1HNWE

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1hnwE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnwE02
1ZM2A 1Z0BA 2HHHI 2MDRA 2NUEA 4LF8E 4JI6I 3OTOI 4DV2I 3CWVA 1XNQI 3ZKDA 4PU9A 1T4OA 2UUBI 1RC7A 4DR5I 4DPYA 4DR1I 1N34I 3ADIA 4PRVA 4JI8E 1ZM3A 1S4EA 1X47A 2JY9A 3QT5A 1U2RA 2GS8A 2L2KB 2EFGA 4JI3I 2UXCE 1UHZA 4NXNE 1FWKA 3M6AA 2L2NA 4X66I 5LMNI 4B3TE 4LF6I 4NXMI 5LMUE 4DV4I 4LF9I 3ZKBA 1PIEA 4DV3I 4M1KA 3PYEA 1Z5AA 3HULA 1Z0VA 2LRSA 1RQ0A 4X65I 3T1HE 1I94I 1EA6A 1Z0CA 2JVAA 1H7SA 2DMYA 4LF4I 2F4VE 1ZBTA 4DU8A 1H72C 1IBLI 2UUAI 2NA2A 3J7AM 2UU9I 2V8PA 1OJ4A 1BKNA 4DR4I 3T1YE 2HFUA 1XNRE 4JI0E 4DUZE 4DR7E 1FJGI 1HNXE 4B3SI 3C4BA 1FI4A 3B78A 1IBME 4LF7I 4GKKI 3J81Q 4DV0I 4AQYE 3PYDA 2DIXA 4MYTA 1HR0I 4KHPE 3WU5A 4DR3E 4Z7YA 4LFAI 3WU3A 3GONA 4B3RI 2RTXA 3ADLA 2AJ4A 1MX0A 4X64E 1STUA 1T4NA 4JG4A 1ZXNA 4DPXA 3H4LA 4JYAI 1D6TA 4OX9I 2X36A 4DV5E 5FLXQ 3J81C 1K47A 4ED4A 4DU7A 3V5RA 4YY3E 4X8WA 5IWAE 1XMOI 4YHHE 4JI2I 2WW4A 4LF5E 4DR2E 3LTOA 3J80Q 4R1FA 4P7AA 2RS7A 2LTSA 1T4LB 2VQEE 2A2DA 3B8HA 4GKJI 1XHKA 1GQEA 2UXBE 1DARA 1ZM4A 3ADJA 2UUCI 5BR8E 2CPNA 1Z0TA 4DV6E 4PRXA 4KHPI 2L2MA 2VQFE 4JV5E 1VISA 1HNWI 2DEIA 4DV7I 1N33E 4B3MI 4URLA 4JI4I 4DUYI 4X64I 2UXDI 3J80C 4HACB 2V2QA 1N32I 2E5LI 2ZM6E 4K0KI 3LLHA 4RPFA 1J26A 2R42A 2DB2A 4M2ZA 1NZ0A 4DXLA 1XMQI 1PVGA 1KIJA 1N36I 3ZZTA 4DV1I 3VYXA 4HYMA 2BM1A 3Q1QA 2N3GA 4FWGA 2LUQA 1Z59A 3F0NA 4LF5I 2EZ6A 4LFBE 3QT8A 4DR6E 3ZM7A 2B7VA 5CFFE 1S16A 1IBKI 5IT9Q 4JI5I 4X62I 3K17A 1HNZE 4JI1E 1DI2A 4JI7E 4LF8I 4HXZA 2HK2A 4MYUA 1WHQA 4LFCE 3J7Yp 3P1XA 4DPUA 2HHHE 3HTXA 4JI8I 1X48A 3OTOE 4DV2E 4JI6E 1N33I 1Z5BA 1XNQE 1UILA 1B62A 2CZ9A 2L3CA 2UUBE 1A6FA 1ZXMA 4DR5E 2UXCI 4NXNI 4B3TI 4FW9A 4DR1E 1N34E 2N3HA 5LMUI 2LTRA 5IT9C 2NUGA 1KVKA 1NHHA 5GMEA 1QU6A 1B63A 1KTVA 2V34A 4JI3E 3T1HI 5LMNE 1ZM9A 4UTGA 4X66E 4KQVA 4LF6E 4NXME 2F4VI 2NPFA 2B7TA 4LF9E 3QT7A 1NHIA 1EI1A 1YYWA 4DV3E 4P52A 3T1YI 1XNRI 1ELOA 4JI0I 4X65E 1I94E 4DUZI 4DR7I 1QZRA 1H7UA 1HNXI 3V2UC 4OOGC 2V2VA 3J7AG 1IBLE 2UUAE 1IBMI 1RR9A 2UU9E 4AQYI 2B3TB 2IHR1 2R3VA 2LJHA 4DR4E 2A2CA 5L3JA 1FJGE 1RREA 5FLXC 4B3SE 3PYGA 4DR3I 4LF7E 5LL6R 4GKKE 4I3HA 4DV0E 2HKJA 1N0VC 1UEKA 1N0UA 1HR0E 4ZVIA 4HACA 2XEXA 2RSMA 4LFAE 1Z5CA 1YZ9A 4B3RE 4DV5I 2BV3A 1FWLA 3WU4A 4YY3I 3B82A 3ZZUA 5IWAI 4YHHI 3PYFA 1O0WA 4JYAE 4OX9E 1J5EE 2BM0A 4DR2I 4HY1A 4EMDA 2OI2A 4XTJA 2VQEI 4WUDA 1XMOE 2ZBKB 2LBSB 3WU6A 4JI2E 2DEJA 2UXBI 4FWDA 1Z0EA 1MG7A 3ZZ0A 5BR8I 2LUPB 1H73A 3VYYA 4DV6I 2L3JA 4GKJE 4Z7CA 2X7IA 2LJPA 1KKHA 2VQFI 2J7KA 4JV5I 1PKPA 2UUCE 4FN5A 3LPSA 1FNMA 3C4TA 2YT4A 1YYOA 5A2QQ 2HFSA 1H74A 4UT4A 4FWHA 5GMDA 3D4JA 2ZM6I 3ADGA 1HNWE 3JAMQ 4DV7E 1X49A 3LNUA 4B3ME 4USMA 4USKA 4JI4E 3QT6A 4DUYE 2UXDE 4WUCA 2HK3A 4DPTA 1N32E 1MU5A 2E5LE 2Q2EB 4DV4E 3K1JA 4K0KE 4WYQB 1NHJA 1WUUA 2VF3A 1WHNA 2ZITA 2L33A 2RS6A 1J5EI 4LFBI 1XMQE 1Z0WA 1N36E 2E1RA 5A2QC 4DR6I 4DV1E 4LF4E 2HKEA 4M30A 1FKAE 1HNZI 2V2ZA 4JI1I 4DPWA 3JAMC 4JI7I 1Z0GA 1YYKA 2NUFA 1EKZA 2KHXA 4DKKA 4LFCI 4WFTA 4WUBA 1IBKE 4JI5E 4X62E
chains in the Genus database with same CATH superfamily
2YWQA 2YPNA 1ZM2A 2VE7C 1Z0BA 2HHHI 2MDRA 2EOSA 2NUEA 4LF8E 2JEBA 2NN6D 1HK7A 3OTOI 4DV2I 3CWVA 4JI6I 3PRYA 5KL5A 1XNQI 3ZKDA 4PU9A 1T4OA 4FW6A 2UUBI 2GO3A 2E1MA 3Q6NA 1RC7A 4DR5I 2EPZA 4QNKA 1Y4SA 4DPYA 4QNJA 4RH8A 4BS9A 4DR1I 1N34I 1A1FA 3ADIA 4PRVA 4JI8E 1ZM3A 4OO1A 2NN6F 2PO2B 1S4EA 3IWDA 1X47A 2JY9A 2V85A 2WBUA 3QT5A 2EN8A 1U2RA 3NZKA 5AE3A 4IFDC 2GS8A 2L2KB 1PDAA 2EFGA 4JI3I 3QG5C 2ENHA 2UXCE 1USUA 1DQ3A 1UHZA 4F2JC 4NXNE 2L2NA 1FWKA 3K85A 3EPHA 3M6AA 4L8NA 4B3TE 4X66I 5C0XD 5LMUE 2I13A 4DV4I 4LF6I 4NXMI 2CT1A 4L5NC 4O4KA 2E72A 2YTNA 4GZNC 2L92A 4LF9I 1IQSA 2RPCA 2PNLA 3ZKBA 1PIEA 2EOMA 4DV3I 4M1KA 2EN4A 3PYEA 5EKWA 1Z5AA 3C6KA 3HULA 1Z0VA 2LRSA 4AIDA 2EORA 1RQ0A 4X65I 4O43A 3T1HE 1I94I 1EA6A 1Z0CA 4P7DA 5C0XF 2EOXA 2WZOA 2JVAA 1ZU1A 2DMYA 2EM7A 3K6QA 1H7SA 2F4VE 4LF4I 1ZBTA 4DU8A 2BR2A 1H72C 1IBLI 2UUAI 2WP8B 1EH7A 2FGGA 2EM4A 5A6JA 2EMZA 2NA2A 2EN1A 3J7AM 2UU9I 2V8PA 4M9VC 3CDIA 1OJ4A 4KWYA 1BKNA 1PJQA 3B4TA 4DR4I 4LCGA 3T1YE 2HFUA 1XNRE 4JI0E 1X6FA 2ELYA 4DUZE 1A1LA 4DR7E 1FJGI 2EPAA 1HNXE 4B3SI 2ELZA 3C4BA 1FI4A 4OO1D 2HJJA 3HQ1A 3B78A 1IBME 4LF7I 4IFDA 1ZBQA 2D9HA 4GKKI 2L6MA 3J81Q 4O24A 4AQYE 4DV0I 2YTFA 1TF6A 3PYDA 2EMLA 2DIXA 4MYTA 2O1UA 2Z5CA 1HR0I 3RMPA 4WSPA 4KHPE 4F9BB 3MHHC 4OO1F 3BF2A 3WU5A 4DR3E 2NABA 4Z7YA 4LFAI 2YRHA 3WU3A 2WBTA 3GONA 2C39B 3Q6MA 4B3RI 2RTXA 1WJPA 2EPPA 3ADLA 3OMLA 2EMFA 3L00A 2EOIA 2JWOA 4BMJA 1MX0A 2AJ4A 2F8BA 2LCEA 4X64E 3H1CA 2C37A 1VI7A 2LE2A 1STUA 5DRRA 2V89A 5JEAB 5A6AA 4P78A 1T4NA 4JG4A 1ZXNA 2EMWA 2JXPA 4DPXA 3H4LA 2YTGA 2LT7A 1Y5YA 5ELWA 4OX9I 4JYAI 1D6TA 2V88A 2X36A 5DNLA 4DV5E 2V83A 4U3BA 2DSYA 2V87A 4R2SA 2EN3A 3J81C 2K7IA 1P47A 1OYSA 4ISAA 1K47A 4N3OA 1EH8A 2EOZA 4ED4A 4F9AB 4DU7A 3V5RA 4YY3E 4X8WA 5IWAE 2PNZA 2MKNA 1XMOI 4YHHE 1UBDC 4JI2I 2NN6B 3C6MA 4BCAA 4I8OA 4LCHA 2O1VA 2WW4A 4LF5E 1A1GA 2EOOA 4DR2E 2J7JA 3LTOA 1BBOA 1AH5A 3J80Q 4R1FA 2EOQA 2RS7A 3BGHA 2EPCA 4P7AA 2EMIA 2LTSA 1T4LB 2M7QA 2VQEE 2A2DA 1L4SA 5K36C 3B8HA 1KYQA 4GKJI 1XHKA 1GTKA 1X3CA 5T6JA 3UK3C 1GQEA 2EOHA 2M4IA 2MKDA 2UXBE 1DARA 3ADJA 1ZM4A 4LPFA 2UUCI 2Z5BB 5LLQA 5BR8E 1PJTA 2EQ0A 2R1FA 1WXRA 1A1JA 3EPKA 4RHBB 1KJKA 1E3HA 4FW4A 2EPRA 2C38A 5C0XB 2CPNA 2FTXB 1Z0TA 4DV6E 2DGCA 4PRXA 5K36E 4KHPI 1N3GA 2L2MA 2WNRA 2VQFE 4JV5E 1ZR9A 2KONA 3M85G 2G7HA 1YSAC 1VISA 3M85D 1HNWI 3BBGA 2DEIA 2EM9A 3U1YA 4DV7I 2PO2A 2H36X 3JTZA 1N33E 4B3MI 5DRQA 4AM3A 4URLA 4JI4I 3P06A 1YPNA 4DUYI 2JEBB 1T39A 4X64I 2UXDI 3J80C 4WXCA 4HACB 3PS3A 3GCMA 1ZAAC 1RMDA 4R2CA 1Z1BA 1QNTA 2J65A 2V2QA 2E5LI 1N32I 4TUIA 1A1HA 2JEAB 2ZM6E 4BC9A 2EL5A 4K0KI 5KL6A 2EMGA 5K36A 3LLHA 3MHSC 2EL6A 3EQ1A 4HTGA 3THOB 2JOBA 4MLVA 4IZKB 1J26A 2R42A 3DD6A 1EH6A 4RPFA 4OO1B 2DB2A 4M2ZA 4IZJA 1NZ0A 2EPNA 4DXLA 3M99B 1XMQI 1PVGA 4IFDE 1KIJA 2I9IA 4U3DA 3ZZTA 1MGTA 1N36I 2EMYA 5DNXA 4DV1I 3JU0A 4ZYGA 2EOJA 3VYXA 3EPLA 1USVA 3KRNA 2YZTA 2BM1A 2YU8A 4HYMA 3Q1QA 2WP8A 1TN9A 3L7ZA 2N3GA 3TQMA 4FWGA 2LUQA 2DLQA 1YUJA 1Z59A 5JEAC 2CGEA 3F0NA 4LF5I 2L8TA 2EZ6A 4F6MA 1SR9A 4LFBE 4MU3A 3QT8A 4MDTA 4DR6E 3ZM7A 2CG9A 2ENCA 1YFHA 1P42A 2JT2A 2V86A 2B7VA 5CFFE 1S16A 3F6GA 2EMBA 2EN6A 2GLIA 1IBKI 4BA2A 5IT9Q 4JI5I 2GPIA 4X62I 3K17A 2V8QB 4R2QA 1HNZE 2MC6A 4MQYA 4JI1E 5A6BA 1DI2A 1IMUA 5FWKA 2A25A 4J8ZA 1NCSA 4JI7E 4LF8I 4HXZA 4R2AA 1TF3A 2HK2A 4MYUA 2LO3A 3VK6A 2O1WA 1WHQA 4LFCE 3J7Yp 3P1XA 1YUIA 2JE6A 4BA1A 5K36D 2MDGA 5KL2A 4DMIA 4DPUA 4O5GA 2EM5A 2YSOA 5AE2A 2DMIA 2C39A 2EN2A 1UDQA 2HHHE 4IZJD 3HTXA 4MU4A 4JI8I 1G2DC 1X48A 3OTOE 4DV2E 4JI6E 2IOPA 1N33I 2B9DA 1Z5BA 1XNQE 5K36F 2CTDA 1UILA 5IXMB 2YSPA 2K4VA 3EPJA 4ZYHA 1B62A 2CZ9A 5JEAA 2YTEA 2EM6A 2L3CA 1JK2A 2UUBE 4IJDA 1A6FA 2EMHA 2EPUA 2AE8A 4OZEA 1ZXMA 2GHFA 4DR5E 4NXNI 3BIDA 2UXCI 4B3TI 2PO1B 2LMZA 4FW9A 4DR1E 1N34E 2N3HA 5LMUI 4NZVA 2LTRA 5IT9C 1YHCA 2EM2A 2NUGA 1KVKA 4R2EA 1NHHA 5GMEA 1QU6A 2N8XA 5AC5A 1B63A 1KTVA 2V34A 2C37B 4IFDD 5ADZA 4JI3E 3T1HI 5A6BD 5LMNE 1ZM9A 4UTGA 4X66E 5A69A 1UDNA 4KQVA 4LF6E 4NXME 2F4VI 2EJ4A 2B7TA 1R6LA 2NPFA 4LF9E 2VESA 4LTYA 1NHIA 4Q35B 2EM8A 1EI1A 1X6HA 3QT7A 5KL3A 4Q28A 1YYWA 4DV3E 3P3EA 3M7NG 4P52A 2LJUA 2EOEA 2VF1A 2YRKA 4IFDF 3ZOQB 1A1IA 2EPLX 3T1YI 1XNRI 5AC4A 1ELOA 5AE1A 4X65E 1I94E 4MU1A 4JI0I 1MEYC 1QZRA 4DUZI 4DR7I 1H7UA 2F1DA 1HNXI 3V2UC 4OOGC 2PNZB 2O1TA 2WBSA 3J7AG 2V2VA 1IBLE 2UUAE 2Z5BA 4R2DA 4BHBA 1IBMI 2M1SA 1NEIA 1RR9A 4HEIA 5A6KA 2UU9E 4R2RA 2PO0B 4AQYI 2B3TB 4M0VA 2IHR1 2R3VA 2LJHA 4DR4E 2A2CA 2EL4A 5L3JA 1FJGE 1RREA 2HC5A 5FLXC 4F9CB 2BBGA 4R2PA 4B3SE 3LMLA 3PYGA 2JYAA 4DR3I 2FV4B 3U1KA 5JEAF 4MLQA 4LF7E 2M9AA 1Y4UA 5LL6R 4X9JA 4GKKE 4I3HA 4DV0E 1Y60A 4NHRA 2HKJA 1N0VC 3PS1A 2ODRC 2YTQA 2EQ1A 1UEKA 1N0UA 4FK5C 1HR0E 4ZYEA 2GQ0A 4FW3A 4J3DA 4ZVIA 4R8OA 3P3CA 4HACA 2C38B 2EMKA 2HGHA 4WX9A 2XEXA 4BBYA 3IWCA 4GEQB 5DRPA 2JEAA 5IV8B 2RSMA 4LFAE 1Z5CA 1YZ9A 2WNRB 4B3RE 4LU9A 1UN6B 2BA0G 2BA0D 3P76A 4IZKA 4DV5I 2EM0A 5KL7A 1F2IG 3PS2A 2BV3A 3AV0A 1FWLA 3GLLA 3WU4A 5EL9A 2EP3A 4YY3I 3B82A 3ZZUA 4WXDA 3F6HA 5IWAI 4YHHI 5TSEA 3HJCA 3PYFA 2YTOA 3CDJA 2EMCA 1O0WA 2PRTA 2ENAA 2BB8A 2DLKA 4JYAE 4OX9E 5AASA 1J5EE 5K36B 2BM0A 4DR2I 4HY1A 1XXEA 1B69A 1G2FC 2EPMX 2OI2A 4EMDA 1T38A 3KWRA 1YH8A 4NBQA 2YTPA 4WPYA 2LVHA 4R03A 4XTJA 4IZJB 2VQEI 4WUDA 2YU5A 1XMOE 2IOQA 2ZBKB 2PNMA 2BA1G 2LBSB 1GZ6A 2BA1D 4JI2E 3WU6A 2EM3A 2DEJA 3HXLA 4MU0A 2UXBI 4FWDA 2Q8UA 1Z0EA 2BR2B 1MG7A 3ZZ0A 5JEAE 3H09A 3L7ZB 5BR8I 2LV2A 2IERA 2EWLA 2NN6C 2JOXA 2LUPB 1X6EA 1H73A 3HPZA 3VYYA 1E3PA 2IESA 5FLXQ 4DV6I 2L3JA 4GKJE 4Z7CA 2X7IA 2LJPA 3KZZA 1KKHA 2Z5EA 2VQFI 2J7KA 4JV5I 1PKPA 2UUCE 4BHCA 5LMNI 5DNYA 4FN5A 4BA2B 3UHMA 4FW7A 2GO4A 3AUZA 3LPSA 1FNMA 4AIMA 4IFDB 2EQ3A 3C4TA 2JPAA 2YT4A 2DRPA 5DROA 1YYOA 5A2QQ 1SFEA 2NN6E 3DF6A 2JR1A 1LLMC 2HFSA 4LOMA 1H74A 2Z5CB 2EPKX 4UT4A 4FWHA 5GMDA 3MSWA 3P3GA 2JE6B 4BA1B 5C0XC 2YTDA 3D4JA 2PO1A 3VHTB 3DJWA 1X5WA 3ADGA 1HNWE 2ZM6I 3GMEA 4F6NA 4IS9A 4DV7E 1OYRA 1X49A 3JAMQ 3LNUA 3HKMA 4B3ME 4USMA 3KZYA 2WCC3 4USKA 4JI4E 4N4RB 2ODRD 2RQLA 2EOFA 4KZSA 4DUYE 1UDSA 3QT6A 1PJSA 2UXDE 4WUCA 2HK3A 4DPTA 2CVEA 2NN6A 4BC7A 1N32E 1MU5A 2E5LE 2Q2EB 4DV4E 1DGCA 4GQUA 5C0XE 4F54A 4ZYDA 4K0KE 3K1JA 4WYQB 1NHJA 1BBGA 1WUUA 2VF3A 2EMXA 1WHNA 2ADRA 5F3WA 2ZITA 1JK1A 4LCFA 2L33A 3HPSA 2RS6A 1J5EI 1A1KA 2EPXA 4LFBI 1XMQE 2EN7A 2R76A 1RHYA 1Y6ZA 1Z0WA 1N36E 5A2QC 2E1RA 3M7ND 4WSGA 4DR6I 3THNA 4DV1E 2O3ZA 4LF4E 2HKEA 4OO1C 1WRJA 2VRDA 4M30A 3FIGA 2JP9A 2EMAA 1FKAE 1UDOA 1R6MA 1AAYA 2MC5A 4FW5A 1IQOA 1BB8A 3ECRA 2EOYA 2YTIA 1HNZI 2V2ZA 5JEAD 4JI1I 2PO0A 1OYPA 2CSHA 4DPWA 3IWBA 5C0XA 3JAMC 4JI7I 1Z0GA 1YYKA 2NUFA 1EKZA 2KOUA 5KL4A 4OKGA 2KHXA 4DKKA 4TUGA 4IS1C 4LFCI 4WFTA 4WUBA 4OO1E 2YRMA 1IBKE 2RSIA 2EPOA 2YTJA 4JI5E 4X62E 2EE8A
chains in the Genus database with same CATH topology
1ZM2A 2VE7C 1Z0BA 2HHHI 2MDRA 2NUEA 4LF8E 4JI6I 1HK7A 3OTOI 4DV2I 3CWVA 3PRYA 1XNQI 3ZKDA 4PU9A 1T4OA 2UUBI 2E1MA 3Q6NA 1RC7A 4DR5I 1Y4SA 4DPYA 4BS9A 4DR1I 1N34I 3ADIA 4PRVA 4JI8E 1ZM3A 1S4EA 3IWDA 1X47A 2JY9A 2V85A 3QT5A 1U2RA 5AE3A 2GS8A 2L2KB 2EFGA 4JI3I 2UXCE 1USUA 1DQ3A 1UHZA 4NXNE 1FWKA 2L2NA 3K85A 3M6AA 4X66I 5LMNI 4L8NA 4B3TE 4LF6I 4NXMI 5LMUE 4DV4I 4L5NC 4LF9I 2L92A 2PNLA 3ZKBA 1PIEA 4DV3I 4M1KA 3PYEA 1Z5AA 3HULA 1Z0VA 2LRSA 1RQ0A 4X65I 3T1HE 1I94I 1EA6A 1Z0CA 4P7DA 2WZOA 2JVAA 1H7SA 2DMYA 3K6QA 4LF4I 2F4VE 1ZBTA 4DU8A 1H72C 1IBLI 2UUAI 2FGGA 2NA2A 3J7AM 2UU9I 2V8PA 1OJ4A 1BKNA 4DR4I 3T1YE 2HFUA 1XNRE 4JI0E 4DUZE 4DR7E 1FJGI 1HNXE 4B3SI 3C4BA 1FI4A 3HQ1A 3B78A 1IBME 4LF7I 1ZBQA 4GKKI 2L6MA 3J81Q 4DV0I 4AQYE 3PYDA 2DIXA 4MYTA 2O1UA 2Z5CA 1HR0I 3RMPA 4WSPA 4KHPE 4F9BB 3WU5A 4DR3E 4Z7YA 4LFAI 3WU3A 3GONA 3Q6MA 4B3RI 2RTXA 3ADLA 3OMLA 2AJ4A 2JWOA 4BMJA 1MX0A 2F8BA 4X64E 2LE2A 1STUA 2V89A 4P78A 1T4NA 4JG4A 1ZXNA 4DPXA 3H4LA 4JYAI 1D6TA 4OX9I 2V88A 2X36A 4DV5E 2V83A 2DSYA 2V87A 5FLXQ 3J81C 4N3OA 1K47A 4ED4A 4F9AB 4DU7A 3V5RA 4YY3E 4X8WA 5IWAE 1XMOI 4YHHE 4JI2I 4BCAA 4I8OA 2O1VA 2WW4A 4LF5E 4DR2E 3LTOA 3J80Q 4R1FA 4P7AA 2RS7A 2LTSA 1T4LB 2M7QA 2VQEE 2A2DA 3B8HA 4GKJI 1XHKA 5T6JA 1GQEA 2M4IA 2UXBE 1DARA 1ZM4A 3ADJA 2UUCI 2Z5BB 5BR8E 1WXRA 2CPNA 2FTXB 1Z0TA 4DV6E 4PRXA 4KHPI 2L2MA 2VQFE 4JV5E 2KONA 2G7HA 1VISA 1HNWI 2DEIA 4DV7I 2H36X 3JTZA 1N33E 4B3MI 4URLA 4JI4I 3P06A 4DUYI 4X64I 2UXDI 3J80C 4HACB 2V2QA 1N32I 2E5LI 4TUIA 2ZM6E 4BC9A 4K0KI 3LLHA 2JOBA 4IZKB 4RPFA 1J26A 2R42A 2DB2A 4M2ZA 4IZJA 1NZ0A 4DXLA 1XMQI 1PVGA 1KIJA 1N36I 3ZZTA 4DV1I 3JU0A 3VYXA 1USVA 2YZTA 2BM1A 4HYMA 3Q1QA 2N3GA 4FWGA 2LUQA 1Z59A 2CGEA 3F0NA 4LF5I 2L8TA 2EZ6A 1SR9A 4LFBE 3QT8A 4DR6E 3ZM7A 2CG9A 2V86A 2B7VA 5CFFE 1S16A 3F6GA 1IBKI 5IT9Q 4JI5I 4X62I 3K17A 2V8QB 1HNZE 2MC6A 4JI1E 1DI2A 5FWKA 4J8ZA 4JI7E 4LF8I 4HXZA 2HK2A 4MYUA 3VK6A 2O1WA 1WHQA 4LFCE 3J7Yp 3P1XA 4DPUA 4DMIA 5AE2A 2HHHE 4IZJD 3HTXA 4JI8I 1X48A 3OTOE 4DV2E 4JI6E 2IOPA 1N33I 2B9DA 1Z5BA 1XNQE 1UILA 1B62A 2K4VA 2CZ9A 2L3CA 2UUBE 1A6FA 1ZXMA 4DR5E 2UXCI 4NXNI 4B3TI 2LMZA 4FW9A 4DR1E 1N34E 2N3HA 5LMUI 2LTRA 5IT9C 2NUGA 1KVKA 1NHHA 5GMEA 1QU6A 1B63A 1KTVA 2V34A 5ADZA 4JI3E 3T1HI 5LMNE 1ZM9A 4UTGA 4X66E 4KQVA 4LF6E 4NXME 2F4VI 2NPFA 2B7TA 4LF9E 3QT7A 4LTYA 1NHIA 1EI1A 4Q28A 1YYWA 4DV3E 4P52A 2VF1A 3ZOQB 3T1YI 1XNRI 1ELOA 5AE1A 4X65E 1I94E 4JI0I 4DUZI 1QZRA 4DR7I 1H7UA 1HNXI 3V2UC 4OOGC 2O1TA 3J7AG 2V2VA 1IBLE 2UUAE 2Z5BA 1IBMI 2M1SA 1RR9A 2UU9E 4AQYI 2B3TB 4M0VA 2IHR1 2R3VA 2LJHA 4DR4E 2A2CA 5L3JA 1FJGE 1RREA 5FLXC 4F9CB 4B3SE 3LMLA 3PYGA 4DR3I 2FV4B 4LF7E 1Y4UA 5LL6R 4GKKE 4I3HA 4DV0E 2HKJA 1N0VC 2ODRC 1UEKA 1N0UA 1HR0E 2GQ0A 4ZVIA 4R8OA 4HACA 2XEXA 4BBYA 3IWCA 4GEQB 2RSMA 4LFAE 1Z5CA 1YZ9A 4B3RE 4LU9A 4IZKA 4DV5I 2BV3A 3AV0A 1FWLA 3WU4A 4YY3I 3B82A 3ZZUA 5IWAI 3F6HA 4YHHI 3HJCA 3PYFA 1O0WA 4JYAE 4OX9E 5AASA 1J5EE 2BM0A 4DR2I 4HY1A 4EMDA 2OI2A 3KWRA 4WPYA 4R03A 4XTJA 4IZJB 2VQEI 4WUDA 1XMOE 2ZBKB 2IOQA 2PNMA 2LBSB 1GZ6A 3WU6A 4JI2E 2DEJA 3HXLA 2UXBI 4FWDA 1Z0EA 1MG7A 3ZZ0A 3H09A 5BR8I 2EWLA 2JOXA 2LUPB 1H73A 3HPZA 3VYYA 4DV6I 2L3JA 4GKJE 4Z7CA 2X7IA 2LJPA 1KKHA 2Z5EA 2VQFI 2J7KA 4JV5I 1PKPA 2UUCE 5DNYA 4FN5A 3LPSA 3AUZA 1FNMA 3C4TA 2YT4A 1YYOA 5A2QQ 3DF6A 2JR1A 2HFSA 1H74A 2Z5CB 4UT4A 4FWHA 5GMDA 3MSWA 3D4JA 3DJWA 2ZM6I 3ADGA 1HNWE 3JAMQ 4DV7E 1X49A 3LNUA 4B3ME 4USMA 4USKA 4JI4E 2ODRD 3QT6A 4KZSA 4DUYE 2UXDE 4WUCA 2HK3A 4DPTA 4BC7A 1N32E 1MU5A 2E5LE 2Q2EB 4DV4E 4F54A 3K1JA 4K0KE 4WYQB 1NHJA 1WUUA 2VF3A 1WHNA 5F3WA 2ZITA 2L33A 3HPSA 2RS6A 1J5EI 4LFBI 1XMQE 1Z0WA 1Y6ZA 1N36E 5A2QC 2E1RA 4DR6I 4DV1E 4LF4E 2HKEA 4M30A 3FIGA 1FKAE 2MC5A 1HNZI 2V2ZA 4JI1I 4DPWA 3IWBA 3JAMC 4JI7I 1Z0GA 1YYKA 2NUFA 1EKZA 2KOUA 2KHXA 4DKKA 4TUGA 4LFCI 4WFTA 4WUBA 1IBKE 4JI5E 4X62E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM2 A;  1Z0B A;  2HHH I;  2MDR A;  2NUE A;  4LF8 E;  4JI6 I;  3OTO I;  4DV2 I;  3CWV A;  1XNQ I;  3ZKD A;  4PU9 A;  1T4O A;  2UUB I;  1RC7 A;  4DR5 I;  4DPY A;  4DR1 I;  1N34 I;  3ADI A;  4PRV A;  4JI8 E;  1ZM3 A;  1S4E A;  1X47 A;  2JY9 A;  3QT5 A;  1U2R A;  2GS8 A;  2L2K B;  2EFG A;  4JI3 I;  2UXC E;  1UHZ A;  4NXN E;  1FWK A;  3M6A A;  2L2N A;  4X66 I;  5LMN I;  4B3T E;  4LF6 I;  4NXM I;  5LMU E;  4DV4 I;  4LF9 I;  3ZKB A;  1PIE A;  4DV3 I;  4M1K A;  3PYE A;  1Z5A A;  3HUL A;  1Z0V A;  2LRS A;  1RQ0 A;  4X65 I;  3T1H E;  1I94 I;  1EA6 A;  1Z0C A;  2JVA A;  1H7S A;  2DMY A;  4LF4 I;  2F4V E;  1ZBT A;  4DU8 A;  1H72 C;  1IBL I;  2UUA I;  2NA2 A;  3J7A M;  2UU9 I;  2V8P A;  1OJ4 A;  1BKN A;  4DR4 I;  3T1Y E;  2HFU A;  1XNR E;  4JI0 E;  4DUZ E;  4DR7 E;  1FJG I;  1HNX E;  4B3S I;  3C4B A;  1FI4 A;  3B78 A;  1IBM E;  4LF7 I;  4GKK I;  3J81 Q;  4DV0 I;  4AQY E;  3PYD A;  2DIX A;  4MYT A;  1HR0 I;  4KHP E;  3WU5 A;  4DR3 E;  4Z7Y A;  4LFA I;  3WU3 A;  3GON A;  4B3R I;  2RTX A;  3ADL A;  2AJ4 A;  1MX0 A;  4X64 E;  1STU A;  1T4N A;  4JG4 A;  1ZXN A;  4DPX A;  3H4L A;  4JYA I;  1D6T A;  4OX9 I;  2X36 A;  4DV5 E;  5FLX Q;  3J81 C;  1K47 A;  4ED4 A;  4DU7 A;  3V5R A;  4YY3 E;  4X8W A;  5IWA E;  1XMO I;  4YHH E;  4JI2 I;  2WW4 A;  4LF5 E;  4DR2 E;  3LTO A;  3J80 Q;  4R1F A;  4P7A A;  2RS7 A;  2LTS A;  1T4L B;  2VQE E;  2A2D A;  3B8H A;  4GKJ I;  1XHK A;  1GQE A;  2UXB E;  1DAR A;  1ZM4 A;  3ADJ A;  2UUC I;  5BR8 E;  2CPN A;  1Z0T A;  4DV6 E;  4PRX A;  4KHP I;  2L2M A;  2VQF E;  4JV5 E;  1VIS A;  1HNW I;  2DEI A;  4DV7 I;  1N33 E;  4B3M I;  4URL A;  4JI4 I;  4DUY I;  4X64 I;  2UXD I;  3J80 C;  4HAC B;  2V2Q A;  1N32 I;  2E5L I;  2ZM6 E;  4K0K I;  3LLH A;  4RPF A;  1J26 A;  2R42 A;  2DB2 A;  4M2Z A;  1NZ0 A;  4DXL A;  1XMQ I;  1PVG A;  1KIJ A;  1N36 I;  3ZZT A;  4DV1 I;  3VYX A;  4HYM A;  2BM1 A;  3Q1Q A;  2N3G A;  4FWG A;  2LUQ A;  1Z59 A;  3F0N A;  4LF5 I;  2EZ6 A;  4LFB E;  3QT8 A;  4DR6 E;  3ZM7 A;  2B7V A;  5CFF E;  1S16 A;  1IBK I;  5IT9 Q;  4JI5 I;  4X62 I;  3K17 A;  1HNZ E;  4JI1 E;  1DI2 A;  4JI7 E;  4LF8 I;  4HXZ A;  2HK2 A;  4MYU A;  1WHQ A;  4LFC E;  3J7Y p;  3P1X A;  4DPU A;  2HHH E;  3HTX A;  4JI8 I;  1X48 A;  3OTO E;  4DV2 E;  4JI6 E;  1N33 I;  1Z5B A;  1XNQ E;  1UIL A;  1B62 A;  2CZ9 A;  2L3C A;  2UUB E;  1A6F A;  1ZXM A;  4DR5 E;  2UXC I;  4NXN I;  4B3T I;  4FW9 A;  4DR1 E;  1N34 E;  2N3H A;  5LMU I;  2LTR A;  5IT9 C;  2NUG A;  1KVK A;  1NHH A;  5GME A;  1QU6 A;  1B63 A;  1KTV A;  2V34 A;  4JI3 E;  3T1H I;  5LMN E;  1ZM9 A;  4UTG A;  4X66 E;  4KQV A;  4LF6 E;  4NXM E;  2F4V I;  2NPF A;  2B7T A;  4LF9 E;  3QT7 A;  1NHI A;  1EI1 A;  1YYW A;  4DV3 E;  4P52 A;  3T1Y I;  1XNR I;  1ELO A;  4JI0 I;  4X65 E;  1I94 E;  4DUZ I;  4DR7 I;  1QZR A;  1H7U A;  1HNX I;  3V2U C;  4OOG C;  2V2V A;  3J7A G;  1IBL E;  2UUA E;  1IBM I;  1RR9 A;  2UU9 E;  4AQY I;  2B3T B;  2IHR 1;  2R3V A;  2LJH A;  4DR4 E;  2A2C A;  5L3J A;  1FJG E;  1RRE A;  5FLX C;  4B3S E;  3PYG A;  4DR3 I;  4LF7 E;  5LL6 R;  4GKK E;  4I3H A;  4DV0 E;  2HKJ A;  1N0V C;  1UEK A;  1N0U A;  1HR0 E;  4ZVI A;  4HAC A;  2XEX A;  2RSM A;  4LFA E;  1Z5C A;  1YZ9 A;  4B3R E;  4DV5 I;  2BV3 A;  1FWL A;  3WU4 A;  4YY3 I;  3B82 A;  3ZZU A;  5IWA I;  4YHH I;  3PYF A;  1O0W A;  4JYA E;  4OX9 E;  1J5E E;  2BM0 A;  4DR2 I;  4HY1 A;  4EMD A;  2OI2 A;  4XTJ A;  2VQE I;  4WUD A;  1XMO E;  2ZBK B;  2LBS B;  3WU6 A;  4JI2 E;  2DEJ A;  2UXB I;  4FWD A;  1Z0E A;  1MG7 A;  3ZZ0 A;  5BR8 I;  2LUP B;  1H73 A;  3VYY A;  4DV6 I;  2L3J A;  4GKJ E;  4Z7C A;  2X7I A;  2LJP A;  1KKH A;  2VQF I;  2J7K A;  4JV5 I;  1PKP A;  2UUC E;  4FN5 A;  3LPS A;  1FNM A;  3C4T A;  2YT4 A;  1YYO A;  5A2Q Q;  2HFS A;  1H74 A;  4UT4 A;  4FWH A;  5GMD A;  3D4J A;  2ZM6 I;  3ADG A;  1HNW E;  3JAM Q;  4DV7 E;  1X49 A;  3LNU A;  4B3M E;  4USM A;  4USK A;  4JI4 E;  3QT6 A;  4DUY E;  2UXD E;  4WUC A;  2HK3 A;  4DPT A;  1N32 E;  1MU5 A;  2E5L E;  2Q2E B;  4DV4 E;  3K1J A;  4K0K E;  4WYQ B;  1NHJ A;  1WUU A;  2VF3 A;  1WHN A;  2ZIT A;  2L33 A;  2RS6 A;  1J5E I;  4LFB I;  1XMQ E;  1Z0W A;  1N36 E;  2E1R A;  5A2Q C;  4DR6 I;  4DV1 E;  4LF4 E;  2HKE A;  4M30 A;  1FKA E;  1HNZ I;  2V2Z A;  4JI1 I;  4DPW A;  3JAM C;  4JI7 I;  1Z0G A;  1YYK A;  2NUF A;  1EKZ A;  2KHX A;  4DKK A;  4LFC I;  4WFT A;  4WUB A;  1IBK E;  4JI5 E;  4X62 E; 
#chains in the Genus database with same CATH topology
 2YWQ A;  2YPN A;  1ZM2 A;  2VE7 C;  1Z0B A;  2HHH I;  2MDR A;  2EOS A;  2NUE A;  4LF8 E;  2JEB A;  2NN6 D;  1HK7 A;  3OTO I;  4DV2 I;  3CWV A;  4JI6 I;  3PRY A;  5KL5 A;  1XNQ I;  3ZKD A;  4PU9 A;  1T4O A;  4FW6 A;  2UUB I;  2GO3 A;  2E1M A;  3Q6N A;  1RC7 A;  4DR5 I;  2EPZ A;  4QNK A;  1Y4S A;  4DPY A;  4QNJ A;  4RH8 A;  4BS9 A;  4DR1 I;  1N34 I;  1A1F A;  3ADI A;  4PRV A;  4JI8 E;  1ZM3 A;  4OO1 A;  2NN6 F;  2PO2 B;  1S4E A;  3IWD A;  1X47 A;  2JY9 A;  2V85 A;  2WBU A;  3QT5 A;  2EN8 A;  1U2R A;  3NZK A;  5AE3 A;  4IFD C;  2GS8 A;  2L2K B;  1PDA A;  2EFG A;  4JI3 I;  3QG5 C;  2ENH A;  2UXC E;  1USU A;  1DQ3 A;  1UHZ A;  4F2J C;  4NXN E;  2L2N A;  1FWK A;  3K85 A;  3EPH A;  3M6A A;  4L8N A;  4B3T E;  4X66 I;  5C0X D;  5LMU E;  2I13 A;  4DV4 I;  4LF6 I;  4NXM I;  2CT1 A;  4L5N C;  4O4K A;  2E72 A;  2YTN A;  4GZN C;  2L92 A;  4LF9 I;  1IQS A;  2RPC A;  2PNL A;  3ZKB A;  1PIE A;  2EOM A;  4DV3 I;  4M1K A;  2EN4 A;  3PYE A;  5EKW A;  1Z5A A;  3C6K A;  3HUL A;  1Z0V A;  2LRS A;  4AID A;  2EOR A;  1RQ0 A;  4X65 I;  4O43 A;  3T1H E;  1I94 I;  1EA6 A;  1Z0C A;  4P7D A;  5C0X F;  2EOX A;  2WZO A;  2JVA A;  1ZU1 A;  2DMY A;  2EM7 A;  3K6Q A;  1H7S A;  2F4V E;  4LF4 I;  1ZBT A;  4DU8 A;  2BR2 A;  1H72 C;  1IBL I;  2UUA I;  2WP8 B;  1EH7 A;  2FGG A;  2EM4 A;  5A6J A;  2EMZ A;  2NA2 A;  2EN1 A;  3J7A M;  2UU9 I;  2V8P A;  4M9V C;  3CDI A;  1OJ4 A;  4KWY A;  1BKN A;  1PJQ A;  3B4T A;  4DR4 I;  4LCG A;  3T1Y E;  2HFU A;  1XNR E;  4JI0 E;  1X6F A;  2ELY A;  4DUZ E;  1A1L A;  4DR7 E;  1FJG I;  2EPA A;  1HNX E;  4B3S I;  2ELZ A;  3C4B A;  1FI4 A;  4OO1 D;  2HJJ A;  3HQ1 A;  3B78 A;  1IBM E;  4LF7 I;  4IFD A;  1ZBQ A;  2D9H A;  4GKK I;  2L6M A;  3J81 Q;  4O24 A;  4AQY E;  4DV0 I;  2YTF A;  1TF6 A;  3PYD A;  2EML A;  2DIX A;  4MYT A;  2O1U A;  2Z5C A;  1HR0 I;  3RMP A;  4WSP A;  4KHP E;  4F9B B;  3MHH C;  4OO1 F;  3BF2 A;  3WU5 A;  4DR3 E;  2NAB A;  4Z7Y A;  4LFA I;  2YRH A;  3WU3 A;  2WBT A;  3GON A;  2C39 B;  3Q6M A;  4B3R I;  2RTX A;  1WJP A;  2EPP A;  3ADL A;  3OML A;  2EMF A;  3L00 A;  2EOI A;  2JWO A;  4BMJ A;  1MX0 A;  2AJ4 A;  2F8B A;  2LCE A;  4X64 E;  3H1C A;  2C37 A;  1VI7 A;  2LE2 A;  1STU A;  5DRR A;  2V89 A;  5JEA B;  5A6A A;  4P78 A;  1T4N A;  4JG4 A;  1ZXN A;  2EMW A;  2JXP A;  4DPX A;  3H4L A;  2YTG A;  2LT7 A;  1Y5Y A;  5ELW A;  4OX9 I;  4JYA I;  1D6T A;  2V88 A;  2X36 A;  5DNL A;  4DV5 E;  2V83 A;  4U3B A;  2DSY A;  2V87 A;  4R2S A;  2EN3 A;  3J81 C;  2K7I A;  1P47 A;  1OYS A;  4ISA A;  1K47 A;  4N3O A;  1EH8 A;  2EOZ A;  4ED4 A;  4F9A B;  4DU7 A;  3V5R A;  4YY3 E;  4X8W A;  5IWA E;  2PNZ A;  2MKN A;  1XMO I;  4YHH E;  1UBD C;  4JI2 I;  2NN6 B;  3C6M A;  4BCA A;  4I8O A;  4LCH A;  2O1V A;  2WW4 A;  4LF5 E;  1A1G A;  2EOO A;  4DR2 E;  2J7J A;  3LTO A;  1BBO A;  1AH5 A;  3J80 Q;  4R1F A;  2EOQ A;  2RS7 A;  3BGH A;  2EPC A;  4P7A A;  2EMI A;  2LTS A;  1T4L B;  2M7Q A;  2VQE E;  2A2D A;  1L4S A;  5K36 C;  3B8H A;  1KYQ A;  4GKJ I;  1XHK A;  1GTK A;  1X3C A;  5T6J A;  3UK3 C;  1GQE A;  2EOH A;  2M4I A;  2MKD A;  2UXB E;  1DAR A;  3ADJ A;  1ZM4 A;  4LPF A;  2UUC I;  2Z5B B;  5LLQ A;  5BR8 E;  1PJT A;  2EQ0 A;  2R1F A;  1WXR A;  1A1J A;  3EPK A;  4RHB B;  1KJK A;  1E3H A;  4FW4 A;  2EPR A;  2C38 A;  5C0X B;  2CPN A;  2FTX B;  1Z0T A;  4DV6 E;  2DGC A;  4PRX A;  5K36 E;  4KHP I;  1N3G A;  2L2M A;  2WNR A;  2VQF E;  4JV5 E;  1ZR9 A;  2KON A;  3M85 G;  2G7H A;  1YSA C;  1VIS A;  3M85 D;  1HNW I;  3BBG A;  2DEI A;  2EM9 A;  3U1Y A;  4DV7 I;  2PO2 A;  2H36 X;  3JTZ A;  1N33 E;  4B3M I;  5DRQ A;  4AM3 A;  4URL A;  4JI4 I;  3P06 A;  1YPN A;  4DUY I;  2JEB B;  1T39 A;  4X64 I;  2UXD I;  3J80 C;  4WXC A;  4HAC B;  3PS3 A;  3GCM A;  1ZAA C;  1RMD A;  4R2C A;  1Z1B A;  1QNT A;  2J65 A;  2V2Q A;  2E5L I;  1N32 I;  4TUI A;  1A1H A;  2JEA B;  2ZM6 E;  4BC9 A;  2EL5 A;  4K0K I;  5KL6 A;  2EMG A;  5K36 A;  3LLH A;  3MHS C;  2EL6 A;  3EQ1 A;  4HTG A;  3THO B;  2JOB A;  4MLV A;  4IZK B;  1J26 A;  2R42 A;  3DD6 A;  1EH6 A;  4RPF A;  4OO1 B;  2DB2 A;  4M2Z A;  4IZJ A;  1NZ0 A;  2EPN A;  4DXL A;  3M99 B;  1XMQ I;  1PVG A;  4IFD E;  1KIJ A;  2I9I A;  4U3D A;  3ZZT A;  1MGT A;  1N36 I;  2EMY A;  5DNX A;  4DV1 I;  3JU0 A;  4ZYG A;  2EOJ A;  3VYX A;  3EPL A;  1USV A;  3KRN A;  2YZT A;  2BM1 A;  2YU8 A;  4HYM A;  3Q1Q A;  2WP8 A;  1TN9 A;  3L7Z A;  2N3G A;  3TQM A;  4FWG A;  2LUQ A;  2DLQ A;  1YUJ A;  1Z59 A;  5JEA C;  2CGE A;  3F0N A;  4LF5 I;  2L8T A;  2EZ6 A;  4F6M A;  1SR9 A;  4LFB E;  4MU3 A;  3QT8 A;  4MDT A;  4DR6 E;  3ZM7 A;  2CG9 A;  2ENC A;  1YFH A;  1P42 A;  2JT2 A;  2V86 A;  2B7V A;  5CFF E;  1S16 A;  3F6G A;  2EMB A;  2EN6 A;  2GLI A;  1IBK I;  4BA2 A;  5IT9 Q;  4JI5 I;  2GPI A;  4X62 I;  3K17 A;  2V8Q B;  4R2Q A;  1HNZ E;  2MC6 A;  4MQY A;  4JI1 E;  5A6B A;  1DI2 A;  1IMU A;  5FWK A;  2A25 A;  4J8Z A;  1NCS A;  4JI7 E;  4LF8 I;  4HXZ A;  4R2A A;  1TF3 A;  2HK2 A;  4MYU A;  2LO3 A;  3VK6 A;  2O1W A;  1WHQ A;  4LFC E;  3J7Y p;  3P1X A;  1YUI A;  2JE6 A;  4BA1 A;  5K36 D;  2MDG A;  5KL2 A;  4DMI A;  4DPU A;  4O5G A;  2EM5 A;  2YSO A;  5AE2 A;  2DMI A;  2C39 A;  2EN2 A;  1UDQ A;  2HHH E;  4IZJ D;  3HTX A;  4MU4 A;  4JI8 I;  1G2D C;  1X48 A;  3OTO E;  4DV2 E;  4JI6 E;  2IOP A;  1N33 I;  2B9D A;  1Z5B A;  1XNQ E;  5K36 F;  2CTD A;  1UIL A;  5IXM B;  2YSP A;  2K4V A;  3EPJ A;  4ZYH A;  1B62 A;  2CZ9 A;  5JEA A;  2YTE A;  2EM6 A;  2L3C A;  1JK2 A;  2UUB E;  4IJD A;  1A6F A;  2EMH A;  2EPU A;  2AE8 A;  4OZE A;  1ZXM A;  2GHF A;  4DR5 E;  4NXN I;  3BID A;  2UXC I;  4B3T I;  2PO1 B;  2LMZ A;  4FW9 A;  4DR1 E;  1N34 E;  2N3H A;  5LMU I;  4NZV A;  2LTR A;  5IT9 C;  1YHC A;  2EM2 A;  2NUG A;  1KVK A;  4R2E A;  1NHH A;  5GME A;  1QU6 A;  2N8X A;  5AC5 A;  1B63 A;  1KTV A;  2V34 A;  2C37 B;  4IFD D;  5ADZ A;  4JI3 E;  3T1H I;  5A6B D;  5LMN E;  1ZM9 A;  4UTG A;  4X66 E;  5A69 A;  1UDN A;  4KQV A;  4LF6 E;  4NXM E;  2F4V I;  2EJ4 A;  2B7T A;  1R6L A;  2NPF A;  4LF9 E;  2VES A;  4LTY A;  1NHI A;  4Q35 B;  2EM8 A;  1EI1 A;  1X6H A;  3QT7 A;  5KL3 A;  4Q28 A;  1YYW A;  4DV3 E;  3P3E A;  3M7N G;  4P52 A;  2LJU A;  2EOE A;  2VF1 A;  2YRK A;  4IFD F;  3ZOQ B;  1A1I A;  2EPL X;  3T1Y I;  1XNR I;  5AC4 A;  1ELO A;  5AE1 A;  4X65 E;  1I94 E;  4MU1 A;  4JI0 I;  1MEY C;  1QZR A;  4DUZ I;  4DR7 I;  1H7U A;  2F1D A;  1HNX I;  3V2U C;  4OOG C;  2PNZ B;  2O1T A;  2WBS A;  3J7A G;  2V2V A;  1IBL E;  2UUA E;  2Z5B A;  4R2D A;  4BHB A;  1IBM I;  2M1S A;  1NEI A;  1RR9 A;  4HEI A;  5A6K A;  2UU9 E;  4R2R A;  2PO0 B;  4AQY I;  2B3T B;  4M0V A;  2IHR 1;  2R3V A;  2LJH A;  4DR4 E;  2A2C A;  2EL4 A;  5L3J A;  1FJG E;  1RRE A;  2HC5 A;  5FLX C;  4F9C B;  2BBG A;  4R2P A;  4B3S E;  3LML A;  3PYG A;  2JYA A;  4DR3 I;  2FV4 B;  3U1K A;  5JEA F;  4MLQ A;  4LF7 E;  2M9A A;  1Y4U A;  5LL6 R;  4X9J A;  4GKK E;  4I3H A;  4DV0 E;  1Y60 A;  4NHR A;  2HKJ A;  1N0V C;  3PS1 A;  2ODR C;  2YTQ A;  2EQ1 A;  1UEK A;  1N0U A;  4FK5 C;  1HR0 E;  4ZYE A;  2GQ0 A;  4FW3 A;  4J3D A;  4ZVI A;  4R8O A;  3P3C A;  4HAC A;  2C38 B;  2EMK A;  2HGH A;  4WX9 A;  2XEX A;  4BBY A;  3IWC A;  4GEQ B;  5DRP A;  2JEA A;  5IV8 B;  2RSM A;  4LFA E;  1Z5C A;  1YZ9 A;  2WNR B;  4B3R E;  4LU9 A;  1UN6 B;  2BA0 G;  2BA0 D;  3P76 A;  4IZK A;  4DV5 I;  2EM0 A;  5KL7 A;  1F2I G;  3PS2 A;  2BV3 A;  3AV0 A;  1FWL A;  3GLL A;  3WU4 A;  5EL9 A;  2EP3 A;  4YY3 I;  3B82 A;  3ZZU A;  4WXD A;  3F6H A;  5IWA I;  4YHH I;  5TSE A;  3HJC A;  3PYF A;  2YTO A;  3CDJ A;  2EMC A;  1O0W A;  2PRT A;  2ENA A;  2BB8 A;  2DLK A;  4JYA E;  4OX9 E;  5AAS A;  1J5E E;  5K36 B;  2BM0 A;  4DR2 I;  4HY1 A;  1XXE A;  1B69 A;  1G2F C;  2EPM X;  2OI2 A;  4EMD A;  1T38 A;  3KWR A;  1YH8 A;  4NBQ A;  2YTP A;  4WPY A;  2LVH A;  4R03 A;  4XTJ A;  4IZJ B;  2VQE I;  4WUD A;  2YU5 A;  1XMO E;  2IOQ A;  2ZBK B;  2PNM A;  2BA1 G;  2LBS B;  1GZ6 A;  2BA1 D;  4JI2 E;  3WU6 A;  2EM3 A;  2DEJ A;  3HXL A;  4MU0 A;  2UXB I;  4FWD A;  2Q8U A;  1Z0E A;  2BR2 B;  1MG7 A;  3ZZ0 A;  5JEA E;  3H09 A;  3L7Z B;  5BR8 I;  2LV2 A;  2IER A;  2EWL A;  2NN6 C;  2JOX A;  2LUP B;  1X6E A;  1H73 A;  3HPZ A;  3VYY A;  1E3P A;  2IES A;  5FLX Q;  4DV6 I;  2L3J A;  4GKJ E;  4Z7C A;  2X7I A;  2LJP A;  3KZZ A;  1KKH A;  2Z5E A;  2VQF I;  2J7K A;  4JV5 I;  1PKP A;  2UUC E;  4BHC A;  5LMN I;  5DNY A;  4FN5 A;  4BA2 B;  3UHM A;  4FW7 A;  2GO4 A;  3AUZ A;  3LPS A;  1FNM A;  4AIM A;  4IFD B;  2EQ3 A;  3C4T A;  2JPA A;  2YT4 A;  2DRP A;  5DRO A;  1YYO A;  5A2Q Q;  1SFE A;  2NN6 E;  3DF6 A;  2JR1 A;  1LLM C;  2HFS A;  4LOM A;  1H74 A;  2Z5C B;  2EPK X;  4UT4 A;  4FWH A;  5GMD A;  3MSW A;  3P3G A;  2JE6 B;  4BA1 B;  5C0X C;  2YTD A;  3D4J A;  2PO1 A;  3VHT B;  3DJW A;  1X5W A;  3ADG A;  1HNW E;  2ZM6 I;  3GME A;  4F6N A;  4IS9 A;  4DV7 E;  1OYR A;  1X49 A;  3JAM Q;  3LNU A;  3HKM A;  4B3M E;  4USM A;  3KZY A;  2WCC 3;  4USK A;  4JI4 E;  4N4R B;  2ODR D;  2RQL A;  2EOF A;  4KZS A;  4DUY E;  1UDS A;  3QT6 A;  1PJS A;  2UXD E;  4WUC A;  2HK3 A;  4DPT A;  2CVE A;  2NN6 A;  4BC7 A;  1N32 E;  1MU5 A;  2E5L E;  2Q2E B;  4DV4 E;  1DGC A;  4GQU A;  5C0X E;  4F54 A;  4ZYD A;  4K0K E;  3K1J A;  4WYQ B;  1NHJ A;  1BBG A;  1WUU A;  2VF3 A;  2EMX A;  1WHN A;  2ADR A;  5F3W A;  2ZIT A;  1JK1 A;  4LCF A;  2L33 A;  3HPS A;  2RS6 A;  1J5E I;  1A1K A;  2EPX A;  4LFB I;  1XMQ E;  2EN7 A;  2R76 A;  1RHY A;  1Y6Z A;  1Z0W A;  1N36 E;  5A2Q C;  2E1R A;  3M7N D;  4WSG A;  4DR6 I;  3THN A;  4DV1 E;  2O3Z A;  4LF4 E;  2HKE A;  4OO1 C;  1WRJ A;  2VRD A;  4M30 A;  3FIG A;  2JP9 A;  2EMA A;  1FKA E;  1UDO A;  1R6M A;  1AAY A;  2MC5 A;  4FW5 A;  1IQO A;  1BB8 A;  3ECR A;  2EOY A;  2YTI A;  1HNZ I;  2V2Z A;  5JEA D;  4JI1 I;  2PO0 A;  1OYP A;  2CSH A;  4DPW A;  3IWB A;  5C0X A;  3JAM C;  4JI7 I;  1Z0G A;  1YYK A;  2NUF A;  1EKZ A;  2KOU A;  5KL4 A;  4OKG A;  2KHX A;  4DKK A;  4TUG A;  4IS1 C;  4LFC I;  4WFT A;  4WUB A;  4OO1 E;  2YRM A;  1IBK E;  2RSI A;  2EPO A;  2YTJ A;  4JI5 E;  4X62 E;  2EE8 A; 
#chains in the Genus database with same CATH homology
 1ZM2 A;  2VE7 C;  1Z0B A;  2HHH I;  2MDR A;  2NUE A;  4LF8 E;  4JI6 I;  1HK7 A;  3OTO I;  4DV2 I;  3CWV A;  3PRY A;  1XNQ I;  3ZKD A;  4PU9 A;  1T4O A;  2UUB I;  2E1M A;  3Q6N A;  1RC7 A;  4DR5 I;  1Y4S A;  4DPY A;  4BS9 A;  4DR1 I;  1N34 I;  3ADI A;  4PRV A;  4JI8 E;  1ZM3 A;  1S4E A;  3IWD A;  1X47 A;  2JY9 A;  2V85 A;  3QT5 A;  1U2R A;  5AE3 A;  2GS8 A;  2L2K B;  2EFG A;  4JI3 I;  2UXC E;  1USU A;  1DQ3 A;  1UHZ A;  4NXN E;  1FWK A;  2L2N A;  3K85 A;  3M6A A;  4X66 I;  5LMN I;  4L8N A;  4B3T E;  4LF6 I;  4NXM I;  5LMU E;  4DV4 I;  4L5N C;  4LF9 I;  2L92 A;  2PNL A;  3ZKB A;  1PIE A;  4DV3 I;  4M1K A;  3PYE A;  1Z5A A;  3HUL A;  1Z0V A;  2LRS A;  1RQ0 A;  4X65 I;  3T1H E;  1I94 I;  1EA6 A;  1Z0C A;  4P7D A;  2WZO A;  2JVA A;  1H7S A;  2DMY A;  3K6Q A;  4LF4 I;  2F4V E;  1ZBT A;  4DU8 A;  1H72 C;  1IBL I;  2UUA I;  2FGG A;  2NA2 A;  3J7A M;  2UU9 I;  2V8P A;  1OJ4 A;  1BKN A;  4DR4 I;  3T1Y E;  2HFU A;  1XNR E;  4JI0 E;  4DUZ E;  4DR7 E;  1FJG I;  1HNX E;  4B3S I;  3C4B A;  1FI4 A;  3HQ1 A;  3B78 A;  1IBM E;  4LF7 I;  1ZBQ A;  4GKK I;  2L6M A;  3J81 Q;  4DV0 I;  4AQY E;  3PYD A;  2DIX A;  4MYT A;  2O1U A;  2Z5C A;  1HR0 I;  3RMP A;  4WSP A;  4KHP E;  4F9B B;  3WU5 A;  4DR3 E;  4Z7Y A;  4LFA I;  3WU3 A;  3GON A;  3Q6M A;  4B3R I;  2RTX A;  3ADL A;  3OML A;  2AJ4 A;  2JWO A;  4BMJ A;  1MX0 A;  2F8B A;  4X64 E;  2LE2 A;  1STU A;  2V89 A;  4P78 A;  1T4N A;  4JG4 A;  1ZXN A;  4DPX A;  3H4L A;  4JYA I;  1D6T A;  4OX9 I;  2V88 A;  2X36 A;  4DV5 E;  2V83 A;  2DSY A;  2V87 A;  5FLX Q;  3J81 C;  4N3O A;  1K47 A;  4ED4 A;  4F9A B;  4DU7 A;  3V5R A;  4YY3 E;  4X8W A;  5IWA E;  1XMO I;  4YHH E;  4JI2 I;  4BCA A;  4I8O A;  2O1V A;  2WW4 A;  4LF5 E;  4DR2 E;  3LTO A;  3J80 Q;  4R1F A;  4P7A A;  2RS7 A;  2LTS A;  1T4L B;  2M7Q A;  2VQE E;  2A2D A;  3B8H A;  4GKJ I;  1XHK A;  5T6J A;  1GQE A;  2M4I A;  2UXB E;  1DAR A;  1ZM4 A;  3ADJ A;  2UUC I;  2Z5B B;  5BR8 E;  1WXR A;  2CPN A;  2FTX B;  1Z0T A;  4DV6 E;  4PRX A;  4KHP I;  2L2M A;  2VQF E;  4JV5 E;  2KON A;  2G7H A;  1VIS A;  1HNW I;  2DEI A;  4DV7 I;  2H36 X;  3JTZ A;  1N33 E;  4B3M I;  4URL A;  4JI4 I;  3P06 A;  4DUY I;  4X64 I;  2UXD I;  3J80 C;  4HAC B;  2V2Q A;  1N32 I;  2E5L I;  4TUI A;  2ZM6 E;  4BC9 A;  4K0K I;  3LLH A;  2JOB A;  4IZK B;  4RPF A;  1J26 A;  2R42 A;  2DB2 A;  4M2Z A;  4IZJ A;  1NZ0 A;  4DXL A;  1XMQ I;  1PVG A;  1KIJ A;  1N36 I;  3ZZT A;  4DV1 I;  3JU0 A;  3VYX A;  1USV A;  2YZT A;  2BM1 A;  4HYM A;  3Q1Q A;  2N3G A;  4FWG A;  2LUQ A;  1Z59 A;  2CGE A;  3F0N A;  4LF5 I;  2L8T A;  2EZ6 A;  1SR9 A;  4LFB E;  3QT8 A;  4DR6 E;  3ZM7 A;  2CG9 A;  2V86 A;  2B7V A;  5CFF E;  1S16 A;  3F6G A;  1IBK I;  5IT9 Q;  4JI5 I;  4X62 I;  3K17 A;  2V8Q B;  1HNZ E;  2MC6 A;  4JI1 E;  1DI2 A;  5FWK A;  4J8Z A;  4JI7 E;  4LF8 I;  4HXZ A;  2HK2 A;  4MYU A;  3VK6 A;  2O1W A;  1WHQ A;  4LFC E;  3J7Y p;  3P1X A;  4DPU A;  4DMI A;  5AE2 A;  2HHH E;  4IZJ D;  3HTX A;  4JI8 I;  1X48 A;  3OTO E;  4DV2 E;  4JI6 E;  2IOP A;  1N33 I;  2B9D A;  1Z5B A;  1XNQ E;  1UIL A;  1B62 A;  2K4V A;  2CZ9 A;  2L3C A;  2UUB E;  1A6F A;  1ZXM A;  4DR5 E;  2UXC I;  4NXN I;  4B3T I;  2LMZ A;  4FW9 A;  4DR1 E;  1N34 E;  2N3H A;  5LMU I;  2LTR A;  5IT9 C;  2NUG A;  1KVK A;  1NHH A;  5GME A;  1QU6 A;  1B63 A;  1KTV A;  2V34 A;  5ADZ A;  4JI3 E;  3T1H I;  5LMN E;  1ZM9 A;  4UTG A;  4X66 E;  4KQV A;  4LF6 E;  4NXM E;  2F4V I;  2NPF A;  2B7T A;  4LF9 E;  3QT7 A;  4LTY A;  1NHI A;  1EI1 A;  4Q28 A;  1YYW A;  4DV3 E;  4P52 A;  2VF1 A;  3ZOQ B;  3T1Y I;  1XNR I;  1ELO A;  5AE1 A;  4X65 E;  1I94 E;  4JI0 I;  4DUZ I;  1QZR A;  4DR7 I;  1H7U A;  1HNX I;  3V2U C;  4OOG C;  2O1T A;  3J7A G;  2V2V A;  1IBL E;  2UUA E;  2Z5B A;  1IBM I;  2M1S A;  1RR9 A;  2UU9 E;  4AQY I;  2B3T B;  4M0V A;  2IHR 1;  2R3V A;  2LJH A;  4DR4 E;  2A2C A;  5L3J A;  1FJG E;  1RRE A;  5FLX C;  4F9C B;  4B3S E;  3LML A;  3PYG A;  4DR3 I;  2FV4 B;  4LF7 E;  1Y4U A;  5LL6 R;  4GKK E;  4I3H A;  4DV0 E;  2HKJ A;  1N0V C;  2ODR C;  1UEK A;  1N0U A;  1HR0 E;  2GQ0 A;  4ZVI A;  4R8O A;  4HAC A;  2XEX A;  4BBY A;  3IWC A;  4GEQ B;  2RSM A;  4LFA E;  1Z5C A;  1YZ9 A;  4B3R E;  4LU9 A;  4IZK A;  4DV5 I;  2BV3 A;  3AV0 A;  1FWL A;  3WU4 A;  4YY3 I;  3B82 A;  3ZZU A;  5IWA I;  3F6H A;  4YHH I;  3HJC A;  3PYF A;  1O0W A;  4JYA E;  4OX9 E;  5AAS A;  1J5E E;  2BM0 A;  4DR2 I;  4HY1 A;  4EMD A;  2OI2 A;  3KWR A;  4WPY A;  4R03 A;  4XTJ A;  4IZJ B;  2VQE I;  4WUD A;  1XMO E;  2ZBK B;  2IOQ A;  2PNM A;  2LBS B;  1GZ6 A;  3WU6 A;  4JI2 E;  2DEJ A;  3HXL A;  2UXB I;  4FWD A;  1Z0E A;  1MG7 A;  3ZZ0 A;  3H09 A;  5BR8 I;  2EWL A;  2JOX A;  2LUP B;  1H73 A;  3HPZ A;  3VYY A;  4DV6 I;  2L3J A;  4GKJ E;  4Z7C A;  2X7I A;  2LJP A;  1KKH A;  2Z5E A;  2VQF I;  2J7K A;  4JV5 I;  1PKP A;  2UUC E;  5DNY A;  4FN5 A;  3LPS A;  3AUZ A;  1FNM A;  3C4T A;  2YT4 A;  1YYO A;  5A2Q Q;  3DF6 A;  2JR1 A;  2HFS A;  1H74 A;  2Z5C B;  4UT4 A;  4FWH A;  5GMD A;  3MSW A;  3D4J A;  3DJW A;  2ZM6 I;  3ADG A;  1HNW E;  3JAM Q;  4DV7 E;  1X49 A;  3LNU A;  4B3M E;  4USM A;  4USK A;  4JI4 E;  2ODR D;  3QT6 A;  4KZS A;  4DUY E;  2UXD E;  4WUC A;  2HK3 A;  4DPT A;  4BC7 A;  1N32 E;  1MU5 A;  2E5L E;  2Q2E B;  4DV4 E;  4F54 A;  3K1J A;  4K0K E;  4WYQ B;  1NHJ A;  1WUU A;  2VF3 A;  1WHN A;  5F3W A;  2ZIT A;  2L33 A;  3HPS A;  2RS6 A;  1J5E I;  4LFB I;  1XMQ E;  1Z0W A;  1Y6Z A;  1N36 E;  5A2Q C;  2E1R A;  4DR6 I;  4DV1 E;  4LF4 E;  2HKE A;  4M30 A;  3FIG A;  1FKA E;  2MC5 A;  1HNZ I;  2V2Z A;  4JI1 I;  4DPW A;  3IWB A;  3JAM C;  4JI7 I;  1Z0G A;  1YYK A;  2NUF A;  1EKZ A;  2KOU A;  2KHX A;  4DKK A;  4TUG A;  4LFC I;  4WFT A;  4WUB A;  1IBK E;  4JI5 E;  4X62 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...