J7AM 4DU8A 1EH7A 1XMQE 3P3EA 1X6EA 2LUPB 4DV4I 2EPMX 4USMA 4KWYA 4HTGA 2UXBE 4USKA 4DUYE 3C6MA 4O5GA 5KL2A 3C4TA 3ZM7A 2ADRA 1Y6ZA 2UXBI 2JXPA 4DUYI 1WUUA 1ZM9A 4WXDA 4BS9A 1N32E 1VI7A 1JK2A 3WU6A 2C37B 2BA0D 1KVKA 2WP8A 2F8BA 2UUAE 1UDSA 3K6QA 4DU7A 3P3CA 2YRKA 3QT6A 2D9HA 2NN6E 4DV7I 2CGEA 2RPCA 2UUAI 1G2DC 4K0KE 1STUA 1X6HA 4DR7I 1Z5BA 4O24A 1X47A 4K0KI 3DJWA 1DI2A 1ELOA 4Q28A 1A1IA 4LCFA 3AUZA 3F0NA 2JE6B 4AM3A 2GO3A 2IHR1 4F6NA 4LF5I 4LTYA 5JEAE 1T38A 4FW7A 2MKNA 4MYTA 2YPNA 1Y4SA 4LPFA 3WU5A 4NBQA 4JI1E 2KHXA 1EKZA 4R8OA 4OZEA 4OO1A 1IQSA 4JI1I 2B7TA 1Y5YA 4JI4E 2BA1G 4JI2I 2EPAA 1IBLE 2ZITA 2RS6A 1KKHA 1USVA 1PKPA 2CTDA 4GEQB 1IBLI 2RSIA 2H36X 2E72A 2UU9E 2YRMA 4B3SE 3PS3A 4R2QA 5DRPA 2UU9I 3JTZA 1FWLA 2L2NA 1IQOA 2BV3A 4DPXA 4B3SI 2LMZA 1NCSA 4MLVA 2NN6B 4X62I 1UN6B 3VYYA 1E3PA 4YHHI 5IV8B 2PO2A 1HNWE 2EM0A 1UDNA 2OI2A 1IBKE 4JI6I 2YTFA 1IMUA 2N3GA 3TQMA 2EPPA 4RHBB 5ADZA 2C39A 3M7NG 1YUIA 4LF9E 3B78A 1AAYA 2EM7A 3PS2A 3L00A 4LF9I 1Z1BA 5JEAB 1PIEA 4BC7A 1T39A 2IESA 2YU5A 3J7AG 2YU8A 2UUCE 3C4BA 2YTJA 5FLXQ 1TN9A 4OX9E 4BHCA 3T1YE 2Z5EA 3KWRA 3JU0A 4R03A 1PDAA 1MEYC 3V5RA 2UUCI 1BBOA 4OX9I 3T1YI 2PO0B 4DV0E 1YPNA 4TUGA 3M6AA 2JPAA 4O43A 5KL4A 4JYAI 5DNXA 1DGCA 1TF6A 3THOB 5IT9C 4DV0I 4M1KA 3ZZ0A 1B69A 3VYXA 2YWQA 4RH8A 2JEAB 1ZU1A 5JEAD 2UXCE 5IWAI 4IFDB 2F1DA 3OTOE 2PNMA 1DARA 2UXCI 2X36A 4ZVIA 3HTXA 5KL5A 3MSWA 4GKKE 2E1MA 4QNJA 5C0XA 3OTOI 1YYKA 4F9AB 4WUCA 3T1HE 2EM9A 2YRHA 2FV4B 2EM5A 2CVEA 3KZYA 2EOHA 3PYFA 4B3TI 2YT4A 4DPYA 4BA2A 4KQVA 1T4OA 3U1YA 4IFDA 2NN6C 2JY9A 1Z5AA 1EH6A 2EPCA 4HACB 4HXZA 3MHSC 4L8NA 4DXLA 4AIMA 3EPHA 3GMEA 3V2UC 4JI3E 4MU0A 4MU3A 4IFDD 2EN3A 1XNRI 2Z5CA 1JK1A 3GCMA 4X65E 3HQ1A 4AQYE 2C38A 2PNZA 1RR9A 2J7KA 4OO1F 3ADLA 2EN6A 2LBSB 2DEJA 4JI5I 4P7AA 2PO1A 2L2KB 4WUBA 4HACA 2E5LI 2EPXA 1A6FA 2EJ4A 2YSOA 4IJDA 2O1TA 5K36F 4B3RI 2EQ0A 1MU5A 2EMXA 2M1SA 2N3HA 2WNRA 3K17A 1ZR9A 1KYQA 4NZVA 3PS1A 2EQ3A 5A6BA 4LF4E 3DF6A 1OYSA 2NUGA 4R2EA 1J26A 3DD6A 4R2SA 1UBDC 3VHTB 2HK2A 1B63A 4LF4I 1Z0WA 5A6BD 2L6MA 4DUZE 2EOJA 1YSAC 1YYOA 4ZYEA 2JP9A 2VQEE 4PU9A 1QNTA 5KL7A 1XMOE 3EPKA 5L3JA 3U1KA 3BF2A 2BA0G 3KRNA 5GMDA 4DV4E 1HR0E 2ENHA 2YTNA 2ENCA 1WHNA 2VQEI 1XMOI 5LL6R 1AH5A 1EH8A 4M30A 2EM8A 3HULA 1HR0I 1FI4A 1Y60A 4ISAA 4FW3A 1O0WA 4IS9A 3J80Q 4X8WA 2BM1A 4LCHA 1BBGA 2EZ6A 2EOOA 1ZAAC 3IWCA 5A6JA 2MDGA 4OO1E 2NPFA 5A2QQ 3IWBA 4F9BB 4JI8E 1KTVA 2DB2A 2EMKA 4IZJB 4NXNI 2EPOA 4DV7E 4JI8I 1PJSA 4BCAA 3LNUA 5K36E 2MKDA 3LLHA 2EMZA 2RS7A 1OJ4A 4LFBE 4DR7E 2B3TB 4LCGA 1N34I 4JV5I 2GLIA 3F6HA 5T6JA 2LVHA 5DROA 4O4KA 1X48A 4DV5E 4JG4A 5A6KA 4LFBI 2EM4A 3HKMA 1QU6A 2DLQA 5LMNI 2JEBB 4DV5I 2EMGA 4HYMA 4LF5E 3EPLA 2M9AA 2C37A 1H73A 1NHHA 1J5EI 2EQ1A 4NXMI 5C0XF 3K85A 2FGGA 4KHPE 4IZJD 2ZM6I 3J7Yp 3P06A 1MG7A 4KHPI 1X6FA 2L2MA 5AC5A 1A1KA 1ZM3A 5BR8E 4DKKA 4DV2I 1Z0CA 1E3HA 3M85D 5LMUE 4JI2E 1H72C 3AV0A 1BKNA 5DNYA 5BR8I 2IOQA 5LMUI 2JE6A 1XNQI 1H7UA 2EM3A 1G2FC 1Z5CA 4L5NC 2F4VI 1A1LA 4UTGA 4ZYDA 3GLLA 2J65A 1NZ0A 2EMWA 2VESA 2DEIA 1GQEA 1S16A 2JOBA 4X62E 4Z7CA 1DQ3A 1VISA 2L3JA 4WFTA 4YY3E 4YHHE 4DPTA 3LMLA 2M4IA 4WSGA 2EE8A 2EOSA 5AE1A 4JI6E 1ZM4A 4YY3I 1FJGI 2JT2A 4WXCA 4BBYA 4DV3I 4B3MI 3ZZUA 2A2CA 3LTOA 4Q35B 1N0VC 4GQUA 2WBSA 1K47A 2NN6A 1X3CA 2EMFA 2I9IA 4R2PA 4DR2E 2R42A 2IOPA 4X9JA 3UHMA 3UK3C 4DR2I 4F6MA 4FW9A 1U2RA 4U3BA 2NN6D 2KONA 2V2VA 1YUJA 5LLQA 4FWGA 1RC7A 4I8OA 4JYAE 3L7ZB 3CDJA 5DRQA 4DV6E 4LF7E 5EL9A 2EPLX 4X66E 5JEAA 4DV6I 4LF7I 4DV1E 2NA2A 3KZZA 2EPKX 1A1JA 2CT1A 4X66I 2BR2B 5IWAE 2EN8A 5FLXC 4RPFA 1UILA 4DV1I 1UDQA 2R3VA 1T4LB 3PYGA 4FN5A 4JI0I 4N4RB 1WHQA 2PO0A 1IBME 4BA1B 1HNXI 2LJUA 1Z0TA 2HFUA 2ELYA 1IBMI 4OKGA 2EOYA 2V34A 2HC5A 3M99B 3LPSA 2EMIA 4R1FA 1HNZI 4OO1C 4B3TE 4IZKB 2V8PA 2WBTA 2Z5BB 4WPYA 3ZKBA 2JEAA 2YTGA 2EOFA 3EQ1A 3BGHA 2A2DA 5K36C 4WUDA 2EORA 4EMDA 2ELZA 1Y4UA 5ELWA 1A1FA 1XNRE 3CDIA 1ZXNA 2AJ4A 2JVAA 1ZBQA 4GZNC 2LRSA 2HKJA 4X64I 4MLQA 1MGTA 2GS8A 4JI5E 5EKWA 1N0UA 4IZKA 1HK7A 5KL3A 1TF3A 2UUBE 2EMYA 2E5LE 2NUFA 4URLA 1H7SA 3NZKA 1FKAE 4B3RE 3JAMQ 4DPUA 2I13A 2UUBI 3THNA 2CZ9A 2V85A 2B7VA 4M2ZA 4J3DA 3Q6MA 4F9CB 4BHBA 3C6KA 2EMHA 4DMIA 2NABA 2O3ZA 2L8TA 2EP3A 3JAMC 2L92A 3P76A 5AASA 4DR5E 4JI7E 4DR6E 2JR1A 2X7IA 3HXLA 2YTDA 2LJPA 4DR5I 4JI7I 4DR6I 5AE3A 2M7QA 2ZBKB 2YTQA 3H1CA 2DSYA 2VF1A 2MDRA 4LF6I 2YTEA 2EOZA 2EMBA 1YHCA 4PRXA 4BMJA 1WRJA 4ZYGA 2V83A 3WU4A 3H4LA 2O1WA 1XXEA 2V2QA 3ADGA 2BBGA 1NHJA 3Q1QA 2GHFA 4NXNE 2O1VA 2EPNA 4LF8I 5F3WA 5C0XC 2WBUA 2JWOA 4MDTA 4JV5E 2ENAA 2HFSA 1N34E 2VE7C 5JEAF 2EM6A 2K7IA 1UEKA 2MC6A 3J80C 2MC5A 1USUA 1Z0EA 3B82A 3J81Q 1BB8A 5FWKA 4KZSA 3M85G 4P52A 5LMNE 4WX9A 1YFHA 2EOEA 4M0VA 2LTRA 5A2QC 2ODRC 1J5EE 2A25A 4NXME 2DGCA 2WP8B 2HGHA 4FW4A 4IZJA 3QT7A 1XMQI 2GPIA 2ZM6E 4ZYHA 3GONA 5TSEA 3J81C 2LO3A 2L3CA 1ZBTA 1SFEA 3FIGA 4DV2E 3EPJA 3H09A 2BM0A 1A1GA 1RREA 4LOMA 2O1UA 4IFDF 1PJQA 4P78A 2JEBA 4NHRA 1XNQE 2PNLA 2UXDE 1X49A 1N32I 2EL5A 2F4VE 2UXDI 5CFFE 3ECRA 2JYAA 2V88A 2DMYA 1A1HA 5DRRA 3BBGA 4OO1B 1MX0A 2EN1A 2EN4A 2EPUA 2GQ0A 2G7HA 4MU4A 1Z59A 2XEXA 5K36B 1FJGE 1I94E 1QZRA 4F54A 2R1FA 4DV3E 4B3ME 2EMCA 1I94I 1UHZA 2RTXA 1YZ9A 3ZOQB 4TUIA 2KOUA 3HPSA 5C0XE 5A69A 2FTXB 2AE8A 2VRDA 4OO1D 5K36A 4JI4I 1F2IG 2PO2B 1UDOA 3B4TA 4DR1E 5AC4A 2LE2A 4R2AA 3VK6A 1KIJA 2C39B 5K36D 1X5WA 2EWLA 2NUEA 4DR1I 4IFDE 2VF3A 4I3HA 1OYPA 1WXRA 2DRPA 1FNMA 1RQ0A 2K4VA 2Q2EB 1PVGA 4R2RA 4MU1A 2BA1D
chains in the Genus database with same CATH topology
2V87A 1N36E 2WW4A 4HY1A 1D6TA 1HNWI 1N36I 3PRYA 4JI0E 1EA6A 1IBKI 1HNXE 1NHIA 4DR3E 1HNZE 5IT9Q 4DR3I 2YZTA 4FWHA 4DPWA 3HJCA 4LU9A 1T4NA 2LTSA 2CG9A 1S4EA 4PRVA 3P1XA 2L33A 4WSPA 3QT8A 1N33E 3ADIA 4X64E 3RMPA 1ZM2A 1N33I 3OMLA 3PYEA 2V8QB 4BC9A 1FWKA 3IWDA 3K1JA 2Z5BA 3ZKDA 3QT5A 2JOXA 3PYDA 2Z5CB 4GKKI 3Q6NA 4LFCE 1GZ6A 4LFCI 3T1HI 5AE2A 1YYWA 2LJHA 2WZOA 4P7DA 2V89A 2VQFE 4GKJE 4OOGC 2VQFI 4WYQB 1H74A 2DIXA 4GKJI 4JI3I 3HPZA 4LF6E 1Z0BA 2ODRD 2EFGA 4DR4E 4Z7YA 5GMEA 4N3OA 4X65I 4AQYI 4LFAE 4DR4I 4UT4A 4FWDA 4LFAI 2LUQA 2HK3A 4ED4A 1XHKA 4LF8E 2V2ZA 2HHHE 2E1RA 3B8HA 2RSMA 3CWVA 1SR9A 3F6GA 2V86A 2HKEA 2HHHI 3D4JA 1Z0VA 4MYUA 3ZZTA 3ADJA 1EI1A 4XTJA 3WU3A 1B62A 2B9DA 4J8ZA 1ZXMA 2CPNA 4DUZI 1Z0GA 3J7AM 4DU8A 1XMQE 2LUPB 4DV4I 4USMA 2UXBE 4USKA 4DUYE 3C4TA 3ZM7A 1Y6ZA 2UXBI 4DUYI 1WUUA 1ZM9A 4BS9A 1N32E 3WU6A 1KVKA 2F8BA 2UUAE 3K6QA 4DU7A 3QT6A 4DV7I 2CGEA 2UUAI 4K0KE 1STUA 4DR7I 1Z5BA 1X47A 4K0KI 3DJWA 1DI2A 1ELOA 4Q28A 3AUZA 3F0NA 2IHR1 4LF5I 4LTYA 4MYTA 1Y4SA 3WU5A 4JI1E 2KHXA 1EKZA 4R8OA 4JI1I 2B7TA 4JI4E 4JI2I 1IBLE 2ZITA 2RS6A 1KKHA 1USVA 1PKPA 4GEQB 1IBLI 2H36X 2UU9E 4B3SE 2UU9I 3JTZA 1FWLA 2L2NA 2BV3A 4DPXA 4B3SI 2LMZA 4X62I 3VYYA 4YHHI 1HNWE 2OI2A 1IBKE 4JI6I 2N3GA 5ADZA 4LF9E 3B78A 4LF9I 1PIEA 4BC7A 3J7AG 2UUCE 3C4BA 5FLXQ 4OX9E 3T1YE 2Z5EA 3KWRA 3JU0A 4R03A 3V5RA 2UUCI 4OX9I 3T1YI 4DV0E 4TUGA 3M6AA 4JYAI 4DV0I 5IT9C 4M1KA 3ZZ0A 3VYXA 2UXCE 5IWAI 3OTOE 2PNMA 1DARA 2UXCI 2X36A 4ZVIA 3HTXA 3MSWA 4GKKE 2E1MA 3OTOI 1YYKA 4F9AB 4WUCA 3T1HE 2FV4B 3PYFA 4B3TI 2YT4A 4DPYA 4KQVA 1T4OA 2JY9A 1Z5AA 4HACB 4HXZA 4DXLA 4L8NA 3V2UC 4JI3E 1XNRI 2Z5CA 4X65E 3HQ1A 4AQYE 1RR9A 2J7KA 3ADLA 4JI5I 2LBSB 2DEJA 4P7AA 2L2KB 4WUBA 4HACA 2E5LI 1A6FA 2O1TA 4B3RI 1MU5A 2M1SA 2N3HA 3K17A 4LF4E 3DF6A 2NUGA 1J26A 2HK2A 1B63A 4LF4I 1Z0WA 2L6MA 4DUZE 1YYOA 2VQEE 4PU9A 1XMOE 5L3JA 5GMDA 1HR0E 4DV4E 2VQEI 1WHNA 1XMOI 5LL6R 1HR0I 4M30A 3HULA 1FI4A 1O0WA 3J80Q 4X8WA 2BM1A 2EZ6A 3IWCA 2NPFA 5A2QQ 3IWBA 4F9BB 4JI8E 1KTVA 2DB2A 4IZJB 4NXNI 4DV7E 4JI8I 4BCAA 3LNUA 3LLHA 2RS7A 1OJ4A 4LFBE 4DR7E 2B3TB 1N34I 4JV5I 3F6HA 5T6JA 1X48A 4DV5E 4JG4A 4LFBI 1QU6A 5LMNI 4DV5I 4HYMA 4LF5E 1H73A 1NHHA 1J5EI 4NXMI 3K85A 2FGGA 4KHPE 4IZJD 2ZM6I 3J7Yp 3P06A 1MG7A 4KHPI 2L2MA 1ZM3A 5BR8E 4DKKA 4DV2I 1Z0CA 5LMUE 4JI2E 1H72C 3AV0A 1BKNA 5DNYA 5BR8I 5LMUI 1XNQI 1H7UA 1Z5CA 4L5NC 2F4VI 4UTGA 1NZ0A 2DEIA 1GQEA 1S16A 2JOBA 4X62E 4Z7CA 1DQ3A 1VISA 2L3JA 4WFTA 4YY3E 4YHHE 4DPTA 3LMLA 2M4IA 5AE1A 4JI6E 1ZM4A 4YY3I 1FJGI 4BBYA 4DV3I 4B3MI 3ZZUA 2A2CA 3LTOA 1N0VC 1K47A 4DR2E 2R42A 2IOPA 4DR2I 4FW9A 1U2RA 2KONA 2V2VA 4FWGA 1RC7A 4I8OA 4JYAE 4DV6E 4LF7E 4X66E 4DV6I 4LF7I 4DV1E 2NA2A 4X66I 5IWAE 5FLXC 4RPFA 1UILA 4DV1I 2R3VA 1T4LB 3PYGA 4FN5A 4JI0I 1WHQA 1IBME 1HNXI 1Z0TA 2HFUA 1IBMI 2V34A 3LPSA 1HNZI 4R1FA 4B3TE 4IZKB 2V8PA 2Z5BB 4WPYA 3ZKBA 2A2DA 4WUDA 4EMDA 1Y4UA 1XNRE 1ZXNA 2AJ4A 2JVAA 1ZBQA 2LRSA 2HKJA 4X64I 2GS8A 4JI5E 1N0UA 4IZKA 1HK7A 2UUBE 2E5LE 2NUFA 4URLA 1H7SA 1FKAE 4B3RE 3JAMQ 4DPUA 2UUBI 2CZ9A 2V85A 2B7VA 4M2ZA 3Q6MA 4F9CB 4DMIA 2L8TA 3JAMC 2L92A 5AASA 4DR5E 4JI7E 4DR6E 2JR1A 2X7IA 3HXLA 2LJPA 4DR5I 4JI7I 4DR6I 5AE3A 2M7QA 2ZBKB 2DSYA 2VF1A 2MDRA 4LF6I 4PRXA 4BMJA 2V83A 3WU4A 3H4LA 2O1WA 2V2QA 3ADGA 1NHJA 3Q1QA 4NXNE 2O1VA 4LF8I 5F3WA 2JWOA 4JV5E 2HFSA 1N34E 2VE7C 1Z0EA 1UEKA 2MC6A 3J80C 2MC5A 1USUA 3J81Q 3B82A 5FWKA 4KZSA 4P52A 5LMNE 4M0VA 5A2QC 2LTRA 2ODRC 1J5EE 4NXME 4IZJA 3QT7A 1XMQI 2ZM6E 3GONA 3J81C 2L3CA 1ZBTA 3FIGA 4DV2E 3H09A 2BM0A 1RREA 2O1UA 4P78A 1XNQE 2PNLA 2UXDE 1X49A 1N32I 2F4VE 2UXDI 5CFFE 2V88A 2DMYA 1MX0A 2GQ0A 2G7HA 1Z59A 2XEXA 1FJGE 1I94E 1QZRA 4F54A 4DV3E 4B3ME 1I94I 1UHZA 2RTXA 1YZ9A 3ZOQB 4TUIA 2KOUA 3HPSA 2FTXB 4JI4I 4DR1E 2LE2A 3VK6A 1KIJA 2EWLA 2NUEA 4DR1I 2VF3A 4I3HA 1WXRA 1FNMA 1RQ0A 2K4VA 2Q2EB 1PVGA 2IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 E;  2WW4 A;  4HY1 A;  1D6T A;  1HNW I;  1N36 I;  1IBK I;  4JI0 E;  1EA6 A;  1HNX E;  1NHI A;  4DR3 E;  1HNZ E;  5IT9 Q;  4DR3 I;  4FWH A;  4DPW A;  1T4N A;  2LTS A;  1S4E A;  4PRV A;  3P1X A;  2L33 A;  3QT8 A;  1N33 E;  3ADI A;  4X64 E;  1ZM2 A;  1N33 I;  3PYE A;  1FWK A;  3K1J A;  3ZKD A;  3QT5 A;  3PYD A;  4GKK I;  4LFC E;  4LFC I;  3T1H I;  1YYW A;  2LJH A;  2VQF E;  4GKJ E;  4OOG C;  2VQF I;  4WYQ B;  1H74 A;  2DIX A;  4GKJ I;  4JI3 I;  4LF6 E;  1Z0B A;  5GME A;  2EFG A;  4DR4 E;  4Z7Y A;  4X65 I;  4AQY I;  4LFA E;  4DR4 I;  4UT4 A;  4FWD A;  4LFA I;  2LUQ A;  2HK3 A;  4ED4 A;  1XHK A;  4LF8 E;  2V2Z A;  2HHH E;  2E1R A;  3B8H A;  2RSM A;  3CWV A;  2HKE A;  2HHH I;  3D4J A;  1Z0V A;  4MYU A;  3ZZT A;  3ADJ A;  1EI1 A;  4XTJ A;  3WU3 A;  1B62 A;  1ZXM A;  2CPN A;  4DUZ I;  1Z0G A;  3J7A M;  4DU8 A;  1XMQ E;  2LUP B;  4DV4 I;  4USM A;  2UXB E;  4USK A;  4DUY E;  3C4T A;  3ZM7 A;  2UXB I;  4DUY I;  1WUU A;  1ZM9 A;  1N32 E;  3WU6 A;  1KVK A;  2UUA E;  4DU7 A;  3QT6 A;  4DV7 I;  2UUA I;  4K0K E;  1STU A;  4DR7 I;  1Z5B A;  1X47 A;  4K0K I;  1DI2 A;  1ELO A;  3F0N A;  2IHR 1;  4LF5 I;  4MYT A;  3WU5 A;  4JI1 E;  2KHX A;  1EKZ A;  4JI1 I;  2B7T A;  4JI4 E;  4JI2 I;  1IBL E;  2ZIT A;  2RS6 A;  1KKH A;  1PKP A;  1IBL I;  2UU9 E;  4B3S E;  2UU9 I;  1FWL A;  2L2N A;  2BV3 A;  4DPX A;  4B3S I;  4X62 I;  3VYY A;  4YHH I;  1HNW E;  2OI2 A;  1IBK E;  4JI6 I;  2N3G A;  4LF9 E;  3B78 A;  4LF9 I;  1PIE A;  3J7A G;  2UUC E;  3C4B A;  5FLX Q;  4OX9 E;  3T1Y E;  2UUC I;  3V5R A;  4OX9 I;  3T1Y I;  4DV0 E;  3M6A A;  4JYA I;  4DV0 I;  5IT9 C;  4M1K A;  3ZZ0 A;  3VYX A;  2UXC E;  5IWA I;  3OTO E;  1DAR A;  2UXC I;  2X36 A;  4ZVI A;  3HTX A;  4GKK E;  3OTO I;  1YYK A;  4WUC A;  3T1H E;  3PYF A;  4B3T I;  2YT4 A;  4DPY A;  4KQV A;  1T4O A;  2JY9 A;  1Z5A A;  4HAC B;  4HXZ A;  4DXL A;  3V2U C;  4JI3 E;  1XNR I;  4X65 E;  4AQY E;  1RR9 A;  2J7K A;  3ADL A;  4JI5 I;  2LBS B;  2DEJ A;  4P7A A;  2L2K B;  4WUB A;  4HAC A;  2E5L I;  1A6F A;  4B3R I;  1MU5 A;  3K17 A;  2N3H A;  4LF4 E;  2NUG A;  1J26 A;  2HK2 A;  1B63 A;  4LF4 I;  1Z0W A;  4DUZ E;  1YYO A;  2VQE E;  4PU9 A;  1XMO E;  5L3J A;  5GMD A;  1HR0 E;  4DV4 E;  2VQE I;  1WHN A;  1XMO I;  5LL6 R;  1HR0 I;  4M30 A;  3HUL A;  1FI4 A;  1O0W A;  3J80 Q;  4X8W A;  2BM1 A;  2EZ6 A;  2NPF A;  5A2Q Q;  4JI8 E;  1KTV A;  2DB2 A;  4NXN I;  4DV7 E;  4JI8 I;  3LNU A;  3LLH A;  2RS7 A;  1OJ4 A;  4LFB E;  4DR7 E;  2B3T B;  1N34 I;  4JV5 I;  1X48 A;  4DV5 E;  4JG4 A;  4LFB I;  1QU6 A;  5LMN I;  4DV5 I;  4HYM A;  4LF5 E;  1H73 A;  1NHH A;  1J5E I;  4NXM I;  4KHP E;  2ZM6 I;  3J7Y p;  1MG7 A;  4KHP I;  2L2M A;  1ZM3 A;  5BR8 E;  4DKK A;  4DV2 I;  1Z0C A;  5LMU E;  4JI2 E;  1H72 C;  5BR8 I;  1BKN A;  5LMU I;  1XNQ I;  1H7U A;  1Z5C A;  2F4V I;  4UTG A;  1NZ0 A;  2DEI A;  1GQE A;  1S16 A;  4X62 E;  4Z7C A;  1VIS A;  2L3J A;  4YHH E;  4WFT A;  4YY3 E;  4DPT A;  4JI6 E;  1ZM4 A;  4YY3 I;  1FJG I;  4DV3 I;  4B3M I;  3ZZU A;  3LTO A;  2A2C A;  1N0V C;  1K47 A;  4DR2 E;  2R42 A;  4DR2 I;  4FW9 A;  1U2R A;  2V2V A;  4FWG A;  1RC7 A;  4JYA E;  4DV6 E;  4LF7 E;  4X66 E;  4DV6 I;  4LF7 I;  4DV1 E;  2NA2 A;  4X66 I;  5IWA E;  5FLX C;  4RPF A;  1UIL A;  4DV1 I;  2R3V A;  1T4L B;  3PYG A;  4FN5 A;  4JI0 I;  1WHQ A;  1IBM E;  1HNX I;  1Z0T A;  2HFU A;  1IBM I;  2V34 A;  3LPS A;  1HNZ I;  4R1F A;  4B3T E;  2V8P A;  3ZKB A;  2A2D A;  4WUD A;  4EMD A;  1XNR E;  1ZXN A;  2AJ4 A;  2JVA A;  2LRS A;  2HKJ A;  4X64 I;  2GS8 A;  4JI5 E;  1N0U A;  2UUB E;  2E5L E;  2NUF A;  4URL A;  1H7S A;  1FKA E;  4B3R E;  3JAM Q;  4DPU A;  2UUB I;  2CZ9 A;  4M2Z A;  2B7V A;  3JAM C;  4DR5 E;  4JI7 E;  4DR6 E;  2X7I A;  2LJP A;  4DR5 I;  4JI7 I;  4DR6 I;  2ZBK B;  2MDR A;  4LF6 I;  4PRX A;  3WU4 A;  3H4L A;  2V2Q A;  3ADG A;  1NHJ A;  3Q1Q A;  4NXN E;  4LF8 I;  4JV5 E;  2HFS A;  1N34 E;  1Z0E A;  1UEK A;  3J80 C;  3J81 Q;  3B82 A;  4P52 A;  5LMN E;  5A2Q C;  2LTR A;  1J5E E;  4NXM E;  3QT7 A;  1XMQ I;  2ZM6 E;  3GON A;  3J81 C;  2L3C A;  1ZBT A;  4DV2 E;  2BM0 A;  1RRE A;  1XNQ E;  2UXD E;  1X49 A;  1N32 I;  2F4V E;  2UXD I;  5CFF E;  2DMY A;  1MX0 A;  1Z59 A;  2XEX A;  1FJG E;  1I94 E;  1QZR A;  4DV3 E;  4B3M E;  1I94 I;  1UHZ A;  2RTX A;  1YZ9 A;  4JI4 I;  4DR1 E;  1KIJ A;  2NUE A;  4DR1 I;  2VF3 A;  4I3H A;  1FNM A;  1RQ0 A;  2Q2E B;  1PVG A; 
#chains in the Genus database with same CATH topology
 2V87 A;  1N36 E;  2WW4 A;  4HY1 A;  2EN7 A;  1D6T A;  1HNW I;  1N3G A;  1N36 I;  3PRY A;  4JI0 E;  1EA6 A;  2PRT A;  1IBK I;  1OYR A;  2YTP A;  1P42 A;  1HNX E;  1NHI A;  2EL6 A;  4DR3 E;  2EOQ A;  3L7Z A;  2EML A;  2LCE A;  4QNK A;  1HNZ E;  5IT9 Q;  2Q8U A;  4DR3 I;  2DMI A;  2YZT A;  3BID A;  4HEI A;  1LLM C;  4FWH A;  4DPW A;  3HJC A;  4LU9 A;  1T4N A;  2EPZ A;  2J7J A;  2LTS A;  2BR2 A;  1R6M A;  2CG9 A;  5DNL A;  1RMD A;  1S4E A;  4PRV A;  3P1X A;  1KJK A;  2L33 A;  2YSP A;  4WSP A;  2WCC 3;  1L4S A;  1N33 E;  3QT8 A;  3M7N D;  5C0X B;  4BA1 A;  3ADI A;  4X64 E;  2BB8 A;  2HJJ A;  3RMP A;  1ZM2 A;  3P3G A;  3OML A;  3PYE A;  1N33 I;  2V8Q B;  2YTO A;  4BC9 A;  1FWK A;  3IWD A;  3K1J A;  4FW5 A;  2Z5B A;  1PJT A;  4BA2 B;  3ZKD A;  2EPR A;  3QT5 A;  2JOX A;  5A6A A;  4FW6 A;  2EMA A;  3PYD A;  2YTI A;  2Z5C B;  5IXM B;  1P47 A;  4GKK I;  3Q6N A;  4LFC E;  1GZ6 A;  2RQL A;  2C38 B;  4MQY A;  2PNZ B;  5C0X D;  4LFC I;  3T1H I;  2N8X A;  5AE2 A;  1YYW A;  2PO1 B;  2LJH A;  4R2D A;  4IS1 C;  2WZO A;  2EN2 A;  2V89 A;  4P7D A;  2VQF E;  4R2C A;  2WNR B;  2EL4 A;  4FK5 C;  4GKJ E;  4OOG C;  2VQF I;  4WYQ B;  1H74 A;  2DIX A;  4GKJ I;  2EOI A;  2EOM A;  4JI3 I;  3HPZ A;  4LF6 E;  1Z0B A;  2ODR D;  2EFG A;  4DR4 E;  4Z7Y A;  5GME A;  4AID A;  2DLK A;  4N3O A;  4X65 I;  4AQY I;  4LFA E;  5JEA C;  4DR4 I;  1YH8 A;  2EM2 A;  1R6L A;  4UT4 A;  2IER A;  2CSH A;  4FWD A;  4LFA I;  2NN6 F;  2LUQ A;  2GO4 A;  2HK3 A;  4ED4 A;  3QG5 C;  1NEI A;  1XHK A;  4LF8 E;  2V2Z A;  2EOX A;  5KL6 A;  2HHH E;  2E1R A;  1RHY A;  3B8H A;  2RSM A;  2LV2 A;  3CWV A;  1SR9 A;  3F6G A;  2V86 A;  2HKE A;  2HHH I;  3D4J A;  1Z0V A;  4MYU A;  3ZZT A;  4F2J C;  3ADJ A;  1WJP A;  1EI1 A;  1GTK A;  4XTJ A;  3WU3 A;  1B62 A;  2B9D A;  4J8Z A;  1ZXM A;  4U3D A;  2CPN A;  4M9V C;  4IFD C;  4DUZ I;  2R76 A;  3MHH C;  2LT7 A;  1Z0G A;  3J7A M;  4DU8 A;  1EH7 A;  1XMQ E;  3P3E A;  1X6E A;  2LUP B;  4DV4 I;  2EPM X;  4USM A;  4KWY A;  4HTG A;  2UXB E;  4USK A;  4DUY E;  3C6M A;  4O5G A;  5KL2 A;  3C4T A;  3ZM7 A;  2ADR A;  1Y6Z A;  2UXB I;  2JXP A;  4DUY I;  1WUU A;  1ZM9 A;  4WXD A;  4BS9 A;  1N32 E;  1VI7 A;  1JK2 A;  3WU6 A;  2C37 B;  2BA0 D;  1KVK A;  2WP8 A;  2F8B A;  2UUA E;  1UDS A;  3K6Q A;  4DU7 A;  3P3C A;  2YRK A;  3QT6 A;  2D9H A;  2NN6 E;  4DV7 I;  2CGE A;  2RPC A;  2UUA I;  1G2D C;  4K0K E;  1STU A;  1X6H A;  4DR7 I;  1Z5B A;  4O24 A;  1X47 A;  4K0K I;  3DJW A;  1DI2 A;  1ELO A;  4Q28 A;  1A1I A;  4LCF A;  3AUZ A;  3F0N A;  2JE6 B;  4AM3 A;  2GO3 A;  2IHR 1;  4F6N A;  4LF5 I;  4LTY A;  5JEA E;  1T38 A;  4FW7 A;  2MKN A;  4MYT A;  2YPN A;  1Y4S A;  4LPF A;  3WU5 A;  4NBQ A;  4JI1 E;  2KHX A;  1EKZ A;  4R8O A;  4OZE A;  4OO1 A;  1IQS A;  4JI1 I;  2B7T A;  1Y5Y A;  4JI4 E;  2BA1 G;  4JI2 I;  2EPA A;  1IBL E;  2ZIT A;  2RS6 A;  1KKH A;  1USV A;  1PKP A;  2CTD A;  4GEQ B;  1IBL I;  2RSI A;  2H36 X;  2E72 A;  2UU9 E;  2YRM A;  4B3S E;  3PS3 A;  4R2Q A;  5DRP A;  2UU9 I;  3JTZ A;  1FWL A;  2L2N A;  1IQO A;  2BV3 A;  4DPX A;  4B3S I;  2LMZ A;  1NCS A;  4MLV A;  2NN6 B;  4X62 I;  1UN6 B;  3VYY A;  1E3P A;  4YHH I;  5IV8 B;  2PO2 A;  1HNW E;  2EM0 A;  1UDN A;  2OI2 A;  1IBK E;  4JI6 I;  2YTF A;  1IMU A;  2N3G A;  3TQM A;  2EPP A;  4RHB B;  5ADZ A;  2C39 A;  3M7N G;  1YUI A;  4LF9 E;  3B78 A;  1AAY A;  2EM7 A;  3PS2 A;  3L00 A;  4LF9 I;  1Z1B A;  5JEA B;  1PIE A;  4BC7 A;  1T39 A;  2IES A;  2YU5 A;  3J7A G;  2YU8 A;  2UUC E;  3C4B A;  2YTJ A;  5FLX Q;  1TN9 A;  4OX9 E;  4BHC A;  3T1Y E;  2Z5E A;  3KWR A;  3JU0 A;  4R03 A;  1PDA A;  1MEY C;  3V5R A;  2UUC I;  1BBO A;  4OX9 I;  3T1Y I;  2PO0 B;  4DV0 E;  1YPN A;  4TUG A;  3M6A A;  2JPA A;  4O43 A;  5KL4 A;  4JYA I;  5DNX A;  1DGC A;  1TF6 A;  3THO B;  5IT9 C;  4DV0 I;  4M1K A;  3ZZ0 A;  1B69 A;  3VYX A;  2YWQ A;  4RH8 A;  2JEA B;  1ZU1 A;  5JEA D;  2UXC E;  5IWA I;  4IFD B;  2F1D A;  3OTO E;  2PNM A;  1DAR A;  2UXC I;  2X36 A;  4ZVI A;  3HTX A;  5KL5 A;  3MSW A;  4GKK E;  2E1M A;  4QNJ A;  5C0X A;  3OTO I;  1YYK A;  4F9A B;  4WUC A;  3T1H E;  2EM9 A;  2YRH A;  2FV4 B;  2EM5 A;  2CVE A;  3KZY A;  2EOH A;  3PYF A;  4B3T I;  2YT4 A;  4DPY A;  4BA2 A;  4KQV A;  1T4O A;  3U1Y A;  4IFD A;  2NN6 C;  2JY9 A;  1Z5A A;  1EH6 A;  2EPC A;  4HAC B;  4HXZ A;  3MHS C;  4L8N A;  4DXL A;  4AIM A;  3EPH A;  3GME A;  3V2U C;  4JI3 E;  4MU0 A;  4MU3 A;  4IFD D;  2EN3 A;  1XNR I;  2Z5C A;  1JK1 A;  3GCM A;  4X65 E;  3HQ1 A;  4AQY E;  2C38 A;  2PNZ A;  1RR9 A;  2J7K A;  4OO1 F;  3ADL A;  2EN6 A;  2LBS B;  2DEJ A;  4JI5 I;  4P7A A;  2PO1 A;  2L2K B;  4WUB A;  4HAC A;  2E5L I;  2EPX A;  1A6F A;  2EJ4 A;  2YSO A;  4IJD A;  2O1T A;  5K36 F;  4B3R I;  2EQ0 A;  1MU5 A;  2EMX A;  2M1S A;  2N3H A;  2WNR A;  3K17 A;  1ZR9 A;  1KYQ A;  4NZV A;  3PS1 A;  2EQ3 A;  5A6B A;  4LF4 E;  3DF6 A;  1OYS A;  2NUG A;  4R2E A;  1J26 A;  3DD6 A;  4R2S A;  1UBD C;  3VHT B;  2HK2 A;  1B63 A;  4LF4 I;  1Z0W A;  5A6B D;  2L6M A;  4DUZ E;  2EOJ A;  1YSA C;  1YYO A;  4ZYE A;  2JP9 A;  2VQE E;  4PU9 A;  1QNT A;  5KL7 A;  1XMO E;  3EPK A;  5L3J A;  3U1K A;  3BF2 A;  2BA0 G;  3KRN A;  5GMD A;  4DV4 E;  1HR0 E;  2ENH A;  2YTN A;  2ENC A;  1WHN A;  2VQE I;  1XMO I;  5LL6 R;  1AH5 A;  1EH8 A;  4M30 A;  2EM8 A;  3HUL A;  1HR0 I;  1FI4 A;  1Y60 A;  4ISA A;  4FW3 A;  1O0W A;  4IS9 A;  3J80 Q;  4X8W A;  2BM1 A;  4LCH A;  1BBG A;  2EZ6 A;  2EOO A;  1ZAA C;  3IWC A;  5A6J A;  2MDG A;  4OO1 E;  2NPF A;  5A2Q Q;  3IWB A;  4F9B B;  4JI8 E;  1KTV A;  2DB2 A;  2EMK A;  4IZJ B;  4NXN I;  2EPO A;  4DV7 E;  4JI8 I;  1PJS A;  4BCA A;  3LNU A;  5K36 E;  2MKD A;  3LLH A;  2EMZ A;  2RS7 A;  1OJ4 A;  4LFB E;  4DR7 E;  2B3T B;  4LCG A;  1N34 I;  4JV5 I;  2GLI A;  3F6H A;  5T6J A;  2LVH A;  5DRO A;  4O4K A;  1X48 A;  4DV5 E;  4JG4 A;  5A6K A;  4LFB I;  2EM4 A;  3HKM A;  1QU6 A;  2DLQ A;  5LMN I;  2JEB B;  4DV5 I;  2EMG A;  4HYM A;  4LF5 E;  3EPL A;  2M9A A;  2C37 A;  1H73 A;  1NHH A;  1J5E I;  2EQ1 A;  4NXM I;  5C0X F;  3K85 A;  2FGG A;  4KHP E;  4IZJ D;  2ZM6 I;  3J7Y p;  3P06 A;  1MG7 A;  4KHP I;  1X6F A;  2L2M A;  5AC5 A;  1A1K A;  1ZM3 A;  5BR8 E;  4DKK A;  4DV2 I;  1Z0C A;  1E3H A;  3M85 D;  5LMU E;  4JI2 E;  1H72 C;  3AV0 A;  1BKN A;  5DNY A;  5BR8 I;  2IOQ A;  5LMU I;  2JE6 A;  1XNQ I;  1H7U A;  2EM3 A;  1G2F C;  1Z5C A;  4L5N C;  2F4V I;  1A1L A;  4UTG A;  4ZYD A;  3GLL A;  2J65 A;  1NZ0 A;  2EMW A;  2VES A;  2DEI A;  1GQE A;  1S16 A;  2JOB A;  4X62 E;  4Z7C A;  1DQ3 A;  1VIS A;  2L3J A;  4WFT A;  4YY3 E;  4YHH E;  4DPT A;  3LML A;  2M4I A;  4WSG A;  2EE8 A;  2EOS A;  5AE1 A;  4JI6 E;  1ZM4 A;  4YY3 I;  1FJG I;  2JT2 A;  4WXC A;  4BBY A;  4DV3 I;  4B3M I;  3ZZU A;  2A2C A;  3LTO A;  4Q35 B;  1N0V C;  4GQU A;  2WBS A;  1K47 A;  2NN6 A;  1X3C A;  2EMF A;  2I9I A;  4R2P A;  4DR2 E;  2R42 A;  2IOP A;  4X9J A;  3UHM A;  3UK3 C;  4DR2 I;  4F6M A;  4FW9 A;  1U2R A;  4U3B A;  2NN6 D;  2KON A;  2V2V A;  1YUJ A;  5LLQ A;  4FWG A;  1RC7 A;  4I8O A;  4JYA E;  3L7Z B;  3CDJ A;  5DRQ A;  4DV6 E;  4LF7 E;  5EL9 A;  2EPL X;  4X66 E;  5JEA A;  4DV6 I;  4LF7 I;  4DV1 E;  2NA2 A;  3KZZ A;  2EPK X;  1A1J A;  2CT1 A;  4X66 I;  2BR2 B;  5IWA E;  2EN8 A;  5FLX C;  4RPF A;  1UIL A;  4DV1 I;  1UDQ A;  2R3V A;  1T4L B;  3PYG A;  4FN5 A;  4JI0 I;  4N4R B;  1WHQ A;  2PO0 A;  1IBM E;  4BA1 B;  1HNX I;  2LJU A;  1Z0T A;  2HFU A;  2ELY A;  1IBM I;  4OKG A;  2EOY A;  2V34 A;  2HC5 A;  3M99 B;  3LPS A;  2EMI A;  4R1F A;  1HNZ I;  4OO1 C;  4B3T E;  4IZK B;  2V8P A;  2WBT A;  2Z5B B;  4WPY A;  3ZKB A;  2JEA A;  2YTG A;  2EOF A;  3EQ1 A;  3BGH A;  2A2D A;  5K36 C;  4WUD A;  2EOR A;  4EMD A;  2ELZ A;  1Y4U A;  5ELW A;  1A1F A;  1XNR E;  3CDI A;  1ZXN A;  2AJ4 A;  2JVA A;  1ZBQ A;  4GZN C;  2LRS A;  2HKJ A;  4X64 I;  4MLQ A;  1MGT A;  2GS8 A;  4JI5 E;  5EKW A;  1N0U A;  4IZK A;  1HK7 A;  5KL3 A;  1TF3 A;  2UUB E;  2EMY A;  2E5L E;  2NUF A;  4URL A;  1H7S A;  3NZK A;  1FKA E;  4B3R E;  3JAM Q;  4DPU A;  2I13 A;  2UUB I;  3THN A;  2CZ9 A;  2V85 A;  2B7V A;  4M2Z A;  4J3D A;  3Q6M A;  4F9C B;  4BHB A;  3C6K A;  2EMH A;  4DMI A;  2NAB A;  2O3Z A;  2L8T A;  2EP3 A;  3JAM C;  2L92 A;  3P76 A;  5AAS A;  4DR5 E;  4JI7 E;  4DR6 E;  2JR1 A;  2X7I A;  3HXL A;  2YTD A;  2LJP A;  4DR5 I;  4JI7 I;  4DR6 I;  5AE3 A;  2M7Q A;  2ZBK B;  2YTQ A;  3H1C A;  2DSY A;  2VF1 A;  2MDR A;  4LF6 I;  2YTE A;  2EOZ A;  2EMB A;  1YHC A;  4PRX A;  4BMJ A;  1WRJ A;  4ZYG A;  2V83 A;  3WU4 A;  3H4L A;  2O1W A;  1XXE A;  2V2Q A;  3ADG A;  2BBG A;  1NHJ A;  3Q1Q A;  2GHF A;  4NXN E;  2O1V A;  2EPN A;  4LF8 I;  5F3W A;  5C0X C;  2WBU A;  2JWO A;  4MDT A;  4JV5 E;  2ENA A;  2HFS A;  1N34 E;  2VE7 C;  5JEA F;  2EM6 A;  2K7I A;  1UEK A;  2MC6 A;  3J80 C;  2MC5 A;  1USU A;  1Z0E A;  3B82 A;  3J81 Q;  1BB8 A;  5FWK A;  4KZS A;  3M85 G;  4P52 A;  5LMN E;  4WX9 A;  1YFH A;  2EOE A;  4M0V A;  2LTR A;  5A2Q C;  2ODR C;  1J5E E;  2A25 A;  4NXM E;  2DGC A;  2WP8 B;  2HGH A;  4FW4 A;  4IZJ A;  3QT7 A;  1XMQ I;  2GPI A;  2ZM6 E;  4ZYH A;  3GON A;  5TSE A;  3J81 C;  2LO3 A;  2L3C A;  1ZBT A;  1SFE A;  3FIG A;  4DV2 E;  3EPJ A;  3H09 A;  2BM0 A;  1A1G A;  1RRE A;  4LOM A;  2O1U A;  4IFD F;  1PJQ A;  4P78 A;  2JEB A;  4NHR A;  1XNQ E;  2PNL A;  2UXD E;  1X49 A;  1N32 I;  2EL5 A;  2F4V E;  2UXD I;  5CFF E;  3ECR A;  2JYA A;  2V88 A;  2DMY A;  1A1H A;  5DRR A;  3BBG A;  4OO1 B;  1MX0 A;  2EN1 A;  2EN4 A;  2EPU A;  2GQ0 A;  2G7H A;  4MU4 A;  1Z59 A;  2XEX A;  5K36 B;  1FJG E;  1I94 E;  1QZR A;  4F54 A;  2R1F A;  4DV3 E;  4B3M E;  2EMC A;  1I94 I;  1UHZ A;  2RTX A;  1YZ9 A;  3ZOQ B;  4TUI A;  2KOU A;  3HPS A;  5C0X E;  5A69 A;  2FTX B;  2AE8 A;  2VRD A;  4OO1 D;  5K36 A;  4JI4 I;  1F2I G;  2PO2 B;  1UDO A;  3B4T A;  4DR1 E;  5AC4 A;  2LE2 A;  4R2A A;  3VK6 A;  1KIJ A;  2C39 B;  5K36 D;  1X5W A;  2EWL A;  2NUE A;  4DR1 I;  4IFD E;  2VF3 A;  4I3H A;  1OYP A;  1WXR A;  2DRP A;  1FNM A;  1RQ0 A;  2K4V A;  2Q2E B;  1PVG A;  4R2R A;  4MU1 A;  2BA1 D; 
#chains in the Genus database with same CATH homology
 2V87 A;  1N36 E;  2WW4 A;  4HY1 A;  1D6T A;  1HNW I;  1N36 I;  3PRY A;  4JI0 E;  1EA6 A;  1IBK I;  1HNX E;  1NHI A;  4DR3 E;  1HNZ E;  5IT9 Q;  4DR3 I;  2YZT A;  4FWH A;  4DPW A;  3HJC A;  4LU9 A;  1T4N A;  2LTS A;  2CG9 A;  1S4E A;  4PRV A;  3P1X A;  2L33 A;  4WSP A;  3QT8 A;  1N33 E;  3ADI A;  4X64 E;  3RMP A;  1ZM2 A;  1N33 I;  3OML A;  3PYE A;  2V8Q B;  4BC9 A;  1FWK A;  3IWD A;  3K1J A;  2Z5B A;  3ZKD A;  3QT5 A;  2JOX A;  3PYD A;  2Z5C B;  4GKK I;  3Q6N A;  4LFC E;  1GZ6 A;  4LFC I;  3T1H I;  5AE2 A;  1YYW A;  2LJH A;  2WZO A;  4P7D A;  2V89 A;  2VQF E;  4GKJ E;  4OOG C;  2VQF I;  4WYQ B;  1H74 A;  2DIX A;  4GKJ I;  4JI3 I;  3HPZ A;  4LF6 E;  1Z0B A;  2ODR D;  2EFG A;  4DR4 E;  4Z7Y A;  5GME A;  4N3O A;  4X65 I;  4AQY I;  4LFA E;  4DR4 I;  4UT4 A;  4FWD A;  4LFA I;  2LUQ A;  2HK3 A;  4ED4 A;  1XHK A;  4LF8 E;  2V2Z A;  2HHH E;  2E1R A;  3B8H A;  2RSM A;  3CWV A;  1SR9 A;  3F6G A;  2V86 A;  2HKE A;  2HHH I;  3D4J A;  1Z0V A;  4MYU A;  3ZZT A;  3ADJ A;  1EI1 A;  4XTJ A;  3WU3 A;  1B62 A;  2B9D A;  4J8Z A;  1ZXM A;  2CPN A;  4DUZ I;  1Z0G A;  3J7A M;  4DU8 A;  1XMQ E;  2LUP B;  4DV4 I;  4USM A;  2UXB E;  4USK A;  4DUY E;  3C4T A;  3ZM7 A;  1Y6Z A;  2UXB I;  4DUY I;  1WUU A;  1ZM9 A;  4BS9 A;  1N32 E;  3WU6 A;  1KVK A;  2F8B A;  2UUA E;  3K6Q A;  4DU7 A;  3QT6 A;  4DV7 I;  2CGE A;  2UUA I;  4K0K E;  1STU A;  4DR7 I;  1Z5B A;  1X47 A;  4K0K I;  3DJW A;  1DI2 A;  1ELO A;  4Q28 A;  3AUZ A;  3F0N A;  2IHR 1;  4LF5 I;  4LTY A;  4MYT A;  1Y4S A;  3WU5 A;  4JI1 E;  2KHX A;  1EKZ A;  4R8O A;  4JI1 I;  2B7T A;  4JI4 E;  4JI2 I;  1IBL E;  2ZIT A;  2RS6 A;  1KKH A;  1USV A;  1PKP A;  4GEQ B;  1IBL I;  2H36 X;  2UU9 E;  4B3S E;  2UU9 I;  3JTZ A;  1FWL A;  2L2N A;  2BV3 A;  4DPX A;  4B3S I;  2LMZ A;  4X62 I;  3VYY A;  4YHH I;  1HNW E;  2OI2 A;  1IBK E;  4JI6 I;  2N3G A;  5ADZ A;  4LF9 E;  3B78 A;  4LF9 I;  1PIE A;  4BC7 A;  3J7A G;  2UUC E;  3C4B A;  5FLX Q;  4OX9 E;  3T1Y E;  2Z5E A;  3KWR A;  3JU0 A;  4R03 A;  3V5R A;  2UUC I;  4OX9 I;  3T1Y I;  4DV0 E;  4TUG A;  3M6A A;  4JYA I;  4DV0 I;  5IT9 C;  4M1K A;  3ZZ0 A;  3VYX A;  2UXC E;  5IWA I;  3OTO E;  2PNM A;  1DAR A;  2UXC I;  2X36 A;  4ZVI A;  3HTX A;  3MSW A;  4GKK E;  2E1M A;  3OTO I;  1YYK A;  4F9A B;  4WUC A;  3T1H E;  2FV4 B;  3PYF A;  4B3T I;  2YT4 A;  4DPY A;  4KQV A;  1T4O A;  2JY9 A;  1Z5A A;  4HAC B;  4HXZ A;  4DXL A;  4L8N A;  3V2U C;  4JI3 E;  1XNR I;  2Z5C A;  4X65 E;  3HQ1 A;  4AQY E;  1RR9 A;  2J7K A;  3ADL A;  4JI5 I;  2LBS B;  2DEJ A;  4P7A A;  2L2K B;  4WUB A;  4HAC A;  2E5L I;  1A6F A;  2O1T A;  4B3R I;  1MU5 A;  2M1S A;  2N3H A;  3K17 A;  4LF4 E;  3DF6 A;  2NUG A;  1J26 A;  2HK2 A;  1B63 A;  4LF4 I;  1Z0W A;  2L6M A;  4DUZ E;  1YYO A;  2VQE E;  4PU9 A;  1XMO E;  5L3J A;  5GMD A;  1HR0 E;  4DV4 E;  2VQE I;  1WHN A;  1XMO I;  5LL6 R;  1HR0 I;  4M30 A;  3HUL A;  1FI4 A;  1O0W A;  3J80 Q;  4X8W A;  2BM1 A;  2EZ6 A;  3IWC A;  2NPF A;  5A2Q Q;  3IWB A;  4F9B B;  4JI8 E;  1KTV A;  2DB2 A;  4IZJ B;  4NXN I;  4DV7 E;  4JI8 I;  4BCA A;  3LNU A;  3LLH A;  2RS7 A;  1OJ4 A;  4LFB E;  4DR7 E;  2B3T B;  1N34 I;  4JV5 I;  3F6H A;  5T6J A;  1X48 A;  4DV5 E;  4JG4 A;  4LFB I;  1QU6 A;  5LMN I;  4DV5 I;  4HYM A;  4LF5 E;  1H73 A;  1NHH A;  1J5E I;  4NXM I;  3K85 A;  2FGG A;  4KHP E;  4IZJ D;  2ZM6 I;  3J7Y p;  3P06 A;  1MG7 A;  4KHP I;  2L2M A;  1ZM3 A;  5BR8 E;  4DKK A;  4DV2 I;  1Z0C A;  5LMU E;  4JI2 E;  1H72 C;  3AV0 A;  1BKN A;  5DNY A;  5BR8 I;  5LMU I;  1XNQ I;  1H7U A;  1Z5C A;  4L5N C;  2F4V I;  4UTG A;  1NZ0 A;  2DEI A;  1GQE A;  1S16 A;  2JOB A;  4X62 E;  4Z7C A;  1DQ3 A;  1VIS A;  2L3J A;  4WFT A;  4YY3 E;  4YHH E;  4DPT A;  3LML A;  2M4I A;  5AE1 A;  4JI6 E;  1ZM4 A;  4YY3 I;  1FJG I;  4BBY A;  4DV3 I;  4B3M I;  3ZZU A;  2A2C A;  3LTO A;  1N0V C;  1K47 A;  4DR2 E;  2R42 A;  2IOP A;  4DR2 I;  4FW9 A;  1U2R A;  2KON A;  2V2V A;  4FWG A;  1RC7 A;  4I8O A;  4JYA E;  4DV6 E;  4LF7 E;  4X66 E;  4DV6 I;  4LF7 I;  4DV1 E;  2NA2 A;  4X66 I;  5IWA E;  5FLX C;  4RPF A;  1UIL A;  4DV1 I;  2R3V A;  1T4L B;  3PYG A;  4FN5 A;  4JI0 I;  1WHQ A;  1IBM E;  1HNX I;  1Z0T A;  2HFU A;  1IBM I;  2V34 A;  3LPS A;  1HNZ I;  4R1F A;  4B3T E;  4IZK B;  2V8P A;  2Z5B B;  4WPY A;  3ZKB A;  2A2D A;  4WUD A;  4EMD A;  1Y4U A;  1XNR E;  1ZXN A;  2AJ4 A;  2JVA A;  1ZBQ A;  2LRS A;  2HKJ A;  4X64 I;  2GS8 A;  4JI5 E;  1N0U A;  4IZK A;  1HK7 A;  2UUB E;  2E5L E;  2NUF A;  4URL A;  1H7S A;  1FKA E;  4B3R E;  3JAM Q;  4DPU A;  2UUB I;  2CZ9 A;  2V85 A;  2B7V A;  4M2Z A;  3Q6M A;  4F9C B;  4DMI A;  2L8T A;  3JAM C;  2L92 A;  5AAS A;  4DR5 E;  4JI7 E;  4DR6 E;  2JR1 A;  2X7I A;  3HXL A;  2LJP A;  4DR5 I;  4JI7 I;  4DR6 I;  5AE3 A;  2M7Q A;  2ZBK B;  2DSY A;  2VF1 A;  2MDR A;  4LF6 I;  4PRX A;  4BMJ A;  2V83 A;  3WU4 A;  3H4L A;  2O1W A;  2V2Q A;  3ADG A;  1NHJ A;  3Q1Q A;  4NXN E;  2O1V A;  4LF8 I;  5F3W A;  2JWO A;  4JV5 E;  2HFS A;  1N34 E;  2VE7 C;  1Z0E A;  1UEK A;  2MC6 A;  3J80 C;  2MC5 A;  1USU A;  3J81 Q;  3B82 A;  5FWK A;  4KZS A;  4P52 A;  5LMN E;  4M0V A;  5A2Q C;  2LTR A;  2ODR C;  1J5E E;  4NXM E;  4IZJ A;  3QT7 A;  1XMQ I;  2ZM6 E;  3GON A;  3J81 C;  2L3C A;  1ZBT A;  3FIG A;  4DV2 E;  3H09 A;  2BM0 A;  1RRE A;  2O1U A;  4P78 A;  1XNQ E;  2PNL A;  2UXD E;  1X49 A;  1N32 I;  2F4V E;  2UXD I;  5CFF E;  2V88 A;  2DMY A;  1MX0 A;  2GQ0 A;  2G7H A;  1Z59 A;  2XEX A;  1FJG E;  1I94 E;  1QZR A;  4F54 A;  4DV3 E;  4B3M E;  1I94 I;  1UHZ A;  2RTX A;  1YZ9 A;  3ZOQ B;  4TUI A;  2KOU A;  3HPS A;  2FTX B;  4JI4 I;  4DR1 E;  2LE2 A;  3VK6 A;  1KIJ A;  2EWL A;  2NUE A;  4DR1 I;  2VF3 A;  4I3H A;  1WXR A;  1FNM A;  1RQ0 A;  2K4V A;  2Q2E B;  1PVG A;  2IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...