3J80Q

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 31
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j80Q00
4YHHI 2HKEA 1KKHA 3LPSA 3D4JA 1B62A 1RR9A 4DV6I 3T1YE 4USMA 5LMUI 1N33E 4LF7E 3WU3A 1RREA 4YHHE 4DV7I 1Z5CA 2BM0A 4JI4I 5A2QC 5LMNE 1J5EE 2UXBI 3GONA 4R1FA 1ZM4A 1PIEA 1HNZI 4K0KI 1XMQE 3F0NA 5A2QQ 3Q1QA 3ZKBA 1IBKI 4GKKI 4URLA 2A2DA 3OTOE 4LFBE 4LF4E 1Z5BA 3ZM7A 4JI3E 1N0UA 3J81Q 4YY3E 2V34A 1KTVA 2X36A 3B82A 2UUCE 3WU4A 1S4EA 4DUYI 2HKJA 2GS8A 1HNWE 1Z0EA 4DR7E 1ELOA 4YY3I 3T1HI 4B3TI 4AQYE 4JI8I 4LF8I 3ZZ0A 4LF6I 3K17A 3J7AG 2ZITA 1H7UA 4DV2I 3WU6A 4X65E 1U2RA 4JI5I 2ZBKB 4XTJA 4LF7I 3JAMC 4GKKE 4JI4E 4PRVA 4DPXA 2UUBI 4FWGA 3B78A 3T1YI 1K47A 3M6AA 3V5RA 4K0KE 1FKAE 1J5EI 2HK2A 4B3MI 3H4LA 4JI7I 4JI2I 2LJPA 3LNUA 4UT4A 1IBKE 4M1KA 1N36E 1N34I 5GMEA 4B3RE 4FW9A 2VQEE 3QT8A 4HACA 4X62I 5LMUE 3K1JA 2HFSA 1FI4A 4DV5I 2EFGA 1H74A 4LFCE 4B3SE 5L3JA 4DV1E 4DV7E 2V2ZA 4HYMA 4DR6E 2NPFA 3QT7A 1N32I 4NXNE 1H73A 1BKNA 1XMOI 4JV5I 4DV0E 5GMDA 1XNRE 1MG7A 1H7SA 4LF6E 1H72C 3J81C 5BR8I 4PRXA 2F4VE 4GKJE 3QT6A 2HHHE 2E1RA 1FWLA 4DR2E 2WW4A 1XNQI 1OJ4A 2UUCI 4LFAI 3QT5A 1NHHA 1KVKA 4DPTA 1PKPA 3ZZTA 4DR6I 2VF3A 4DR1I 4DR3I 4LFAE 4DR5I 5IT9C 1N36I 4KQVA 4Z7YA 2F4VI 4LFCI 2Q2EB 4DUZE 4DR3E 4LF5I 1ZM2A 2J7KA 4DR4E 4JI3I 4NXMI 2E5LE 4JI1E 4DV0I 1FWKA 4X66E 1FJGI 1ZXNA 2V8PA 1I94E 2R42A 4DR4I 1B63A 1A6FA 1EA6A 2CZ9A 5LL6R 1D6TA 4X62E 5FLXC 2UUBE 5FLXQ 4JG4A 1VISA 4KHPE 3V2UC 2ZM6I 2AJ4A 1Z0TA 2UXDI 2VQEI 2HHHI 1KIJA 1Z0GA 4JYAI 1N34E 3CWVA 4UTGA 1IBLI 4DV3E 1Z59A 4FN5A 4JI5E 3PYFA 1XNRI 4ZVIA 2OI2A 4JI2E 1Z0WA 3J7AM 4JI6E 2UUAE 1I94I 2UU9I 4EMDA 5LMNI 4LF5E 4B3SI 2UXDE 4LF9E 4DV4E 3LTOA 5IWAI 4Z7CA 1XHKA 2R3VA 2UXCI 4X65I 1DARA 3B8HA 1XNQE 4OX9E 4B3ME 4USKA 4WUDA 4JI6I 5BR8E 2A2CA 4GKJI 4DPUA 2DEIA 4PU9A 4DPYA 1PVGA 4FWDA 3T1HE 2UXBE 4DR2I 3PYGA 1N32E 4WUCA 1IBMI 3HULA 4JI0I 3J80C 4HY1A 1ZM3A 1FJGE 4P7AA 2VQFE 1ZM9A 1FNMA 2XEXA 4X64I 1HR0I 3ZZUA 4NXME 4MYUA 2V2VA 4HXZA 4DR5E 1Z0BA 3PYEA 1XMOE 1HNXI 4X66I 4ED4A 4LF9I 2HFUA 4KHPI 4DV5E 2UUAI 4DUYE 2X7IA 1MX0A 1N0VC 4DPWA 3WU5A 4DUZI 4JI0E 4JI8E 4I3HA 4OX9I 4DV2E 4MYTA 1ZXMA 2ZM6E 1Z5AA 4B3TE 4DV4I 2BM1A 4JYAE 1NZ0A 4JI7E 4DR1E 4DR7I 1QZRA 1XMQI 4JI1I 1HNZE 1HNXE 4HACB 1N33I 2HK3A 3PYDA 4LFBI 4X64E 2DEJA 1HR0E 4DU7A 3OTOI 4DV1I 5IT9Q 3JAMQ 5IWAE 2V2QA 1HNWI 1EI1A 4NXNI 3J80Q 4DXLA 4FWHA 4RPFA 4LF8E 1S16A 2BV3A 1NHJA 4AQYI 1Z0VA 1UEKA 1MU5A 4WUBA 4DU8A 2VQFI 1IBLE 4DV6E 4B3RI 2UXCE 1WUUA 4LF4I 4JV5E 4P52A 1NHIA 1Z0CA 3ZKDA 4DV3I 2E5LI 2UU9E 1IBME
chains in the Genus database with same CATH superfamily
2WP8B 4YHHI 2HKEA 1E3HA 1KKHA 3LPSA 2Z5BB 3PS3A 3D4JA 1B62A 1RR9A 4DV6I 3T1YE 4USMA 2F1DA 5EKWA 5LMUI 1N33E 4LF7E 4U3DA 3WU3A 1RREA 1XXEA 2JT2A 4YHHE 2NN6A 4DV7I 1Z5CA 4GQUA 2BM0A 3PS1A 4JI4I 5A2QC 5LMNE 5JEAF 1J5EE 2UXBI 3GONA 1OYSA 2PO1A 4R1FA 1ZM4A 2CG9A 5DNLA 1PIEA 1HNZI 4K0KI 1XMQE 3F0NA 5A2QQ 4QNKA 3Q1QA 3ZKBA 1IBKI 4GKKI 4URLA 4QNJA 2A2DA 3OTOE 4LFBE 1Z5BA 1USVA 3ZM7A 4LF4E 4JI3E 1N0UA 3J81Q 4YY3E 3B4TA 5JEAA 2PO1B 2V34A 3P3GA 5DROA 1KTVA 2X36A 3B82A 4OO1F 4OO1C 4LOMA 2UUCE 3WU4A 1S4EA 3L7ZB 4DUYI 2HKJA 5C0XD 2GS8A 2NN6B 4OO1E 1UDNA 4MQYA 1HNWE 1Z0EA 2GO4A 1ELOA 4DR7E 4YY3I 3T1HI 4B3TI 4AQYE 4JI8I 4OZEA 4LF8I 2WNRB 3ZZ0A 4J3DA 5EL9A 4LF6I 3K17A 3Q6NA 3J7AG 2O3ZA 2ZITA 3P06A 3PS2A 1H7UA 4MDTA 4DV2I 4OO1A 3WU6A 4FW4A 2C39A 4IFDD 3NZKA 5DRQA 4X65E 1U2RA 2CGEA 4JI5I 4FW3A 2ZBKB 4OKGA 2BR2A 4XTJA 4LF7I 4BA2B 3JAMC 4GKKE 4JI4E 4PRVA 4DPXA 2UUBI 3DD6A 4FW6A 4FWGA 3B78A 2PNMA 3T1YI 1K47A 3M6AA 3V5RA 4K0KE 1FKAE 1J5EI 2HK2A 4B3MI 3CDJA 3H4LA 4JI7I 5K36F 2C38B 2VESA 4JI2I 2LJPA 1OYPA 3LNUA 2WP8A 5DNXA 2Z5CB 4UT4A 1IBKE 4M1KA 1N36E 2JEBA 1N34I 1VI7A 5GMEA 4B3RE 1HK7A 4FW9A 2PNZB 2VQEE 3QT8A 4HACA 4X62I 5LMUE 4AM3A 1RHYA 2PNZA 4IFDA 1USUA 3K1JA 3Q6MA 2HFSA 1FI4A 3L7ZA 3M7ND 5K36A 4DV5I 4BA2A 1Y60A 2EFGA 3P3CA 1H74A 4LFCE 4B3SE 4MU1A 5L3JA 3M85G 4DV1E 4DV7E 2V2ZA 4HYMA 4IZKA 4DR6E 2NPFA 3QT7A 4FW7A 1N32I 4NXNE 1H73A 1BKNA 1XMOI 4JV5I 4DV0E 5GMDA 1XNRE 1MG7A 1H7SA 4LF6E 1H72C 3J81C 2Z5BA 5BR8I 4IFDF 1Y6ZA 4PRXA 1P42A 3HKMA 2F4VE 4GKJE 3QT6A 2HHHE 2E1RA 1FWLA 4DR2E 4MU4A 2C39B 2JEAB 2WW4A 1XNQI 1OJ4A 2UUCI 3PRYA 4LFAI 3QT5A 1NHHA 3U1KA 1KVKA 2WNRA 4DPTA 3U1YA 1PKPA 3ZZTA 4DR6I 2VF3A 4DR1I 4DR3I 4OO1D 3HJCA 2NN6D 4LFAE 4DR5I 5IT9C 2PO0A 1N36I 3M7NG 4KQVA 4Z7YA 2F4VI 1R6MA 4LFCI 2Q2EB 5K36C 3KRNA 4LCGA 4IFDE 4DUZE 4DR3E 3K85A 4LF5I 1ZM2A 2J7KA 4DR4E 2PO0B 4JI3I 4NXMI 2Z5CA 5JEAC 2BA0D 2E5LE 5C0XA 4JI1E 4LPFA 4DV0I 1FWKA 4X66E 1FJGI 5K36E 1ZXNA 2V8PA 1I94E 2R42A 1UDSA 2J65A 4DR4I 1B63A 4LCHA 5C0XB 1A6FA 1EA6A 1Y5YA 5LL6R 1D6TA 4X62E 5FLXC 5JEAE 2UUBE 5FLXQ 4JG4A 1VISA 2JE6B 2O1TA 4KHPE 3V2UC 2ZM6I 2AJ4A 3P76A 5C0XF 1Z0TA 2UXDI 2VQEI 2HHHI 1KIJA 1Z0GA 4JYAI 2NN6E 1N34E 3CWVA 4UTGA 4OO1B 1IBLI 4DV3E 1Z59A 3GCMA 4FN5A 2O1WA 2O1VA 4JI5E 3PYFA 1XNRI 4ZVIA 4NBQA 2OI2A 3GMEA 4JI2E 1Z0WA 3J7AM 4JI6E 2GQ0A 2UUAE 1I94I 2UU9I 4EMDA 5LMNI 4LF5E 1Y4SA 4B3SI 2UXDE 4LF9E 4DV4E 3LTOA 4IS9A 1UDOA 5IWAI 4Z7CA 1XHKA 2R3VA 2UXCI 4X65I 1DARA 2PO2A 3B8HA 1XNQE 4OX9E 2JEAA 4B3ME 2GO3A 4USKA 4WUDA 1Y4UA 2IOQA 4JI6I 5BR8E 2A2CA 5JEAD 4GKJI 4DPUA 2DEIA 4PU9A 4DPYA 5C0XE 1PVGA 2PO2B 4FW5A 4FWDA 3T1HE 2Z5EA 2UXBE 4DR2I 3PYGA 5K36D 1N32E 4WUCA 1IBMI 3HULA 4JI0I 4HY1A 3J80C 4N3OA 1ZM3A 1FJGE 4P7AA 2VQFE 4AIDA 1ZM9A 1FNMA 2XEXA 5ELWA 4BA1B 1E3PA 2CVEA 4X64I 1HR0I 3ZZUA 5DRPA 4NXME 4MYUA 2V2VA 5FWKA 2IERA 4HXZA 4DR5E 1Z0BA 3PYEA 1XMOE 2BR2B 1HNXI 4X66I 4ED4A 2AE8A 4LCFA 4IFDC 4IZJA 4LF9I 2HFUA 4KHPI 4DV5E 2UUAI 3M85D 4DUYE 2JEBB 2X7IA 4ISAA 5DRRA 1MX0A 1N0VC 4DPWA 3WU5A 4DUZI 2NN6C 4IZKB 4U3BA 4JI0E 4JI8E 4I3HA 1R6LA 4OX9I 4DV2E 4IZJD 4MYTA 1ZXMA 5C0XC 3P3EA 5K36B 2ZM6E 1Z5AA 2UU9E 2PNLA 4B3TE 4DV4I 2BM1A 2C37A 4JYAE 1NZ0A 4JI7E 4DR1E 3UHMA 4DR7I 1QZRA 1XMQI 4JI1I 1HNZE 1YH8A 1HNXE 4IZJB 5JEAB 2BA0G 4HACB 4MU3A 1N33I 2HK3A 2JE6A 3GLLA 2IESA 3PYDA 4LFBI 4X64E 2DEJA 1HR0E 4DU7A 2O1UA 3OTOI 4DV1I 5IT9Q 3JAMQ 5IWAE 4AIMA 2V2QA 2C38A 1HNWI 1EI1A 4NXNI 3J80Q 4DXLA 4FWHA 1UDQA 4RPFA 4LF8E 1S16A 2BV3A 1NHJA 2IOPA 4AQYI 1Z0VA 1UEKA 1MU5A 4WUBA 3CDIA 4DU8A 4MU0A 2C37B 2VQFI 1IBLE 4IFDB 4DV6E 4B3RI 2UXCE 4BA1A 1WUUA 1YHCA 4LF4I 4JV5E 4P52A 2BA1D 1NHIA 1OYRA 1Z0CA 2BA1G 3ZKDA 4DV3I 2NN6F 2E5LI 3H1CA 2CZ9A 1IBME
chains in the Genus database with same CATH topology
4YHHI 2HKEA 1KKHA 3LPSA 2Z5BB 3D4JA 1B62A 1RR9A 4DV6I 3T1YE 4USMA 5LMUI 1N33E 4LF7E 3WU3A 1RREA 4YHHE 4DV7I 1Z5CA 2BM0A 4JI4I 5A2QC 5LMNE 1J5EE 2UXBI 3GONA 4R1FA 1ZM4A 2CG9A 1PIEA 1HNZI 4K0KI 1XMQE 3F0NA 5A2QQ 3Q1QA 3ZKBA 1IBKI 4GKKI 4URLA 2A2DA 3OTOE 4LFBE 1Z5BA 1USVA 3ZM7A 4LF4E 4JI3E 1N0UA 3J81Q 4YY3E 2V34A 1KTVA 2X36A 3B82A 2UUCE 3WU4A 1S4EA 4DUYI 2HKJA 2GS8A 1HNWE 1Z0EA 4DR7E 1ELOA 4YY3I 3T1HI 4B3TI 4AQYE 4JI8I 4LF8I 3ZZ0A 4LF6I 3K17A 3Q6NA 3J7AG 2ZITA 3P06A 1H7UA 4DV2I 3WU6A 4X65E 1U2RA 2CGEA 4JI5I 2ZBKB 4XTJA 4LF7I 3JAMC 4GKKE 4JI4E 4PRVA 4DPXA 2UUBI 4FWGA 3B78A 2PNMA 3T1YI 1K47A 3M6AA 3V5RA 4K0KE 1FKAE 1J5EI 2HK2A 4B3MI 3H4LA 4JI7I 4JI2I 2LJPA 3LNUA 2Z5CB 4UT4A 1IBKE 4M1KA 1N36E 1N34I 5GMEA 4B3RE 1HK7A 4FW9A 2VQEE 3QT8A 4HACA 4X62I 5LMUE 1USUA 3K1JA 3Q6MA 2HFSA 1FI4A 4DV5I 2EFGA 1H74A 4LFCE 4B3SE 5L3JA 4DV1E 4DV7E 2V2ZA 4HYMA 4IZKA 4DR6E 2NPFA 3QT7A 1N32I 4NXNE 1H73A 1BKNA 1XMOI 4JV5I 4DV0E 5GMDA 1XNRE 1MG7A 1H7SA 4LF6E 1H72C 3J81C 2Z5BA 5BR8I 1Y6ZA 4PRXA 2F4VE 4GKJE 3QT6A 2HHHE 2E1RA 1FWLA 4DR2E 2WW4A 1XNQI 1OJ4A 2UUCI 3PRYA 4LFAI 3QT5A 1NHHA 1KVKA 4DPTA 1PKPA 3ZZTA 4DR6I 2VF3A 4DR1I 4DR3I 3HJCA 4LFAE 4DR5I 5IT9C 1N36I 4KQVA 4Z7YA 2F4VI 4LFCI 2Q2EB 4DUZE 4DR3E 3K85A 4LF5I 1ZM2A 2J7KA 4DR4E 4JI3I 4NXMI 2Z5CA 2E5LE 4JI1E 4DV0I 1FWKA 4X66E 1FJGI 1ZXNA 2V8PA 1I94E 2R42A 4DR4I 1B63A 1A6FA 1EA6A 2CZ9A 5LL6R 1D6TA 4X62E 5FLXC 2UUBE 5FLXQ 4JG4A 1VISA 4KHPE 2O1TA 3V2UC 2ZM6I 2AJ4A 1Z0TA 2UXDI 2VQEI 2HHHI 1KIJA 1Z0GA 4JYAI 1N34E 3CWVA 4UTGA 1IBLI 4DV3E 1Z59A 4FN5A 2O1WA 2O1VA 4JI5E 3PYFA 1XNRI 4ZVIA 2OI2A 4JI2E 1Z0WA 3J7AM 4JI6E 2GQ0A 2UUAE 1I94I 2UU9I 4EMDA 5LMNI 4LF5E 1Y4SA 4B3SI 2UXDE 4LF9E 4DV4E 3LTOA 5IWAI 4Z7CA 1XHKA 2R3VA 2UXCI 4X65I 1DARA 3B8HA 1XNQE 4OX9E 4B3ME 4USKA 4WUDA 1Y4UA 2IOQA 4JI6I 5BR8E 2A2CA 4GKJI 4DPUA 2DEIA 4PU9A 4DPYA 1PVGA 4FWDA 3T1HE 2Z5EA 2UXBE 4DR2I 3PYGA 1N32E 4WUCA 1IBMI 3HULA 4JI0I 3J80C 4HY1A 4N3OA 1ZM3A 1FJGE 4P7AA 2VQFE 1ZM9A 1FNMA 2XEXA 4X64I 1HR0I 3ZZUA 4NXME 4MYUA 2V2VA 5FWKA 4HXZA 4DR5E 1Z0BA 3PYEA 1XMOE 1HNXI 4X66I 4ED4A 4IZJA 4LF9I 2HFUA 4KHPI 4DV5E 2UUAI 4DUYE 2X7IA 1MX0A 1N0VC 4DPWA 3WU5A 4DUZI 4IZKB 4JI0E 4JI8E 4I3HA 4OX9I 4DV2E 4IZJD 4MYTA 1ZXMA 2ZM6E 1Z5AA 2PNLA 4B3TE 4DV4I 2BM1A 4JYAE 1NZ0A 4JI7E 4DR1E 4DR7I 1QZRA 1XMQI 4JI1I 1HNZE 1HNXE 4IZJB 4HACB 1N33I 2HK3A 3PYDA 4LFBI 4X64E 2DEJA 1HR0E 4DU7A 2O1UA 3OTOI 4DV1I 5IT9Q 3JAMQ 5IWAE 2V2QA 1HNWI 1EI1A 4NXNI 3J80Q 4DXLA 4FWHA 4RPFA 4LF8E 1S16A 2BV3A 1NHJA 2IOPA 4AQYI 1Z0VA 1UEKA 1MU5A 4WUBA 4DU8A 2VQFI 1IBLE 4DV6E 4B3RI 2UXCE 1WUUA 4LF4I 4JV5E 4P52A 1NHIA 1Z0CA 3ZKDA 4DV3I 2E5LI 2UU9E 1IBME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH I;  2HKE A;  1KKH A;  3LPS A;  3D4J A;  1B62 A;  1RR9 A;  4DV6 I;  3T1Y E;  4USM A;  5LMU I;  1N33 E;  4LF7 E;  3WU3 A;  1RRE A;  4YHH E;  4DV7 I;  1Z5C A;  2BM0 A;  4JI4 I;  5A2Q C;  5LMN E;  1J5E E;  2UXB I;  3GON A;  4R1F A;  1ZM4 A;  1PIE A;  1HNZ I;  4K0K I;  1XMQ E;  3F0N A;  5A2Q Q;  3Q1Q A;  3ZKB A;  1IBK I;  4GKK I;  4URL A;  2A2D A;  3OTO E;  4LFB E;  4LF4 E;  1Z5B A;  3ZM7 A;  4JI3 E;  1N0U A;  3J81 Q;  4YY3 E;  2V34 A;  1KTV A;  2X36 A;  3B82 A;  2UUC E;  3WU4 A;  1S4E A;  4DUY I;  2HKJ A;  2GS8 A;  1HNW E;  1Z0E A;  4DR7 E;  1ELO A;  4YY3 I;  3T1H I;  4B3T I;  4AQY E;  4JI8 I;  4LF8 I;  3ZZ0 A;  4LF6 I;  3K17 A;  3J7A G;  2ZIT A;  1H7U A;  4DV2 I;  3WU6 A;  4X65 E;  1U2R A;  4JI5 I;  2ZBK B;  4XTJ A;  4LF7 I;  3JAM C;  4GKK E;  4JI4 E;  4PRV A;  4DPX A;  2UUB I;  4FWG A;  3B78 A;  3T1Y I;  1K47 A;  3M6A A;  3V5R A;  4K0K E;  1FKA E;  1J5E I;  2HK2 A;  4B3M I;  3H4L A;  4JI7 I;  4JI2 I;  2LJP A;  3LNU A;  4UT4 A;  1IBK E;  4M1K A;  1N36 E;  1N34 I;  5GME A;  4B3R E;  4FW9 A;  2VQE E;  3QT8 A;  4HAC A;  4X62 I;  5LMU E;  3K1J A;  2HFS A;  1FI4 A;  4DV5 I;  2EFG A;  1H74 A;  4LFC E;  4B3S E;  5L3J A;  4DV1 E;  4DV7 E;  2V2Z A;  4HYM A;  4DR6 E;  2NPF A;  3QT7 A;  1N32 I;  4NXN E;  1H73 A;  1BKN A;  1XMO I;  4JV5 I;  4DV0 E;  5GMD A;  1XNR E;  1MG7 A;  1H7S A;  4LF6 E;  1H72 C;  3J81 C;  5BR8 I;  4PRX A;  2F4V E;  4GKJ E;  3QT6 A;  2HHH E;  2E1R A;  1FWL A;  4DR2 E;  2WW4 A;  1XNQ I;  1OJ4 A;  2UUC I;  4LFA I;  3QT5 A;  1NHH A;  1KVK A;  4DPT A;  1PKP A;  3ZZT A;  4DR6 I;  2VF3 A;  4DR1 I;  4DR3 I;  4LFA E;  4DR5 I;  5IT9 C;  1N36 I;  4KQV A;  4Z7Y A;  2F4V I;  4LFC I;  2Q2E B;  4DUZ E;  4DR3 E;  4LF5 I;  1ZM2 A;  2J7K A;  4DR4 E;  4JI3 I;  4NXM I;  2E5L E;  4JI1 E;  4DV0 I;  1FWK A;  4X66 E;  1FJG I;  1ZXN A;  2V8P A;  1I94 E;  2R42 A;  4DR4 I;  1B63 A;  1A6F A;  1EA6 A;  2CZ9 A;  5LL6 R;  1D6T A;  4X62 E;  5FLX C;  2UUB E;  5FLX Q;  4JG4 A;  1VIS A;  4KHP E;  3V2U C;  2ZM6 I;  2AJ4 A;  1Z0T A;  2UXD I;  2VQE I;  2HHH I;  1KIJ A;  1Z0G A;  4JYA I;  1N34 E;  3CWV A;  4UTG A;  1IBL I;  4DV3 E;  1Z59 A;  4FN5 A;  4JI5 E;  3PYF A;  1XNR I;  4ZVI A;  2OI2 A;  4JI2 E;  1Z0W A;  3J7A M;  4JI6 E;  2UUA E;  1I94 I;  2UU9 I;  4EMD A;  5LMN I;  4LF5 E;  4B3S I;  2UXD E;  4LF9 E;  4DV4 E;  3LTO A;  5IWA I;  4Z7C A;  1XHK A;  2R3V A;  2UXC I;  4X65 I;  1DAR A;  3B8H A;  1XNQ E;  4OX9 E;  4B3M E;  4USK A;  4WUD A;  4JI6 I;  5BR8 E;  2A2C A;  4GKJ I;  4DPU A;  2DEI A;  4PU9 A;  4DPY A;  1PVG A;  4FWD A;  3T1H E;  2UXB E;  4DR2 I;  3PYG A;  1N32 E;  4WUC A;  1IBM I;  3HUL A;  4JI0 I;  3J80 C;  4HY1 A;  1ZM3 A;  1FJG E;  4P7A A;  2VQF E;  1ZM9 A;  1FNM A;  2XEX A;  4X64 I;  1HR0 I;  3ZZU A;  4NXM E;  4MYU A;  2V2V A;  4HXZ A;  4DR5 E;  1Z0B A;  3PYE A;  1XMO E;  1HNX I;  4X66 I;  4ED4 A;  4LF9 I;  2HFU A;  4KHP I;  4DV5 E;  2UUA I;  4DUY E;  2X7I A;  1MX0 A;  1N0V C;  4DPW A;  3WU5 A;  4DUZ I;  4JI0 E;  4JI8 E;  4I3H A;  4OX9 I;  4DV2 E;  4MYT A;  1ZXM A;  2ZM6 E;  1Z5A A;  4B3T E;  4DV4 I;  2BM1 A;  4JYA E;  1NZ0 A;  4JI7 E;  4DR1 E;  4DR7 I;  1QZR A;  1XMQ I;  4JI1 I;  1HNZ E;  1HNX E;  4HAC B;  1N33 I;  2HK3 A;  3PYD A;  4LFB I;  4X64 E;  2DEJ A;  1HR0 E;  4DU7 A;  3OTO I;  4DV1 I;  5IT9 Q;  3JAM Q;  5IWA E;  2V2Q A;  1HNW I;  1EI1 A;  4NXN I;  3J80 Q;  4DXL A;  4FWH A;  4RPF A;  4LF8 E;  1S16 A;  2BV3 A;  1NHJ A;  4AQY I;  1Z0V A;  1UEK A;  1MU5 A;  4WUB A;  4DU8 A;  2VQF I;  1IBL E;  4DV6 E;  4B3R I;  2UXC E;  1WUU A;  4LF4 I;  4JV5 E;  4P52 A;  1NHI A;  1Z0C A;  3ZKD A;  4DV3 I;  2E5L I;  2UU9 E;  1IBM E; 
#chains in the Genus database with same CATH topology
 2WP8 B;  4YHH I;  2HKE A;  1E3H A;  1KKH A;  3LPS A;  2Z5B B;  3PS3 A;  3D4J A;  1B62 A;  1RR9 A;  4DV6 I;  3T1Y E;  4USM A;  2F1D A;  5EKW A;  5LMU I;  1N33 E;  4LF7 E;  4U3D A;  3WU3 A;  1RRE A;  1XXE A;  2JT2 A;  4YHH E;  2NN6 A;  4DV7 I;  1Z5C A;  4GQU A;  2BM0 A;  3PS1 A;  4JI4 I;  5A2Q C;  5LMN E;  5JEA F;  1J5E E;  2UXB I;  3GON A;  1OYS A;  2PO1 A;  4R1F A;  1ZM4 A;  2CG9 A;  5DNL A;  1PIE A;  1HNZ I;  4K0K I;  1XMQ E;  3F0N A;  5A2Q Q;  4QNK A;  3Q1Q A;  3ZKB A;  1IBK I;  4GKK I;  4URL A;  4QNJ A;  2A2D A;  3OTO E;  4LFB E;  1Z5B A;  1USV A;  3ZM7 A;  4LF4 E;  4JI3 E;  1N0U A;  3J81 Q;  4YY3 E;  3B4T A;  5JEA A;  2PO1 B;  2V34 A;  3P3G A;  5DRO A;  1KTV A;  2X36 A;  3B82 A;  4OO1 F;  4OO1 C;  4LOM A;  2UUC E;  3WU4 A;  1S4E A;  3L7Z B;  4DUY I;  2HKJ A;  5C0X D;  2GS8 A;  2NN6 B;  4OO1 E;  1UDN A;  4MQY A;  1HNW E;  1Z0E A;  2GO4 A;  1ELO A;  4DR7 E;  4YY3 I;  3T1H I;  4B3T I;  4AQY E;  4JI8 I;  4OZE A;  4LF8 I;  2WNR B;  3ZZ0 A;  4J3D A;  5EL9 A;  4LF6 I;  3K17 A;  3Q6N A;  3J7A G;  2O3Z A;  2ZIT A;  3P06 A;  3PS2 A;  1H7U A;  4MDT A;  4DV2 I;  4OO1 A;  3WU6 A;  4FW4 A;  2C39 A;  4IFD D;  3NZK A;  5DRQ A;  4X65 E;  1U2R A;  2CGE A;  4JI5 I;  4FW3 A;  2ZBK B;  4OKG A;  2BR2 A;  4XTJ A;  4LF7 I;  4BA2 B;  3JAM C;  4GKK E;  4JI4 E;  4PRV A;  4DPX A;  2UUB I;  3DD6 A;  4FW6 A;  4FWG A;  3B78 A;  2PNM A;  3T1Y I;  1K47 A;  3M6A A;  3V5R A;  4K0K E;  1FKA E;  1J5E I;  2HK2 A;  4B3M I;  3CDJ A;  3H4L A;  4JI7 I;  5K36 F;  2C38 B;  2VES A;  4JI2 I;  2LJP A;  1OYP A;  3LNU A;  2WP8 A;  5DNX A;  2Z5C B;  4UT4 A;  1IBK E;  4M1K A;  1N36 E;  2JEB A;  1N34 I;  1VI7 A;  5GME A;  4B3R E;  1HK7 A;  4FW9 A;  2PNZ B;  2VQE E;  3QT8 A;  4HAC A;  4X62 I;  5LMU E;  4AM3 A;  1RHY A;  2PNZ A;  4IFD A;  1USU A;  3K1J A;  3Q6M A;  2HFS A;  1FI4 A;  3L7Z A;  3M7N D;  5K36 A;  4DV5 I;  4BA2 A;  1Y60 A;  2EFG A;  3P3C A;  1H74 A;  4LFC E;  4B3S E;  4MU1 A;  5L3J A;  3M85 G;  4DV1 E;  4DV7 E;  2V2Z A;  4HYM A;  4IZK A;  4DR6 E;  2NPF A;  3QT7 A;  4FW7 A;  1N32 I;  4NXN E;  1H73 A;  1BKN A;  1XMO I;  4JV5 I;  4DV0 E;  5GMD A;  1XNR E;  1MG7 A;  1H7S A;  4LF6 E;  1H72 C;  3J81 C;  2Z5B A;  5BR8 I;  4IFD F;  1Y6Z A;  4PRX A;  1P42 A;  3HKM A;  2F4V E;  4GKJ E;  3QT6 A;  2HHH E;  2E1R A;  1FWL A;  4DR2 E;  4MU4 A;  2C39 B;  2JEA B;  2WW4 A;  1XNQ I;  1OJ4 A;  2UUC I;  3PRY A;  4LFA I;  3QT5 A;  1NHH A;  3U1K A;  1KVK A;  2WNR A;  4DPT A;  3U1Y A;  1PKP A;  3ZZT A;  4DR6 I;  2VF3 A;  4DR1 I;  4DR3 I;  4OO1 D;  3HJC A;  2NN6 D;  4LFA E;  4DR5 I;  5IT9 C;  2PO0 A;  1N36 I;  3M7N G;  4KQV A;  4Z7Y A;  2F4V I;  1R6M A;  4LFC I;  2Q2E B;  5K36 C;  3KRN A;  4LCG A;  4IFD E;  4DUZ E;  4DR3 E;  3K85 A;  4LF5 I;  1ZM2 A;  2J7K A;  4DR4 E;  2PO0 B;  4JI3 I;  4NXM I;  2Z5C A;  5JEA C;  2BA0 D;  2E5L E;  5C0X A;  4JI1 E;  4LPF A;  4DV0 I;  1FWK A;  4X66 E;  1FJG I;  5K36 E;  1ZXN A;  2V8P A;  1I94 E;  2R42 A;  1UDS A;  2J65 A;  4DR4 I;  1B63 A;  4LCH A;  5C0X B;  1A6F A;  1EA6 A;  1Y5Y A;  5LL6 R;  1D6T A;  4X62 E;  5FLX C;  5JEA E;  2UUB E;  5FLX Q;  4JG4 A;  1VIS A;  2JE6 B;  2O1T A;  4KHP E;  3V2U C;  2ZM6 I;  2AJ4 A;  3P76 A;  5C0X F;  1Z0T A;  2UXD I;  2VQE I;  2HHH I;  1KIJ A;  1Z0G A;  4JYA I;  2NN6 E;  1N34 E;  3CWV A;  4UTG A;  4OO1 B;  1IBL I;  4DV3 E;  1Z59 A;  3GCM A;  4FN5 A;  2O1W A;  2O1V A;  4JI5 E;  3PYF A;  1XNR I;  4ZVI A;  4NBQ A;  2OI2 A;  3GME A;  4JI2 E;  1Z0W A;  3J7A M;  4JI6 E;  2GQ0 A;  2UUA E;  1I94 I;  2UU9 I;  4EMD A;  5LMN I;  4LF5 E;  1Y4S A;  4B3S I;  2UXD E;  4LF9 E;  4DV4 E;  3LTO A;  4IS9 A;  1UDO A;  5IWA I;  4Z7C A;  1XHK A;  2R3V A;  2UXC I;  4X65 I;  1DAR A;  2PO2 A;  3B8H A;  1XNQ E;  4OX9 E;  2JEA A;  4B3M E;  2GO3 A;  4USK A;  4WUD A;  1Y4U A;  2IOQ A;  4JI6 I;  5BR8 E;  2A2C A;  5JEA D;  4GKJ I;  4DPU A;  2DEI A;  4PU9 A;  4DPY A;  5C0X E;  1PVG A;  2PO2 B;  4FW5 A;  4FWD A;  3T1H E;  2Z5E A;  2UXB E;  4DR2 I;  3PYG A;  5K36 D;  1N32 E;  4WUC A;  1IBM I;  3HUL A;  4JI0 I;  4HY1 A;  3J80 C;  4N3O A;  1ZM3 A;  1FJG E;  4P7A A;  2VQF E;  4AID A;  1ZM9 A;  1FNM A;  2XEX A;  5ELW A;  4BA1 B;  1E3P A;  2CVE A;  4X64 I;  1HR0 I;  3ZZU A;  5DRP A;  4NXM E;  4MYU A;  2V2V A;  5FWK A;  2IER A;  4HXZ A;  4DR5 E;  1Z0B A;  3PYE A;  1XMO E;  2BR2 B;  1HNX I;  4X66 I;  4ED4 A;  2AE8 A;  4LCF A;  4IFD C;  4IZJ A;  4LF9 I;  2HFU A;  4KHP I;  4DV5 E;  2UUA I;  3M85 D;  4DUY E;  2JEB B;  2X7I A;  4ISA A;  5DRR A;  1MX0 A;  1N0V C;  4DPW A;  3WU5 A;  4DUZ I;  2NN6 C;  4IZK B;  4U3B A;  4JI0 E;  4JI8 E;  4I3H A;  1R6L A;  4OX9 I;  4DV2 E;  4IZJ D;  4MYT A;  1ZXM A;  5C0X C;  3P3E A;  5K36 B;  2ZM6 E;  1Z5A A;  2UU9 E;  2PNL A;  4B3T E;  4DV4 I;  2BM1 A;  2C37 A;  4JYA E;  1NZ0 A;  4JI7 E;  4DR1 E;  3UHM A;  4DR7 I;  1QZR A;  1XMQ I;  4JI1 I;  1HNZ E;  1YH8 A;  1HNX E;  4IZJ B;  5JEA B;  2BA0 G;  4HAC B;  4MU3 A;  1N33 I;  2HK3 A;  2JE6 A;  3GLL A;  2IES A;  3PYD A;  4LFB I;  4X64 E;  2DEJ A;  1HR0 E;  4DU7 A;  2O1U A;  3OTO I;  4DV1 I;  5IT9 Q;  3JAM Q;  5IWA E;  4AIM A;  2V2Q A;  2C38 A;  1HNW I;  1EI1 A;  4NXN I;  3J80 Q;  4DXL A;  4FWH A;  1UDQ A;  4RPF A;  4LF8 E;  1S16 A;  2BV3 A;  1NHJ A;  2IOP A;  4AQY I;  1Z0V A;  1UEK A;  1MU5 A;  4WUB A;  3CDI A;  4DU8 A;  4MU0 A;  2C37 B;  2VQF I;  1IBL E;  4IFD B;  4DV6 E;  4B3R I;  2UXC E;  4BA1 A;  1WUU A;  1YHC A;  4LF4 I;  4JV5 E;  4P52 A;  2BA1 D;  1NHI A;  1OYR A;  1Z0C A;  2BA1 G;  3ZKD A;  4DV3 I;  2NN6 F;  2E5L I;  3H1C A;  2CZ9 A;  1IBM E; 
#chains in the Genus database with same CATH homology
 4YHH I;  2HKE A;  1KKH A;  3LPS A;  2Z5B B;  3D4J A;  1B62 A;  1RR9 A;  4DV6 I;  3T1Y E;  4USM A;  5LMU I;  1N33 E;  4LF7 E;  3WU3 A;  1RRE A;  4YHH E;  4DV7 I;  1Z5C A;  2BM0 A;  4JI4 I;  5A2Q C;  5LMN E;  1J5E E;  2UXB I;  3GON A;  4R1F A;  1ZM4 A;  2CG9 A;  1PIE A;  1HNZ I;  4K0K I;  1XMQ E;  3F0N A;  5A2Q Q;  3Q1Q A;  3ZKB A;  1IBK I;  4GKK I;  4URL A;  2A2D A;  3OTO E;  4LFB E;  1Z5B A;  1USV A;  3ZM7 A;  4LF4 E;  4JI3 E;  1N0U A;  3J81 Q;  4YY3 E;  2V34 A;  1KTV A;  2X36 A;  3B82 A;  2UUC E;  3WU4 A;  1S4E A;  4DUY I;  2HKJ A;  2GS8 A;  1HNW E;  1Z0E A;  4DR7 E;  1ELO A;  4YY3 I;  3T1H I;  4B3T I;  4AQY E;  4JI8 I;  4LF8 I;  3ZZ0 A;  4LF6 I;  3K17 A;  3Q6N A;  3J7A G;  2ZIT A;  3P06 A;  1H7U A;  4DV2 I;  3WU6 A;  4X65 E;  1U2R A;  2CGE A;  4JI5 I;  2ZBK B;  4XTJ A;  4LF7 I;  3JAM C;  4GKK E;  4JI4 E;  4PRV A;  4DPX A;  2UUB I;  4FWG A;  3B78 A;  2PNM A;  3T1Y I;  1K47 A;  3M6A A;  3V5R A;  4K0K E;  1FKA E;  1J5E I;  2HK2 A;  4B3M I;  3H4L A;  4JI7 I;  4JI2 I;  2LJP A;  3LNU A;  2Z5C B;  4UT4 A;  1IBK E;  4M1K A;  1N36 E;  1N34 I;  5GME A;  4B3R E;  1HK7 A;  4FW9 A;  2VQE E;  3QT8 A;  4HAC A;  4X62 I;  5LMU E;  1USU A;  3K1J A;  3Q6M A;  2HFS A;  1FI4 A;  4DV5 I;  2EFG A;  1H74 A;  4LFC E;  4B3S E;  5L3J A;  4DV1 E;  4DV7 E;  2V2Z A;  4HYM A;  4IZK A;  4DR6 E;  2NPF A;  3QT7 A;  1N32 I;  4NXN E;  1H73 A;  1BKN A;  1XMO I;  4JV5 I;  4DV0 E;  5GMD A;  1XNR E;  1MG7 A;  1H7S A;  4LF6 E;  1H72 C;  3J81 C;  2Z5B A;  5BR8 I;  1Y6Z A;  4PRX A;  2F4V E;  4GKJ E;  3QT6 A;  2HHH E;  2E1R A;  1FWL A;  4DR2 E;  2WW4 A;  1XNQ I;  1OJ4 A;  2UUC I;  3PRY A;  4LFA I;  3QT5 A;  1NHH A;  1KVK A;  4DPT A;  1PKP A;  3ZZT A;  4DR6 I;  2VF3 A;  4DR1 I;  4DR3 I;  3HJC A;  4LFA E;  4DR5 I;  5IT9 C;  1N36 I;  4KQV A;  4Z7Y A;  2F4V I;  4LFC I;  2Q2E B;  4DUZ E;  4DR3 E;  3K85 A;  4LF5 I;  1ZM2 A;  2J7K A;  4DR4 E;  4JI3 I;  4NXM I;  2Z5C A;  2E5L E;  4JI1 E;  4DV0 I;  1FWK A;  4X66 E;  1FJG I;  1ZXN A;  2V8P A;  1I94 E;  2R42 A;  4DR4 I;  1B63 A;  1A6F A;  1EA6 A;  2CZ9 A;  5LL6 R;  1D6T A;  4X62 E;  5FLX C;  2UUB E;  5FLX Q;  4JG4 A;  1VIS A;  4KHP E;  2O1T A;  3V2U C;  2ZM6 I;  2AJ4 A;  1Z0T A;  2UXD I;  2VQE I;  2HHH I;  1KIJ A;  1Z0G A;  4JYA I;  1N34 E;  3CWV A;  4UTG A;  1IBL I;  4DV3 E;  1Z59 A;  4FN5 A;  2O1W A;  2O1V A;  4JI5 E;  3PYF A;  1XNR I;  4ZVI A;  2OI2 A;  4JI2 E;  1Z0W A;  3J7A M;  4JI6 E;  2GQ0 A;  2UUA E;  1I94 I;  2UU9 I;  4EMD A;  5LMN I;  4LF5 E;  1Y4S A;  4B3S I;  2UXD E;  4LF9 E;  4DV4 E;  3LTO A;  5IWA I;  4Z7C A;  1XHK A;  2R3V A;  2UXC I;  4X65 I;  1DAR A;  3B8H A;  1XNQ E;  4OX9 E;  4B3M E;  4USK A;  4WUD A;  1Y4U A;  2IOQ A;  4JI6 I;  5BR8 E;  2A2C A;  4GKJ I;  4DPU A;  2DEI A;  4PU9 A;  4DPY A;  1PVG A;  4FWD A;  3T1H E;  2Z5E A;  2UXB E;  4DR2 I;  3PYG A;  1N32 E;  4WUC A;  1IBM I;  3HUL A;  4JI0 I;  3J80 C;  4HY1 A;  4N3O A;  1ZM3 A;  1FJG E;  4P7A A;  2VQF E;  1ZM9 A;  1FNM A;  2XEX A;  4X64 I;  1HR0 I;  3ZZU A;  4NXM E;  4MYU A;  2V2V A;  5FWK A;  4HXZ A;  4DR5 E;  1Z0B A;  3PYE A;  1XMO E;  1HNX I;  4X66 I;  4ED4 A;  4IZJ A;  4LF9 I;  2HFU A;  4KHP I;  4DV5 E;  2UUA I;  4DUY E;  2X7I A;  1MX0 A;  1N0V C;  4DPW A;  3WU5 A;  4DUZ I;  4IZK B;  4JI0 E;  4JI8 E;  4I3H A;  4OX9 I;  4DV2 E;  4IZJ D;  4MYT A;  1ZXM A;  2ZM6 E;  1Z5A A;  2PNL A;  4B3T E;  4DV4 I;  2BM1 A;  4JYA E;  1NZ0 A;  4JI7 E;  4DR1 E;  4DR7 I;  1QZR A;  1XMQ I;  4JI1 I;  1HNZ E;  1HNX E;  4IZJ B;  4HAC B;  1N33 I;  2HK3 A;  3PYD A;  4LFB I;  4X64 E;  2DEJ A;  1HR0 E;  4DU7 A;  2O1U A;  3OTO I;  4DV1 I;  5IT9 Q;  3JAM Q;  5IWA E;  2V2Q A;  1HNW I;  1EI1 A;  4NXN I;  3J80 Q;  4DXL A;  4FWH A;  4RPF A;  4LF8 E;  1S16 A;  2BV3 A;  1NHJ A;  2IOP A;  4AQY I;  1Z0V A;  1UEK A;  1MU5 A;  4WUB A;  4DU8 A;  2VQF I;  1IBL E;  4DV6 E;  4B3R I;  2UXC E;  1WUU A;  4LF4 I;  4JV5 E;  4P52 A;  1NHI A;  1Z0C A;  3ZKD A;  4DV3 I;  2E5L I;  2UU9 E;  1IBM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...