3J80Q

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
TVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGRGARSRFQKSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 31
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3j80Q00
4LF9E 2BM0A 4DR7E 4NXME 1IBKE 4FWHA 5IT9C 4DV3I 2UUCI 4DU8A 3J7AM 2A2CA 4DR2I 4DUZI 2J7KA 4DR3I 1Z0CA 3J80C 1N32E 4GKKI 4DV4I 3QT5A 1XHKA 2WW4A 1S4EA 1HNXI 1FI4A 4HACB 1U2RA 4PRXA 4WUDA 1EA6A 4X65E 4B3SI 4B3TI 5BR8E 3T1YE 1FNMA 4X62E 5LMNI 3OTOI 2E5LI 1ZM2A 4KHPI 5LMUE 3ZKBA 4LFCI 1J5EI 1Z5CA 3WU3A 3ZM7A 4DR5I 2HFUA 4DR1I 4DV5I 2UXDI 2LJPA 4DV3E 2UUCE 1Z0VA 3GONA 4DR2E 1FJGI 4LFBI 4DUZE 5A2QC 4DR3E 4Z7YA 3H4LA 4GKKE 4DV4E 1PIEA 4OX9I 1HNXE 2CZ9A 1I94I 5GMEA 4JI5I 4DV2I 4DV7I 1MU5A 3V2UC 2UUBI 3D4JA 5FLXQ 3ZZUA 4B3SE 4DV0I 4B3TE 1FWKA 1Z0BA 3LNUA 5LMNE 4FW9A 4R1FA 4DXLA 2E5LE 3K17A 4KHPE 1VISA 4LFCE 1EI1A 1J5EE 3HULA 1NZ0A 3ZZ0A 2VQFI 4DR5E 3JAMC 5L3JA 4DR1E 2X7IA 4DV5E 1B62A 4WUCA 4DPWA 2UXDE 1PVGA 1FWLA 4USMA 4AQYI 3T1HE 4YHHI 1FJGE 4LFBE 1ZXNA 4GKJI 2F4VI 4DPTA 4DU7A 4OX9E 3J81C 4JYAI 4DV6I 1I94E 4JI5E 3QT7A 4DV2E 1HNZI 4DV7E 2UUBE 3ZZTA 1NHHA 4DV0E 4DPYA 1XNQI 4LFAI 4DR4I 1UEKA 1Z5AA 1MX0A 3LPSA 1H7SA 1N34I 2V8PA 1D6TA 4FN5A 1Z0GA 1ZM4A 3B8HA 4Z7CA 2VQFE 1OJ4A 1ZM9A 2V34A 4JI0I 1Z0TA 4AQYE 4YHHE 3V5RA 1H7UA 1NHIA 1N0VC 4GKJE 2F4VE 4JYAE 4DV6E 1HNZE 1IBLI 4XTJA 4P7AA 2VQEI 1XNQE 2EFGA 1HR0I 4PRVA 2HKEA 4LFAE 3PYFA 4ZVIA 4DR4E 4MYTA 2V2VA 1N34E 5IT9Q 5IWAI 3K1JA 3B82A 4K0KI 1N33I 1XNRI 3LTOA 4JI2I 2HK2A 2UXBI 3J80Q 3OTOE 4JI0E 3QT8A 1N0UA 1Z0EA 2AJ4A 1Z0WA 1HNWI 4DUYI 4M1KA 4JI4I 4JI1I 1IBLE 4EMDA 4LF8I 4RPFA 3Q1QA 1FKAE 2HK3A 2VQEE 1HR0E 4PU9A 4UT4A 2HHHI 2E1RA 4I3HA 1RR9A 4B3MI 4JI8I 2UXCI 5BR8I 5IWAE 1KIJA 1H73A 4KQVA 2X36A 2V2QA 4K0KE 2VF3A 1N33E 1MG7A 4DPXA 1XNRE 2UU9I 4JI2E 5A2QQ 4X64I 2UXBE 1KTVA 1S16A 4HACA 4JI7I 4X66I 3PYDA 2HFSA 2UUAI 1HNWE 2DEIA 4DUYE 2ZM6I 4JI4E 4JI1E 4DR6I 4UTGA 2R3VA 2Q2EB 3WU5A 1IBMI 3QT6A 1QZRA 4DPUA 4DV1I 1A6FA 4LF8E 5FLXC 1ZM3A 1ZXMA 1ELOA 4HY1A 2HHHE 1Z5BA 2BV3A 3JAMQ 4FWDA 1PKPA 4B3ME 4JI8E 4NXNI 3WU4A 3B78A 2UXCE 4LF6I 4LF4I 4LF5I 2UU9E 4X64E 1XMQI 4YY3I 4JI7E 4X66E 4JG4A 3J81Q 4ED4A 1RREA 4URLA 1B63A 1XMOI 1H72C 2UUAE 4JV5I 1KKHA 2GS8A 4P52A 1N36I 3PYEA 3PYGA 2ZM6E 4B3RI 4DR6E 4JI6I 3M6AA 1BKNA 1IBME 1NHJA 3T1HI 4JI3I 4DV1E 4LF7I 2A2DA 4LF9I 4USKA 4DR7I 3WU6A 5LL6R 4NXMI 1IBKI 3J7AG 4NXNE 3F0NA 3CWVA 1KVKA 4LF6E 4LF4E 2ZBKB 2DEJA 4LF5E 5GMDA 1N32I 1XMQE 4YY3E 1H74A 2HKJA 2OI2A 1XMOE 4MYUA 4X65I 4JV5E 4HXZA 2BM1A 1N36E 2R42A 3T1YI 1WUUA 4B3RE 4X62I 4JI6E 1Z59A 4HYMA 4FWGA 4JI3E 5LMUI 4LF7E 2ZITA 1K47A 2NPFA 1DARA 3ZKDA 2XEXA 2V2ZA 4WUBA
chains in the Genus database with same CATH superfamily
4LF9E 2BM0A 2CG9A 4LCHA 5JEAC 4DR7E 2NN6B 4NXME 1IBKE 4FWHA 2F1DA 5IT9C 2IOQA 4DV3I 2UUCI 4DU8A 3J7AM 5K36C 1XXEA 2A2CA 4DR2I 2Z5CB 4DUZI 4J3DA 2J7KA 4LOMA 4DR3I 1Z0CA 3J80C 1N32E 4GKKI 4DV4I 3QT5A 1YHCA 1XHKA 2WW4A 1S4EA 1HNXI 4BA2A 1FI4A 2WP8B 4HACB 1U2RA 4OO1C 4PRXA 4WUDA 2O1TA 2BA1D 1EA6A 4X65E 4B3SI 4B3TI 5BR8E 1OYSA 1Y4SA 3T1YE 4IFDB 1FNMA 1VI7A 4X62E 5LMNI 3OTOI 2JEBB 2PO2B 5JEAD 2E5LI 1ZM2A 3GLLA 4KHPI 5LMUE 2IOPA 3ZKBA 4LFCI 1J5EI 5K36D 1Z5CA 2C37A 3WU3A 3ZM7A 1R6LA 4DR5I 2HFUA 4MU4A 4FW4A 4LCFA 4DR1I 4DV5I 4MQYA 5C0XF 5DRPA 2UXDI 2LJPA 4DV3E 2UUCE 3PS3A 4OO1D 1Z0VA 2JEAB 1Y4UA 3GONA 4DR2E 1FJGI 4LFBI 4IZJB 2PNZA 4DUZE 5A2QC 4DR3E 4Z7YA 3H4LA 4GKKE 2C39A 4DV4E 1PIEA 4OX9I 1HNXE 4N3OA 2CZ9A 1I94I 5GMEA 4JI5I 4DV2I 4DV7I 1MU5A 3V2UC 1YH8A 2UUBI 3D4JA 5FLXQ 2Z5BA 3ZZUA 4B3SE 4DV0I 4B3TE 5JEAA 1FWKA 3U1YA 4ISAA 1UDSA 1Z0BA 3P3EA 3LNUA 5LMNE 4FW9A 4R1FA 4DXLA 2E5LE 5K36A 3K17A 2PO0A 4KHPE 1VISA 3M7ND 2O3ZA 4LFCE 1EI1A 1J5EE 2WNRB 3HULA 1NZ0A 3ZZ0A 2VQFI 2NN6F 4DR5E 2C39B 3JAMC 5L3JA 4OO1A 1P42A 4DR1E 2X7IA 4DV5E 1B62A 4WUCA 4DPWA 1USVA 2UXDE 5C0XC 1PVGA 1FWLA 4USMA 4AQYI 3T1HE 4YHHI 2BA1G 1FJGE 4LFBE 1ZXNA 2AE8A 1UDNA 4GKJI 3B4TA 2F4VI 2C38B 4DPTA 5ELWA 4DU7A 4OX9E 3J81C 1RHYA 4JYAI 4DV6I 1I94E 4JI5E 3QT7A 2O1VA 4DV2E 1HNZI 4FW5A 4DV7E 2UUBE 2BR2A 3ZZTA 1NHHA 4IFDF 4DV0E 4DPYA 1XNQI 3Q6NA 1E3PA 4LFAI 4OO1B 2BA0D 4DR4I 1UEKA 1Z5AA 1MX0A 3LPSA 4MU1A 1H7SA 1N34I 2V8PA 1D6TA 4FN5A 5C0XD 1Z0GA 2GQ0A 1ZM4A 2JE6B 4IFDE 3Q6MA 3B8HA 4AM3A 4Z7CA 2VQFE 3P06A 1OJ4A 2NN6C 1ZM9A 3HJCA 2V34A 4IS9A 4JI0I 1Z0TA 2BR2B 4AQYE 4YHHE 3V5RA 1H7UA 1NHIA 1N0VC 3KRNA 4GKJE 1USUA 2F4VE 4JYAE 4DV6E 1HNZE 1IBLI 4XTJA 4BA2B 5DRQA 3M7NG 2JT2A 4P7AA 4U3BA 2VQEI 1XNQE 2EFGA 1HR0I 3U1KA 4PRVA 2HKEA 4LFAE 3M85D 3PYFA 4OZEA 4ZVIA 5C0XA 4DR4E 2NN6D 4MYTA 2V2VA 1N34E 5IT9Q 5IWAI 3K1JA 3B82A 2PO1A 4K0KI 1N33I 3CDIA 1XNRI 3LTOA 4JI2I 2HK2A 2UXBI 3J80Q 2C37B 3PRYA 3OTOE 4JI0E 3L7ZA 3QT8A 1Y60A 1N0UA 4NBQA 3K85A 1Z0EA 2AJ4A 2GO4A 1Z0WA 1HNWI 4DUYI 4M1KA 4JI4I 4U3DA 4JI1I 2PNZB 2VESA 1R6MA 2BA0G 1IBLE 4EMDA 4LF8I 4FW6A 4RPFA 3Q1QA 3GCMA 1FKAE 2IERA 2HK3A 4AIMA 2VQEE 5JEAE 1HR0E 2NN6A 2Z5BB 4PU9A 4UT4A 2HHHI 2E1RA 4OO1F 4I3HA 1RR9A 5JEAB 4B3MI 4JI8I 5K36E 2UXCI 2Z5CA 5BR8I 1Y6ZA 1KIJA 5IWAE 1H73A 5K36B 4KQVA 2X36A 2V2QA 2PO0B 1HK7A 4K0KE 2VF3A 1N33E 1MG7A 4DPXA 1XNRE 4IZJD 2UU9I 4JI2E 5A2QQ 4X64I 2UXBE 1KTVA 2WP8A 1S16A 4HACA 4OO1E 2GO3A 4JI7I 4X66I 4FW7A 3P3GA 3PYDA 2HFSA 2UUAI 2Z5EA 1HNWE 2DEIA 4DUYE 2JEBA 2PO2A 2ZM6I 4JI4E 4JI1E 4DR6I 4UTGA 4WUBA 4OKGA 4LPFA 2R3VA 2IESA 2Q2EB 3WU5A 2CVEA 3M85G 1IBMI 4LCGA 3QT6A 1QZRA 4DPUA 4DV1I 4QNKA 1A6FA 5DROA 4LF8E 5FLXC 1ZM3A 1ZXMA 1ELOA 4HY1A 2HHHE 1Z5BA 5DNLA 3NZKA 2BV3A 3JAMQ 2O1UA 4FWDA 1PKPA 3P76A 5DNXA 4B3ME 4JI8E 2JEAA 4BA1A 1OYPA 4NXNI 3WU4A 3B78A 4IZJA 2UXCE 4MDTA 2O1WA 4LF6I 4LF4I 4LF5I 2UU9E 4X64E 1XMQI 2PNLA 4YY3I 4JI7E 4X66E 4JG4A 5EL9A 3J81Q 4IFDC 2PNMA 3UHMA 4ED4A 1RREA 4URLA 1B63A 1XMOI 1H72C 4IZKA 2J65A 2UUAE 4JV5I 1KKHA 4AIDA 1Y5YA 2GS8A 4P52A 4MU0A 1N36I 4FW3A 3PYEA 2ZM6E 4B3RI 4DR6E 4JI6I 3M6AA 1BKNA 1IBME 1NHJA 4BA1B 1UDOA 3T1HI 4JI3I 4DV1E 2WNRA 4LF7I 4MU3A 5EKWA 3PS2A 2A2DA 3H1CA 5JEAF 4LF9I 4USKA 4DR7I 5C0XE 3WU6A 5LL6R 4NXMI 1IBKI 3J7AG 4IFDD 4NXNE 5K36F 1E3HA 2CGEA 3DD6A 3F0NA 5C0XB 3CWVA 4IZKB 1KVKA 4LF6E 4LF4E 2ZBKB 2C38A 2DEJA 4LF5E 5GMDA 1N32I 4QNJA 1XMQE 2PO1B 4GQUA 4YY3E 3P3CA 1H74A 2HKJA 2OI2A 1XMOE 4MYUA 3HKMA 4X65I 4JV5E 4HXZA 3L7ZB 2BM1A 1N36E 2R42A 3T1YI 1WUUA 5FWKA 4B3RE 4X62I 4JI6E 5DRRA 1Z59A 4HYMA 3CDJA 3GMEA 4FWGA 4JI3E 5LMUI 4LF7E 1OYRA 2JE6A 1K47A 2ZITA 3PS1A 1UDQA 2NPFA 1DARA 3ZKDA 2XEXA 2V2ZA 3PYGA 2NN6E 4IFDA
chains in the Genus database with same CATH topology
4LF9E 2BM0A 2CG9A 4DR7E 4NXME 1IBKE 4FWHA 5IT9C 2IOQA 4DV3I 2UUCI 4DU8A 3J7AM 2A2CA 4DR2I 2Z5CB 4DUZI 2J7KA 4DR3I 1Z0CA 3J80C 1N32E 4GKKI 4DV4I 3QT5A 1XHKA 2WW4A 1S4EA 1HNXI 1FI4A 4HACB 1U2RA 4PRXA 4WUDA 2O1TA 1EA6A 4X65E 4B3SI 4B3TI 5BR8E 1Y4SA 3T1YE 1FNMA 4X62E 5LMNI 3OTOI 2E5LI 1ZM2A 4KHPI 5LMUE 2IOPA 3ZKBA 4LFCI 1J5EI 1Z5CA 3WU3A 3ZM7A 4DR5I 2HFUA 4DR1I 4DV5I 2UXDI 2LJPA 4DV3E 2UUCE 1Z0VA 1Y4UA 3GONA 4DR2E 1FJGI 4LFBI 4IZJB 4DUZE 5A2QC 4DR3E 4Z7YA 3H4LA 4GKKE 4DV4E 1PIEA 4OX9I 1HNXE 4N3OA 2CZ9A 1I94I 5GMEA 4JI5I 4DV2I 4DV7I 1MU5A 3V2UC 2UUBI 3D4JA 5FLXQ 2Z5BA 3ZZUA 4B3SE 4DV0I 4B3TE 1FWKA 1Z0BA 3LNUA 5LMNE 4FW9A 4R1FA 4DXLA 2E5LE 3K17A 4KHPE 1VISA 4LFCE 1EI1A 1J5EE 3HULA 1NZ0A 3ZZ0A 2VQFI 4DR5E 3JAMC 5L3JA 4DR1E 2X7IA 4DV5E 1B62A 4WUCA 4DPWA 1USVA 2UXDE 1PVGA 1FWLA 4USMA 4AQYI 3T1HE 4YHHI 1FJGE 4LFBE 1ZXNA 4GKJI 2F4VI 4DPTA 4DU7A 4OX9E 3J81C 4JYAI 4DV6I 1I94E 4JI5E 3QT7A 2O1VA 4DV2E 1HNZI 4DV7E 2UUBE 3ZZTA 1NHHA 4DV0E 4DPYA 1XNQI 3Q6NA 4LFAI 4DR4I 1UEKA 1Z5AA 1MX0A 3LPSA 1H7SA 1N34I 2V8PA 1D6TA 4FN5A 1Z0GA 2GQ0A 1ZM4A 3Q6MA 3B8HA 4Z7CA 2VQFE 3P06A 1OJ4A 1ZM9A 3HJCA 2V34A 4JI0I 1Z0TA 4AQYE 4YHHE 3V5RA 1H7UA 1NHIA 1N0VC 4GKJE 1USUA 2F4VE 4JYAE 4DV6E 1HNZE 1IBLI 4XTJA 4P7AA 2VQEI 1XNQE 2EFGA 1HR0I 4PRVA 2HKEA 4LFAE 3PYFA 4ZVIA 4DR4E 4MYTA 2V2VA 1N34E 5IT9Q 5IWAI 3K1JA 3B82A 4K0KI 1N33I 1XNRI 3LTOA 4JI2I 2HK2A 2UXBI 3J80Q 3PRYA 3OTOE 4JI0E 3QT8A 1N0UA 3K85A 1Z0EA 2AJ4A 1Z0WA 1HNWI 4DUYI 4M1KA 4JI4I 4JI1I 1IBLE 4EMDA 4LF8I 4RPFA 3Q1QA 1FKAE 2HK3A 2VQEE 1HR0E 2Z5BB 4PU9A 4UT4A 2HHHI 2E1RA 4I3HA 1RR9A 4B3MI 4JI8I 2UXCI 2Z5CA 5BR8I 1Y6ZA 1KIJA 5IWAE 1H73A 4KQVA 2X36A 2V2QA 4K0KE 1HK7A 2VF3A 1N33E 1MG7A 4DPXA 1XNRE 4IZJD 2UU9I 4JI2E 5A2QQ 4X64I 2UXBE 1KTVA 1S16A 4HACA 4JI7I 4X66I 3PYDA 2HFSA 2UUAI 2Z5EA 1HNWE 2DEIA 4DUYE 2ZM6I 4JI4E 4JI1E 4DR6I 4UTGA 4WUBA 2R3VA 2Q2EB 3WU5A 1IBMI 3QT6A 1QZRA 4DPUA 4DV1I 1A6FA 4LF8E 5FLXC 1ZM3A 1ZXMA 1ELOA 4HY1A 2HHHE 1Z5BA 2BV3A 3JAMQ 2O1UA 4FWDA 1PKPA 4B3ME 4JI8E 4NXNI 3WU4A 3B78A 4IZJA 2UXCE 2O1WA 4LF6I 4LF4I 4LF5I 2UU9E 4X64E 1XMQI 2PNLA 4YY3I 4JI7E 4X66E 4JG4A 3J81Q 2PNMA 4ED4A 1RREA 4URLA 1B63A 1XMOI 1H72C 4IZKA 2UUAE 4JV5I 1KKHA 2GS8A 4P52A 1N36I 3PYEA 2ZM6E 4B3RI 4DR6E 4JI6I 3M6AA 1BKNA 1IBME 1NHJA 3T1HI 4JI3I 4DV1E 4LF7I 2A2DA 4LF9I 4USKA 4DR7I 3WU6A 5LL6R 4NXMI 1IBKI 3J7AG 4NXNE 2CGEA 3F0NA 3CWVA 4IZKB 1KVKA 4LF6E 4LF4E 2ZBKB 2DEJA 4LF5E 5GMDA 1N32I 1XMQE 4YY3E 1H74A 2HKJA 2OI2A 1XMOE 4MYUA 4X65I 4JV5E 4HXZA 2BM1A 1N36E 2R42A 3T1YI 1WUUA 5FWKA 4B3RE 4X62I 4JI6E 1Z59A 4HYMA 4FWGA 4JI3E 5LMUI 4LF7E 2ZITA 1K47A 2NPFA 1DARA 3ZKDA 2XEXA 2V2ZA 3PYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 E;  2BM0 A;  4DR7 E;  4NXM E;  1IBK E;  4FWH A;  5IT9 C;  4DV3 I;  2UUC I;  4DU8 A;  3J7A M;  2A2C A;  4DR2 I;  4DUZ I;  2J7K A;  4DR3 I;  1Z0C A;  3J80 C;  1N32 E;  4GKK I;  4DV4 I;  3QT5 A;  1XHK A;  2WW4 A;  1S4E A;  1HNX I;  1FI4 A;  4HAC B;  1U2R A;  4PRX A;  4WUD A;  1EA6 A;  4X65 E;  4B3S I;  4B3T I;  5BR8 E;  3T1Y E;  1FNM A;  4X62 E;  5LMN I;  3OTO I;  2E5L I;  1ZM2 A;  4KHP I;  5LMU E;  3ZKB A;  4LFC I;  1J5E I;  1Z5C A;  3WU3 A;  3ZM7 A;  4DR5 I;  2HFU A;  4DR1 I;  4DV5 I;  2UXD I;  2LJP A;  4DV3 E;  2UUC E;  1Z0V A;  3GON A;  4DR2 E;  1FJG I;  4LFB I;  4DUZ E;  5A2Q C;  4DR3 E;  4Z7Y A;  3H4L A;  4GKK E;  4DV4 E;  1PIE A;  4OX9 I;  1HNX E;  2CZ9 A;  1I94 I;  5GME A;  4JI5 I;  4DV2 I;  4DV7 I;  1MU5 A;  3V2U C;  2UUB I;  3D4J A;  5FLX Q;  3ZZU A;  4B3S E;  4DV0 I;  4B3T E;  1FWK A;  1Z0B A;  3LNU A;  5LMN E;  4FW9 A;  4R1F A;  4DXL A;  2E5L E;  3K17 A;  4KHP E;  1VIS A;  4LFC E;  1EI1 A;  1J5E E;  3HUL A;  1NZ0 A;  3ZZ0 A;  2VQF I;  4DR5 E;  3JAM C;  5L3J A;  4DR1 E;  2X7I A;  4DV5 E;  1B62 A;  4WUC A;  4DPW A;  2UXD E;  1PVG A;  1FWL A;  4USM A;  4AQY I;  3T1H E;  4YHH I;  1FJG E;  4LFB E;  1ZXN A;  4GKJ I;  2F4V I;  4DPT A;  4DU7 A;  4OX9 E;  3J81 C;  4JYA I;  4DV6 I;  1I94 E;  4JI5 E;  3QT7 A;  4DV2 E;  1HNZ I;  4DV7 E;  2UUB E;  3ZZT A;  1NHH A;  4DV0 E;  4DPY A;  1XNQ I;  4LFA I;  4DR4 I;  1UEK A;  1Z5A A;  1MX0 A;  3LPS A;  1H7S A;  1N34 I;  2V8P A;  1D6T A;  4FN5 A;  1Z0G A;  1ZM4 A;  3B8H A;  4Z7C A;  2VQF E;  1OJ4 A;  1ZM9 A;  2V34 A;  4JI0 I;  1Z0T A;  4AQY E;  4YHH E;  3V5R A;  1H7U A;  1NHI A;  1N0V C;  4GKJ E;  2F4V E;  4JYA E;  4DV6 E;  1HNZ E;  1IBL I;  4XTJ A;  4P7A A;  2VQE I;  1XNQ E;  2EFG A;  1HR0 I;  4PRV A;  2HKE A;  4LFA E;  3PYF A;  4ZVI A;  4DR4 E;  4MYT A;  2V2V A;  1N34 E;  5IT9 Q;  5IWA I;  3K1J A;  3B82 A;  4K0K I;  1N33 I;  1XNR I;  3LTO A;  4JI2 I;  2HK2 A;  2UXB I;  3J80 Q;  3OTO E;  4JI0 E;  3QT8 A;  1N0U A;  1Z0E A;  2AJ4 A;  1Z0W A;  1HNW I;  4DUY I;  4M1K A;  4JI4 I;  4JI1 I;  1IBL E;  4EMD A;  4LF8 I;  4RPF A;  3Q1Q A;  1FKA E;  2HK3 A;  2VQE E;  1HR0 E;  4PU9 A;  4UT4 A;  2HHH I;  2E1R A;  4I3H A;  1RR9 A;  4B3M I;  4JI8 I;  2UXC I;  5BR8 I;  5IWA E;  1KIJ A;  1H73 A;  4KQV A;  2X36 A;  2V2Q A;  4K0K E;  2VF3 A;  1N33 E;  1MG7 A;  4DPX A;  1XNR E;  2UU9 I;  4JI2 E;  5A2Q Q;  4X64 I;  2UXB E;  1KTV A;  1S16 A;  4HAC A;  4JI7 I;  4X66 I;  3PYD A;  2HFS A;  2UUA I;  1HNW E;  2DEI A;  4DUY E;  2ZM6 I;  4JI4 E;  4JI1 E;  4DR6 I;  4UTG A;  2R3V A;  2Q2E B;  3WU5 A;  1IBM I;  3QT6 A;  1QZR A;  4DPU A;  4DV1 I;  1A6F A;  4LF8 E;  5FLX C;  1ZM3 A;  1ZXM A;  1ELO A;  4HY1 A;  2HHH E;  1Z5B A;  2BV3 A;  3JAM Q;  4FWD A;  1PKP A;  4B3M E;  4JI8 E;  4NXN I;  3WU4 A;  3B78 A;  2UXC E;  4LF6 I;  4LF4 I;  4LF5 I;  2UU9 E;  4X64 E;  1XMQ I;  4YY3 I;  4JI7 E;  4X66 E;  4JG4 A;  3J81 Q;  4ED4 A;  1RRE A;  4URL A;  1B63 A;  1XMO I;  1H72 C;  2UUA E;  4JV5 I;  1KKH A;  2GS8 A;  4P52 A;  1N36 I;  3PYE A;  3PYG A;  2ZM6 E;  4B3R I;  4DR6 E;  4JI6 I;  3M6A A;  1BKN A;  1IBM E;  1NHJ A;  3T1H I;  4JI3 I;  4DV1 E;  4LF7 I;  2A2D A;  4LF9 I;  4USK A;  4DR7 I;  3WU6 A;  5LL6 R;  4NXM I;  1IBK I;  3J7A G;  4NXN E;  3F0N A;  3CWV A;  1KVK A;  4LF6 E;  4LF4 E;  2ZBK B;  2DEJ A;  4LF5 E;  5GMD A;  1N32 I;  1XMQ E;  4YY3 E;  1H74 A;  2HKJ A;  2OI2 A;  1XMO E;  4MYU A;  4X65 I;  4JV5 E;  4HXZ A;  2BM1 A;  1N36 E;  2R42 A;  3T1Y I;  1WUU A;  4B3R E;  4X62 I;  4JI6 E;  1Z59 A;  4HYM A;  4FWG A;  4JI3 E;  5LMU I;  4LF7 E;  2ZIT A;  1K47 A;  2NPF A;  1DAR A;  3ZKD A;  2XEX A;  2V2Z A;  4WUB A; 
#chains in the Genus database with same CATH topology
 4LF9 E;  2BM0 A;  2CG9 A;  4LCH A;  5JEA C;  4DR7 E;  2NN6 B;  4NXM E;  1IBK E;  4FWH A;  2F1D A;  5IT9 C;  2IOQ A;  4DV3 I;  2UUC I;  4DU8 A;  3J7A M;  5K36 C;  1XXE A;  2A2C A;  4DR2 I;  2Z5C B;  4DUZ I;  4J3D A;  2J7K A;  4LOM A;  4DR3 I;  1Z0C A;  3J80 C;  1N32 E;  4GKK I;  4DV4 I;  3QT5 A;  1YHC A;  1XHK A;  2WW4 A;  1S4E A;  1HNX I;  4BA2 A;  1FI4 A;  2WP8 B;  4HAC B;  1U2R A;  4OO1 C;  4PRX A;  4WUD A;  2O1T A;  2BA1 D;  1EA6 A;  4X65 E;  4B3S I;  4B3T I;  5BR8 E;  1OYS A;  1Y4S A;  3T1Y E;  4IFD B;  1FNM A;  1VI7 A;  4X62 E;  5LMN I;  3OTO I;  2JEB B;  2PO2 B;  5JEA D;  2E5L I;  1ZM2 A;  3GLL A;  4KHP I;  5LMU E;  2IOP A;  3ZKB A;  4LFC I;  1J5E I;  5K36 D;  1Z5C A;  2C37 A;  3WU3 A;  3ZM7 A;  1R6L A;  4DR5 I;  2HFU A;  4MU4 A;  4FW4 A;  4LCF A;  4DR1 I;  4DV5 I;  4MQY A;  5C0X F;  5DRP A;  2UXD I;  2LJP A;  4DV3 E;  2UUC E;  3PS3 A;  4OO1 D;  1Z0V A;  2JEA B;  1Y4U A;  3GON A;  4DR2 E;  1FJG I;  4LFB I;  4IZJ B;  2PNZ A;  4DUZ E;  5A2Q C;  4DR3 E;  4Z7Y A;  3H4L A;  4GKK E;  2C39 A;  4DV4 E;  1PIE A;  4OX9 I;  1HNX E;  4N3O A;  2CZ9 A;  1I94 I;  5GME A;  4JI5 I;  4DV2 I;  4DV7 I;  1MU5 A;  3V2U C;  1YH8 A;  2UUB I;  3D4J A;  5FLX Q;  2Z5B A;  3ZZU A;  4B3S E;  4DV0 I;  4B3T E;  5JEA A;  1FWK A;  3U1Y A;  4ISA A;  1UDS A;  1Z0B A;  3P3E A;  3LNU A;  5LMN E;  4FW9 A;  4R1F A;  4DXL A;  2E5L E;  5K36 A;  3K17 A;  2PO0 A;  4KHP E;  1VIS A;  3M7N D;  2O3Z A;  4LFC E;  1EI1 A;  1J5E E;  2WNR B;  3HUL A;  1NZ0 A;  3ZZ0 A;  2VQF I;  2NN6 F;  4DR5 E;  2C39 B;  3JAM C;  5L3J A;  4OO1 A;  1P42 A;  4DR1 E;  2X7I A;  4DV5 E;  1B62 A;  4WUC A;  4DPW A;  1USV A;  2UXD E;  5C0X C;  1PVG A;  1FWL A;  4USM A;  4AQY I;  3T1H E;  4YHH I;  2BA1 G;  1FJG E;  4LFB E;  1ZXN A;  2AE8 A;  1UDN A;  4GKJ I;  3B4T A;  2F4V I;  2C38 B;  4DPT A;  5ELW A;  4DU7 A;  4OX9 E;  3J81 C;  1RHY A;  4JYA I;  4DV6 I;  1I94 E;  4JI5 E;  3QT7 A;  2O1V A;  4DV2 E;  1HNZ I;  4FW5 A;  4DV7 E;  2UUB E;  2BR2 A;  3ZZT A;  1NHH A;  4IFD F;  4DV0 E;  4DPY A;  1XNQ I;  3Q6N A;  1E3P A;  4LFA I;  4OO1 B;  2BA0 D;  4DR4 I;  1UEK A;  1Z5A A;  1MX0 A;  3LPS A;  4MU1 A;  1H7S A;  1N34 I;  2V8P A;  1D6T A;  4FN5 A;  5C0X D;  1Z0G A;  2GQ0 A;  1ZM4 A;  2JE6 B;  4IFD E;  3Q6M A;  3B8H A;  4AM3 A;  4Z7C A;  2VQF E;  3P06 A;  1OJ4 A;  2NN6 C;  1ZM9 A;  3HJC A;  2V34 A;  4IS9 A;  4JI0 I;  1Z0T A;  2BR2 B;  4AQY E;  4YHH E;  3V5R A;  1H7U A;  1NHI A;  1N0V C;  3KRN A;  4GKJ E;  1USU A;  2F4V E;  4JYA E;  4DV6 E;  1HNZ E;  1IBL I;  4XTJ A;  4BA2 B;  5DRQ A;  3M7N G;  2JT2 A;  4P7A A;  4U3B A;  2VQE I;  1XNQ E;  2EFG A;  1HR0 I;  3U1K A;  4PRV A;  2HKE A;  4LFA E;  3M85 D;  3PYF A;  4OZE A;  4ZVI A;  5C0X A;  4DR4 E;  2NN6 D;  4MYT A;  2V2V A;  1N34 E;  5IT9 Q;  5IWA I;  3K1J A;  3B82 A;  2PO1 A;  4K0K I;  1N33 I;  3CDI A;  1XNR I;  3LTO A;  4JI2 I;  2HK2 A;  2UXB I;  3J80 Q;  2C37 B;  3PRY A;  3OTO E;  4JI0 E;  3L7Z A;  3QT8 A;  1Y60 A;  1N0U A;  4NBQ A;  3K85 A;  1Z0E A;  2AJ4 A;  2GO4 A;  1Z0W A;  1HNW I;  4DUY I;  4M1K A;  4JI4 I;  4U3D A;  4JI1 I;  2PNZ B;  2VES A;  1R6M A;  2BA0 G;  1IBL E;  4EMD A;  4LF8 I;  4FW6 A;  4RPF A;  3Q1Q A;  3GCM A;  1FKA E;  2IER A;  2HK3 A;  4AIM A;  2VQE E;  5JEA E;  1HR0 E;  2NN6 A;  2Z5B B;  4PU9 A;  4UT4 A;  2HHH I;  2E1R A;  4OO1 F;  4I3H A;  1RR9 A;  5JEA B;  4B3M I;  4JI8 I;  5K36 E;  2UXC I;  2Z5C A;  5BR8 I;  1Y6Z A;  1KIJ A;  5IWA E;  1H73 A;  5K36 B;  4KQV A;  2X36 A;  2V2Q A;  2PO0 B;  1HK7 A;  4K0K E;  2VF3 A;  1N33 E;  1MG7 A;  4DPX A;  1XNR E;  4IZJ D;  2UU9 I;  4JI2 E;  5A2Q Q;  4X64 I;  2UXB E;  1KTV A;  2WP8 A;  1S16 A;  4HAC A;  4OO1 E;  2GO3 A;  4JI7 I;  4X66 I;  4FW7 A;  3P3G A;  3PYD A;  2HFS A;  2UUA I;  2Z5E A;  1HNW E;  2DEI A;  4DUY E;  2JEB A;  2PO2 A;  2ZM6 I;  4JI4 E;  4JI1 E;  4DR6 I;  4UTG A;  4WUB A;  4OKG A;  4LPF A;  2R3V A;  2IES A;  2Q2E B;  3WU5 A;  2CVE A;  3M85 G;  1IBM I;  4LCG A;  3QT6 A;  1QZR A;  4DPU A;  4DV1 I;  4QNK A;  1A6F A;  5DRO A;  4LF8 E;  5FLX C;  1ZM3 A;  1ZXM A;  1ELO A;  4HY1 A;  2HHH E;  1Z5B A;  5DNL A;  3NZK A;  2BV3 A;  3JAM Q;  2O1U A;  4FWD A;  1PKP A;  3P76 A;  5DNX A;  4B3M E;  4JI8 E;  2JEA A;  4BA1 A;  1OYP A;  4NXN I;  3WU4 A;  3B78 A;  4IZJ A;  2UXC E;  4MDT A;  2O1W A;  4LF6 I;  4LF4 I;  4LF5 I;  2UU9 E;  4X64 E;  1XMQ I;  2PNL A;  4YY3 I;  4JI7 E;  4X66 E;  4JG4 A;  5EL9 A;  3J81 Q;  4IFD C;  2PNM A;  3UHM A;  4ED4 A;  1RRE A;  4URL A;  1B63 A;  1XMO I;  1H72 C;  4IZK A;  2J65 A;  2UUA E;  4JV5 I;  1KKH A;  4AID A;  1Y5Y A;  2GS8 A;  4P52 A;  4MU0 A;  1N36 I;  4FW3 A;  3PYE A;  2ZM6 E;  4B3R I;  4DR6 E;  4JI6 I;  3M6A A;  1BKN A;  1IBM E;  1NHJ A;  4BA1 B;  1UDO A;  3T1H I;  4JI3 I;  4DV1 E;  2WNR A;  4LF7 I;  4MU3 A;  5EKW A;  3PS2 A;  2A2D A;  3H1C A;  5JEA F;  4LF9 I;  4USK A;  4DR7 I;  5C0X E;  3WU6 A;  5LL6 R;  4NXM I;  1IBK I;  3J7A G;  4IFD D;  4NXN E;  5K36 F;  1E3H A;  2CGE A;  3DD6 A;  3F0N A;  5C0X B;  3CWV A;  4IZK B;  1KVK A;  4LF6 E;  4LF4 E;  2ZBK B;  2C38 A;  2DEJ A;  4LF5 E;  5GMD A;  1N32 I;  4QNJ A;  1XMQ E;  2PO1 B;  4GQU A;  4YY3 E;  3P3C A;  1H74 A;  2HKJ A;  2OI2 A;  1XMO E;  4MYU A;  3HKM A;  4X65 I;  4JV5 E;  4HXZ A;  3L7Z B;  2BM1 A;  1N36 E;  2R42 A;  3T1Y I;  1WUU A;  5FWK A;  4B3R E;  4X62 I;  4JI6 E;  5DRR A;  1Z59 A;  4HYM A;  3CDJ A;  3GME A;  4FWG A;  4JI3 E;  5LMU I;  4LF7 E;  1OYR A;  2JE6 A;  1K47 A;  2ZIT A;  3PS1 A;  1UDQ A;  2NPF A;  1DAR A;  3ZKD A;  2XEX A;  2V2Z A;  3PYG A;  2NN6 E;  4IFD A; 
#chains in the Genus database with same CATH homology
 4LF9 E;  2BM0 A;  2CG9 A;  4DR7 E;  4NXM E;  1IBK E;  4FWH A;  5IT9 C;  2IOQ A;  4DV3 I;  2UUC I;  4DU8 A;  3J7A M;  2A2C A;  4DR2 I;  2Z5C B;  4DUZ I;  2J7K A;  4DR3 I;  1Z0C A;  3J80 C;  1N32 E;  4GKK I;  4DV4 I;  3QT5 A;  1XHK A;  2WW4 A;  1S4E A;  1HNX I;  1FI4 A;  4HAC B;  1U2R A;  4PRX A;  4WUD A;  2O1T A;  1EA6 A;  4X65 E;  4B3S I;  4B3T I;  5BR8 E;  1Y4S A;  3T1Y E;  1FNM A;  4X62 E;  5LMN I;  3OTO I;  2E5L I;  1ZM2 A;  4KHP I;  5LMU E;  2IOP A;  3ZKB A;  4LFC I;  1J5E I;  1Z5C A;  3WU3 A;  3ZM7 A;  4DR5 I;  2HFU A;  4DR1 I;  4DV5 I;  2UXD I;  2LJP A;  4DV3 E;  2UUC E;  1Z0V A;  1Y4U A;  3GON A;  4DR2 E;  1FJG I;  4LFB I;  4IZJ B;  4DUZ E;  5A2Q C;  4DR3 E;  4Z7Y A;  3H4L A;  4GKK E;  4DV4 E;  1PIE A;  4OX9 I;  1HNX E;  4N3O A;  2CZ9 A;  1I94 I;  5GME A;  4JI5 I;  4DV2 I;  4DV7 I;  1MU5 A;  3V2U C;  2UUB I;  3D4J A;  5FLX Q;  2Z5B A;  3ZZU A;  4B3S E;  4DV0 I;  4B3T E;  1FWK A;  1Z0B A;  3LNU A;  5LMN E;  4FW9 A;  4R1F A;  4DXL A;  2E5L E;  3K17 A;  4KHP E;  1VIS A;  4LFC E;  1EI1 A;  1J5E E;  3HUL A;  1NZ0 A;  3ZZ0 A;  2VQF I;  4DR5 E;  3JAM C;  5L3J A;  4DR1 E;  2X7I A;  4DV5 E;  1B62 A;  4WUC A;  4DPW A;  1USV A;  2UXD E;  1PVG A;  1FWL A;  4USM A;  4AQY I;  3T1H E;  4YHH I;  1FJG E;  4LFB E;  1ZXN A;  4GKJ I;  2F4V I;  4DPT A;  4DU7 A;  4OX9 E;  3J81 C;  4JYA I;  4DV6 I;  1I94 E;  4JI5 E;  3QT7 A;  2O1V A;  4DV2 E;  1HNZ I;  4DV7 E;  2UUB E;  3ZZT A;  1NHH A;  4DV0 E;  4DPY A;  1XNQ I;  3Q6N A;  4LFA I;  4DR4 I;  1UEK A;  1Z5A A;  1MX0 A;  3LPS A;  1H7S A;  1N34 I;  2V8P A;  1D6T A;  4FN5 A;  1Z0G A;  2GQ0 A;  1ZM4 A;  3Q6M A;  3B8H A;  4Z7C A;  2VQF E;  3P06 A;  1OJ4 A;  1ZM9 A;  3HJC A;  2V34 A;  4JI0 I;  1Z0T A;  4AQY E;  4YHH E;  3V5R A;  1H7U A;  1NHI A;  1N0V C;  4GKJ E;  1USU A;  2F4V E;  4JYA E;  4DV6 E;  1HNZ E;  1IBL I;  4XTJ A;  4P7A A;  2VQE I;  1XNQ E;  2EFG A;  1HR0 I;  4PRV A;  2HKE A;  4LFA E;  3PYF A;  4ZVI A;  4DR4 E;  4MYT A;  2V2V A;  1N34 E;  5IT9 Q;  5IWA I;  3K1J A;  3B82 A;  4K0K I;  1N33 I;  1XNR I;  3LTO A;  4JI2 I;  2HK2 A;  2UXB I;  3J80 Q;  3PRY A;  3OTO E;  4JI0 E;  3QT8 A;  1N0U A;  3K85 A;  1Z0E A;  2AJ4 A;  1Z0W A;  1HNW I;  4DUY I;  4M1K A;  4JI4 I;  4JI1 I;  1IBL E;  4EMD A;  4LF8 I;  4RPF A;  3Q1Q A;  1FKA E;  2HK3 A;  2VQE E;  1HR0 E;  2Z5B B;  4PU9 A;  4UT4 A;  2HHH I;  2E1R A;  4I3H A;  1RR9 A;  4B3M I;  4JI8 I;  2UXC I;  2Z5C A;  5BR8 I;  1Y6Z A;  1KIJ A;  5IWA E;  1H73 A;  4KQV A;  2X36 A;  2V2Q A;  4K0K E;  1HK7 A;  2VF3 A;  1N33 E;  1MG7 A;  4DPX A;  1XNR E;  4IZJ D;  2UU9 I;  4JI2 E;  5A2Q Q;  4X64 I;  2UXB E;  1KTV A;  1S16 A;  4HAC A;  4JI7 I;  4X66 I;  3PYD A;  2HFS A;  2UUA I;  2Z5E A;  1HNW E;  2DEI A;  4DUY E;  2ZM6 I;  4JI4 E;  4JI1 E;  4DR6 I;  4UTG A;  4WUB A;  2R3V A;  2Q2E B;  3WU5 A;  1IBM I;  3QT6 A;  1QZR A;  4DPU A;  4DV1 I;  1A6F A;  4LF8 E;  5FLX C;  1ZM3 A;  1ZXM A;  1ELO A;  4HY1 A;  2HHH E;  1Z5B A;  2BV3 A;  3JAM Q;  2O1U A;  4FWD A;  1PKP A;  4B3M E;  4JI8 E;  4NXN I;  3WU4 A;  3B78 A;  4IZJ A;  2UXC E;  2O1W A;  4LF6 I;  4LF4 I;  4LF5 I;  2UU9 E;  4X64 E;  1XMQ I;  2PNL A;  4YY3 I;  4JI7 E;  4X66 E;  4JG4 A;  3J81 Q;  2PNM A;  4ED4 A;  1RRE A;  4URL A;  1B63 A;  1XMO I;  1H72 C;  4IZK A;  2UUA E;  4JV5 I;  1KKH A;  2GS8 A;  4P52 A;  1N36 I;  3PYE A;  2ZM6 E;  4B3R I;  4DR6 E;  4JI6 I;  3M6A A;  1BKN A;  1IBM E;  1NHJ A;  3T1H I;  4JI3 I;  4DV1 E;  4LF7 I;  2A2D A;  4LF9 I;  4USK A;  4DR7 I;  3WU6 A;  5LL6 R;  4NXM I;  1IBK I;  3J7A G;  4NXN E;  2CGE A;  3F0N A;  3CWV A;  4IZK B;  1KVK A;  4LF6 E;  4LF4 E;  2ZBK B;  2DEJ A;  4LF5 E;  5GMD A;  1N32 I;  1XMQ E;  4YY3 E;  1H74 A;  2HKJ A;  2OI2 A;  1XMO E;  4MYU A;  4X65 I;  4JV5 E;  4HXZ A;  2BM1 A;  1N36 E;  2R42 A;  3T1Y I;  1WUU A;  5FWK A;  4B3R E;  4X62 I;  4JI6 E;  1Z59 A;  4HYM A;  4FWG A;  4JI3 E;  5LMU I;  4LF7 E;  2ZIT A;  1K47 A;  2NPF A;  1DAR A;  3ZKD A;  2XEX A;  2V2Z A;  3PYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...