5BR8E

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5br8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8E02
4DPXA 3PYEA 3LTOA 1H7UA 4LF7E 1Z0VA 4WUCA 2BV3A 3QT5A 1Z5AA 1EI1A 1I94I 4HACB 5LMNI 2ZM6I 1FKAE 4USKA 4HXZA 1YZ9A 1HNZE 4LF4E 1N34I 1X48A 2LRSA 1Z0BA 2V2QA 1IBKI 3VYYA 1IBLE 4FWGA 3F0NA 4DXLA 1EA6A 1KVKA 5CFFE 2V8PA 5FLXQ 3OTOE 1N33I 4JI4I 2B7VA 1B62A 4B3ME 4OOGC 4DUYE 4HACA 1NHIA 4DV4I 1B63A 2UUBI 4KHPE 1PIEA 3ZZTA 4X62I 4PRXA 4JI2I 1N36I 4JG4A 3J80C 5A2QC 1BKNA 2HFUA 4JI7E 1I94E 1YYKA 5LMNE 2LTRA 1Z0TA 2ZM6E 4DPYA 2JVAA 1K47A 1D6TA 1MU5A 3WU4A 4NXMI 4JI0I 2V2VA 1YYWA 4Z7CA 1J5EI 3M6AA 4WUDA 3GONA 4EMDA 4DR3I 3JAMC 1N33E 4JI4E 4DR7I 1T4NA 2L3CA 2ZITA 4DR5I 4DV4E 4PU9A 1N32I 4XTJA 4YHHI 1A6FA 2NA2A 4DV3I 4JI2E 1N36E 1T4LB 1N0UA 2X36A 4FWHA 4DR4I 3J7AM 1ZBTA 3PYGA 4WFTA 2UXDI 4LF8I 1X47A 1IBLI 1PVGA 3ZZ0A 2UXBI 1Z5BA 4DV1I 3J81C 4DV0E 2UXCI 3WU3A 4X65I 4NXME 2BM0A 4JI0E 4LFCI 1MG7A 5IWAI 2EFGA 1S16A 1J5EE 3J80Q 5A2QQ 4DR3E 1H7SA 2E5LI 2F4VI 2LBSB 1EKZA 4DR7E 2ZBKB 2V2ZA 4DR5E 1N32E 2B3TB 4JI7I 1Z0CA 1VISA 4YHHE 4DV6I 1N0VC 4OX9I 4DV3E 1KKHA 1NHHA 4DR1I 4DUZE 4DR4E 3JAMQ 4DV2E 4LF6I 4DR6I 4AQYI 2UXDE 3ZKDA 4LF8E 1FJGI 2NUEA 2UXBE 5L3JA 4DV1E 2IHR1 4JYAI 2J7KA 2L2MA 2UXCE 1Z5CA 1RC7A 3WU5A 4X65E 5IWAE 4LFCE 3P1XA 4LF9I 3ADJA 1ZXNA 1NZ0A 2DMYA 3ZKBA 2E5LE 2F4VE 1Z59A 4URLA 4JI3I 1HNWI 1UEKA 2R42A 1XHKA 4M30A 4B3SI 3J81Q 4MYTA 2LUQA 4DV6E 1HR0I 2BM1A 4DV5E 1XMOE 4OX9E 3WU6A 2R3VA 4LF5I 4DR1E 4DV0I 1WHQA 1XNRI 4GKJI 4NXNI 4LF6E 4DPWA 4DR6E 2LUPB 4AQYE 4JI8I 1ZM9A 1XMQI 1FJGE 3CWVA 1ZM4A 1ELOA 5LMUI 5IT9C 4JYAE 3QT8A 3B78A 4B3TE 2DB2A 4LF9E 2E1RA 4DPTA 4LFBE 3ADGA 2L3JA 2NUGA 1RQ0A 2CPNA 4DR2E 3T1YE 1H73A 4WYQB 2A2CA 2RS7A 4JI3E 3V5RA 1ZXMA 1HNWE 4I3HA 1Z0EA 2EZ6A 2VF3A 2UUCI 4B3SE 4JI6E 2L33A 4USMA 4UT4A 4DUZI 2VQFI 2NPFA 4DV2I 2WW4A 4FWDA 1J26A 4RPFA 1HR0E 1ZM2A 1H74A 4YY3E 2HKJA 3ZZUA 5BR8I 3HTXA 4LF5E 4DV7I 1RREA 1XNRE 4GKJE 4NXNE 4P7AA 2DEJA 4KQVA 4JI8E 2RS6A 1XMQE 2HFSA 5LMUE 3B82A 2CZ9A 3V2UC 1IBMI 4JI5I 5GMEA 1KTVA 2VQEI 2UU9I 1S4EA 3K1JA 2HKEA 4JV5I 2AJ4A 2L2NA 1FWKA 1MX0A 2OI2A 4X64I 4DV5I 1NHJA 1X49A 1U2RA 3H4LA 1XMOI 2UUCE 5IT9Q 1STUA 4Z7YA 4UTGA 2VQFE 2YT4A 2MDRA 2L2KB 4WUBA 1DARA 3K17A 5BR8E 2HK2A 4FN5A 4DV7E 3PYDA 1PKPA 2DEIA 2HHHI 4P52A 4PRVA 2GS8A 4B3TI 4LFBI 3C4TA 1H72C 2A2DA 4HY1A 2NUFA 1FWLA 3Q1QA 1FI4A 1IBME 4DR2I 3T1YI 3QT6A 1QZRA 4JI5E 2VQEE 2UU9E 2RSMA 3J7Yp 4JV5E 4JI6I 4R1FA 3HULA 2X7IA 2DIXA 1XNQI 2KHXA 3T1HE 3QT7A 4B3RI 4X64E 1YYOA 1UHZA 4K0KI 4YY3I 4X66I 1GQEA 2LTSA 1UILA 2N3HA 4M2ZA 3ADIA 1Z0GA 4JI1I 3C4BA 1QU6A 4LFAI 1HNXI 1FNMA 1OJ4A 2HHHE 4ED4A 5GMDA 4HYMA 3D4JA 4ZVIA 2LJPA 4FW9A 1DI2A 1N34E 1RR9A 1IBKE 2UUAI 4DKKA 3LLHA 4DU8A 4GKKI 1XNQE 3J7AG 4B3RE 1WHNA 2N3GA 4LF7I 4X8WA 4K0KE 2B7TA 4X66E 1Z0WA 5FLXC 2UUBE 1O0WA 3PYFA 4X62E 4JI1E 1KIJA 2Q2EB 3ADLA 3LPSA 2LJHA 4LFAE 1HNZI 4DPUA 1HNXE 4LF4I 3ZM7A 4DU7A 5LL6R 2HK3A 3LNUA 2RTXA 3OTOI 2V34A 1WUUA 3B8HA 3VYXA 3T1HI 2XEXA 2UUAE 4B3MI 4DUYI 1T4OA 2JY9A 1ZM3A 4M1KA 4GKKE 4KHPI 4MYUA
chains in the Genus database with same CATH superfamily
4DPXA 1G2FC 3PYEA 5JEAD 5KL6A 3LTOA 2EN3A 2EM6A 2V87A 1H7UA 2WNRA 4LF7E 1X6HA 1Z0VA 2JPAA 4F9BB 4WUCA 3ZOQB 2BV3A 3GLLA 3P3EA 3QT5A 2EM0A 1Z5AA 1EI1A 1I94I 4HACB 2BB8A 2EPPA 1KYQA 2EOYA 2L8TA 5LMNI 2ZM6I 1FKAE 2RPCA 4USKA 2O1TA 1Y4SA 4HXZA 1YZ9A 2EMFA 2YZTA 1HNZE 4LF4E 1N34I 1A1KA 2EMWA 4P7DA 4IFDB 1X48A 1AH5A 2LRSA 5KL5A 1Z0BA 2LJUA 4R2DA 2V2QA 1IBKI 2EPOA 2CGEA 3VYYA 1IBLE 4FWGA 2PO1A 3F0NA 4DXLA 1EA6A 1KVKA 1YH8A 2ELYA 2EOFA 2YTNA 4R2CA 1OYSA 5CFFE 2BA0G 2F1DA 2NN6B 2V8PA 5FLXQ 3OTOE 5F3WA 1N33I 1USUA 4JI4I 2CVEA 2B7VA 2Z5EA 2HJJA 1B62A 1SR9A 1IQOA 2CG9A 4B3ME 4OOGC 4R2SA 3M99B 2YRHA 4DUYE 4HACA 1NHIA 4DV4I 4IZJD 1N3GA 5K36D 2VE7C 1B63A 2UUBI 3P06A 4KHPE 1PIEA 1UDQA 2LMZA 5LLQA 3ZZTA 4X62I 2C37B 2LT7A 2BA0D 4PRXA 4IFDA 4JI2I 4IFDE 1N36I 2Z5BB 4ZYGA 1WXRA 2DLQA 3J80C 4JG4A 2EM8A 3P76A 2LVHA 4FK5C 5A2QC 5AASA 3P3CA 3OMLA 1A1LA 1LLMC 1BKNA 2EM9A 4F2JC 4JI7E 2HFUA 4OO1A 1I94E 1YYKA 4MYUA 2NN6A 2NN6E 2LTRA 5LMNE 1Z0TA 5A69A 2ZM6E 2YTEA 2EPZA 4LPFA 2YU5A 3KZYA 4TUGA 4DPYA 2EOZA 2E1MA 2JVAA 2VF1A 1K47A 1MU5A 5JEAB 1D6TA 4RHBB 1JK1A 3WU4A 4NXMI 2JYAA 4JI0I 4OZEA 2EL5A 2V2VA 1F2IG 1YUJA 1YYWA 4IZKB 2EQ3A 2PO0B 4Z7CA 1J5EI 3M6AA 4WUDA 2H36X 2C37A 3GONA 4N3OA 3DF6A 4EMDA 2M4IA 2EJ4A 2V8QB 2YTOA 3JAMC 1Y60A 1Y5YA 1T38A 2Z5BA 4DR3I 1PJQA 2YTPA 1N33E 4JI4E 3PS1A 4DR7I 1T4NA 5IV8B 3JU0A 1IMUA 2L3CA 2ZITA 3M7NG 5ELWA 4DR5I 4WSPA 4DV4E 4O4KA 1PJTA 1TF3A 2EM5A 4ZYHA 2L6MA 4PU9A 4BA1B 1N32I 4XTJA 4BBYA 2J65A 1RMDA 4YHHI 2PRTA 1A6FA 3EPHA 5JEAE 2NA2A 4I8OA 4WXDA 4DV3I 2YWQA 4JI2E 1N36E 1BBGA 4P78A 3JTZA 1T4LB 1N0UA 2X36A 4IZKA 4R2AA 4FWHA 2PO0A 2EMXA 4DR4I 1IQSA 2NABA 3J7AM 3M7ND 1ZBTA 3EPKA 2EWLA 3PYGA 4WFTA 2IOQA 4J8ZA 3C6MA 2O1WA 2UXDI 4LF8I 1A1FA 2EN6A 2HC5A 1X47A 2V83A 1IBLI 2EPKX 1PVGA 3ZZ0A 2UXBI 4L8NA 1Z5BA 4DV1I 3RMPA 2DLKA 1VI7A 3J81C 1SFEA 2V89A 4KWYA 4DV0E 4BC7A 1Y4UA 3PRYA 4MQYA 2VRDA 4MU3A 2EPXA 2UXCI 2DRPA 5AE1A 2EMAA 3WU3A 4X65I 2EPMX 4NXME 2JOXA 1XXEA 2BM0A 4JI0E 4LFCI 2EMKA 4M0VA 1MG7A 2EFGA 1S16A 4BA1A 5IWAI 2GO3A 3HPSA 1GTKA 4R2RA 2MC6A 2NN6F 2EOMA 2DSYA 1J5EE 1A1GA 3J80Q 1DQ3A 5A2QQ 5C0XC 4U3DA 4DR3E 1H7SA 2E5LI 2F4VI 1PJSA 2KOUA 2LBSB 1EKZA 2HGHA 4DR7E 3PS3A 2CSHA 2ZBKB 2O3ZA 2EOOA 4DR5E 3ECRA 1BBOA 2V2ZA 5ADZA 3M85G 4ZYDA 2EM2A 2EN2A 3L00A 2EP3A 2WBUA 2B3TB 1N32E 4IS9A 2EQ0A 3MHHC 3VK6A 1Z0CA 4JI7I 1G2DC 2MKNA 4YHHE 1VISA 5FWKA 4DV6I 1TN9A 5KL3A 2AE8A 2EPRA 1N0VC 4OX9I 2YRMA 4DV3E 3TQMA 1KKHA 1NHHA 2EN7A 1X6FA 1OYRA 4DR1I 4DUZE 4NBQA 2V88A 3H09A 1YSAC 4DR4E 3B4TA 3JAMQ 3HPZA 2MDGA 4DV2E 3M85D 4LF6I 4DR6I 3HQ1A 2F8BA 3H1CA 4LCHA 4AQYI 3BBGA 2UXDE 4FW7A 3ZKDA 2WZOA 4LF8E 2JEAB 3KWRA 4IFDC 1FJGI 4BC9A 2NUEA 2UXBE 5L3JA 5JEAF 4DV1E 2EMBA 1QNTA 1ZU1A 2IHR1 1B69A 1UDOA 4AM3A 4JYAI 2J7KA 2L2MA 3NZKA 2EOQA 2UXCE 1RC7A 1Z5CA 3K6QA 5DNYA 2EOIA 3CDJA 3WU5A 4X65E 2CT1A 5IWAE 4LFCE 4LCFA 4OO1C 3P1XA 4LF9I 2K4VA 3ADJA 5AC4A 1ZXNA 5KL7A 3U1YA 5KL4A 4GEQB 4WXCA 1NZ0A 2DMYA 3ZKBA 2E5LE 2F4VE 4R2EA 3THOB 4L5NC 1Z59A 4F54A 4URLA 4JI3I 2JEBB 1HNWI 2JOBA 1UEKA 3LMLA 2R42A 3IWDA 4FW3A 2A25A 1XHKA 4M30A 4B3SI 3J81Q 1EH7A 2JEAA 2EPLX 2JE6B 3IWBA 2GO4A 4MYTA 2LUQA 1R6LA 3Q6NA 4NZVA 2EMZA 4DV6E 2B9DA 4DV5E 3EPJA 4F6MA 1P47A 2BM1A 1HR0I 1XMOE 1E3HA 4OX9E 5DNLA 4BHBA 2G7HA 3WU6A 1GZ6A 2R3VA 4LF5I 4DR1E 4DV0I 1WHQA 3BIDA 1XNRI 2BBGA 4GKJI 4NXNI 2DMIA 4LF6E 5K36F 4DPWA 4DR6E 2FV4B 2LUPB 4AQYE 4JI8I 1ZM9A 2R1FA 4J3DA 1XMQI 2PO2B 1FJGE 5C0XD 5A6BA 1ZM4A 1ELOA 3CWVA 2JEBA 5IT9C 2GPIA 5LMUI 3BGHA 4JYAE 3QT8A 4U3BA 2LO3A 2I9IA 2EOEA 3B78A 2WBTA 2JE6A 2EM7A 2BR2B 4B3TE 2DB2A 3GMEA 4LF9E 2E1RA 2EMLA 4DPTA 3UHMA 4BA2B 4LFBE 5AE2A 3ADGA 2L3JA 3KRNA 4AIDA 2LCEA 4R03A 1RQ0A 5TSEA 4R2QA 2CPNA 4F6NA 2NUGA 2EN1A 2VESA 2RSIA 4DR2E 3T1YE 1H73A 5A6AA 4WYQB 2J7JA 1Y6ZA 2A2CA 2FTXB 2RS7A 4JI3E 1ZXMA 2WP8B 1HNWE 3Q6MA 4I3HA 1Z0EA 3DJWA 3V5RA 5JEAA 2EZ6A 2VF3A 4MDTA 5A6KA 2UUCI 4B3SE 4JI6E 4WSGA 2EPCA 2L33A 2PO2A 4USMA 4UT4A 2VQFI 4DUZI 1UN6B 3DD6A 2NPFA 4DV2I 2WCC3 2WW4A 4Q28A 2L92A 4FWDA 2EM4A 4IFDD 2PNMA 1J26A 4RPFA 1HR0E 2PNLA 2YTGA 4DMIA 4BMJA 1ZM2A 4IZJB 5DNXA 1L4SA 1A1JA 4KZSA 1H74A 5K36B 4YY3E 2HKJA 2GHFA 3ZZUA 2PNZB 2BR2A 5BR8I 2JR1A 3F6GA 4LF5E 3HTXA 4DV7I 1RREA 3C6KA 3GCMA 1XNRE 4GKJE 4NXNE 4P7AA 3HXLA 4OO1D 2LV2A 1YUIA 1YFHA 2NN6D 2DEJA 2ADRA 4JI8E 4KQVA 2RS6A 2N8XA 2YSPA 1XMQE 1YHCA 3EQ1A 1E3PA 2HFSA 3HJCA 5LMUE 1HK7A 4LU9A 3B82A 2CZ9A 2EMHA 4O5GA 3V2UC 2V85A 2EORA 2WNRB 1IBMI 1RHYA 2YU8A 3IWCA 2E72A 2M7QA 5AC5A 4GZNC 3CDIA 4JI5I 4FW5A 5GMEA 1KTVA 2VQEI 2YTQA 2EOSA 2EPNA 1S4EA 2UU9I 2EN8A 3K1JA 2HKEA 4JV5I 2AJ4A 4IZJA 2L2NA 1ZBQA 3L7ZB 5K36A 5K36E 1NEIA 2PNZA 4N4RB 2EMYA 1FWKA 1MX0A 2OI2A 3UK3C 5C0XB 4X64I 4BCAA 4DV5I 4MLVA 1X49A 1NHJA 1U2RA 3AUZA 4O43A 3H4LA 3HKMA 1XMOI 5EKWA 2UUCE 5IT9Q 1STUA 2EOHA 4Z7YA 4UTGA 4QNJA 1KJKA 2VQFE 2YT4A 2MDRA 2L2KB 2JWOA 1MGTA 5DRRA 3EPLA 4WUBA 1DARA 5EL9A 3K17A 2R76A 1USVA 5BR8E 1YPNA 2HK2A 4F9AB 4FN5A 4DV7E 3PYDA 1PKPA 2DEIA 1UBDC 2HHHI 5KL2A 1MEYC 1NCSA 2I13A 2YTIA 2O1VA 4P52A 4PRVA 2GS8A 2GLIA 3L7ZA 2ODRD 4B3TI 2O1UA 4R8OA 2NN6C 1PDAA 2CTDA 4LFBI 5C0XA 2C38B 3C4TA 1H72C 5C0XE 2A2DA 4HY1A 5DRPA 2NUFA 1FWLA 1WJPA 3Q1QA 1FI4A 1IBME 4DR2I 3T1YI 4TUIA 4WPYA 2V86A 3QT6A 2C39B 4MU0A 1QZRA 4JI5E 2VQEE 2UU9E 2RSMA 1TF6A 1OYPA 3J7Yp 4Q35B 4M9VC 4JV5E 4JI6I 4R1FA 4OO1B 3HULA 1X5WA 2X7IA 2DIXA 2ENAA 1XNQI 2GQ0A 2KHXA 2MC5A 3T1HE 1ZR9A 3QT7A 4B3RI 1ZAAC 4X64E 1YYOA 4OKGA 1UHZA 4X9JA 2Z5CB 2EE8A 5IXMB 4K0KI 4YY3I 2EL6A 2EOXA 4R2PA 4X66I 5DROA 1GQEA 1X3CA 2D9HA 2YSOA 3F6HA 2LTSA 1EH6A 1UILA 2C38A 4RH8A 2N3HA 2K7IA 2EPAA 4M2ZA 3ADIA 1Z0GA 3PS2A 4JI1I 4HTGA 5JEAC 3C4BA 2IESA 1QU6A 2YRKA 2EPUA 2IOPA 2C39A 4LFAI 1HNXI 2WBSA 4FW4A 1FNMA 2M1SA 2EQ1A 1OJ4A 2HHHE 3FIGA 4ED4A 4OO1E 4LTYA 2EN4A 2RQLA 1DGCA 5GMDA 4HYMA 3KZZA 3D4JA 4ZVIA 2LJPA 4F9CB 4FW9A 2ODRC 1DI2A 2Q8UA 4MU4A 1N34E 2Z5CA 4GQUA 4WX9A 3P3GA 1AAYA 1RR9A 3BF2A 1IBKE 4MU1A 2UUAI 4DKKA 2ENCA 2YTFA 4NHRA 2JT2A 4ZYEA 1JK2A 3LLHA 4DU8A 1EH8A 5C0XF 4GKKI 2EOJA 2BA1G 1Z1BA 1XNQE 3J7AG 4HEIA 4ISAA 2DGCA 2JXPA 5AE3A 4B3RE 2YPNA 1WHNA 2N3GA 4LF7I 4X8WA 2FGGA 4K0KE 2B7TA 4X66E 2EMGA 2EMIA 2IERA 1BB8A 1Z0WA 5FLXC 4AIMA 4BA2A 2UUBE 1P42A 5A6JA 1O0WA 5K36C 3AV0A 3MHSC 2YTJA 3PYFA 4X62E 2MKDA 3U1KA 4O24A 4JI1E 1KIJA 1R6MA 2Q2EB 3ADLA 2BA1D 3LPSA 2LE2A 2KONA 2LJHA 4LFAE 1HNZI 2WP8A 4DPUA 1HNXE 4LF4I 4IS1C 3ZM7A 5DRQA 5LL6R 4DU7A 2ELZA 1X6EA 2HK3A 1UDNA 3QG5C 5A6BD 3LNUA 4LOMA 4LCGA 4IFDF 2RTXA 3VHTB 4FW6A 2JP9A 2ENHA 4QNKA 3OTOI 2EM3A 2V34A 1WUUA 3B8HA 2M9AA 3VYXA 3T1HI 2XEXA 2EMCA 4OO1F 3MSWA 4MLQA 2UUAE 3THNA 4B3MI 1WRJA 4DUYI 1T4OA 5T6JA 2JY9A 1UDSA 1A1IA 1ZM3A 4M1KA 4BS9A 3K85A 2YTDA 1A1HA 4BHCA 2EL4A 4GKKE 4IJDA 4KHPI 1T39A 2PO1B
chains in the Genus database with same CATH topology
4DPXA 3PYEA 3LTOA 2V87A 1H7UA 4LF7E 1Z0VA 4F9BB 4WUCA 3ZOQB 2BV3A 3QT5A 1Z5AA 1EI1A 1I94I 4HACB 2L8TA 5LMNI 2ZM6I 1FKAE 4USKA 2O1TA 1Y4SA 4HXZA 1YZ9A 1HNZE 2YZTA 4LF4E 1N34I 4P7DA 1X48A 2LRSA 1Z0BA 2V2QA 1IBKI 2CGEA 3VYYA 1IBLE 4FWGA 3F0NA 4DXLA 1EA6A 1KVKA 5CFFE 2V8PA 5FLXQ 3OTOE 5F3WA 1N33I 1USUA 4JI4I 2B7VA 2Z5EA 1B62A 1SR9A 2CG9A 4B3ME 4OOGC 4DUYE 4HACA 1NHIA 4DV4I 4IZJD 2VE7C 1B63A 2UUBI 3P06A 4KHPE 1PIEA 2LMZA 3ZZTA 4X62I 4PRXA 4JI2I 1N36I 2Z5BB 1WXRA 3J80C 4JG4A 5A2QC 5AASA 3OMLA 1BKNA 2HFUA 4JI7E 1I94E 1YYKA 2LTRA 5LMNE 1Z0TA 2ZM6E 4TUGA 4DPYA 2JVAA 2E1MA 2VF1A 1K47A 1D6TA 1MU5A 3WU4A 4NXMI 4JI0I 2V2VA 4IZKB 1YYWA 4Z7CA 1J5EI 3M6AA 4WUDA 2H36X 4N3OA 3GONA 3DF6A 4EMDA 2M4IA 4DR3I 2V8QB 3JAMC 2Z5BA 1N33E 4JI4E 4DR7I 1T4NA 3JU0A 2L3CA 2ZITA 4DR5I 4WSPA 4DV4E 2L6MA 4PU9A 1N32I 4XTJA 4BBYA 4YHHI 1A6FA 2NA2A 4I8OA 4DV3I 4JI2E 1N36E 4P78A 3JTZA 1T4LB 1N0UA 2X36A 4IZKA 4FWHA 4DR4I 3J7AM 1ZBTA 2EWLA 3PYGA 4WFTA 2IOQA 4J8ZA 2O1WA 2UXDI 4LF8I 2V83A 1X47A 1IBLI 1PVGA 3ZZ0A 2UXBI 4L8NA 1Z5BA 4DV1I 3RMPA 3J81C 2V89A 4DV0E 4BC7A 1Y4UA 3PRYA 2UXCI 5AE1A 3WU3A 4X65I 4NXME 2JOXA 2BM0A 4JI0E 4LFCI 4M0VA 1MG7A 2EFGA 5IWAI 1S16A 3HPSA 2MC6A 2DSYA 1J5EE 3J80Q 1DQ3A 5A2QQ 4DR3E 1H7SA 2E5LI 2F4VI 2KOUA 2LBSB 1EKZA 4DR7E 2ZBKB 2V2ZA 4DR5E 5ADZA 1N32E 2B3TB 3VK6A 1Z0CA 4JI7I 1VISA 4YHHE 5FWKA 4DV6I 1N0VC 4OX9I 4DV3E 1KKHA 1NHHA 4DR1I 4DUZE 2V88A 3H09A 4DR4E 3JAMQ 3HPZA 4DV2E 4LF6I 4DR6I 3HQ1A 2F8BA 4AQYI 2UXDE 3ZKDA 2WZOA 4LF8E 3KWRA 1FJGI 4BC9A 2NUEA 2UXBE 5L3JA 4DV1E 2IHR1 4JYAI 2J7KA 2L2MA 2UXCE 1Z5CA 1RC7A 3K6QA 5DNYA 3WU5A 4X65E 5IWAE 4LFCE 3P1XA 4LF9I 2K4VA 3ADJA 1ZXNA 4GEQB 1NZ0A 2DMYA 3ZKBA 2E5LE 2F4VE 4L5NC 1Z59A 4F54A 4URLA 4JI3I 1HNWI 2JOBA 1UEKA 3LMLA 2R42A 3IWDA 1XHKA 4M30A 4B3SI 3J81Q 3IWBA 4MYTA 2LUQA 3Q6NA 4DV6E 1HR0I 2B9DA 4DV5E 2BM1A 1XMOE 4OX9E 2G7HA 3WU6A 1GZ6A 2R3VA 4LF5I 4DR1E 4DV0I 1WHQA 1XNRI 4GKJI 4NXNI 4LF6E 4DPWA 4DR6E 2FV4B 2LUPB 4AQYE 4JI8I 1ZM9A 1XMQI 1FJGE 1ZM4A 3CWVA 1ELOA 5LMUI 5IT9C 4JYAE 3QT8A 3B78A 4B3TE 2DB2A 4LF9E 2E1RA 4DPTA 4LFBE 5AE2A 3ADGA 2L3JA 2NUGA 4R03A 1RQ0A 2CPNA 4DR2E 3T1YE 1H73A 1Y6ZA 4WYQB 2A2CA 2FTXB 2RS7A 4JI3E 1ZXMA 3Q6MA 1HNWE 3V5RA 4I3HA 1Z0EA 3DJWA 2EZ6A 2VF3A 2UUCI 4B3SE 4JI6E 2L33A 4USMA 4UT4A 4DUZI 2VQFI 2NPFA 4DV2I 2WW4A 4Q28A 2L92A 4FWDA 2PNMA 1J26A 4RPFA 1HR0E 2PNLA 4DMIA 4BMJA 1ZM2A 4IZJB 4KZSA 1H74A 4YY3E 2HKJA 3ZZUA 5BR8I 2JR1A 3F6GA 4LF5E 3HTXA 4DV7I 1RREA 1XNRE 4GKJE 4NXNE 4P7AA 3HXLA 2DEJA 4KQVA 4JI8E 2RS6A 1XMQE 2HFSA 3HJCA 5LMUE 1HK7A 4LU9A 3B82A 2CZ9A 3V2UC 2V85A 1IBMI 3IWCA 2M7QA 4JI5I 5GMEA 1KTVA 2VQEI 2UU9I 1S4EA 3K1JA 2HKEA 4JV5I 2AJ4A 4IZJA 2L2NA 1ZBQA 1FWKA 1MX0A 2OI2A 4X64I 4BCAA 4DV5I 1NHJA 1X49A 1U2RA 3AUZA 3H4LA 1XMOI 2UUCE 5IT9Q 1STUA 4Z7YA 4UTGA 2VQFE 2YT4A 2MDRA 2L2KB 2JWOA 4WUBA 1DARA 3K17A 1USVA 5BR8E 2HK2A 4F9AB 4FN5A 4DV7E 3PYDA 1PKPA 2DEIA 2HHHI 2O1VA 4P52A 4PRVA 2GS8A 2ODRD 4B3TI 2O1UA 4R8OA 4LFBI 3C4TA 1H72C 2A2DA 4HY1A 1FWLA 2NUFA 3Q1QA 1FI4A 1IBME 4DR2I 3T1YI 4TUIA 4WPYA 2V86A 3QT6A 1QZRA 4JI5E 2VQEE 2UU9E 2RSMA 3J7Yp 4JV5E 4JI6I 4R1FA 3HULA 2X7IA 2DIXA 1XNQI 2GQ0A 2KHXA 2MC5A 3T1HE 3QT7A 4B3RI 4X64E 1YYOA 1UHZA 2Z5CB 4K0KI 4YY3I 4X66I 1GQEA 3F6HA 2LTSA 1UILA 2N3HA 4M2ZA 3ADIA 1Z0GA 4JI1I 3C4BA 1QU6A 2IOPA 4LFAI 1HNXI 1FNMA 2M1SA 1OJ4A 2HHHE 3FIGA 4ED4A 4LTYA 5GMDA 4HYMA 3D4JA 4ZVIA 2LJPA 4F9CB 4FW9A 2ODRC 1DI2A 1N34E 2Z5CA 1RR9A 1IBKE 2UUAI 4DKKA 3LLHA 4DU8A 4GKKI 1XNQE 3J7AG 5AE3A 4B3RE 1WHNA 2N3GA 4LF7I 4X8WA 2FGGA 4K0KE 2B7TA 4X66E 1Z0WA 5FLXC 2UUBE 1O0WA 3AV0A 3PYFA 4X62E 4JI1E 1KIJA 2Q2EB 3ADLA 3LPSA 2LE2A 2KONA 2LJHA 4LFAE 1HNZI 4DPUA 1HNXE 4LF4I 3ZM7A 4DU7A 5LL6R 2HK3A 3LNUA 2RTXA 3OTOI 2V34A 1WUUA 3B8HA 3VYXA 3T1HI 2XEXA 3MSWA 2UUAE 4B3MI 4DUYI 1T4OA 5T6JA 2JY9A 1ZM3A 4M1KA 4BS9A 3K85A 4GKKE 4KHPI 4MYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPX A;  3PYE A;  3LTO A;  1H7U A;  4LF7 E;  1Z0V A;  4WUC A;  2BV3 A;  3QT5 A;  1Z5A A;  1EI1 A;  1I94 I;  4HAC B;  5LMN I;  2ZM6 I;  1FKA E;  4USK A;  4HXZ A;  1YZ9 A;  1HNZ E;  4LF4 E;  1N34 I;  1X48 A;  2LRS A;  1Z0B A;  2V2Q A;  1IBK I;  3VYY A;  1IBL E;  4FWG A;  3F0N A;  4DXL A;  1EA6 A;  1KVK A;  5CFF E;  2V8P A;  5FLX Q;  3OTO E;  1N33 I;  4JI4 I;  2B7V A;  1B62 A;  4B3M E;  4OOG C;  4DUY E;  4HAC A;  1NHI A;  4DV4 I;  1B63 A;  2UUB I;  4KHP E;  1PIE A;  3ZZT A;  4X62 I;  4PRX A;  4JI2 I;  1N36 I;  4JG4 A;  3J80 C;  5A2Q C;  1BKN A;  2HFU A;  4JI7 E;  1I94 E;  1YYK A;  5LMN E;  2LTR A;  1Z0T A;  2ZM6 E;  4DPY A;  2JVA A;  1K47 A;  1D6T A;  1MU5 A;  3WU4 A;  4NXM I;  4JI0 I;  2V2V A;  1YYW A;  4Z7C A;  1J5E I;  3M6A A;  4WUD A;  3GON A;  4EMD A;  4DR3 I;  3JAM C;  1N33 E;  4JI4 E;  4DR7 I;  1T4N A;  2L3C A;  2ZIT A;  4DR5 I;  4DV4 E;  4PU9 A;  1N32 I;  4XTJ A;  4YHH I;  1A6F A;  2NA2 A;  4DV3 I;  4JI2 E;  1N36 E;  1T4L B;  1N0U A;  2X36 A;  4FWH A;  4DR4 I;  3J7A M;  1ZBT A;  3PYG A;  4WFT A;  2UXD I;  4LF8 I;  1X47 A;  1IBL I;  1PVG A;  3ZZ0 A;  2UXB I;  1Z5B A;  4DV1 I;  3J81 C;  4DV0 E;  2UXC I;  3WU3 A;  4X65 I;  4NXM E;  2BM0 A;  4JI0 E;  4LFC I;  1MG7 A;  5IWA I;  2EFG A;  1S16 A;  1J5E E;  3J80 Q;  5A2Q Q;  4DR3 E;  1H7S A;  2E5L I;  2F4V I;  2LBS B;  1EKZ A;  4DR7 E;  2ZBK B;  2V2Z A;  4DR5 E;  1N32 E;  2B3T B;  4JI7 I;  1Z0C A;  1VIS A;  4YHH E;  4DV6 I;  1N0V C;  4OX9 I;  4DV3 E;  1KKH A;  1NHH A;  4DR1 I;  4DUZ E;  4DR4 E;  3JAM Q;  4DV2 E;  4LF6 I;  4DR6 I;  4AQY I;  2UXD E;  3ZKD A;  4LF8 E;  1FJG I;  2NUE A;  2UXB E;  5L3J A;  4DV1 E;  2IHR 1;  4JYA I;  2J7K A;  2L2M A;  2UXC E;  1Z5C A;  1RC7 A;  3WU5 A;  4X65 E;  5IWA E;  4LFC E;  3P1X A;  4LF9 I;  3ADJ A;  1ZXN A;  1NZ0 A;  2DMY A;  3ZKB A;  2E5L E;  2F4V E;  1Z59 A;  4URL A;  4JI3 I;  1HNW I;  1UEK A;  2R42 A;  1XHK A;  4M30 A;  4B3S I;  3J81 Q;  4MYT A;  2LUQ A;  4DV6 E;  1HR0 I;  2BM1 A;  4DV5 E;  1XMO E;  4OX9 E;  3WU6 A;  2R3V A;  4LF5 I;  4DR1 E;  4DV0 I;  1WHQ A;  1XNR I;  4GKJ I;  4NXN I;  4LF6 E;  4DPW A;  4DR6 E;  2LUP B;  4AQY E;  4JI8 I;  1ZM9 A;  1XMQ I;  1FJG E;  3CWV A;  1ZM4 A;  1ELO A;  5LMU I;  5IT9 C;  4JYA E;  3QT8 A;  3B78 A;  4B3T E;  2DB2 A;  4LF9 E;  2E1R A;  4DPT A;  4LFB E;  3ADG A;  2L3J A;  2NUG A;  1RQ0 A;  2CPN A;  4DR2 E;  3T1Y E;  1H73 A;  4WYQ B;  2A2C A;  2RS7 A;  4JI3 E;  3V5R A;  1ZXM A;  1HNW E;  4I3H A;  1Z0E A;  2EZ6 A;  2VF3 A;  2UUC I;  4B3S E;  4JI6 E;  2L33 A;  4USM A;  4UT4 A;  4DUZ I;  2VQF I;  2NPF A;  4DV2 I;  2WW4 A;  4FWD A;  1J26 A;  4RPF A;  1HR0 E;  1ZM2 A;  1H74 A;  4YY3 E;  2HKJ A;  3ZZU A;  5BR8 I;  3HTX A;  4LF5 E;  4DV7 I;  1RRE A;  1XNR E;  4GKJ E;  4NXN E;  4P7A A;  2DEJ A;  4KQV A;  4JI8 E;  2RS6 A;  1XMQ E;  2HFS A;  5LMU E;  3B82 A;  2CZ9 A;  3V2U C;  1IBM I;  4JI5 I;  5GME A;  1KTV A;  2VQE I;  2UU9 I;  1S4E A;  3K1J A;  2HKE A;  4JV5 I;  2AJ4 A;  2L2N A;  1FWK A;  1MX0 A;  2OI2 A;  4X64 I;  4DV5 I;  1NHJ A;  1X49 A;  1U2R A;  3H4L A;  1XMO I;  2UUC E;  5IT9 Q;  1STU A;  4Z7Y A;  4UTG A;  2VQF E;  2YT4 A;  2MDR A;  2L2K B;  4WUB A;  1DAR A;  3K17 A;  5BR8 E;  2HK2 A;  4FN5 A;  4DV7 E;  3PYD A;  1PKP A;  2DEI A;  2HHH I;  4P52 A;  4PRV A;  2GS8 A;  4B3T I;  4LFB I;  3C4T A;  1H72 C;  2A2D A;  4HY1 A;  2NUF A;  1FWL A;  3Q1Q A;  1FI4 A;  1IBM E;  4DR2 I;  3T1Y I;  3QT6 A;  1QZR A;  4JI5 E;  2VQE E;  2UU9 E;  2RSM A;  3J7Y p;  4JV5 E;  4JI6 I;  4R1F A;  3HUL A;  2X7I A;  2DIX A;  1XNQ I;  2KHX A;  3T1H E;  3QT7 A;  4B3R I;  4X64 E;  1YYO A;  1UHZ A;  4K0K I;  4YY3 I;  4X66 I;  1GQE A;  2LTS A;  1UIL A;  2N3H A;  4M2Z A;  3ADI A;  1Z0G A;  4JI1 I;  3C4B A;  1QU6 A;  4LFA I;  1HNX I;  1FNM A;  1OJ4 A;  2HHH E;  4ED4 A;  5GMD A;  4HYM A;  3D4J A;  4ZVI A;  2LJP A;  4FW9 A;  1DI2 A;  1N34 E;  1RR9 A;  1IBK E;  2UUA I;  4DKK A;  3LLH A;  4DU8 A;  4GKK I;  1XNQ E;  3J7A G;  4B3R E;  1WHN A;  2N3G A;  4LF7 I;  4X8W A;  4K0K E;  2B7T A;  4X66 E;  1Z0W A;  5FLX C;  2UUB E;  1O0W A;  3PYF A;  4X62 E;  4JI1 E;  1KIJ A;  2Q2E B;  3ADL A;  3LPS A;  2LJH A;  4LFA E;  1HNZ I;  4DPU A;  1HNX E;  4LF4 I;  3ZM7 A;  4DU7 A;  5LL6 R;  2HK3 A;  3LNU A;  2RTX A;  3OTO I;  2V34 A;  1WUU A;  3B8H A;  3VYX A;  3T1H I;  2XEX A;  2UUA E;  4B3M I;  4DUY I;  1T4O A;  2JY9 A;  1ZM3 A;  4M1K A;  4GKK E;  4KHP I;  4MYU A; 
#chains in the Genus database with same CATH topology
 4DPX A;  1G2F C;  3PYE A;  5JEA D;  5KL6 A;  3LTO A;  2EN3 A;  2EM6 A;  2V87 A;  1H7U A;  2WNR A;  4LF7 E;  1X6H A;  1Z0V A;  2JPA A;  4F9B B;  4WUC A;  3ZOQ B;  2BV3 A;  3GLL A;  3P3E A;  3QT5 A;  2EM0 A;  1Z5A A;  1EI1 A;  1I94 I;  4HAC B;  2BB8 A;  2EPP A;  1KYQ A;  2EOY A;  2L8T A;  5LMN I;  2ZM6 I;  1FKA E;  2RPC A;  4USK A;  2O1T A;  1Y4S A;  4HXZ A;  1YZ9 A;  2EMF A;  2YZT A;  1HNZ E;  4LF4 E;  1N34 I;  1A1K A;  2EMW A;  4P7D A;  4IFD B;  1X48 A;  1AH5 A;  2LRS A;  5KL5 A;  1Z0B A;  2LJU A;  4R2D A;  2V2Q A;  1IBK I;  2EPO A;  2CGE A;  3VYY A;  1IBL E;  4FWG A;  2PO1 A;  3F0N A;  4DXL A;  1EA6 A;  1KVK A;  1YH8 A;  2ELY A;  2EOF A;  2YTN A;  4R2C A;  1OYS A;  5CFF E;  2BA0 G;  2F1D A;  2NN6 B;  2V8P A;  5FLX Q;  3OTO E;  5F3W A;  1N33 I;  1USU A;  4JI4 I;  2CVE A;  2B7V A;  2Z5E A;  2HJJ A;  1B62 A;  1SR9 A;  1IQO A;  2CG9 A;  4B3M E;  4OOG C;  4R2S A;  3M99 B;  2YRH A;  4DUY E;  4HAC A;  1NHI A;  4DV4 I;  4IZJ D;  1N3G A;  5K36 D;  2VE7 C;  1B63 A;  2UUB I;  3P06 A;  4KHP E;  1PIE A;  1UDQ A;  2LMZ A;  5LLQ A;  3ZZT A;  4X62 I;  2C37 B;  2LT7 A;  2BA0 D;  4PRX A;  4IFD A;  4JI2 I;  4IFD E;  1N36 I;  2Z5B B;  4ZYG A;  1WXR A;  2DLQ A;  3J80 C;  4JG4 A;  2EM8 A;  3P76 A;  2LVH A;  4FK5 C;  5A2Q C;  5AAS A;  3P3C A;  3OML A;  1A1L A;  1LLM C;  1BKN A;  2EM9 A;  4F2J C;  4JI7 E;  2HFU A;  4OO1 A;  1I94 E;  1YYK A;  4MYU A;  2NN6 A;  2NN6 E;  2LTR A;  5LMN E;  1Z0T A;  5A69 A;  2ZM6 E;  2YTE A;  2EPZ A;  4LPF A;  2YU5 A;  3KZY A;  4TUG A;  4DPY A;  2EOZ A;  2E1M A;  2JVA A;  2VF1 A;  1K47 A;  1MU5 A;  5JEA B;  1D6T A;  4RHB B;  1JK1 A;  3WU4 A;  4NXM I;  2JYA A;  4JI0 I;  4OZE A;  2EL5 A;  2V2V A;  1F2I G;  1YUJ A;  1YYW A;  4IZK B;  2EQ3 A;  2PO0 B;  4Z7C A;  1J5E I;  3M6A A;  4WUD A;  2H36 X;  2C37 A;  3GON A;  4N3O A;  3DF6 A;  4EMD A;  2M4I A;  2EJ4 A;  2V8Q B;  2YTO A;  3JAM C;  1Y60 A;  1Y5Y A;  1T38 A;  2Z5B A;  4DR3 I;  1PJQ A;  2YTP A;  1N33 E;  4JI4 E;  3PS1 A;  4DR7 I;  1T4N A;  5IV8 B;  3JU0 A;  1IMU A;  2L3C A;  2ZIT A;  3M7N G;  5ELW A;  4DR5 I;  4WSP A;  4DV4 E;  4O4K A;  1PJT A;  1TF3 A;  2EM5 A;  4ZYH A;  2L6M A;  4PU9 A;  4BA1 B;  1N32 I;  4XTJ A;  4BBY A;  2J65 A;  1RMD A;  4YHH I;  2PRT A;  1A6F A;  3EPH A;  5JEA E;  2NA2 A;  4I8O A;  4WXD A;  4DV3 I;  2YWQ A;  4JI2 E;  1N36 E;  1BBG A;  4P78 A;  3JTZ A;  1T4L B;  1N0U A;  2X36 A;  4IZK A;  4R2A A;  4FWH A;  2PO0 A;  2EMX A;  4DR4 I;  1IQS A;  2NAB A;  3J7A M;  3M7N D;  1ZBT A;  3EPK A;  2EWL A;  3PYG A;  4WFT A;  2IOQ A;  4J8Z A;  3C6M A;  2O1W A;  2UXD I;  4LF8 I;  1A1F A;  2EN6 A;  2HC5 A;  1X47 A;  2V83 A;  1IBL I;  2EPK X;  1PVG A;  3ZZ0 A;  2UXB I;  4L8N A;  1Z5B A;  4DV1 I;  3RMP A;  2DLK A;  1VI7 A;  3J81 C;  1SFE A;  2V89 A;  4KWY A;  4DV0 E;  4BC7 A;  1Y4U A;  3PRY A;  4MQY A;  2VRD A;  4MU3 A;  2EPX A;  2UXC I;  2DRP A;  5AE1 A;  2EMA A;  3WU3 A;  4X65 I;  2EPM X;  4NXM E;  2JOX A;  1XXE A;  2BM0 A;  4JI0 E;  4LFC I;  2EMK A;  4M0V A;  1MG7 A;  2EFG A;  1S16 A;  4BA1 A;  5IWA I;  2GO3 A;  3HPS A;  1GTK A;  4R2R A;  2MC6 A;  2NN6 F;  2EOM A;  2DSY A;  1J5E E;  1A1G A;  3J80 Q;  1DQ3 A;  5A2Q Q;  5C0X C;  4U3D A;  4DR3 E;  1H7S A;  2E5L I;  2F4V I;  1PJS A;  2KOU A;  2LBS B;  1EKZ A;  2HGH A;  4DR7 E;  3PS3 A;  2CSH A;  2ZBK B;  2O3Z A;  2EOO A;  4DR5 E;  3ECR A;  1BBO A;  2V2Z A;  5ADZ A;  3M85 G;  4ZYD A;  2EM2 A;  2EN2 A;  3L00 A;  2EP3 A;  2WBU A;  2B3T B;  1N32 E;  4IS9 A;  2EQ0 A;  3MHH C;  3VK6 A;  1Z0C A;  4JI7 I;  1G2D C;  2MKN A;  4YHH E;  1VIS A;  5FWK A;  4DV6 I;  1TN9 A;  5KL3 A;  2AE8 A;  2EPR A;  1N0V C;  4OX9 I;  2YRM A;  4DV3 E;  3TQM A;  1KKH A;  1NHH A;  2EN7 A;  1X6F A;  1OYR A;  4DR1 I;  4DUZ E;  4NBQ A;  2V88 A;  3H09 A;  1YSA C;  4DR4 E;  3B4T A;  3JAM Q;  3HPZ A;  2MDG A;  4DV2 E;  3M85 D;  4LF6 I;  4DR6 I;  3HQ1 A;  2F8B A;  3H1C A;  4LCH A;  4AQY I;  3BBG A;  2UXD E;  4FW7 A;  3ZKD A;  2WZO A;  4LF8 E;  2JEA B;  3KWR A;  4IFD C;  1FJG I;  4BC9 A;  2NUE A;  2UXB E;  5L3J A;  5JEA F;  4DV1 E;  2EMB A;  1QNT A;  1ZU1 A;  2IHR 1;  1B69 A;  1UDO A;  4AM3 A;  4JYA I;  2J7K A;  2L2M A;  3NZK A;  2EOQ A;  2UXC E;  1RC7 A;  1Z5C A;  3K6Q A;  5DNY A;  2EOI A;  3CDJ A;  3WU5 A;  4X65 E;  2CT1 A;  5IWA E;  4LFC E;  4LCF A;  4OO1 C;  3P1X A;  4LF9 I;  2K4V A;  3ADJ A;  5AC4 A;  1ZXN A;  5KL7 A;  3U1Y A;  5KL4 A;  4GEQ B;  4WXC A;  1NZ0 A;  2DMY A;  3ZKB A;  2E5L E;  2F4V E;  4R2E A;  3THO B;  4L5N C;  1Z59 A;  4F54 A;  4URL A;  4JI3 I;  2JEB B;  1HNW I;  2JOB A;  1UEK A;  3LML A;  2R42 A;  3IWD A;  4FW3 A;  2A25 A;  1XHK A;  4M30 A;  4B3S I;  3J81 Q;  1EH7 A;  2JEA A;  2EPL X;  2JE6 B;  3IWB A;  2GO4 A;  4MYT A;  2LUQ A;  1R6L A;  3Q6N A;  4NZV A;  2EMZ A;  4DV6 E;  2B9D A;  4DV5 E;  3EPJ A;  4F6M A;  1P47 A;  2BM1 A;  1HR0 I;  1XMO E;  1E3H A;  4OX9 E;  5DNL A;  4BHB A;  2G7H A;  3WU6 A;  1GZ6 A;  2R3V A;  4LF5 I;  4DR1 E;  4DV0 I;  1WHQ A;  3BID A;  1XNR I;  2BBG A;  4GKJ I;  4NXN I;  2DMI A;  4LF6 E;  5K36 F;  4DPW A;  4DR6 E;  2FV4 B;  2LUP B;  4AQY E;  4JI8 I;  1ZM9 A;  2R1F A;  4J3D A;  1XMQ I;  2PO2 B;  1FJG E;  5C0X D;  5A6B A;  1ZM4 A;  1ELO A;  3CWV A;  2JEB A;  5IT9 C;  2GPI A;  5LMU I;  3BGH A;  4JYA E;  3QT8 A;  4U3B A;  2LO3 A;  2I9I A;  2EOE A;  3B78 A;  2WBT A;  2JE6 A;  2EM7 A;  2BR2 B;  4B3T E;  2DB2 A;  3GME A;  4LF9 E;  2E1R A;  2EML A;  4DPT A;  3UHM A;  4BA2 B;  4LFB E;  5AE2 A;  3ADG A;  2L3J A;  3KRN A;  4AID A;  2LCE A;  4R03 A;  1RQ0 A;  5TSE A;  4R2Q A;  2CPN A;  4F6N A;  2NUG A;  2EN1 A;  2VES A;  2RSI A;  4DR2 E;  3T1Y E;  1H73 A;  5A6A A;  4WYQ B;  2J7J A;  1Y6Z A;  2A2C A;  2FTX B;  2RS7 A;  4JI3 E;  1ZXM A;  2WP8 B;  1HNW E;  3Q6M A;  4I3H A;  1Z0E A;  3DJW A;  3V5R A;  5JEA A;  2EZ6 A;  2VF3 A;  4MDT A;  5A6K A;  2UUC I;  4B3S E;  4JI6 E;  4WSG A;  2EPC A;  2L33 A;  2PO2 A;  4USM A;  4UT4 A;  2VQF I;  4DUZ I;  1UN6 B;  3DD6 A;  2NPF A;  4DV2 I;  2WCC 3;  2WW4 A;  4Q28 A;  2L92 A;  4FWD A;  2EM4 A;  4IFD D;  2PNM A;  1J26 A;  4RPF A;  1HR0 E;  2PNL A;  2YTG A;  4DMI A;  4BMJ A;  1ZM2 A;  4IZJ B;  5DNX A;  1L4S A;  1A1J A;  4KZS A;  1H74 A;  5K36 B;  4YY3 E;  2HKJ A;  2GHF A;  3ZZU A;  2PNZ B;  2BR2 A;  5BR8 I;  2JR1 A;  3F6G A;  4LF5 E;  3HTX A;  4DV7 I;  1RRE A;  3C6K A;  3GCM A;  1XNR E;  4GKJ E;  4NXN E;  4P7A A;  3HXL A;  4OO1 D;  2LV2 A;  1YUI A;  1YFH A;  2NN6 D;  2DEJ A;  2ADR A;  4JI8 E;  4KQV A;  2RS6 A;  2N8X A;  2YSP A;  1XMQ E;  1YHC A;  3EQ1 A;  1E3P A;  2HFS A;  3HJC A;  5LMU E;  1HK7 A;  4LU9 A;  3B82 A;  2CZ9 A;  2EMH A;  4O5G A;  3V2U C;  2V85 A;  2EOR A;  2WNR B;  1IBM I;  1RHY A;  2YU8 A;  3IWC A;  2E72 A;  2M7Q A;  5AC5 A;  4GZN C;  3CDI A;  4JI5 I;  4FW5 A;  5GME A;  1KTV A;  2VQE I;  2YTQ A;  2EOS A;  2EPN A;  1S4E A;  2UU9 I;  2EN8 A;  3K1J A;  2HKE A;  4JV5 I;  2AJ4 A;  4IZJ A;  2L2N A;  1ZBQ A;  3L7Z B;  5K36 A;  5K36 E;  1NEI A;  2PNZ A;  4N4R B;  2EMY A;  1FWK A;  1MX0 A;  2OI2 A;  3UK3 C;  5C0X B;  4X64 I;  4BCA A;  4DV5 I;  4MLV A;  1X49 A;  1NHJ A;  1U2R A;  3AUZ A;  4O43 A;  3H4L A;  3HKM A;  1XMO I;  5EKW A;  2UUC E;  5IT9 Q;  1STU A;  2EOH A;  4Z7Y A;  4UTG A;  4QNJ A;  1KJK A;  2VQF E;  2YT4 A;  2MDR A;  2L2K B;  2JWO A;  1MGT A;  5DRR A;  3EPL A;  4WUB A;  1DAR A;  5EL9 A;  3K17 A;  2R76 A;  1USV A;  5BR8 E;  1YPN A;  2HK2 A;  4F9A B;  4FN5 A;  4DV7 E;  3PYD A;  1PKP A;  2DEI A;  1UBD C;  2HHH I;  5KL2 A;  1MEY C;  1NCS A;  2I13 A;  2YTI A;  2O1V A;  4P52 A;  4PRV A;  2GS8 A;  2GLI A;  3L7Z A;  2ODR D;  4B3T I;  2O1U A;  4R8O A;  2NN6 C;  1PDA A;  2CTD A;  4LFB I;  5C0X A;  2C38 B;  3C4T A;  1H72 C;  5C0X E;  2A2D A;  4HY1 A;  5DRP A;  2NUF A;  1FWL A;  1WJP A;  3Q1Q A;  1FI4 A;  1IBM E;  4DR2 I;  3T1Y I;  4TUI A;  4WPY A;  2V86 A;  3QT6 A;  2C39 B;  4MU0 A;  1QZR A;  4JI5 E;  2VQE E;  2UU9 E;  2RSM A;  1TF6 A;  1OYP A;  3J7Y p;  4Q35 B;  4M9V C;  4JV5 E;  4JI6 I;  4R1F A;  4OO1 B;  3HUL A;  1X5W A;  2X7I A;  2DIX A;  2ENA A;  1XNQ I;  2GQ0 A;  2KHX A;  2MC5 A;  3T1H E;  1ZR9 A;  3QT7 A;  4B3R I;  1ZAA C;  4X64 E;  1YYO A;  4OKG A;  1UHZ A;  4X9J A;  2Z5C B;  2EE8 A;  5IXM B;  4K0K I;  4YY3 I;  2EL6 A;  2EOX A;  4R2P A;  4X66 I;  5DRO A;  1GQE A;  1X3C A;  2D9H A;  2YSO A;  3F6H A;  2LTS A;  1EH6 A;  1UIL A;  2C38 A;  4RH8 A;  2N3H A;  2K7I A;  2EPA A;  4M2Z A;  3ADI A;  1Z0G A;  3PS2 A;  4JI1 I;  4HTG A;  5JEA C;  3C4B A;  2IES A;  1QU6 A;  2YRK A;  2EPU A;  2IOP A;  2C39 A;  4LFA I;  1HNX I;  2WBS A;  4FW4 A;  1FNM A;  2M1S A;  2EQ1 A;  1OJ4 A;  2HHH E;  3FIG A;  4ED4 A;  4OO1 E;  4LTY A;  2EN4 A;  2RQL A;  1DGC A;  5GMD A;  4HYM A;  3KZZ A;  3D4J A;  4ZVI A;  2LJP A;  4F9C B;  4FW9 A;  2ODR C;  1DI2 A;  2Q8U A;  4MU4 A;  1N34 E;  2Z5C A;  4GQU A;  4WX9 A;  3P3G A;  1AAY A;  1RR9 A;  3BF2 A;  1IBK E;  4MU1 A;  2UUA I;  4DKK A;  2ENC A;  2YTF A;  4NHR A;  2JT2 A;  4ZYE A;  1JK2 A;  3LLH A;  4DU8 A;  1EH8 A;  5C0X F;  4GKK I;  2EOJ A;  2BA1 G;  1Z1B A;  1XNQ E;  3J7A G;  4HEI A;  4ISA A;  2DGC A;  2JXP A;  5AE3 A;  4B3R E;  2YPN A;  1WHN A;  2N3G A;  4LF7 I;  4X8W A;  2FGG A;  4K0K E;  2B7T A;  4X66 E;  2EMG A;  2EMI A;  2IER A;  1BB8 A;  1Z0W A;  5FLX C;  4AIM A;  4BA2 A;  2UUB E;  1P42 A;  5A6J A;  1O0W A;  5K36 C;  3AV0 A;  3MHS C;  2YTJ A;  3PYF A;  4X62 E;  2MKD A;  3U1K A;  4O24 A;  4JI1 E;  1KIJ A;  1R6M A;  2Q2E B;  3ADL A;  2BA1 D;  3LPS A;  2LE2 A;  2KON A;  2LJH A;  4LFA E;  1HNZ I;  2WP8 A;  4DPU A;  1HNX E;  4LF4 I;  4IS1 C;  3ZM7 A;  5DRQ A;  5LL6 R;  4DU7 A;  2ELZ A;  1X6E A;  2HK3 A;  1UDN A;  3QG5 C;  5A6B D;  3LNU A;  4LOM A;  4LCG A;  4IFD F;  2RTX A;  3VHT B;  4FW6 A;  2JP9 A;  2ENH A;  4QNK A;  3OTO I;  2EM3 A;  2V34 A;  1WUU A;  3B8H A;  2M9A A;  3VYX A;  3T1H I;  2XEX A;  2EMC A;  4OO1 F;  3MSW A;  4MLQ A;  2UUA E;  3THN A;  4B3M I;  1WRJ A;  4DUY I;  1T4O A;  5T6J A;  2JY9 A;  1UDS A;  1A1I A;  1ZM3 A;  4M1K A;  4BS9 A;  3K85 A;  2YTD A;  1A1H A;  4BHC A;  2EL4 A;  4GKK E;  4IJD A;  4KHP I;  1T39 A;  2PO1 B; 
#chains in the Genus database with same CATH homology
 4DPX A;  3PYE A;  3LTO A;  2V87 A;  1H7U A;  4LF7 E;  1Z0V A;  4F9B B;  4WUC A;  3ZOQ B;  2BV3 A;  3QT5 A;  1Z5A A;  1EI1 A;  1I94 I;  4HAC B;  2L8T A;  5LMN I;  2ZM6 I;  1FKA E;  4USK A;  2O1T A;  1Y4S A;  4HXZ A;  1YZ9 A;  1HNZ E;  2YZT A;  4LF4 E;  1N34 I;  4P7D A;  1X48 A;  2LRS A;  1Z0B A;  2V2Q A;  1IBK I;  2CGE A;  3VYY A;  1IBL E;  4FWG A;  3F0N A;  4DXL A;  1EA6 A;  1KVK A;  5CFF E;  2V8P A;  5FLX Q;  3OTO E;  5F3W A;  1N33 I;  1USU A;  4JI4 I;  2B7V A;  2Z5E A;  1B62 A;  1SR9 A;  2CG9 A;  4B3M E;  4OOG C;  4DUY E;  4HAC A;  1NHI A;  4DV4 I;  4IZJ D;  2VE7 C;  1B63 A;  2UUB I;  3P06 A;  4KHP E;  1PIE A;  2LMZ A;  3ZZT A;  4X62 I;  4PRX A;  4JI2 I;  1N36 I;  2Z5B B;  1WXR A;  3J80 C;  4JG4 A;  5A2Q C;  5AAS A;  3OML A;  1BKN A;  2HFU A;  4JI7 E;  1I94 E;  1YYK A;  2LTR A;  5LMN E;  1Z0T A;  2ZM6 E;  4TUG A;  4DPY A;  2JVA A;  2E1M A;  2VF1 A;  1K47 A;  1D6T A;  1MU5 A;  3WU4 A;  4NXM I;  4JI0 I;  2V2V A;  4IZK B;  1YYW A;  4Z7C A;  1J5E I;  3M6A A;  4WUD A;  2H36 X;  4N3O A;  3GON A;  3DF6 A;  4EMD A;  2M4I A;  4DR3 I;  2V8Q B;  3JAM C;  2Z5B A;  1N33 E;  4JI4 E;  4DR7 I;  1T4N A;  3JU0 A;  2L3C A;  2ZIT A;  4DR5 I;  4WSP A;  4DV4 E;  2L6M A;  4PU9 A;  1N32 I;  4XTJ A;  4BBY A;  4YHH I;  1A6F A;  2NA2 A;  4I8O A;  4DV3 I;  4JI2 E;  1N36 E;  4P78 A;  3JTZ A;  1T4L B;  1N0U A;  2X36 A;  4IZK A;  4FWH A;  4DR4 I;  3J7A M;  1ZBT A;  2EWL A;  3PYG A;  4WFT A;  2IOQ A;  4J8Z A;  2O1W A;  2UXD I;  4LF8 I;  2V83 A;  1X47 A;  1IBL I;  1PVG A;  3ZZ0 A;  2UXB I;  4L8N A;  1Z5B A;  4DV1 I;  3RMP A;  3J81 C;  2V89 A;  4DV0 E;  4BC7 A;  1Y4U A;  3PRY A;  2UXC I;  5AE1 A;  3WU3 A;  4X65 I;  4NXM E;  2JOX A;  2BM0 A;  4JI0 E;  4LFC I;  4M0V A;  1MG7 A;  2EFG A;  5IWA I;  1S16 A;  3HPS A;  2MC6 A;  2DSY A;  1J5E E;  3J80 Q;  1DQ3 A;  5A2Q Q;  4DR3 E;  1H7S A;  2E5L I;  2F4V I;  2KOU A;  2LBS B;  1EKZ A;  4DR7 E;  2ZBK B;  2V2Z A;  4DR5 E;  5ADZ A;  1N32 E;  2B3T B;  3VK6 A;  1Z0C A;  4JI7 I;  1VIS A;  4YHH E;  5FWK A;  4DV6 I;  1N0V C;  4OX9 I;  4DV3 E;  1KKH A;  1NHH A;  4DR1 I;  4DUZ E;  2V88 A;  3H09 A;  4DR4 E;  3JAM Q;  3HPZ A;  4DV2 E;  4LF6 I;  4DR6 I;  3HQ1 A;  2F8B A;  4AQY I;  2UXD E;  3ZKD A;  2WZO A;  4LF8 E;  3KWR A;  1FJG I;  4BC9 A;  2NUE A;  2UXB E;  5L3J A;  4DV1 E;  2IHR 1;  4JYA I;  2J7K A;  2L2M A;  2UXC E;  1Z5C A;  1RC7 A;  3K6Q A;  5DNY A;  3WU5 A;  4X65 E;  5IWA E;  4LFC E;  3P1X A;  4LF9 I;  2K4V A;  3ADJ A;  1ZXN A;  4GEQ B;  1NZ0 A;  2DMY A;  3ZKB A;  2E5L E;  2F4V E;  4L5N C;  1Z59 A;  4F54 A;  4URL A;  4JI3 I;  1HNW I;  2JOB A;  1UEK A;  3LML A;  2R42 A;  3IWD A;  1XHK A;  4M30 A;  4B3S I;  3J81 Q;  3IWB A;  4MYT A;  2LUQ A;  3Q6N A;  4DV6 E;  1HR0 I;  2B9D A;  4DV5 E;  2BM1 A;  1XMO E;  4OX9 E;  2G7H A;  3WU6 A;  1GZ6 A;  2R3V A;  4LF5 I;  4DR1 E;  4DV0 I;  1WHQ A;  1XNR I;  4GKJ I;  4NXN I;  4LF6 E;  4DPW A;  4DR6 E;  2FV4 B;  2LUP B;  4AQY E;  4JI8 I;  1ZM9 A;  1XMQ I;  1FJG E;  1ZM4 A;  3CWV A;  1ELO A;  5LMU I;  5IT9 C;  4JYA E;  3QT8 A;  3B78 A;  4B3T E;  2DB2 A;  4LF9 E;  2E1R A;  4DPT A;  4LFB E;  5AE2 A;  3ADG A;  2L3J A;  2NUG A;  4R03 A;  1RQ0 A;  2CPN A;  4DR2 E;  3T1Y E;  1H73 A;  1Y6Z A;  4WYQ B;  2A2C A;  2FTX B;  2RS7 A;  4JI3 E;  1ZXM A;  3Q6M A;  1HNW E;  3V5R A;  4I3H A;  1Z0E A;  3DJW A;  2EZ6 A;  2VF3 A;  2UUC I;  4B3S E;  4JI6 E;  2L33 A;  4USM A;  4UT4 A;  4DUZ I;  2VQF I;  2NPF A;  4DV2 I;  2WW4 A;  4Q28 A;  2L92 A;  4FWD A;  2PNM A;  1J26 A;  4RPF A;  1HR0 E;  2PNL A;  4DMI A;  4BMJ A;  1ZM2 A;  4IZJ B;  4KZS A;  1H74 A;  4YY3 E;  2HKJ A;  3ZZU A;  5BR8 I;  2JR1 A;  3F6G A;  4LF5 E;  3HTX A;  4DV7 I;  1RRE A;  1XNR E;  4GKJ E;  4NXN E;  4P7A A;  3HXL A;  2DEJ A;  4KQV A;  4JI8 E;  2RS6 A;  1XMQ E;  2HFS A;  3HJC A;  5LMU E;  1HK7 A;  4LU9 A;  3B82 A;  2CZ9 A;  3V2U C;  2V85 A;  1IBM I;  3IWC A;  2M7Q A;  4JI5 I;  5GME A;  1KTV A;  2VQE I;  2UU9 I;  1S4E A;  3K1J A;  2HKE A;  4JV5 I;  2AJ4 A;  4IZJ A;  2L2N A;  1ZBQ A;  1FWK A;  1MX0 A;  2OI2 A;  4X64 I;  4BCA A;  4DV5 I;  1NHJ A;  1X49 A;  1U2R A;  3AUZ A;  3H4L A;  1XMO I;  2UUC E;  5IT9 Q;  1STU A;  4Z7Y A;  4UTG A;  2VQF E;  2YT4 A;  2MDR A;  2L2K B;  2JWO A;  4WUB A;  1DAR A;  3K17 A;  1USV A;  5BR8 E;  2HK2 A;  4F9A B;  4FN5 A;  4DV7 E;  3PYD A;  1PKP A;  2DEI A;  2HHH I;  2O1V A;  4P52 A;  4PRV A;  2GS8 A;  2ODR D;  4B3T I;  2O1U A;  4R8O A;  4LFB I;  3C4T A;  1H72 C;  2A2D A;  4HY1 A;  1FWL A;  2NUF A;  3Q1Q A;  1FI4 A;  1IBM E;  4DR2 I;  3T1Y I;  4TUI A;  4WPY A;  2V86 A;  3QT6 A;  1QZR A;  4JI5 E;  2VQE E;  2UU9 E;  2RSM A;  3J7Y p;  4JV5 E;  4JI6 I;  4R1F A;  3HUL A;  2X7I A;  2DIX A;  1XNQ I;  2GQ0 A;  2KHX A;  2MC5 A;  3T1H E;  3QT7 A;  4B3R I;  4X64 E;  1YYO A;  1UHZ A;  2Z5C B;  4K0K I;  4YY3 I;  4X66 I;  1GQE A;  3F6H A;  2LTS A;  1UIL A;  2N3H A;  4M2Z A;  3ADI A;  1Z0G A;  4JI1 I;  3C4B A;  1QU6 A;  2IOP A;  4LFA I;  1HNX I;  1FNM A;  2M1S A;  1OJ4 A;  2HHH E;  3FIG A;  4ED4 A;  4LTY A;  5GMD A;  4HYM A;  3D4J A;  4ZVI A;  2LJP A;  4F9C B;  4FW9 A;  2ODR C;  1DI2 A;  1N34 E;  2Z5C A;  1RR9 A;  1IBK E;  2UUA I;  4DKK A;  3LLH A;  4DU8 A;  4GKK I;  1XNQ E;  3J7A G;  5AE3 A;  4B3R E;  1WHN A;  2N3G A;  4LF7 I;  4X8W A;  2FGG A;  4K0K E;  2B7T A;  4X66 E;  1Z0W A;  5FLX C;  2UUB E;  1O0W A;  3AV0 A;  3PYF A;  4X62 E;  4JI1 E;  1KIJ A;  2Q2E B;  3ADL A;  3LPS A;  2LE2 A;  2KON A;  2LJH A;  4LFA E;  1HNZ I;  4DPU A;  1HNX E;  4LF4 I;  3ZM7 A;  4DU7 A;  5LL6 R;  2HK3 A;  3LNU A;  2RTX A;  3OTO I;  2V34 A;  1WUU A;  3B8H A;  3VYX A;  3T1H I;  2XEX A;  3MSW A;  2UUA E;  4B3M I;  4DUY I;  1T4O A;  5T6J A;  2JY9 A;  1ZM3 A;  4M1K A;  4BS9 A;  3K85 A;  4GKK E;  4KHP I;  4MYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...