1HNWE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnwE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwE02
2HKJA 1S4EA 3K17A 2BM1A 2R3VA 5BR8E 4DV1I 4FN5A 4JI8E 2UXCI 2YT4A 1Z5BA 2HKEA 1N33E 2LTSA 2J7KA 4DR5E 3J81Q 4DR1E 4HACA 4JYAI 3OTOE 1T4LB 2E5LI 5L3JA 3V5RA 4URLA 2N3GA 4GKKE 5IT9Q 5LMNE 4YY3E 2HFSA 1B63A 4DV1E 1FJGI 2UUAE 4HACB 4PRVA 4FW9A 4DUZE 2L2MA 4YHHI 1ZM2A 5LMUI 4LF5E 1XNRE 4USKA 1X48A 2ZM6I 4JI6I 4JYAE 4DPXA 4X66E 3ADJA 1HNWI 4DV7E 1ZM9A 4P52A 1H72C 1Z5CA 1YYKA 3JAMC 1J26A 1MX0A 1Z59A 3B78A 1HNXE 4DV4E 3LNUA 4UT4A 4NXMI 1Z0EA 2LUPB 1HR0I 5A2QC 4GKJI 3CWVA 1Z0CA 4JI5E 4Z7CA 4LFCE 4X65I 2RS7A 4UTGA 4DV0I 1FKAE 3PYEA 5IWAI 4AQYI 1XMQE 1RR9A 2UXDE 4DR6E 3T1HI 1H73A 1J5EE 4DV3I 1HNXI 1EKZA 1WUUA 1X47A 4JV5I 2L2NA 4JG4A 1IBKE 4LF4I 2EFGA 1PKPA 1HNZE 4JI7I 1ZM4A 1FNMA 4DV2I 3ADLA 3T1YI 4HYMA 4FWGA 4JI2I 4DR2E 2GS8A 4MYTA 4LF7I 2B7VA 1A6FA 4WUBA 5IT9C 4ED4A 2LTRA 1N36I 1BKNA 2ZITA 3D4JA 4DKKA 1UILA 4JI4I 1T4NA 4K0KE 2IHR1 3J81C 3PYDA 5GMEA 2LBSB 4B3RI 2UUBI 2DMYA 4DUYI 4JI7E 2HK3A 1H7UA 3ZKDA 1XMOE 3OTOI 1GQEA 4NXNE 3T1YE 3V2UC 4DU8A 2VQFE 4DV5I 1RC7A 4DR3E 1IBLE 2A2CA 4MYUA 1UHZA 5A2QQ 4X64I 2DB2A 4JI3I 4YHHE 4OX9I 1ZBTA 1O0WA 2UXBE 2OI2A 1ELOA 1QU6A 4EMDA 3QT5A 1HNWE 2LUQA 4NXNI 1X49A 3Q1QA 4R1FA 1IBME 1UEKA 3B82A 1EI1A 1HR0E 3ADGA 4M1KA 4DR4I 1RREA 1YZ9A 4ZVIA 3QT6A 2DIXA 2A2DA 2VF3A 2NUGA 4DR1I 3F0NA 3B8HA 1RQ0A 2L33A 4Z7YA 3J7AM 2UUCI 3J7AG 4B3TI 4B3ME 4AQYE 4X62I 5LMNI 4X8WA 2L3JA 5BR8I 1PIEA 2R42A 1I94E 2LJPA 4DU7A 4DV3E 1J5EI 2UXCE 4DR4E 2ZBKB 1XNRI 1ZXMA 4DPUA 2B7TA 4P7AA 3ZZ0A 2UU9E 1NHIA 1DI2A 3LLHA 4X66I 1EA6A 2E1RA 3QT8A 2RTXA 4GKKI 4WUCA 1KTVA 2L3CA 2V2ZA 2NUEA 1I94I 4LFBI 3WU5A 1N34E 1KIJA 4DV6E 1NHJA 4DUYE 1XNQI 2RS6A 4JI1E 4DR6I 4USMA 2VQEI 2V34A 3HULA 4KHPE 1Z5AA 3J80C 1KVKA 4M30A 4LFBE 1N33I 3VYYA 4LF4E 4LFAE 4WFTA 1HNZI 1NHHA 1Z0WA 1Z0GA 4LFCI 2UXBI 4DV2E 5FLXC 4LF6E 1N32E 1YYOA 4DR2I 1T4OA 4LF7E 4DR7E 2LRSA 2X36A 2X7IA 4JI1I 1FWLA 2UXDI 4YY3I 1MU5A 2VQEE 4M2ZA 3QT7A 5FLXQ 2UUAI 4KHPI 4DUZI 4JV5E 3H4LA 4RPFA 4LF5I 2RSMA 4PU9A 3VYXA 2WW4A 4HY1A 1STUA 3LTOA 3K1JA 2KHXA 1H74A 2E5LE 2V2VA 3M6AA 2HHHE 4B3MI 4JI2E 4DXLA 2MDRA 1MG7A 3LPSA 4DPYA 4OOGC 1N36E 4NXME 2XEXA 2NPFA 4DV4I 4XTJA 4B3SI 2F4VI 3ADIA 1U2RA 4LF9I 3GONA 1FJGE 4GKJE 4HXZA 2LJHA 4K0KI 4I3HA 1FI4A 2V8PA 4PRXA 2UU9I 4JI6E 2HK2A 1WHNA 3J80Q 5LL6R 4DV7I 3ZM7A 2NA2A 1OJ4A 2L2KB 4DV5E 1Z0VA 2NUFA 4KQVA 4DPWA 4DR3I 4JI0E 4LF9E 1IBKI 2DEJA 3C4TA 2CPNA 4LF8I 4X65E 2BM0A 1XNQE 3ZZTA 1K47A 1KKHA 2Q2EB 4X62E 1XMQI 1N0UA 4FWHA 5GMDA 4DPTA 1IBMI 4WYQB 2AJ4A 3T1HE 2B3TB 1DARA 2EZ6A 4JI4E 1H7SA 1PVGA 4JI0I 5LMUE 4B3RE 2ZM6E 4LF8E 3HTXA 1ZXNA 1VISA 1D6TA 4LF6I 1N32I 3C4BA 4B3TE 3WU4A 3ZKBA 1N0VC 1IBLI 2JVAA 4WUDA 4X64E 4JI3E 3P1XA 1N34I 4OX9E 4JI5I 4FWDA 3WU3A 4DV0E 2UUBE 1ZM3A 2HFUA 1NZ0A 1XMOI 3J7Yp 5IWAE 1Z0BA 1YYWA 2HHHI 2VQFI 3PYGA 1S16A 4JI8I 1QZRA 2DEIA 4B3SE 2F4VE 2BV3A 2V2QA 3WU6A 3JAMQ 1FWKA 4DR5I 1XHKA 4LFAI 5CFFE 2N3HA 1WHQA 4DV6I 2JY9A 2UUCE 3ZZUA 4DR7I 1Z0TA 3PYFA 2CZ9A 1B62A
chains in the Genus database with same CATH superfamily
2HKJA 2EOJA 1S4EA 2V85A 3K17A 2BM1A 2R3VA 5BR8E 1A1JA 4AIDA 1ZAAC 5A6BD 4WXCA 2PNLA 1NCSA 2JXPA 4DV1I 4FN5A 2VE7C 4BA2B 4JI8E 2UXCI 1OYRA 2YT4A 1Z5BA 2IESA 2HKEA 3VK6A 2YSPA 1P47A 1N33E 2LTSA 3DD6A 2J7KA 4DR5E 3J81Q 1TF6A 2WP8A 5A69A 5TSEA 2CVEA 4DR1E 2IOPA 4HACA 4JYAI 3OTOE 2YRHA 1T4LB 2E5LI 1UDSA 4IZJB 1N3GA 2UUBI 3BBGA 1A1KA 4F9BB 1USUA 5DROA 5JEAA 5L3JA 3V5RA 4URLA 2N3GA 3DJWA 1JK2A 4IFDE 4GKKE 5IT9Q 5LMNE 2EOFA 1Y60A 4YY3E 2LE2A 2WCC3 2HFSA 4R2SA 2O1TA 2HGHA 2O1UA 1Y4SA 1B63A 2NN6B 3U1KA 1E3PA 4MU0A 2EN8A 4DV1E 2EQ1A 1FJGI 2UUAE 4HACB 4AIMA 4PRVA 4FW9A 2YTGA 4L8NA 3EPLA 4DUZE 2L2MA 1A1FA 2FGGA 4YHHI 1ZM2A 2PNZB 2N8XA 1X5WA 5LMUI 2ENCA 4LF5E 1XNRE 3CDJA 4USKA 2EMHA 2EQ0A 3P06A 1X48A 2PO2B 2EPUA 2ZM6I 1ZR9A 1GTKA 4JI6I 2PO2A 4OO1E 4JYAE 4DPXA 4X66E 3ADJA 4M9VC 1HNWI 4DV7E 3IWDA 2Z5CA 2V89A 2CG9A 1UDOA 1B69A 1ZM9A 2C39B 4P52A 2CT1A 1H72C 2DLKA 1Z5CA 3JAMC 1YYKA 2Z5BA 1J26A 4FW4A 3VHTB 1MX0A 3L7ZA 2CSHA 4FK5C 1Z59A 2DLQA 4LCHA 2JYAA 3B78A 1HNXE 2EPOA 4DV4E 3LNUA 4UT4A 4NXMI 1RMDA 1Z0EA 2LUPB 1HR0I 2ENHA 4BMJA 5A2QC 4LOMA 1JK1A 1T39A 4GKJI 4WPYA 3CWVA 1Z0CA 4JI5E 4Z7CA 1GZ6A 2EMGA 4LFCE 4X65I 3Q6MA 2RS7A 4UTGA 4DV0I 1FKAE 2V87A 2NN6E 3PYEA 4R2PA 3UHMA 4WX9A 2YTNA 5IWAI 4AQYI 1XMQE 5KL2A 1A1IA 1RR9A 2UXDE 4DR6E 3MHSC 4J3DA 2GHFA 3ZOQB 2BA1D 3T1HI 1QNTA 2EMWA 2YTPA 4ZYGA 1H73A 2V8QB 2GQ0A 4IFDD 1J5EE 4DV3I 1HNXI 3HPSA 1EKZA 1WUUA 2BR2B 1X47A 4JV5I 2LV2A 2L2NA 2YPNA 2ADRA 2J7JA 4JG4A 1USVA 4DMIA 1IBKE 4LF4I 2EFGA 1PKPA 2VF1A 2C38A 2YWQA 1HNZE 2EM6A 2WP8B 3L00A 4JI7I 3H09A 3BF2A 2MC5A 2EN4A 3K6QA 1ZM4A 4MLVA 4WXDA 1FNMA 1OYSA 4DV2I 3ADLA 1X6EA 3T1YI 4HYMA 4FWGA 4JI2I 4DR2E 2GS8A 4MYTA 4LF7I 4U3BA 2B7VA 4BS9A 5FWKA 1A6FA 4WUBA 2M9AA 5IT9C 2BA0G 2EE8A 4ED4A 1KJKA 2LTRA 4FW6A 1N36I 2JEAB 2ODRD 3M7NG 1BKNA 2PO0B 2ZITA 3D4JA 2PO0A 3KZYA 2LT7A 3Q6NA 5T6JA 1UILA 4DKKA 3QG5C 1L4SA 1T4NA 2EOEA 5ADZA 2VESA 4DR1I 4JI4I 4FW5A 1PJQA 4K0KE 2IHR1 2EN1A 3J81C 3PYDA 4R2AA 5GMEA 2LBSB 3HKMA 2CTDA 5LLQA 4LPFA 2I13A 4MU1A 2DMYA 2E1MA 4BA1B 4JI7E 4GZNC 2MKDA 2VRDA 1NEIA 2HK3A 4DUYI 4ZYEA 1H7UA 1XMOE 3ZKDA 3OTOI 1ZBQA 1GQEA 4WSPA 4NXNE 3T1YE 3V2UC 2C38B 4DU8A 2VQFE 1BBOA 4DV5I 1Y6ZA 4QNKA 2H36X 1AAYA 2JP9A 2Q8UA 4AM3A 1RC7A 4DR3E 1IBLE 5A6BA 2A2CA 4MYUA 4MDTA 5AASA 1UHZA 2EMZA 4B3RI 2GLIA 5A2QQ 2NN6C 2EOQA 5ELWA 4X64I 2DB2A 4JI3I 1A1HA 4IS1C 4BA2A 5A6KA 1EH6A 4YHHE 1YUJA 2V88A 3M99B 2K7IA 4OX9I 4IZKA 1ZBTA 1SFEA 1O0WA 2UXBE 5IXMB 2JOXA 5DNXA 2OI2A 1ELOA 1QU6A 2O1WA 4GQUA 4EMDA 2EM9A 3QT5A 2PO1A 1HNWE 2LUQA 2F8BA 5KL5A 4OO1F 1IQOA 3B4TA 4NXNI 1X49A 2WNRB 1BBGA 2EMFA 3IWBA 3Q1QA 4R1FA 1IBME 1UEKA 4BHBA 1MGTA 4N3OA 1BB8A 3B82A 2EL6A 2JEBB 4F9AB 1EI1A 3KZZA 3PS1A 1ZU1A 3THNA 1HR0E 2EPMX 3ADGA 3RMPA 4M1KA 4DR4I 1RREA 5C0XB 5EKWA 1YZ9A 4IFDC 4QNJA 4BC9A 4ZVIA 2BA1G 3QT6A 2DIXA 2A2DA 2VF3A 2G7HA 2NUGA 2RPCA 1EH8A 2D9HA 1RQ0A 2L33A 2MC6A 3F6GA 3B8HA 3F0NA 4IS9A 4Z7YA 3J7AM 2UUCI 2M7QA 2EN3A 3J7AG 4B3TI 4B3ME 2DSYA 1R6MA 1IMUA 1PDAA 4AQYE 4F9CB 4X62I 5LMNI 3LMLA 4X8WA 2EM8A 3TQMA 4NBQA 4O24A 2EOHA 2L3JA 5BR8I 1MEYC 4KWYA 1PIEA 2R42A 1YSAC 4ISAA 1I94E 2LJPA 2BA0D 4DU7A 4DV3E 1J5EI 2EMBA 2KONA 4LU9A 2UXCE 3JU0A 4DR4E 2EPXA 2ENAA 1DGCA 1E3HA 2E72A 2ZBKB 1XNRI 2K4VA 4P7DA 1ZXMA 2ODRC 3KWRA 5JEAC 3HQ1A 1WJPA 4DPUA 2B7TA 4P7AA 3ZZ0A 2UU9E 1NHIA 1DI2A 2Z5EA 3LLHA 3P3CA 3HPZA 4X66I 4TUIA 1EA6A 2EPRA 4OZEA 1PJTA 1G2FC 2E1RA 5A6AA 4Q35B 2IOQA 2RTXA 3QT8A 5JEAE 4GKKI 4WUCA 2F1DA 2EPCA 3F6HA 2B9DA 3IWCA 2L3CA 1Z1BA 1KTVA 1X3CA 3PRYA 4FW3A 4IFDA 2V2ZA 2NUEA 2YTFA 5C0XD 1I94I 4LFBI 5K36D 1F2IG 3WU5A 3FIGA 4IFDB 2EORA 4IZJA 5DNYA 2EOMA 1PJSA 4MLQA 1N34E 3EQ1A 4HTGA 5AE3A 4DV6E 1KIJA 1NHJA 4DUYE 1XNQI 4OKGA 3AUZA 4NHRA 4R2CA 4N4RB 2RS6A 2CGEA 4MQYA 5C0XE 4JI1E 2JPAA 4LCGA 4DR6I 3U1YA 4BC7A 4FW7A 5AE1A 4USMA 2VQEI 3JTZA 5JEAF 2V34A 3L7ZB 3DF6A 3J80C 4KHPE 1Z5AA 3HULA 2WBSA 1KVKA 5DRRA 1TN9A 5C0XF 2EMIA 4M30A 4F6MA 4LFBE 2IERA 2O1VA 2V83A 1N33I 1G2DC 3VYYA 2AE8A 4LF4E 1TF3A 2JEBA 4LFAE 4WFTA 2EPNA 1HNZI 1NHHA 4BHCA 2EMCA 1Z0GA 1Z0WA 4X9JA 4LFCI 2UXBI 2EQ3A 5F3WA 4M0VA 4O4KA 5FLXC 4DV2E 2L6MA 4LF6E 1N32E 4ZYHA 1YYOA 1YH8A 1UN6B 4DR2I 1T4OA 4LF7E 4DR7E 2M1SA 2LRSA 2FTXB 4TUGA 4R2DA 2C37B 2GO4A 3CDIA 4O43A 2X36A 2X7IA 1FWLA 4JI1I 2UXDI 4YY3I 3PS2A 3EPHA 1MU5A 2JE6A 2JT2A 2NN6A 3M85D 2VQEE 4M2ZA 2EM4A 4MU3A 3QT7A 1YPNA 5FLXQ 2UUAI 4OO1B 4KHPI 2L92A 4DUZI 3M85G 4K0KI 2NN6F 4JV5E 2EN6A 1EH7A 2YTDA 5IV8B 3H4LA 1AH5A 4RPFA 4LF5I 2ELYA 2EJ4A 2EPLX 2RSMA 4PU9A 2YTOA 3VYXA 1RHYA 4OO1A 1DQ3A 1YFHA 2WW4A 4P78A 1STUA 4HY1A 3LTOA 3HJCA 2PO1B 4HEIA 2M4IA 2PNZA 3OMLA 2BB8A 1HK7A 3K1JA 5EL9A 2KHXA 1H74A 2E5LE 2V2VA 3M6AA 2RQLA 2EPPA 2I9IA 1UBDC 2HHHE 4B3MI 4JI2E 2A25A 1LLMC 3K85A 2Z5CB 1YUIA 2MDRA 1MG7A 2O3ZA 2GO3A 3LPSA 4DXLA 2EMXA 4U3DA 4DPYA 1X6FA 4OOGC 1N36E 4NXME 5KL7A 2XEXA 2EOXA 2FV4B 4ZYDA 4XTJA 2NPFA 4DV4I 4B3SI 3ADIA 1U2RA 2F4VI 2EL4A 3GONA 4LF9I 1FJGE 5K36C 4GKJE 4HXZA 2LJHA 5KL3A 3EPKA 4IZJD 1XXEA 5C0XC 4L5NC 4F2JC 4R2EA 2R1FA 2LMZA 2JE6B 1FI4A 4F54A 2YRMA 1UDNA 4I3HA 1SR9A 2V8PA 5K36F 5C0XA 1KYQA 2EN2A 4PRXA 2UU9I 3AV0A 2PNMA 1Y5YA 3BIDA 4JI6E 2HK2A 1WHNA 3J80Q 1UDQA 4R2QA 5LL6R 4DV7I 1IQSA 2LVHA 5K36E 3ZM7A 2MKNA 2NA2A 4R2RA 2V86A 2EM2A 4J8ZA 1OJ4A 2L2KB 4DV5E 5JEAB 1Z0VA 2J65A 2WZOA 2NUFA 4IJDA 5JEAD 4KQVA 4DPWA 4DR3I 4OO1C 2ELZA 1A1GA 3M7ND 2EM3A 5DRPA 3P76A 2EOSA 4JI0E 4LF9E 2JEAA 2YU8A 2HJJA 3P3GA 3PS3A 2DEJA 4IZKB 1IBKI 3C4TA 2WBUA 3NZKA 2CPNA 2EOOA 2JOBA 2L8TA 4LF8I 2YTIA 2PRTA 4X65E 2BM0A 1T38A 3HXLA 4KZSA 5DNLA 2EPZA 1XNQE 5A6JA 4IFDF 2EOZA 1R6LA 1VI7A 1A1LA 1K47A 1KKHA 1YHCA 2Q2EB 3ZZTA 4X62E 1XMQI 2JWOA 1N0UA 2EP3A 4R03A 5K36A 4FWHA 5GMDA 4DPTA 2EMAA 3ECRA 1IBMI 2YRKA 4WYQB 2EWLA 2AJ4A 4RHBB 3T1HE 3EPJA 3THOB 2B3TB 3KRNA 1DARA 3BGHA 3C6KA 2EZ6A 2GPIA 4JI4E 1H7SA 1PVGA 4BA1A 2NABA 4JI0I 1Y4UA 5LMUE 5AC5A 2EM7A 3UK3C 3H1CA 4MU4A 4B3RE 2ZM6E 4LF8E 2HC5A 4LTYA 3HTXA 1ZXNA 5DRQA 4R8OA 4F6NA 1VISA 2EM0A 2DGCA 2Z5BB 1D6TA 2YU5A 4BBYA 2C39A 4LF6I 1N32I 3C4BA 4B3TE 2BR2A 2JR1A 2EPAA 3WU4A 2EOYA 3ZKBA 2KOUA 1N0VC 3GCMA 1IBLI 2JVAA 2WNRA 4WUDA 2MDGA 2EMLA 5KL4A 4X64E 2YTEA 4JI3E 2EN7A 4NZVA 5K36B 3P1XA 2EM5A 2NN6D 2EMYA 4I8OA 1N34I 2YTQA 4GEQB 4OX9E 1P42A 2YTJA 4JI5I 2LO3A 2C37A 4WSGA 4FWDA 3WU3A 4DV0E 2UUBE 2EOIA 3MSWA 1X6HA 1ZM3A 2HFUA 2YZTA 2LCEA 4O5GA 3J7Yp 5IWAE 1NZ0A 2BBGA 1Z0BA 1XMOI 1YYWA 3MHHC 3C6MA 4LCFA 4RH8A 2HHHI 2LJUA 2VQFI 2EMKA 3PYGA 4BCAA 2R76A 1OYPA 1S16A 1WXRA 2DRPA 4JI8I 1QZRA 2DEIA 4B3SE 2F4VE 2BV3A 2V2QA 3WU6A 3JAMQ 2DMIA 1FWKA 4DR5I 5AE2A 1XHKA 4LFAI 4OO1D 5CFFE 3GMEA 2EL5A 2N3HA 2YSOA 1WHQA 1WRJA 2EPKX 4DV6I 2JY9A 2RSIA 2UUCE 3GLLA 3ZZUA 4DR7I 1Z0TA 5KL6A 2CZ9A 3P3EA 3PYFA 4Q28A 1B62A 5AC4A 2WBTA
chains in the Genus database with same CATH topology
2HKJA 1S4EA 2V85A 3K17A 2BM1A 2R3VA 5BR8E 2PNLA 4DV1I 4FN5A 2VE7C 4JI8E 2UXCI 2YT4A 1Z5BA 2HKEA 3VK6A 1N33E 2LTSA 2J7KA 4DR5E 3J81Q 4DR1E 2IOPA 4HACA 4JYAI 3OTOE 1T4LB 2E5LI 4IZJB 4F9BB 1USUA 5L3JA 3V5RA 4URLA 2N3GA 3DJWA 4GKKE 5IT9Q 5LMNE 4YY3E 2LE2A 2HFSA 2O1TA 2O1UA 1Y4SA 1B63A 4DV1E 1FJGI 2UUAE 4HACB 4PRVA 4FW9A 4L8NA 4DUZE 2L2MA 4YHHI 2FGGA 1ZM2A 5LMUI 4LF5E 1XNRE 4USKA 3P06A 1X48A 2ZM6I 4JI6I 4JYAE 4DPXA 4X66E 3ADJA 1HNWI 4DV7E 3IWDA 2Z5CA 2V89A 2CG9A 1ZM9A 4P52A 1H72C 1Z5CA 3JAMC 1YYKA 2Z5BA 1J26A 1MX0A 1Z59A 3B78A 1HNXE 4DV4E 3LNUA 4UT4A 4NXMI 1Z0EA 2LUPB 1HR0I 4BMJA 5A2QC 4GKJI 4WPYA 3CWVA 1Z0CA 4JI5E 4Z7CA 1GZ6A 4LFCE 4X65I 3Q6MA 2RS7A 4UTGA 4DV0I 1FKAE 2V87A 3PYEA 5IWAI 4AQYI 1XMQE 1RR9A 2UXDE 4DR6E 3ZOQB 3T1HI 1H73A 2V8QB 2GQ0A 1J5EE 4DV3I 1HNXI 3HPSA 1EKZA 1WUUA 1X47A 4JV5I 2L2NA 4JG4A 1USVA 4DMIA 1IBKE 4LF4I 2EFGA 1PKPA 2VF1A 1HNZE 4JI7I 3H09A 1ZM4A 2MC5A 3K6QA 1FNMA 4DV2I 3ADLA 3T1YI 4HYMA 4FWGA 4JI2I 4DR2E 2GS8A 4MYTA 4LF7I 2B7VA 4BS9A 5FWKA 1A6FA 4WUBA 5IT9C 4ED4A 2LTRA 1N36I 2ODRD 1BKNA 2ZITA 3D4JA 3Q6NA 5T6JA 1UILA 4DKKA 4JI4I 1T4NA 5ADZA 4K0KE 2IHR1 3J81C 3PYDA 5GMEA 2LBSB 4B3RI 2UUBI 2DMYA 2E1MA 4DUYI 4JI7E 2HK3A 1H7UA 3ZKDA 1XMOE 3OTOI 1ZBQA 1GQEA 4WSPA 4NXNE 3T1YE 3V2UC 4DU8A 2VQFE 4DV5I 1Y6ZA 2H36X 1RC7A 4DR3E 1IBLE 2A2CA 4MYUA 5AASA 1UHZA 5A2QQ 4X64I 2DB2A 4JI3I 4YHHE 2V88A 4OX9I 4IZKA 1ZBTA 1O0WA 2UXBE 2JOXA 2OI2A 1ELOA 1QU6A 2O1WA 4EMDA 3QT5A 1HNWE 2LUQA 2F8BA 4NXNI 1X49A 3IWBA 3Q1QA 4R1FA 1IBME 1UEKA 4N3OA 3B82A 4F9AB 1EI1A 1HR0E 3ADGA 4M1KA 3RMPA 4DR4I 1RREA 1YZ9A 4BC9A 4ZVIA 3QT6A 2DIXA 2A2DA 2VF3A 2NUGA 2G7HA 3F6GA 3F0NA 2MC6A 1RQ0A 2L33A 3B8HA 4DR1I 4Z7YA 3J7AM 2UUCI 2M7QA 3J7AG 4B3TI 4B3ME 2DSYA 4AQYE 4F9CB 4X62I 5LMNI 3LMLA 4X8WA 2L3JA 5BR8I 1PIEA 2R42A 1I94E 2LJPA 4DU7A 4DV3E 1J5EI 2KONA 4LU9A 2UXCE 3JU0A 4DR4E 2ZBKB 1XNRI 2K4VA 4P7DA 1ZXMA 2ODRC 3KWRA 3HQ1A 4DPUA 2B7TA 4P7AA 3ZZ0A 2UU9E 1NHIA 1DI2A 2Z5EA 3LLHA 3HPZA 4X66I 4TUIA 1EA6A 2E1RA 2IOQA 2RTXA 3QT8A 4GKKI 4WUCA 3F6HA 2B9DA 3IWCA 2L3CA 1KTVA 3PRYA 2V2ZA 2NUEA 1I94I 4LFBI 3WU5A 3FIGA 4IZJA 5DNYA 1N34E 1KIJA 5AE3A 4DV6E 1NHJA 4DUYE 1XNQI 3AUZA 2RS6A 2CGEA 4JI1E 4DR6I 4BC7A 5AE1A 4USMA 2VQEI 3JTZA 2V34A 3DF6A 3J80C 4KHPE 1Z5AA 3HULA 1KVKA 4M30A 2O1VA 4LFBE 2V83A 1N33I 3VYYA 4LF4E 4LFAE 4WFTA 1HNZI 1NHHA 1Z0WA 1Z0GA 4LFCI 2UXBI 5F3WA 4M0VA 5FLXC 4DV2E 2L6MA 4LF6E 1N32E 1YYOA 4DR2I 1T4OA 4LF7E 4DR7E 2M1SA 2LRSA 2FTXB 4TUGA 2X36A 2X7IA 4JI1I 1FWLA 2UXDI 4YY3I 1MU5A 2VQEE 4M2ZA 3QT7A 5FLXQ 2UUAI 4KHPI 2L92A 4DUZI 4JV5E 3H4LA 4RPFA 4LF5I 2RSMA 4PU9A 3VYXA 1DQ3A 2WW4A 4HY1A 1STUA 4P78A 3LTOA 3HJCA 2M4IA 3OMLA 3K1JA 1HK7A 2KHXA 1H74A 2E5LE 2V2VA 3M6AA 2HHHE 4B3MI 4JI2E 3K85A 2Z5CB 4DXLA 2MDRA 1MG7A 3LPSA 4DPYA 4OOGC 1N36E 4NXME 2XEXA 2NPFA 4DV4I 2FV4B 4XTJA 4B3SI 2F4VI 3ADIA 1U2RA 4LF9I 3GONA 1FJGE 4GKJE 4HXZA 2LJHA 4IZJD 4L5NC 4K0KI 2LMZA 4I3HA 1FI4A 4F54A 1SR9A 2V8PA 4PRXA 2UU9I 3AV0A 2PNMA 4JI6E 2HK2A 1WHNA 3J80Q 5LL6R 4DV7I 3ZM7A 2NA2A 2V86A 1OJ4A 4J8ZA 2L2KB 4DV5E 1Z0VA 2WZOA 2NUFA 4KQVA 4DPWA 4DR3I 4JI0E 4LF9E 4IZKB 1IBKI 2DEJA 3C4TA 2CPNA 2JOBA 2L8TA 4LF8I 4X65E 2BM0A 3HXLA 4KZSA 1XNQE 3ZZTA 1K47A 1KKHA 2Q2EB 4X62E 1XMQI 2JWOA 1N0UA 4R03A 4FWHA 5GMDA 4DPTA 1IBMI 4WYQB 2EWLA 2AJ4A 3T1HE 2B3TB 1DARA 2EZ6A 4JI4E 1H7SA 1PVGA 4JI0I 1Y4UA 5LMUE 4B3RE 2ZM6E 4LF8E 3HTXA 4LTYA 1ZXNA 4R8OA 1VISA 2Z5BB 1D6TA 4BBYA 4LF6I 1N32I 3C4BA 4B3TE 2JR1A 3WU4A 3ZKBA 2KOUA 1N0VC 1IBLI 2JVAA 4WUDA 4X64E 4JI3E 3P1XA 4I8OA 1N34I 4GEQB 4OX9E 4JI5I 4FWDA 3WU3A 4DV0E 2UUBE 3MSWA 1ZM3A 2HFUA 2YZTA 1NZ0A 1XMOI 3J7Yp 5IWAE 1Z0BA 1YYWA 2HHHI 2VQFI 3PYGA 4BCAA 1S16A 1WXRA 4JI8I 1QZRA 2DEIA 4B3SE 2F4VE 2BV3A 2V2QA 3WU6A 3JAMQ 1FWKA 4DR5I 5AE2A 1XHKA 4LFAI 5CFFE 2N3HA 1WHQA 4DV6I 2JY9A 2UUCE 3ZZUA 4DR7I 1Z0TA 3PYFA 2CZ9A 4Q28A 1B62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKJ A;  1S4E A;  3K17 A;  2BM1 A;  2R3V A;  5BR8 E;  4DV1 I;  4FN5 A;  4JI8 E;  2UXC I;  2YT4 A;  1Z5B A;  2HKE A;  1N33 E;  2LTS A;  2J7K A;  4DR5 E;  3J81 Q;  4DR1 E;  4HAC A;  4JYA I;  3OTO E;  1T4L B;  2E5L I;  5L3J A;  3V5R A;  4URL A;  2N3G A;  4GKK E;  5IT9 Q;  5LMN E;  4YY3 E;  2HFS A;  1B63 A;  4DV1 E;  1FJG I;  2UUA E;  4HAC B;  4PRV A;  4FW9 A;  4DUZ E;  2L2M A;  4YHH I;  1ZM2 A;  5LMU I;  4LF5 E;  1XNR E;  4USK A;  1X48 A;  2ZM6 I;  4JI6 I;  4JYA E;  4DPX A;  4X66 E;  3ADJ A;  1HNW I;  4DV7 E;  1ZM9 A;  4P52 A;  1H72 C;  1Z5C A;  1YYK A;  3JAM C;  1J26 A;  1MX0 A;  1Z59 A;  3B78 A;  1HNX E;  4DV4 E;  3LNU A;  4UT4 A;  4NXM I;  1Z0E A;  2LUP B;  1HR0 I;  5A2Q C;  4GKJ I;  3CWV A;  1Z0C A;  4JI5 E;  4Z7C A;  4LFC E;  4X65 I;  2RS7 A;  4UTG A;  4DV0 I;  1FKA E;  3PYE A;  5IWA I;  4AQY I;  1XMQ E;  1RR9 A;  2UXD E;  4DR6 E;  3T1H I;  1H73 A;  1J5E E;  4DV3 I;  1HNX I;  1EKZ A;  1WUU A;  1X47 A;  4JV5 I;  2L2N A;  4JG4 A;  1IBK E;  4LF4 I;  2EFG A;  1PKP A;  1HNZ E;  4JI7 I;  1ZM4 A;  1FNM A;  4DV2 I;  3ADL A;  3T1Y I;  4HYM A;  4FWG A;  4JI2 I;  4DR2 E;  2GS8 A;  4MYT A;  4LF7 I;  2B7V A;  1A6F A;  4WUB A;  5IT9 C;  4ED4 A;  2LTR A;  1N36 I;  1BKN A;  2ZIT A;  3D4J A;  4DKK A;  1UIL A;  4JI4 I;  1T4N A;  4K0K E;  2IHR 1;  3J81 C;  3PYD A;  5GME A;  2LBS B;  4B3R I;  2UUB I;  2DMY A;  4DUY I;  4JI7 E;  2HK3 A;  1H7U A;  3ZKD A;  1XMO E;  3OTO I;  1GQE A;  4NXN E;  3T1Y E;  3V2U C;  4DU8 A;  2VQF E;  4DV5 I;  1RC7 A;  4DR3 E;  1IBL E;  2A2C A;  4MYU A;  1UHZ A;  5A2Q Q;  4X64 I;  2DB2 A;  4JI3 I;  4YHH E;  4OX9 I;  1ZBT A;  1O0W A;  2UXB E;  2OI2 A;  1ELO A;  1QU6 A;  4EMD A;  3QT5 A;  1HNW E;  2LUQ A;  4NXN I;  1X49 A;  3Q1Q A;  4R1F A;  1IBM E;  1UEK A;  3B82 A;  1EI1 A;  1HR0 E;  3ADG A;  4M1K A;  4DR4 I;  1RRE A;  1YZ9 A;  4ZVI A;  3QT6 A;  2DIX A;  2A2D A;  2VF3 A;  2NUG A;  4DR1 I;  3F0N A;  3B8H A;  1RQ0 A;  2L33 A;  4Z7Y A;  3J7A M;  2UUC I;  3J7A G;  4B3T I;  4B3M E;  4AQY E;  4X62 I;  5LMN I;  4X8W A;  2L3J A;  5BR8 I;  1PIE A;  2R42 A;  1I94 E;  2LJP A;  4DU7 A;  4DV3 E;  1J5E I;  2UXC E;  4DR4 E;  2ZBK B;  1XNR I;  1ZXM A;  4DPU A;  2B7T A;  4P7A A;  3ZZ0 A;  2UU9 E;  1NHI A;  1DI2 A;  3LLH A;  4X66 I;  1EA6 A;  2E1R A;  3QT8 A;  2RTX A;  4GKK I;  4WUC A;  1KTV A;  2L3C A;  2V2Z A;  2NUE A;  1I94 I;  4LFB I;  3WU5 A;  1N34 E;  1KIJ A;  4DV6 E;  1NHJ A;  4DUY E;  1XNQ I;  2RS6 A;  4JI1 E;  4DR6 I;  4USM A;  2VQE I;  2V34 A;  3HUL A;  4KHP E;  1Z5A A;  3J80 C;  1KVK A;  4M30 A;  4LFB E;  1N33 I;  3VYY A;  4LF4 E;  4LFA E;  4WFT A;  1HNZ I;  1NHH A;  1Z0W A;  1Z0G A;  4LFC I;  2UXB I;  4DV2 E;  5FLX C;  4LF6 E;  1N32 E;  1YYO A;  4DR2 I;  1T4O A;  4LF7 E;  4DR7 E;  2LRS A;  2X36 A;  2X7I A;  4JI1 I;  1FWL A;  2UXD I;  4YY3 I;  1MU5 A;  2VQE E;  4M2Z A;  3QT7 A;  5FLX Q;  2UUA I;  4KHP I;  4DUZ I;  4JV5 E;  3H4L A;  4RPF A;  4LF5 I;  2RSM A;  4PU9 A;  3VYX A;  2WW4 A;  4HY1 A;  1STU A;  3LTO A;  3K1J A;  2KHX A;  1H74 A;  2E5L E;  2V2V A;  3M6A A;  2HHH E;  4B3M I;  4JI2 E;  4DXL A;  2MDR A;  1MG7 A;  3LPS A;  4DPY A;  4OOG C;  1N36 E;  4NXM E;  2XEX A;  2NPF A;  4DV4 I;  4XTJ A;  4B3S I;  2F4V I;  3ADI A;  1U2R A;  4LF9 I;  3GON A;  1FJG E;  4GKJ E;  4HXZ A;  2LJH A;  4K0K I;  4I3H A;  1FI4 A;  2V8P A;  4PRX A;  2UU9 I;  4JI6 E;  2HK2 A;  1WHN A;  3J80 Q;  5LL6 R;  4DV7 I;  3ZM7 A;  2NA2 A;  1OJ4 A;  2L2K B;  4DV5 E;  1Z0V A;  2NUF A;  4KQV A;  4DPW A;  4DR3 I;  4JI0 E;  4LF9 E;  1IBK I;  2DEJ A;  3C4T A;  2CPN A;  4LF8 I;  4X65 E;  2BM0 A;  1XNQ E;  3ZZT A;  1K47 A;  1KKH A;  2Q2E B;  4X62 E;  1XMQ I;  1N0U A;  4FWH A;  5GMD A;  4DPT A;  1IBM I;  4WYQ B;  2AJ4 A;  3T1H E;  2B3T B;  1DAR A;  2EZ6 A;  4JI4 E;  1H7S A;  1PVG A;  4JI0 I;  5LMU E;  4B3R E;  2ZM6 E;  4LF8 E;  3HTX A;  1ZXN A;  1VIS A;  1D6T A;  4LF6 I;  1N32 I;  3C4B A;  4B3T E;  3WU4 A;  3ZKB A;  1N0V C;  1IBL I;  2JVA A;  4WUD A;  4X64 E;  4JI3 E;  3P1X A;  1N34 I;  4OX9 E;  4JI5 I;  4FWD A;  3WU3 A;  4DV0 E;  2UUB E;  1ZM3 A;  2HFU A;  1NZ0 A;  1XMO I;  3J7Y p;  5IWA E;  1Z0B A;  1YYW A;  2HHH I;  2VQF I;  3PYG A;  1S16 A;  4JI8 I;  1QZR A;  2DEI A;  4B3S E;  2F4V E;  2BV3 A;  2V2Q A;  3WU6 A;  3JAM Q;  1FWK A;  4DR5 I;  1XHK A;  4LFA I;  5CFF E;  2N3H A;  1WHQ A;  4DV6 I;  2JY9 A;  2UUC E;  3ZZU A;  4DR7 I;  1Z0T A;  3PYF A;  2CZ9 A;  1B62 A; 
#chains in the Genus database with same CATH topology
 2HKJ A;  2EOJ A;  1S4E A;  2V85 A;  3K17 A;  2BM1 A;  2R3V A;  5BR8 E;  1A1J A;  4AID A;  1ZAA C;  5A6B D;  4WXC A;  2PNL A;  1NCS A;  2JXP A;  4DV1 I;  4FN5 A;  2VE7 C;  4BA2 B;  4JI8 E;  2UXC I;  1OYR A;  2YT4 A;  1Z5B A;  2IES A;  2HKE A;  3VK6 A;  2YSP A;  1P47 A;  1N33 E;  2LTS A;  3DD6 A;  2J7K A;  4DR5 E;  3J81 Q;  1TF6 A;  2WP8 A;  5A69 A;  5TSE A;  2CVE A;  4DR1 E;  2IOP A;  4HAC A;  4JYA I;  3OTO E;  2YRH A;  1T4L B;  2E5L I;  1UDS A;  4IZJ B;  1N3G A;  2UUB I;  3BBG A;  1A1K A;  4F9B B;  1USU A;  5DRO A;  5JEA A;  5L3J A;  3V5R A;  4URL A;  2N3G A;  3DJW A;  1JK2 A;  4IFD E;  4GKK E;  5IT9 Q;  5LMN E;  2EOF A;  1Y60 A;  4YY3 E;  2LE2 A;  2WCC 3;  2HFS A;  4R2S A;  2O1T A;  2HGH A;  2O1U A;  1Y4S A;  1B63 A;  2NN6 B;  3U1K A;  1E3P A;  4MU0 A;  2EN8 A;  4DV1 E;  2EQ1 A;  1FJG I;  2UUA E;  4HAC B;  4AIM A;  4PRV A;  4FW9 A;  2YTG A;  4L8N A;  3EPL A;  4DUZ E;  2L2M A;  1A1F A;  2FGG A;  4YHH I;  1ZM2 A;  2PNZ B;  2N8X A;  1X5W A;  5LMU I;  2ENC A;  4LF5 E;  1XNR E;  3CDJ A;  4USK A;  2EMH A;  2EQ0 A;  3P06 A;  1X48 A;  2PO2 B;  2EPU A;  2ZM6 I;  1ZR9 A;  1GTK A;  4JI6 I;  2PO2 A;  4OO1 E;  4JYA E;  4DPX A;  4X66 E;  3ADJ A;  4M9V C;  1HNW I;  4DV7 E;  3IWD A;  2Z5C A;  2V89 A;  2CG9 A;  1UDO A;  1B69 A;  1ZM9 A;  2C39 B;  4P52 A;  2CT1 A;  1H72 C;  2DLK A;  1Z5C A;  3JAM C;  1YYK A;  2Z5B A;  1J26 A;  4FW4 A;  3VHT B;  1MX0 A;  3L7Z A;  2CSH A;  4FK5 C;  1Z59 A;  2DLQ A;  4LCH A;  2JYA A;  3B78 A;  1HNX E;  2EPO A;  4DV4 E;  3LNU A;  4UT4 A;  4NXM I;  1RMD A;  1Z0E A;  2LUP B;  1HR0 I;  2ENH A;  4BMJ A;  5A2Q C;  4LOM A;  1JK1 A;  1T39 A;  4GKJ I;  4WPY A;  3CWV A;  1Z0C A;  4JI5 E;  4Z7C A;  1GZ6 A;  2EMG A;  4LFC E;  4X65 I;  3Q6M A;  2RS7 A;  4UTG A;  4DV0 I;  1FKA E;  2V87 A;  2NN6 E;  3PYE A;  4R2P A;  3UHM A;  4WX9 A;  2YTN A;  5IWA I;  4AQY I;  1XMQ E;  5KL2 A;  1A1I A;  1RR9 A;  2UXD E;  4DR6 E;  3MHS C;  4J3D A;  2GHF A;  3ZOQ B;  2BA1 D;  3T1H I;  1QNT A;  2EMW A;  2YTP A;  4ZYG A;  1H73 A;  2V8Q B;  2GQ0 A;  4IFD D;  1J5E E;  4DV3 I;  1HNX I;  3HPS A;  1EKZ A;  1WUU A;  2BR2 B;  1X47 A;  4JV5 I;  2LV2 A;  2L2N A;  2YPN A;  2ADR A;  2J7J A;  4JG4 A;  1USV A;  4DMI A;  1IBK E;  4LF4 I;  2EFG A;  1PKP A;  2VF1 A;  2C38 A;  2YWQ A;  1HNZ E;  2EM6 A;  2WP8 B;  3L00 A;  4JI7 I;  3H09 A;  3BF2 A;  2MC5 A;  2EN4 A;  3K6Q A;  1ZM4 A;  4MLV A;  4WXD A;  1FNM A;  1OYS A;  4DV2 I;  3ADL A;  1X6E A;  3T1Y I;  4HYM A;  4FWG A;  4JI2 I;  4DR2 E;  2GS8 A;  4MYT A;  4LF7 I;  4U3B A;  2B7V A;  4BS9 A;  5FWK A;  1A6F A;  4WUB A;  2M9A A;  5IT9 C;  2BA0 G;  2EE8 A;  4ED4 A;  1KJK A;  2LTR A;  4FW6 A;  1N36 I;  2JEA B;  2ODR D;  3M7N G;  1BKN A;  2PO0 B;  2ZIT A;  3D4J A;  2PO0 A;  3KZY A;  2LT7 A;  3Q6N A;  5T6J A;  1UIL A;  4DKK A;  3QG5 C;  1L4S A;  1T4N A;  2EOE A;  5ADZ A;  2VES A;  4DR1 I;  4JI4 I;  4FW5 A;  1PJQ A;  4K0K E;  2IHR 1;  2EN1 A;  3J81 C;  3PYD A;  4R2A A;  5GME A;  2LBS B;  3HKM A;  2CTD A;  5LLQ A;  4LPF A;  2I13 A;  4MU1 A;  2DMY A;  2E1M A;  4BA1 B;  4JI7 E;  4GZN C;  2MKD A;  2VRD A;  1NEI A;  2HK3 A;  4DUY I;  4ZYE A;  1H7U A;  1XMO E;  3ZKD A;  3OTO I;  1ZBQ A;  1GQE A;  4WSP A;  4NXN E;  3T1Y E;  3V2U C;  2C38 B;  4DU8 A;  2VQF E;  1BBO A;  4DV5 I;  1Y6Z A;  4QNK A;  2H36 X;  1AAY A;  2JP9 A;  2Q8U A;  4AM3 A;  1RC7 A;  4DR3 E;  1IBL E;  5A6B A;  2A2C A;  4MYU A;  4MDT A;  5AAS A;  1UHZ A;  2EMZ A;  4B3R I;  2GLI A;  5A2Q Q;  2NN6 C;  2EOQ A;  5ELW A;  4X64 I;  2DB2 A;  4JI3 I;  1A1H A;  4IS1 C;  4BA2 A;  5A6K A;  1EH6 A;  4YHH E;  1YUJ A;  2V88 A;  3M99 B;  2K7I A;  4OX9 I;  4IZK A;  1ZBT A;  1SFE A;  1O0W A;  2UXB E;  5IXM B;  2JOX A;  5DNX A;  2OI2 A;  1ELO A;  1QU6 A;  2O1W A;  4GQU A;  4EMD A;  2EM9 A;  3QT5 A;  2PO1 A;  1HNW E;  2LUQ A;  2F8B A;  5KL5 A;  4OO1 F;  1IQO A;  3B4T A;  4NXN I;  1X49 A;  2WNR B;  1BBG A;  2EMF A;  3IWB A;  3Q1Q A;  4R1F A;  1IBM E;  1UEK A;  4BHB A;  1MGT A;  4N3O A;  1BB8 A;  3B82 A;  2EL6 A;  2JEB B;  4F9A B;  1EI1 A;  3KZZ A;  3PS1 A;  1ZU1 A;  3THN A;  1HR0 E;  2EPM X;  3ADG A;  3RMP A;  4M1K A;  4DR4 I;  1RRE A;  5C0X B;  5EKW A;  1YZ9 A;  4IFD C;  4QNJ A;  4BC9 A;  4ZVI A;  2BA1 G;  3QT6 A;  2DIX A;  2A2D A;  2VF3 A;  2G7H A;  2NUG A;  2RPC A;  1EH8 A;  2D9H A;  1RQ0 A;  2L33 A;  2MC6 A;  3F6G A;  3B8H A;  3F0N A;  4IS9 A;  4Z7Y A;  3J7A M;  2UUC I;  2M7Q A;  2EN3 A;  3J7A G;  4B3T I;  4B3M E;  2DSY A;  1R6M A;  1IMU A;  1PDA A;  4AQY E;  4F9C B;  4X62 I;  5LMN I;  3LML A;  4X8W A;  2EM8 A;  3TQM A;  4NBQ A;  4O24 A;  2EOH A;  2L3J A;  5BR8 I;  1MEY C;  4KWY A;  1PIE A;  2R42 A;  1YSA C;  4ISA A;  1I94 E;  2LJP A;  2BA0 D;  4DU7 A;  4DV3 E;  1J5E I;  2EMB A;  2KON A;  4LU9 A;  2UXC E;  3JU0 A;  4DR4 E;  2EPX A;  2ENA A;  1DGC A;  1E3H A;  2E72 A;  2ZBK B;  1XNR I;  2K4V A;  4P7D A;  1ZXM A;  2ODR C;  3KWR A;  5JEA C;  3HQ1 A;  1WJP A;  4DPU A;  2B7T A;  4P7A A;  3ZZ0 A;  2UU9 E;  1NHI A;  1DI2 A;  2Z5E A;  3LLH A;  3P3C A;  3HPZ A;  4X66 I;  4TUI A;  1EA6 A;  2EPR A;  4OZE A;  1PJT A;  1G2F C;  2E1R A;  5A6A A;  4Q35 B;  2IOQ A;  2RTX A;  3QT8 A;  5JEA E;  4GKK I;  4WUC A;  2F1D A;  2EPC A;  3F6H A;  2B9D A;  3IWC A;  2L3C A;  1Z1B A;  1KTV A;  1X3C A;  3PRY A;  4FW3 A;  4IFD A;  2V2Z A;  2NUE A;  2YTF A;  5C0X D;  1I94 I;  4LFB I;  5K36 D;  1F2I G;  3WU5 A;  3FIG A;  4IFD B;  2EOR A;  4IZJ A;  5DNY A;  2EOM A;  1PJS A;  4MLQ A;  1N34 E;  3EQ1 A;  4HTG A;  5AE3 A;  4DV6 E;  1KIJ A;  1NHJ A;  4DUY E;  1XNQ I;  4OKG A;  3AUZ A;  4NHR A;  4R2C A;  4N4R B;  2RS6 A;  2CGE A;  4MQY A;  5C0X E;  4JI1 E;  2JPA A;  4LCG A;  4DR6 I;  3U1Y A;  4BC7 A;  4FW7 A;  5AE1 A;  4USM A;  2VQE I;  3JTZ A;  5JEA F;  2V34 A;  3L7Z B;  3DF6 A;  3J80 C;  4KHP E;  1Z5A A;  3HUL A;  2WBS A;  1KVK A;  5DRR A;  1TN9 A;  5C0X F;  2EMI A;  4M30 A;  4F6M A;  4LFB E;  2IER A;  2O1V A;  2V83 A;  1N33 I;  1G2D C;  3VYY A;  2AE8 A;  4LF4 E;  1TF3 A;  2JEB A;  4LFA E;  4WFT A;  2EPN A;  1HNZ I;  1NHH A;  4BHC A;  2EMC A;  1Z0G A;  1Z0W A;  4X9J A;  4LFC I;  2UXB I;  2EQ3 A;  5F3W A;  4M0V A;  4O4K A;  5FLX C;  4DV2 E;  2L6M A;  4LF6 E;  1N32 E;  4ZYH A;  1YYO A;  1YH8 A;  1UN6 B;  4DR2 I;  1T4O A;  4LF7 E;  4DR7 E;  2M1S A;  2LRS A;  2FTX B;  4TUG A;  4R2D A;  2C37 B;  2GO4 A;  3CDI A;  4O43 A;  2X36 A;  2X7I A;  1FWL A;  4JI1 I;  2UXD I;  4YY3 I;  3PS2 A;  3EPH A;  1MU5 A;  2JE6 A;  2JT2 A;  2NN6 A;  3M85 D;  2VQE E;  4M2Z A;  2EM4 A;  4MU3 A;  3QT7 A;  1YPN A;  5FLX Q;  2UUA I;  4OO1 B;  4KHP I;  2L92 A;  4DUZ I;  3M85 G;  4K0K I;  2NN6 F;  4JV5 E;  2EN6 A;  1EH7 A;  2YTD A;  5IV8 B;  3H4L A;  1AH5 A;  4RPF A;  4LF5 I;  2ELY A;  2EJ4 A;  2EPL X;  2RSM A;  4PU9 A;  2YTO A;  3VYX A;  1RHY A;  4OO1 A;  1DQ3 A;  1YFH A;  2WW4 A;  4P78 A;  1STU A;  4HY1 A;  3LTO A;  3HJC A;  2PO1 B;  4HEI A;  2M4I A;  2PNZ A;  3OML A;  2BB8 A;  1HK7 A;  3K1J A;  5EL9 A;  2KHX A;  1H74 A;  2E5L E;  2V2V A;  3M6A A;  2RQL A;  2EPP A;  2I9I A;  1UBD C;  2HHH E;  4B3M I;  4JI2 E;  2A25 A;  1LLM C;  3K85 A;  2Z5C B;  1YUI A;  2MDR A;  1MG7 A;  2O3Z A;  2GO3 A;  3LPS A;  4DXL A;  2EMX A;  4U3D A;  4DPY A;  1X6F A;  4OOG C;  1N36 E;  4NXM E;  5KL7 A;  2XEX A;  2EOX A;  2FV4 B;  4ZYD A;  4XTJ A;  2NPF A;  4DV4 I;  4B3S I;  3ADI A;  1U2R A;  2F4V I;  2EL4 A;  3GON A;  4LF9 I;  1FJG E;  5K36 C;  4GKJ E;  4HXZ A;  2LJH A;  5KL3 A;  3EPK A;  4IZJ D;  1XXE A;  5C0X C;  4L5N C;  4F2J C;  4R2E A;  2R1F A;  2LMZ A;  2JE6 B;  1FI4 A;  4F54 A;  2YRM A;  1UDN A;  4I3H A;  1SR9 A;  2V8P A;  5K36 F;  5C0X A;  1KYQ A;  2EN2 A;  4PRX A;  2UU9 I;  3AV0 A;  2PNM A;  1Y5Y A;  3BID A;  4JI6 E;  2HK2 A;  1WHN A;  3J80 Q;  1UDQ A;  4R2Q A;  5LL6 R;  4DV7 I;  1IQS A;  2LVH A;  5K36 E;  3ZM7 A;  2MKN A;  2NA2 A;  4R2R A;  2V86 A;  2EM2 A;  4J8Z A;  1OJ4 A;  2L2K B;  4DV5 E;  5JEA B;  1Z0V A;  2J65 A;  2WZO A;  2NUF A;  4IJD A;  5JEA D;  4KQV A;  4DPW A;  4DR3 I;  4OO1 C;  2ELZ A;  1A1G A;  3M7N D;  2EM3 A;  5DRP A;  3P76 A;  2EOS A;  4JI0 E;  4LF9 E;  2JEA A;  2YU8 A;  2HJJ A;  3P3G A;  3PS3 A;  2DEJ A;  4IZK B;  1IBK I;  3C4T A;  2WBU A;  3NZK A;  2CPN A;  2EOO A;  2JOB A;  2L8T A;  4LF8 I;  2YTI A;  2PRT A;  4X65 E;  2BM0 A;  1T38 A;  3HXL A;  4KZS A;  5DNL A;  2EPZ A;  1XNQ E;  5A6J A;  4IFD F;  2EOZ A;  1R6L A;  1VI7 A;  1A1L A;  1K47 A;  1KKH A;  1YHC A;  2Q2E B;  3ZZT A;  4X62 E;  1XMQ I;  2JWO A;  1N0U A;  2EP3 A;  4R03 A;  5K36 A;  4FWH A;  5GMD A;  4DPT A;  2EMA A;  3ECR A;  1IBM I;  2YRK A;  4WYQ B;  2EWL A;  2AJ4 A;  4RHB B;  3T1H E;  3EPJ A;  3THO B;  2B3T B;  3KRN A;  1DAR A;  3BGH A;  3C6K A;  2EZ6 A;  2GPI A;  4JI4 E;  1H7S A;  1PVG A;  4BA1 A;  2NAB A;  4JI0 I;  1Y4U A;  5LMU E;  5AC5 A;  2EM7 A;  3UK3 C;  3H1C A;  4MU4 A;  4B3R E;  2ZM6 E;  4LF8 E;  2HC5 A;  4LTY A;  3HTX A;  1ZXN A;  5DRQ A;  4R8O A;  4F6N A;  1VIS A;  2EM0 A;  2DGC A;  2Z5B B;  1D6T A;  2YU5 A;  4BBY A;  2C39 A;  4LF6 I;  1N32 I;  3C4B A;  4B3T E;  2BR2 A;  2JR1 A;  2EPA A;  3WU4 A;  2EOY A;  3ZKB A;  2KOU A;  1N0V C;  3GCM A;  1IBL I;  2JVA A;  2WNR A;  4WUD A;  2MDG A;  2EML A;  5KL4 A;  4X64 E;  2YTE A;  4JI3 E;  2EN7 A;  4NZV A;  5K36 B;  3P1X A;  2EM5 A;  2NN6 D;  2EMY A;  4I8O A;  1N34 I;  2YTQ A;  4GEQ B;  4OX9 E;  1P42 A;  2YTJ A;  4JI5 I;  2LO3 A;  2C37 A;  4WSG A;  4FWD A;  3WU3 A;  4DV0 E;  2UUB E;  2EOI A;  3MSW A;  1X6H A;  1ZM3 A;  2HFU A;  2YZT A;  2LCE A;  4O5G A;  3J7Y p;  5IWA E;  1NZ0 A;  2BBG A;  1Z0B A;  1XMO I;  1YYW A;  3MHH C;  3C6M A;  4LCF A;  4RH8 A;  2HHH I;  2LJU A;  2VQF I;  2EMK A;  3PYG A;  4BCA A;  2R76 A;  1OYP A;  1S16 A;  1WXR A;  2DRP A;  4JI8 I;  1QZR A;  2DEI A;  4B3S E;  2F4V E;  2BV3 A;  2V2Q A;  3WU6 A;  3JAM Q;  2DMI A;  1FWK A;  4DR5 I;  5AE2 A;  1XHK A;  4LFA I;  4OO1 D;  5CFF E;  3GME A;  2EL5 A;  2N3H A;  2YSO A;  1WHQ A;  1WRJ A;  2EPK X;  4DV6 I;  2JY9 A;  2RSI A;  2UUC E;  3GLL A;  3ZZU A;  4DR7 I;  1Z0T A;  5KL6 A;  2CZ9 A;  3P3E A;  3PYF A;  4Q28 A;  1B62 A;  5AC4 A;  2WBT A; 
#chains in the Genus database with same CATH homology
 2HKJ A;  1S4E A;  2V85 A;  3K17 A;  2BM1 A;  2R3V A;  5BR8 E;  2PNL A;  4DV1 I;  4FN5 A;  2VE7 C;  4JI8 E;  2UXC I;  2YT4 A;  1Z5B A;  2HKE A;  3VK6 A;  1N33 E;  2LTS A;  2J7K A;  4DR5 E;  3J81 Q;  4DR1 E;  2IOP A;  4HAC A;  4JYA I;  3OTO E;  1T4L B;  2E5L I;  4IZJ B;  4F9B B;  1USU A;  5L3J A;  3V5R A;  4URL A;  2N3G A;  3DJW A;  4GKK E;  5IT9 Q;  5LMN E;  4YY3 E;  2LE2 A;  2HFS A;  2O1T A;  2O1U A;  1Y4S A;  1B63 A;  4DV1 E;  1FJG I;  2UUA E;  4HAC B;  4PRV A;  4FW9 A;  4L8N A;  4DUZ E;  2L2M A;  4YHH I;  2FGG A;  1ZM2 A;  5LMU I;  4LF5 E;  1XNR E;  4USK A;  3P06 A;  1X48 A;  2ZM6 I;  4JI6 I;  4JYA E;  4DPX A;  4X66 E;  3ADJ A;  1HNW I;  4DV7 E;  3IWD A;  2Z5C A;  2V89 A;  2CG9 A;  1ZM9 A;  4P52 A;  1H72 C;  1Z5C A;  3JAM C;  1YYK A;  2Z5B A;  1J26 A;  1MX0 A;  1Z59 A;  3B78 A;  1HNX E;  4DV4 E;  3LNU A;  4UT4 A;  4NXM I;  1Z0E A;  2LUP B;  1HR0 I;  4BMJ A;  5A2Q C;  4GKJ I;  4WPY A;  3CWV A;  1Z0C A;  4JI5 E;  4Z7C A;  1GZ6 A;  4LFC E;  4X65 I;  3Q6M A;  2RS7 A;  4UTG A;  4DV0 I;  1FKA E;  2V87 A;  3PYE A;  5IWA I;  4AQY I;  1XMQ E;  1RR9 A;  2UXD E;  4DR6 E;  3ZOQ B;  3T1H I;  1H73 A;  2V8Q B;  2GQ0 A;  1J5E E;  4DV3 I;  1HNX I;  3HPS A;  1EKZ A;  1WUU A;  1X47 A;  4JV5 I;  2L2N A;  4JG4 A;  1USV A;  4DMI A;  1IBK E;  4LF4 I;  2EFG A;  1PKP A;  2VF1 A;  1HNZ E;  4JI7 I;  3H09 A;  1ZM4 A;  2MC5 A;  3K6Q A;  1FNM A;  4DV2 I;  3ADL A;  3T1Y I;  4HYM A;  4FWG A;  4JI2 I;  4DR2 E;  2GS8 A;  4MYT A;  4LF7 I;  2B7V A;  4BS9 A;  5FWK A;  1A6F A;  4WUB A;  5IT9 C;  4ED4 A;  2LTR A;  1N36 I;  2ODR D;  1BKN A;  2ZIT A;  3D4J A;  3Q6N A;  5T6J A;  1UIL A;  4DKK A;  4JI4 I;  1T4N A;  5ADZ A;  4K0K E;  2IHR 1;  3J81 C;  3PYD A;  5GME A;  2LBS B;  4B3R I;  2UUB I;  2DMY A;  2E1M A;  4DUY I;  4JI7 E;  2HK3 A;  1H7U A;  3ZKD A;  1XMO E;  3OTO I;  1ZBQ A;  1GQE A;  4WSP A;  4NXN E;  3T1Y E;  3V2U C;  4DU8 A;  2VQF E;  4DV5 I;  1Y6Z A;  2H36 X;  1RC7 A;  4DR3 E;  1IBL E;  2A2C A;  4MYU A;  5AAS A;  1UHZ A;  5A2Q Q;  4X64 I;  2DB2 A;  4JI3 I;  4YHH E;  2V88 A;  4OX9 I;  4IZK A;  1ZBT A;  1O0W A;  2UXB E;  2JOX A;  2OI2 A;  1ELO A;  1QU6 A;  2O1W A;  4EMD A;  3QT5 A;  1HNW E;  2LUQ A;  2F8B A;  4NXN I;  1X49 A;  3IWB A;  3Q1Q A;  4R1F A;  1IBM E;  1UEK A;  4N3O A;  3B82 A;  4F9A B;  1EI1 A;  1HR0 E;  3ADG A;  4M1K A;  3RMP A;  4DR4 I;  1RRE A;  1YZ9 A;  4BC9 A;  4ZVI A;  3QT6 A;  2DIX A;  2A2D A;  2VF3 A;  2NUG A;  2G7H A;  3F6G A;  3F0N A;  2MC6 A;  1RQ0 A;  2L33 A;  3B8H A;  4DR1 I;  4Z7Y A;  3J7A M;  2UUC I;  2M7Q A;  3J7A G;  4B3T I;  4B3M E;  2DSY A;  4AQY E;  4F9C B;  4X62 I;  5LMN I;  3LML A;  4X8W A;  2L3J A;  5BR8 I;  1PIE A;  2R42 A;  1I94 E;  2LJP A;  4DU7 A;  4DV3 E;  1J5E I;  2KON A;  4LU9 A;  2UXC E;  3JU0 A;  4DR4 E;  2ZBK B;  1XNR I;  2K4V A;  4P7D A;  1ZXM A;  2ODR C;  3KWR A;  3HQ1 A;  4DPU A;  2B7T A;  4P7A A;  3ZZ0 A;  2UU9 E;  1NHI A;  1DI2 A;  2Z5E A;  3LLH A;  3HPZ A;  4X66 I;  4TUI A;  1EA6 A;  2E1R A;  2IOQ A;  2RTX A;  3QT8 A;  4GKK I;  4WUC A;  3F6H A;  2B9D A;  3IWC A;  2L3C A;  1KTV A;  3PRY A;  2V2Z A;  2NUE A;  1I94 I;  4LFB I;  3WU5 A;  3FIG A;  4IZJ A;  5DNY A;  1N34 E;  1KIJ A;  5AE3 A;  4DV6 E;  1NHJ A;  4DUY E;  1XNQ I;  3AUZ A;  2RS6 A;  2CGE A;  4JI1 E;  4DR6 I;  4BC7 A;  5AE1 A;  4USM A;  2VQE I;  3JTZ A;  2V34 A;  3DF6 A;  3J80 C;  4KHP E;  1Z5A A;  3HUL A;  1KVK A;  4M30 A;  2O1V A;  4LFB E;  2V83 A;  1N33 I;  3VYY A;  4LF4 E;  4LFA E;  4WFT A;  1HNZ I;  1NHH A;  1Z0W A;  1Z0G A;  4LFC I;  2UXB I;  5F3W A;  4M0V A;  5FLX C;  4DV2 E;  2L6M A;  4LF6 E;  1N32 E;  1YYO A;  4DR2 I;  1T4O A;  4LF7 E;  4DR7 E;  2M1S A;  2LRS A;  2FTX B;  4TUG A;  2X36 A;  2X7I A;  4JI1 I;  1FWL A;  2UXD I;  4YY3 I;  1MU5 A;  2VQE E;  4M2Z A;  3QT7 A;  5FLX Q;  2UUA I;  4KHP I;  2L92 A;  4DUZ I;  4JV5 E;  3H4L A;  4RPF A;  4LF5 I;  2RSM A;  4PU9 A;  3VYX A;  1DQ3 A;  2WW4 A;  4HY1 A;  1STU A;  4P78 A;  3LTO A;  3HJC A;  2M4I A;  3OML A;  3K1J A;  1HK7 A;  2KHX A;  1H74 A;  2E5L E;  2V2V A;  3M6A A;  2HHH E;  4B3M I;  4JI2 E;  3K85 A;  2Z5C B;  4DXL A;  2MDR A;  1MG7 A;  3LPS A;  4DPY A;  4OOG C;  1N36 E;  4NXM E;  2XEX A;  2NPF A;  4DV4 I;  2FV4 B;  4XTJ A;  4B3S I;  2F4V I;  3ADI A;  1U2R A;  4LF9 I;  3GON A;  1FJG E;  4GKJ E;  4HXZ A;  2LJH A;  4IZJ D;  4L5N C;  4K0K I;  2LMZ A;  4I3H A;  1FI4 A;  4F54 A;  1SR9 A;  2V8P A;  4PRX A;  2UU9 I;  3AV0 A;  2PNM A;  4JI6 E;  2HK2 A;  1WHN A;  3J80 Q;  5LL6 R;  4DV7 I;  3ZM7 A;  2NA2 A;  2V86 A;  1OJ4 A;  4J8Z A;  2L2K B;  4DV5 E;  1Z0V A;  2WZO A;  2NUF A;  4KQV A;  4DPW A;  4DR3 I;  4JI0 E;  4LF9 E;  4IZK B;  1IBK I;  2DEJ A;  3C4T A;  2CPN A;  2JOB A;  2L8T A;  4LF8 I;  4X65 E;  2BM0 A;  3HXL A;  4KZS A;  1XNQ E;  3ZZT A;  1K47 A;  1KKH A;  2Q2E B;  4X62 E;  1XMQ I;  2JWO A;  1N0U A;  4R03 A;  4FWH A;  5GMD A;  4DPT A;  1IBM I;  4WYQ B;  2EWL A;  2AJ4 A;  3T1H E;  2B3T B;  1DAR A;  2EZ6 A;  4JI4 E;  1H7S A;  1PVG A;  4JI0 I;  1Y4U A;  5LMU E;  4B3R E;  2ZM6 E;  4LF8 E;  3HTX A;  4LTY A;  1ZXN A;  4R8O A;  1VIS A;  2Z5B B;  1D6T A;  4BBY A;  4LF6 I;  1N32 I;  3C4B A;  4B3T E;  2JR1 A;  3WU4 A;  3ZKB A;  2KOU A;  1N0V C;  1IBL I;  2JVA A;  4WUD A;  4X64 E;  4JI3 E;  3P1X A;  4I8O A;  1N34 I;  4GEQ B;  4OX9 E;  4JI5 I;  4FWD A;  3WU3 A;  4DV0 E;  2UUB E;  3MSW A;  1ZM3 A;  2HFU A;  2YZT A;  1NZ0 A;  1XMO I;  3J7Y p;  5IWA E;  1Z0B A;  1YYW A;  2HHH I;  2VQF I;  3PYG A;  4BCA A;  1S16 A;  1WXR A;  4JI8 I;  1QZR A;  2DEI A;  4B3S E;  2F4V E;  2BV3 A;  2V2Q A;  3WU6 A;  3JAM Q;  1FWK A;  4DR5 I;  5AE2 A;  1XHK A;  4LFA I;  5CFF E;  2N3H A;  1WHQ A;  4DV6 I;  2JY9 A;  2UUC E;  3ZZU A;  4DR7 I;  1Z0T A;  3PYF A;  2CZ9 A;  4Q28 A;  1B62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...