5BR8E

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5br8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8E02
3WU4A 2NUGA 2DEIA 4LF6E 4DR4E 2HKEA 4DR5E 4UTGA 2J7KA 4AQYI 4LF7I 1NHJA 1X47A 3T1HI 1MX0A 2CPNA 4FWHA 4DV3E 4WUCA 1GQEA 3QT6A 1N0UA 2X7IA 1EA6A 2LUPB 4DR6I 4FWDA 1UHZA 3C4TA 3T1HE 2OI2A 4LF8I 2UUCE 1Z0BA 4DV4I 3LLHA 4DV0I 4USKA 1QZRA 3K17A 3P1XA 2VF3A 2E5LE 1J5EI 1XHKA 4JI8I 1Z5AA 4MYUA 2ZITA 5GMEA 2L3CA 4DPTA 3QT8A 1YYKA 4DR6E 1KVKA 1H7SA 2NUEA 4RPFA 4LF8E 2LRSA 4DV0E 1D6TA 1H74A 4LF4I 1N36I 1ZM4A 1J5EE 1FNMA 1Z0TA 4DV2I 4B3SI 4Z7YA 4M2ZA 4JI2I 2L2KB 4K0KI 1N34I 4UT4A 3OTOI 4JI6I 2RTXA 1UEKA 5FLXQ 5L3JA 3LNUA 2DB2A 2LBSB 4EMDA 1RR9A 4DPYA 4USMA 4LF4E 2JVAA 1N36E 5LL6R 5LMUI 4R1FA 2NUFA 3K1JA 2ZM6I 4LFBE 1Z0WA 1HNWE 4DV2E 3ADGA 4X64I 4B3SE 1RREA 4JI2E 4K0KE 1N34E 2KHXA 4DV5E 3OTOE 4JI6E 1Z5CA 1EI1A 3B82A 1YYOA 3C4BA 4P7AA 4DUYE 4LFAI 4HXZA 2RS6A 3ADIA 3T1YI 1T4NA 2IHR1 2UXDI 4I3HA 2ZM6E 2BV3A 3ZKDA 1N0VC 2L33A 4HY1A 1YYWA 2HHHI 2V8PA 4X64E 4WYQB 1DARA 3HULA 1N32I 2LJPA 2YT4A 2V2VA 4JI7I 1I94I 1PKPA 2VQFE 4DR2I 1KKHA 3JAMC 4B3RI 1RC7A 4DKKA 2B7TA 4DU7A 4B3TI 4LFAE 3ADLA 3T1YE 1ZM2A 1OJ4A 5CFFE 2UXDE 1RQ0A 1EKZA 2L3JA 1Z0VA 1QU6A 2HHHE 4DXLA 2L2MA 1IBMI 2L2NA 3PYDA 1N32E 4HYMA 4DU8A 5IWAI 4NXME 1ZXNA 5A2QC 4JI7E 2CZ9A 3D4JA 5GMDA 1I94E 4DR2E 1PVGA 2NA2A 4OX9I 3GONA 4PRXA 2N3HA 4B3RE 1VISA 4B3TE 4GKKI 4X8WA 1HNZI 4URLA 4JI1I 4AQYE 1ZM9A 4LF7E 2UUBI 1IBME 3HTXA 4WFTA 1XNQI 5IWAE 2MDRA 4OX9E 1H73A 1ZXMA 2HFUA 1HNXI 2RS7A 1YZ9A 2UXCI 2VQEI 4GKKE 3WU6A 4ED4A 4KHPI 1HNZE 4JI1E 4MYTA 2UUBE 1KIJA 4X62I 4DV4E 1XNQE 4DV1I 4PRVA 3V5RA 1NZ0A 2A2CA 4JI8E 5A2QQ 4WUBA 4KQVA 1HNXE 3J80C 2UXCE 2VQEE 1FWKA 4KHPE 1FJGI 3M6AA 1IBLI 4DR3I 1FI4A 1ELOA 4DV1E 1HR0I 3ZZUA 3F0NA 2Q2EB 4Z7CA 4JI4I 1Z0GA 4M1KA 3WU3A 4FWGA 1H72C 3CWVA 4X65I 1H7UA 1FJGE 2X36A 1IBLE 1WUUA 4JYAI 4LF5I 4HACA 3J7AG 1HR0E 4ZVIA 4PU9A 1S16A 1O0WA 5LMUE 2LTRA 4DR1I 5BR8I 3V2UC 4JI4E 4DR7I 3B78A 2LJHA 4HACB 2BM1A 4X65E 1Z5BA 5LMNI 3H4LA 1XNRI 3J80Q 3J81C 4YHHI 4JYAE 4LF5E 3ZM7A 4JI5I 2ZBKB 4B3MI 1MU5A 3ZZTA 4DR1E 2N3GA 5BR8E 2HK3A 3ZZ0A 4DR7E 2R42A 4DV3I 4JI3I 3ZKBA 2AJ4A 1BKNA 2R3VA 4FN5A 1XNRE 4YHHE 4JI5E 4B3ME 2UUCI 4JI3E 2A2DA 1KTVA 3QT7A 5IT9C 3ADJA 1ZBTA 2E5LI 2UU9I 3J7AM 1B63A 1Z0EA 3Q1QA 5FLXC 2HFSA 3PYGA 2NPFA 1WHNA 2V2ZA 3J81Q 2E1RA 1XMOI 3JAMQ 1J26A 4M30A 4OOGC 2B3TB 2B7VA 1Z59A 4DPXA 2F4VI 2LTSA 3LTOA 2UU9E 3B8HA 4X66I 3WU5A 1PIEA 2WW4A 1WHQA 2UUAI 2DEJA 1XMOE 1NHIA 1DI2A 4DV7I 1UILA 4X62E 2HK2A 1NHHA 4NXNI 2UXBI 1N33I 2EFGA 4GKJI 2BM0A 2F4VE 4JI0I 1X49A 1A6FA 4LFCI 4JV5I 2RSMA 2XEXA 4LFBI 4X66E 2DIXA 1HNWI 3LPSA 2JY9A 2GS8A 4DPUA 1ZM3A 1Z0CA 5IT9Q 2UUAE 2HKJA 4DV5I 1IBKI 4LF9I 4DUZI 4JG4A 4DR3E 4DV7E 4NXNE 1T4OA 4DUYI 2UXBE 3PYFA 1N33E 2LUQA 4GKJE 2V34A 4JI0E 4XTJA 4LFCE 4JV5E 3PYEA 3J7Yp 1XMQI 1MG7A 1IBKE 4DV6I 4LF9E 4DUZE 4YY3I 2VQFI 1S4EA 1X48A 1FKAE 2EZ6A 2DMYA 4LF6I 1U2RA 4DR4I 2V2QA 3VYXA 1FWLA 4P52A 1T4LB 3VYYA 4DR5I 4WUDA 1XMQE 1K47A 1B62A 3QT5A 4NXMI 1STUA 4DV6E 4DPWA 4FW9A 4YY3E 5LMNE
chains in the Genus database with same CATH superfamily
3WU4A 3AUZA 2PO2B 2EOHA 2G7HA 2NUGA 2M4IA 5DRRA 3UK3C 2DEIA 1KYQA 3MHSC 4LF6E 4MU4A 4DR4E 4BC7A 2HKEA 5BR8I 1G2FC 2O1WA 2ELYA 2EPCA 2EORA 2EPMX 2JYAA 2M9AA 4P7DA 4DR5E 2EOJA 1YSAC 4UTGA 2J7KA 4R2DA 2BBGA 2CGEA 4AQYI 4LTYA 1NHJA 1X47A 2LVHA 1MX0A 3T1HI 4LF7I 2CPNA 4HTGA 1XXEA 2YSOA 4FWHA 4DV3E 2EWLA 4OO1F 4WUCA 4IFDD 1F2IG 1Y4SA 2Z5EA 2YWQA 2B9DA 4BA2A 1GQEA 4WX9A 4NHRA 2V83A 3QT6A 2HC5A 1N0UA 1A1GA 4F2JC 2EMCA 2X7IA 1EA6A 3B4TA 2JEAA 2LUPB 1A1IA 4M0VA 2EOYA 5KL6A 4FWDA 4DR6I 2EM8A 4IZKB 5JEAE 4BA2B 1UHZA 4OO1C 3C4TA 4Q35B 3U1KA 2I9IA 5KL5A 3T1HE 2OI2A 2UUCE 4LF8I 1Z0BA 2M7QA 4DV4I 1KJKA 5ELWA 3LLHA 4N3OA 2JEAB 4DV0I 4R2AA 4USKA 1QZRA 3K17A 4ZYGA 1GZ6A 3P1XA 2VF3A 2O1UA 3EPHA 2E5LE 1J5EI 2BA0G 2YTDA 1XHKA 4DR1I 3C6MA 4BCAA 4JI8I 1Z5AA 4MYUA 2ZITA 5GMEA 2L3CA 4OO1B 4DPTA 4WPYA 2YTFA 3QT8A 1YYKA 4DR6E 1KVKA 2PO1A 1H7SA 2NUEA 5KL4A 2ADRA 4LCFA 4F54A 2JT2A 4RPFA 4AIMA 4LF8E 5AE3A 1YH8A 2IERA 5C0XA 2LRSA 3P3GA 1X3CA 2EJ4A 2WBSA 1RHYA 4DV0E 1D6TA 1H74A 2PO1B 5EL9A 4LF4I 2EL6A 1N36I 2Q8UA 1ZM4A 1J5EE 4WXDA 4OO1D 1FNMA 5C0XB 1Z0TA 5DRQA 4DV2I 2LT7A 1UN6B 4Z7YA 4B3SI 4M2ZA 4JI2I 5TSEA 2L2KB 1WJPA 3BF2A 1N34I 2FV4B 2EM5A 4K0KI 3C6KA 4UT4A 3OTOI 3IWBA 5C0XE 2EP3A 4JI6I 2RTXA 1UEKA 5FLXQ 2JP9A 5L3JA 3LNUA 2DB2A 2ENCA 2LBSB 2EPNA 4EMDA 1YUIA 1RR9A 2IESA 2LO3A 2DSYA 4NBQA 4DPYA 4USMA 2WP8B 4LF4E 1EH6A 2EM6A 2JVAA 1N36E 3IWCA 5LL6R 5LMUI 4MU3A 4R1FA 2NUFA 3K1JA 5AASA 4IFDF 2ZM6I 4LFBE 3L00A 1Z0WA 1HNWE 2BB8A 4DV2E 3ADGA 4X64I 5LLQA 4B3SE 1RREA 2EMGA 4JI2E 4LU9A 4K0KE 1N34E 2JEBA 2KHXA 2EN1A 3OTOE 4DV5E 2EOMA 2EM7A 4JI6E 4I8OA 1EI1A 1Z5CA 1UDNA 3B82A 4R03A 4TUIA 1YYOA 2EPAA 3MHHC 3EPKA 2EPUA 2EOZA 3UHMA 2EMBA 4R2SA 3C4BA 4P7AA 4DUYE 2O1TA 2JEBB 4LFAI 4IFDC 4HXZA 2BA0D 2RS6A 3ADIA 3T1YI 1T4NA 3NZKA 2IHR1 2GLIA 2UXDI 4I3HA 2ZM6E 2BV3A 3ZKDA 2Z5CA 1N0VC 2L33A 4HY1A 1YYWA 1IQOA 2JR1A 2V8PA 2DLQA 2CSHA 4WYQB 4X64E 5A6AA 1DARA 3HULA 1N32I 2LJPA 2EQ0A 2YT4A 4O5GA 3P3CA 2V2VA 4JI7I 4RHBB 4ISAA 4FW7A 1I94I 2V8QB 2DRPA 5EKWA 1Y6ZA 1PKPA 2VQFE 3OMLA 4DR2I 2Z5CB 3AV0A 3FIGA 2EL5A 1KKHA 2GO4A 3JAMC 1GTKA 4QNKA 4B3RI 1RC7A 4DKKA 2B7TA 4DU7A 1BBGA 4B3TI 4LFAE 3ADLA 3T1YE 1VI7A 2J65A 3DD6A 4MQYA 2WBTA 2EOQA 1ZM2A 1OJ4A 3H09A 5CFFE 2UXDE 5K36F 1RQ0A 2MDGA 1EKZA 2L3JA 1Z0VA 3H1CA 1QU6A 4BS9A 2HHHE 4DXLA 4ZYEA 5JEAA 2L2MA 1WXRA 2L2NA 1IBMI 4NZVA 3PYDA 1N32E 4HYMA 4DU8A 1OYSA 5IWAI 4NXME 5A2QC 1ZXNA 4JI7E 2CZ9A 3D4JA 2CTDA 5IV8B 5GMDA 4MU0A 1I94E 1NEIA 4AM3A 4BMJA 4L8NA 4DR2E 1PVGA 2GO3A 4HEIA 3KWRA 2NA2A 4OX9I 3JTZA 2EMAA 5JEAB 3GONA 2EPLX 4TUGA 2N3HA 4PRXA 2J7JA 4B3RE 4KWYA 1VISA 2EM0A 4B3TE 5K36C 4GKKI 4X8WA 1SR9A 2JOBA 2YPNA 1HNZI 4URLA 4JI1I 4FK5C 2EPRA 4WSGA 4AQYE 1ZM9A 4LF7E 2AE8A 2UUBI 3DF6A 2EMWA 1IBME 2YRHA 3HTXA 4WFTA 2GHFA 1XNQI 5IWAE 1E3HA 2NN6D 2MDRA 1ZR9A 1N3GA 1E3PA 1A1LA 1ZAAC 4ZYDA 2MKNA 5A6BD 4OX9E 1DGCA 1H73A 1ZXMA 4O24A 2WCC3 2FTXB 2HFUA 5FWKA 2YU5A 4BHCA 1WRJA 3LMLA 3THNA 2LMZA 2RS7A 4U3BA 2YTOA 1YZ9A 2L6MA 1HNXI 2VQEI 4FW9A 4GKKE 2UXCI 3WU6A 4IFDA 4ED4A 4KHPI 1HNZE 2EPKX 2LE2A 4JI1E 2N8XA 4MYTA 2YTGA 3PS1A 2UUBE 2YRKA 1KIJA 1YFHA 4X62I 4DV4E 3DJWA 2IOQA 1XNQE 4LCHA 4DV1I 4IFDB 5K36D 3M99B 1TN9A 4BC9A 3RMPA 4PRVA 3V5RA 1Y5YA 3P06A 1NZ0A 2A2CA 2V89A 2EOFA 4MLVA 2YZTA 4JI8E 4IFDE 5A2QQ 2YU8A 2F1DA 2LJUA 4KQVA 1BB8A 4WUBA 3J80C 1HNXE 2UXCE 4BA1A 2VQEE 2HHHI 4IJDA 1FWKA 4KHPE 2EPXA 2EOEA 1P42A 1FJGI 1R6LA 3M6AA 4IZJD 5A6BA 3JU0A 1IBLI 4DR3I 1YHCA 4O43A 2HGHA 4MDTA 1FI4A 1ELOA 4WSPA 4DV1E 4LCGA 4BA1B 1HR0I 3ZZUA 1QNTA 2WBUA 2PNZA 3F0NA 2Q2EB 4OZEA 2BR2A 2EN4A 3MSWA 2MC5A 5KL3A 1JK2A 4Z7CA 2RPCA 4JI4I 1Z0GA 4M1KA 5KL7A 1X6FA 3WU3A 1TF3A 2O3ZA 4FWGA 3HXLA 1H72C 3CWVA 2K4VA 1EH8A 1USUA 2PNZB 4X65I 1H7UA 5T6JA 1FJGE 2BR2B 3HKMA 2X36A 4IZKA 4RH8A 1IBLE 4R2PA 4OO1A 4BBYA 4L5NC 1WUUA 2CVEA 2L8TA 4JYAI 4LF5I 4DMIA 3CDJA 4HACA 3J7AG 1BBOA 1HR0E 1UBDC 4PU9A 4ZVIA 2EM3A 1S16A 1O0WA 4F6MA 5DNYA 2DLKA 2RSIA 2FGGA 1HK7A 5LMUE 2EMFA 2LTRA 1A1FA 2EMYA 2EM2A 2WZOA 3HQ1A 4J8ZA 1Z1BA 1T39A 3IWDA 2NN6F 2EMKA 4JI4E 3V2UC 4DR7I 5K36E 1Y4UA 2LJHA 3B78A 4HACB 2YTNA 2BM1A 2C39A 5C0XF 4O4KA 5DNLA 2VESA 4X65E 3U1YA 4OO1E 1X6HA 2YRMA 1Z5BA 5LMNI 4AIDA 3F6HA 3H4LA 1XNRI 3KZZA 3J80Q 3J81C 4FW5A 2A25A 2LCEA 4YHHI 2C38A 4JYAE 4LF5E 5KL2A 3ZM7A 2EL4A 2C39B 4JI5I 1X5WA 2EOSA 2ZBKB 3F6GA 2NN6C 5A6JA 1AAYA 5ADZA 4LPFA 4B3MI 1YPNA 1MU5A 3ZZTA 3VK6A 2EN6A 4DR1E 2N3GA 5BR8E 1USVA 2HK3A 4GQUA 3ZZ0A 2O1VA 3CDIA 5C0XC 2YSPA 4DR7E 2C38B 3EPLA 1IMUA 2R42A 3PRYA 4X9JA 3ZKBA 4DV3I 4JI3I 2VF1A 2EQ3A 4R2EA 4MLQA 2IOPA 2AJ4A 1BKNA 2R3VA 4FN5A 5A69A 2YTJA 4IS1C 3Q6MA 3TQMA 1XNRE 2JWOA 5DRPA 4R8OA 3GLLA 4YHHE 2CG9A 1PJSA 2YTIA 3Q6NA 4JI5E 4P78A 4R2RA 3M7NG 4B3ME 2PO0A 2K7IA 2MC6A 3EQ1A 5A6KA 2GQ0A 2EM9A 2EPOA 2ODRC 2UUCI 2VE7C 4JI3E 3KZYA 2DGCA 2A2DA 2F8BA 3QG5C 1KTVA 3QT7A 2BA1G 2EN7A 3HJCA 2KOUA 2CT1A 4GEQB 1JK1A 2PO0B 2JE6A 1OYRA 5IT9C 3ADJA 1ZBTA 3THOB 1T38A 2E5LI 2EM4A 4BHBA 2UU9I 3J7AM 1B63A 3VHTB 5C0XD 1Z0EA 2YTPA 1A1JA 1B69A 5IXMB 5FLXC 2HFSA 1IQSA 3PYGA 5AC4A 2NPFA 3Q1QA 3EPJA 2RQLA 4OKGA 2I13A 1WHNA 2V2ZA 3J81Q 2JE6B 2ELZA 2E1RA 4ZYHA 1XMOI 3M85G 3JAMQ 2ENAA 1J26A 4M30A 2YTEA 1ZU1A 4OOGC 2EOOA 3BGHA 2B3TB 1ZBQA 5AC5A 4F6NA 4Q28A 2EOXA 4IS9A 2B7VA 1Z59A 1DQ3A 4DPXA 1PJTA 2F4VI 1MEYC 2LTSA 3LTOA 4J3DA 3P3EA 2UU9E 2EOIA 3B8HA 4X66I 4R2QA 2E1MA 2ODRD 4FW4A 3WU5A 2JPAA 1PIEA 2V86A 1Y60A 1L4SA 2WW4A 3PS2A 5JEAF 1WHQA 1UDQA 2UUAI 2YTQA 2JOXA 2DEJA 2NN6A 2L92A 1XMOE 2M1SA 1NHIA 4LOMA 4MU1A 1DI2A 5AE1A 4DV7I 1RMDA 1UILA 2R76A 2V88A 4X62E 1NHHA 2EN8A 2HK2A 2WNRA 3ECRA 3PS3A 4NXNI 4M9VC 2UXBI 1N33I 3K6QA 2EFGA 4GKJI 2NN6B 2BM0A 3HPZA 2F4VE 4JI0I 1X49A 2H36X 1A6FA 4LFCI 4JV5I 2EQ1A 2RSMA 2XEXA 4LFBI 4X66E 2DIXA 3BIDA 4F9CB 5JEAC 1HNWI 3LPSA 3M7ND 2JY9A 2WNRB 5DNXA 2D9HA 2NN6E 2GS8A 4DPUA 2EN2A 1UDOA 1ZM3A 1Z0CA 5IT9Q 2WP8A 2ENHA 2UUAE 4WXCA 2HKJA 4DV5I 1IBKI 5K36A 1SFEA 4LF9I 4DUZI 3K85A 4JG4A 2EMXA 2BA1D 4DR3E 3GMEA 4DV7E 2R1FA 4NXNE 1PJQA 3ZOQB 1T4OA 2EPPA 2EPZA 4DUYI 2UXBE 4KZSA 4F9AB 1N33E 1R6MA 3PYFA 2LUQA 4GKJE 5K36B 2V34A 4JI0E 2EMLA 4XTJA 5F3WA 2NABA 1UDSA 2GPIA 4LFCE 4JV5E 3PYEA 4IZJA 3GCMA 1G2DC 4FW3A 2EE8A 2V85A 3J7Yp 1XMQI 2KONA 2EMHA 1OYPA 2HJJA 2C37A 1NCSA 1LLMC 2PNMA 1MG7A 4QNJA 1MGTA 5AE2A 1IBKE 3M85D 5DROA 2LV2A 4DV6I 4U3DA 4LF9E 2EMIA 4DUZE 1X6EA 3HPSA 1YUJA 2EMZA 4R2CA 4IZJB 4YY3I 2VQFI 1TF6A 1A1HA 1S4EA 1X48A 4N4RB 1FKAE 2EZ6A 2DMYA 2VRDA 3L7ZA 2V87A 4FW6A 5JEAD 2Z5BA 1U2RA 2C37B 4LF6I 3BBGA 4DR4I 2V2QA 4F9BB 3P76A 3KRNA 3VYXA 1FWLA 4P52A 2PRTA 1T4LB 3VYYA 4DR5I 4WUDA 2DMIA 2E72A 2JXPA 2PO2A 3L7ZB 1XMQE 1K47A 2MKDA 2Z5BB 1A1KA 1B62A 4GZNC 3QT5A 2EN3A 1P47A 1EH7A 4NXMI 1PDAA 2PNLA 1STUA 4DV6E 4DPWA 1AH5A 4YY3E 5LMNE
chains in the Genus database with same CATH topology
3WU4A 3AUZA 2G7HA 2NUGA 2M4IA 2DEIA 4LF6E 4DR4E 4BC7A 2HKEA 2O1WA 4P7DA 4DR5E 4UTGA 2J7KA 2CGEA 4AQYI 4LTYA 1NHJA 1X47A 3T1HI 1MX0A 4LF7I 2CPNA 4FWHA 4DV3E 2EWLA 4WUCA 1Y4SA 2Z5EA 2B9DA 1GQEA 2V83A 3QT6A 1N0UA 2X7IA 1EA6A 2LUPB 4M0VA 4DR6I 4FWDA 1UHZA 3C4TA 3T1HE 2OI2A 4LF8I 2UUCE 1Z0BA 2M7QA 4DV4I 3LLHA 4N3OA 4DV0I 4USKA 1QZRA 3K17A 1GZ6A 3P1XA 2VF3A 2O1UA 2E5LE 1J5EI 1XHKA 4BCAA 4JI8I 1Z5AA 4MYUA 2ZITA 5GMEA 2L3CA 4DPTA 4WPYA 3QT8A 1YYKA 4DR6E 1KVKA 1H7SA 2NUEA 4F54A 4RPFA 4LF8E 5AE3A 2LRSA 4DV0E 1D6TA 1H74A 4LF4I 1N36I 1ZM4A 1J5EE 1FNMA 1Z0TA 4DV2I 4B3SI 4Z7YA 4M2ZA 4JI2I 2L2KB 4K0KI 1N34I 2FV4B 4UT4A 3OTOI 3IWBA 4JI6I 2RTXA 1UEKA 5FLXQ 5L3JA 3LNUA 2DB2A 2LBSB 4EMDA 1RR9A 2DSYA 4DPYA 4USMA 4LF4E 2JVAA 1N36E 3IWCA 5LL6R 5LMUI 4R1FA 2NUFA 3K1JA 5AASA 2ZM6I 4LFBE 1Z0WA 1HNWE 4DV2E 3ADGA 4X64I 4B3SE 1RREA 4JI2E 4LU9A 4K0KE 1N34E 2KHXA 4DV5E 3OTOE 4JI6E 1Z5CA 4I8OA 1EI1A 3B82A 4R03A 4TUIA 1YYOA 3C4BA 4P7AA 4DUYE 2O1TA 4LFAI 4HXZA 2RS6A 3ADIA 3T1YI 1T4NA 2IHR1 2UXDI 4I3HA 2ZM6E 2BV3A 3ZKDA 2Z5CA 1N0VC 2L33A 4HY1A 1YYWA 2HHHI 2JR1A 2V8PA 4X64E 4WYQB 1DARA 3HULA 1N32I 2LJPA 2YT4A 2V2VA 4JI7I 1I94I 2V8QB 1Y6ZA 1PKPA 2VQFE 3OMLA 4DR2I 2Z5CB 3AV0A 3FIGA 1KKHA 3JAMC 4B3RI 1RC7A 4DKKA 2B7TA 4DU7A 4B3TI 4LFAE 3ADLA 3T1YE 1ZM2A 1OJ4A 3H09A 5CFFE 2UXDE 1RQ0A 1EKZA 2L3JA 1Z0VA 1QU6A 4BS9A 2HHHE 4DXLA 2L2MA 1WXRA 2L2NA 1IBMI 3PYDA 1N32E 4HYMA 4DU8A 5IWAI 4NXME 5A2QC 1ZXNA 4JI7E 2CZ9A 3D4JA 5GMDA 1I94E 4BMJA 4L8NA 4DR2E 1PVGA 3KWRA 2NA2A 4OX9I 3JTZA 3GONA 4PRXA 4TUGA 2N3HA 4B3RE 1VISA 4B3TE 4GKKI 4X8WA 1SR9A 2JOBA 1HNZI 4URLA 4JI1I 4AQYE 1ZM9A 4LF7E 2UUBI 3DF6A 1IBME 3HTXA 4WFTA 1XNQI 5IWAE 2MDRA 4OX9E 1H73A 1ZXMA 2HFUA 2FTXB 5FWKA 3LMLA 2LMZA 2RS7A 1HNXI 1YZ9A 2UXCI 2L6MA 2VQEI 4GKKE 3WU6A 4ED4A 4KHPI 1HNZE 2LE2A 4JI1E 4MYTA 2UUBE 1KIJA 4X62I 4DV4E 3DJWA 2IOQA 1XNQE 4DV1I 4BC9A 3RMPA 4PRVA 3V5RA 3P06A 1NZ0A 2A2CA 2V89A 2YZTA 4JI8E 5A2QQ 4WUBA 4KQVA 1HNXE 3J80C 2UXCE 2VQEE 1FWKA 4KHPE 1FJGI 3M6AA 4IZJD 1IBLI 3JU0A 4DR3I 1FI4A 1ELOA 4WSPA 4DV1E 1HR0I 3ZZUA 3F0NA 2Q2EB 3MSWA 2MC5A 4Z7CA 4JI4I 1Z0GA 4M1KA 3WU3A 4FWGA 3HXLA 1H72C 3CWVA 2K4VA 1USUA 4X65I 1H7UA 5T6JA 1FJGE 2X36A 4IZKA 1IBLE 4BBYA 4L5NC 1WUUA 2L8TA 4JYAI 4LF5I 4DMIA 4HACA 3J7AG 1HR0E 4ZVIA 4PU9A 1S16A 1O0WA 5DNYA 2FGGA 1HK7A 5LMUE 4IZKB 2LTRA 4DR1I 5BR8I 2WZOA 3HQ1A 4J8ZA 3V2UC 3IWDA 4JI4E 4DR7I 1Y4UA 2LJHA 3B78A 4HACB 2BM1A 4X65E 1Z5BA 5LMNI 3F6HA 3H4LA 1XNRI 3J80Q 3J81C 4YHHI 4JYAE 4LF5E 3ZM7A 4JI5I 2ZBKB 3F6GA 5ADZA 4B3MI 1MU5A 3ZZTA 3VK6A 4DR1E 2N3GA 5BR8E 1USVA 2HK3A 3ZZ0A 2O1VA 4DR7E 2R42A 3PRYA 4DV3I 3ZKBA 4JI3I 2VF1A 2IOPA 2AJ4A 1BKNA 2R3VA 4FN5A 3Q6MA 1XNRE 2JWOA 4R8OA 4YHHE 2CG9A 3Q6NA 4JI5E 4P78A 4B3ME 2MC6A 2GQ0A 2UUCI 2ODRC 2VE7C 4JI3E 2A2DA 2F8BA 1KTVA 3QT7A 3HJCA 2KOUA 4GEQB 5IT9C 3ADJA 1ZBTA 2E5LI 2UU9I 3J7AM 1B63A 1Z0EA 3Q1QA 5FLXC 2HFSA 3PYGA 2NPFA 1WHNA 2V2ZA 3J81Q 2E1RA 1XMOI 3JAMQ 1J26A 4M30A 4OOGC 2B3TB 1ZBQA 4Q28A 2B7VA 1Z59A 1DQ3A 4DPXA 2F4VI 2LTSA 3LTOA 2UU9E 3B8HA 4X66I 2E1MA 2ODRD 3WU5A 1PIEA 2V86A 2WW4A 1WHQA 2UUAI 2JOXA 2DEJA 2L92A 1XMOE 2M1SA 1NHIA 1DI2A 5AE1A 4DV7I 1UILA 2V88A 4X62E 1NHHA 2HK2A 4NXNI 2UXBI 1N33I 3K6QA 2EFGA 4GKJI 2BM0A 3HPZA 2F4VE 4JI0I 1X49A 2H36X 1A6FA 4LFCI 4JV5I 2RSMA 2XEXA 4LFBI 4X66E 2DIXA 4F9CB 1HNWI 3LPSA 2JY9A 2GS8A 4DPUA 1ZM3A 1Z0CA 5IT9Q 2UUAE 2HKJA 4DV5I 1IBKI 4LF9I 4DUZI 3K85A 4JG4A 4DR3E 4DV7E 4NXNE 3ZOQB 1T4OA 4DUYI 2UXBE 4KZSA 4F9AB 1N33E 3PYFA 2LUQA 4GKJE 2V34A 4JI0E 4XTJA 5F3WA 4LFCE 4JV5E 3PYEA 4IZJA 2V85A 3J7Yp 1XMQI 2KONA 2PNMA 1MG7A 5AE2A 1IBKE 4DV6I 4LF9E 4DUZE 4YY3I 3HPSA 2VQFI 4IZJB 1S4EA 1X48A 1FKAE 2EZ6A 2DMYA 4LF6I 2V87A 2Z5BA 1U2RA 4DR4I 2V2QA 4F9BB 3VYXA 1FWLA 4P52A 1T4LB 3VYYA 4DR5I 4WUDA 1XMQE 1K47A 2Z5BB 1B62A 3QT5A 4NXMI 2PNLA 1STUA 4DV6E 4DPWA 4FW9A 4YY3E 5LMNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU4 A;  2NUG A;  2DEI A;  4LF6 E;  4DR4 E;  2HKE A;  4DR5 E;  4UTG A;  2J7K A;  4AQY I;  4LF7 I;  1NHJ A;  1X47 A;  3T1H I;  1MX0 A;  2CPN A;  4FWH A;  4DV3 E;  4WUC A;  1GQE A;  3QT6 A;  1N0U A;  2X7I A;  1EA6 A;  2LUP B;  4DR6 I;  4FWD A;  1UHZ A;  3C4T A;  3T1H E;  2OI2 A;  4LF8 I;  2UUC E;  1Z0B A;  4DV4 I;  3LLH A;  4DV0 I;  4USK A;  1QZR A;  3K17 A;  3P1X A;  2VF3 A;  2E5L E;  1J5E I;  1XHK A;  4JI8 I;  1Z5A A;  4MYU A;  2ZIT A;  5GME A;  2L3C A;  4DPT A;  3QT8 A;  1YYK A;  4DR6 E;  1KVK A;  1H7S A;  2NUE A;  4RPF A;  4LF8 E;  2LRS A;  4DV0 E;  1D6T A;  1H74 A;  4LF4 I;  1N36 I;  1ZM4 A;  1J5E E;  1FNM A;  1Z0T A;  4DV2 I;  4B3S I;  4Z7Y A;  4M2Z A;  4JI2 I;  2L2K B;  4K0K I;  1N34 I;  4UT4 A;  3OTO I;  4JI6 I;  2RTX A;  1UEK A;  5FLX Q;  5L3J A;  3LNU A;  2DB2 A;  2LBS B;  4EMD A;  1RR9 A;  4DPY A;  4USM A;  4LF4 E;  2JVA A;  1N36 E;  5LL6 R;  5LMU I;  4R1F A;  2NUF A;  3K1J A;  2ZM6 I;  4LFB E;  1Z0W A;  1HNW E;  4DV2 E;  3ADG A;  4X64 I;  4B3S E;  1RRE A;  4JI2 E;  4K0K E;  1N34 E;  2KHX A;  4DV5 E;  3OTO E;  4JI6 E;  1Z5C A;  1EI1 A;  3B82 A;  1YYO A;  3C4B A;  4P7A A;  4DUY E;  4LFA I;  4HXZ A;  2RS6 A;  3ADI A;  3T1Y I;  1T4N A;  2IHR 1;  2UXD I;  4I3H A;  2ZM6 E;  2BV3 A;  3ZKD A;  1N0V C;  2L33 A;  4HY1 A;  1YYW A;  2HHH I;  2V8P A;  4X64 E;  4WYQ B;  1DAR A;  3HUL A;  1N32 I;  2LJP A;  2YT4 A;  2V2V A;  4JI7 I;  1I94 I;  1PKP A;  2VQF E;  4DR2 I;  1KKH A;  3JAM C;  4B3R I;  1RC7 A;  4DKK A;  2B7T A;  4DU7 A;  4B3T I;  4LFA E;  3ADL A;  3T1Y E;  1ZM2 A;  1OJ4 A;  5CFF E;  2UXD E;  1RQ0 A;  1EKZ A;  2L3J A;  1Z0V A;  1QU6 A;  2HHH E;  4DXL A;  2L2M A;  1IBM I;  2L2N A;  3PYD A;  1N32 E;  4HYM A;  4DU8 A;  5IWA I;  4NXM E;  1ZXN A;  5A2Q C;  4JI7 E;  2CZ9 A;  3D4J A;  5GMD A;  1I94 E;  4DR2 E;  1PVG A;  2NA2 A;  4OX9 I;  3GON A;  4PRX A;  2N3H A;  4B3R E;  1VIS A;  4B3T E;  4GKK I;  4X8W A;  1HNZ I;  4URL A;  4JI1 I;  4AQY E;  1ZM9 A;  4LF7 E;  2UUB I;  1IBM E;  3HTX A;  4WFT A;  1XNQ I;  5IWA E;  2MDR A;  4OX9 E;  1H73 A;  1ZXM A;  2HFU A;  1HNX I;  2RS7 A;  1YZ9 A;  2UXC I;  2VQE I;  4GKK E;  3WU6 A;  4ED4 A;  4KHP I;  1HNZ E;  4JI1 E;  4MYT A;  2UUB E;  1KIJ A;  4X62 I;  4DV4 E;  1XNQ E;  4DV1 I;  4PRV A;  3V5R A;  1NZ0 A;  2A2C A;  4JI8 E;  5A2Q Q;  4WUB A;  4KQV A;  1HNX E;  3J80 C;  2UXC E;  2VQE E;  1FWK A;  4KHP E;  1FJG I;  3M6A A;  1IBL I;  4DR3 I;  1FI4 A;  1ELO A;  4DV1 E;  1HR0 I;  3ZZU A;  3F0N A;  2Q2E B;  4Z7C A;  4JI4 I;  1Z0G A;  4M1K A;  3WU3 A;  4FWG A;  1H72 C;  3CWV A;  4X65 I;  1H7U A;  1FJG E;  2X36 A;  1IBL E;  1WUU A;  4JYA I;  4LF5 I;  4HAC A;  3J7A G;  1HR0 E;  4ZVI A;  4PU9 A;  1S16 A;  1O0W A;  5LMU E;  2LTR A;  4DR1 I;  5BR8 I;  3V2U C;  4JI4 E;  4DR7 I;  3B78 A;  2LJH A;  4HAC B;  2BM1 A;  4X65 E;  1Z5B A;  5LMN I;  3H4L A;  1XNR I;  3J80 Q;  3J81 C;  4YHH I;  4JYA E;  4LF5 E;  3ZM7 A;  4JI5 I;  2ZBK B;  4B3M I;  1MU5 A;  3ZZT A;  4DR1 E;  2N3G A;  5BR8 E;  2HK3 A;  3ZZ0 A;  4DR7 E;  2R42 A;  4DV3 I;  4JI3 I;  3ZKB A;  2AJ4 A;  1BKN A;  2R3V A;  4FN5 A;  1XNR E;  4YHH E;  4JI5 E;  4B3M E;  2UUC I;  4JI3 E;  2A2D A;  1KTV A;  3QT7 A;  5IT9 C;  3ADJ A;  1ZBT A;  2E5L I;  2UU9 I;  3J7A M;  1B63 A;  1Z0E A;  3Q1Q A;  5FLX C;  2HFS A;  3PYG A;  2NPF A;  1WHN A;  2V2Z A;  3J81 Q;  2E1R A;  1XMO I;  3JAM Q;  1J26 A;  4M30 A;  4OOG C;  2B3T B;  2B7V A;  1Z59 A;  4DPX A;  2F4V I;  2LTS A;  3LTO A;  2UU9 E;  3B8H A;  4X66 I;  3WU5 A;  1PIE A;  2WW4 A;  1WHQ A;  2UUA I;  2DEJ A;  1XMO E;  1NHI A;  1DI2 A;  4DV7 I;  1UIL A;  4X62 E;  2HK2 A;  1NHH A;  4NXN I;  2UXB I;  1N33 I;  2EFG A;  4GKJ I;  2BM0 A;  2F4V E;  4JI0 I;  1X49 A;  1A6F A;  4LFC I;  4JV5 I;  2RSM A;  2XEX A;  4LFB I;  4X66 E;  2DIX A;  1HNW I;  3LPS A;  2JY9 A;  2GS8 A;  4DPU A;  1ZM3 A;  1Z0C A;  5IT9 Q;  2UUA E;  2HKJ A;  4DV5 I;  1IBK I;  4LF9 I;  4DUZ I;  4JG4 A;  4DR3 E;  4DV7 E;  4NXN E;  1T4O A;  4DUY I;  2UXB E;  3PYF A;  1N33 E;  2LUQ A;  4GKJ E;  2V34 A;  4JI0 E;  4XTJ A;  4LFC E;  4JV5 E;  3PYE A;  3J7Y p;  1XMQ I;  1MG7 A;  1IBK E;  4DV6 I;  4LF9 E;  4DUZ E;  4YY3 I;  2VQF I;  1S4E A;  1X48 A;  1FKA E;  2EZ6 A;  2DMY A;  4LF6 I;  1U2R A;  4DR4 I;  2V2Q A;  3VYX A;  1FWL A;  4P52 A;  1T4L B;  3VYY A;  4DR5 I;  4WUD A;  1XMQ E;  1K47 A;  1B62 A;  3QT5 A;  4NXM I;  1STU A;  4DV6 E;  4DPW A;  4FW9 A;  4YY3 E;  5LMN E; 
#chains in the Genus database with same CATH topology
 3WU4 A;  3AUZ A;  2PO2 B;  2EOH A;  2G7H A;  2NUG A;  2M4I A;  5DRR A;  3UK3 C;  2DEI A;  1KYQ A;  3MHS C;  4LF6 E;  4MU4 A;  4DR4 E;  4BC7 A;  2HKE A;  5BR8 I;  1G2F C;  2O1W A;  2ELY A;  2EPC A;  2EOR A;  2EPM X;  2JYA A;  2M9A A;  4P7D A;  4DR5 E;  2EOJ A;  1YSA C;  4UTG A;  2J7K A;  4R2D A;  2BBG A;  2CGE A;  4AQY I;  4LTY A;  1NHJ A;  1X47 A;  2LVH A;  1MX0 A;  3T1H I;  4LF7 I;  2CPN A;  4HTG A;  1XXE A;  2YSO A;  4FWH A;  4DV3 E;  2EWL A;  4OO1 F;  4WUC A;  4IFD D;  1F2I G;  1Y4S A;  2Z5E A;  2YWQ A;  2B9D A;  4BA2 A;  1GQE A;  4WX9 A;  4NHR A;  2V83 A;  3QT6 A;  2HC5 A;  1N0U A;  1A1G A;  4F2J C;  2EMC A;  2X7I A;  1EA6 A;  3B4T A;  2JEA A;  2LUP B;  1A1I A;  4M0V A;  2EOY A;  5KL6 A;  4FWD A;  4DR6 I;  2EM8 A;  4IZK B;  5JEA E;  4BA2 B;  1UHZ A;  4OO1 C;  3C4T A;  4Q35 B;  3U1K A;  2I9I A;  5KL5 A;  3T1H E;  2OI2 A;  2UUC E;  4LF8 I;  1Z0B A;  2M7Q A;  4DV4 I;  1KJK A;  5ELW A;  3LLH A;  4N3O A;  2JEA B;  4DV0 I;  4R2A A;  4USK A;  1QZR A;  3K17 A;  4ZYG A;  1GZ6 A;  3P1X A;  2VF3 A;  2O1U A;  3EPH A;  2E5L E;  1J5E I;  2BA0 G;  2YTD A;  1XHK A;  4DR1 I;  3C6M A;  4BCA A;  4JI8 I;  1Z5A A;  4MYU A;  2ZIT A;  5GME A;  2L3C A;  4OO1 B;  4DPT A;  4WPY A;  2YTF A;  3QT8 A;  1YYK A;  4DR6 E;  1KVK A;  2PO1 A;  1H7S A;  2NUE A;  5KL4 A;  2ADR A;  4LCF A;  4F54 A;  2JT2 A;  4RPF A;  4AIM A;  4LF8 E;  5AE3 A;  1YH8 A;  2IER A;  5C0X A;  2LRS A;  3P3G A;  1X3C A;  2EJ4 A;  2WBS A;  1RHY A;  4DV0 E;  1D6T A;  1H74 A;  2PO1 B;  5EL9 A;  4LF4 I;  2EL6 A;  1N36 I;  2Q8U A;  1ZM4 A;  1J5E E;  4WXD A;  4OO1 D;  1FNM A;  5C0X B;  1Z0T A;  5DRQ A;  4DV2 I;  2LT7 A;  1UN6 B;  4Z7Y A;  4B3S I;  4M2Z A;  4JI2 I;  5TSE A;  2L2K B;  1WJP A;  3BF2 A;  1N34 I;  2FV4 B;  2EM5 A;  4K0K I;  3C6K A;  4UT4 A;  3OTO I;  3IWB A;  5C0X E;  2EP3 A;  4JI6 I;  2RTX A;  1UEK A;  5FLX Q;  2JP9 A;  5L3J A;  3LNU A;  2DB2 A;  2ENC A;  2LBS B;  2EPN A;  4EMD A;  1YUI A;  1RR9 A;  2IES A;  2LO3 A;  2DSY A;  4NBQ A;  4DPY A;  4USM A;  2WP8 B;  4LF4 E;  1EH6 A;  2EM6 A;  2JVA A;  1N36 E;  3IWC A;  5LL6 R;  5LMU I;  4MU3 A;  4R1F A;  2NUF A;  3K1J A;  5AAS A;  4IFD F;  2ZM6 I;  4LFB E;  3L00 A;  1Z0W A;  1HNW E;  2BB8 A;  4DV2 E;  3ADG A;  4X64 I;  5LLQ A;  4B3S E;  1RRE A;  2EMG A;  4JI2 E;  4LU9 A;  4K0K E;  1N34 E;  2JEB A;  2KHX A;  2EN1 A;  3OTO E;  4DV5 E;  2EOM A;  2EM7 A;  4JI6 E;  4I8O A;  1EI1 A;  1Z5C A;  1UDN A;  3B82 A;  4R03 A;  4TUI A;  1YYO A;  2EPA A;  3MHH C;  3EPK A;  2EPU A;  2EOZ A;  3UHM A;  2EMB A;  4R2S A;  3C4B A;  4P7A A;  4DUY E;  2O1T A;  2JEB B;  4LFA I;  4IFD C;  4HXZ A;  2BA0 D;  2RS6 A;  3ADI A;  3T1Y I;  1T4N A;  3NZK A;  2IHR 1;  2GLI A;  2UXD I;  4I3H A;  2ZM6 E;  2BV3 A;  3ZKD A;  2Z5C A;  1N0V C;  2L33 A;  4HY1 A;  1YYW A;  1IQO A;  2JR1 A;  2V8P A;  2DLQ A;  2CSH A;  4WYQ B;  4X64 E;  5A6A A;  1DAR A;  3HUL A;  1N32 I;  2LJP A;  2EQ0 A;  2YT4 A;  4O5G A;  3P3C A;  2V2V A;  4JI7 I;  4RHB B;  4ISA A;  4FW7 A;  1I94 I;  2V8Q B;  2DRP A;  5EKW A;  1Y6Z A;  1PKP A;  2VQF E;  3OML A;  4DR2 I;  2Z5C B;  3AV0 A;  3FIG A;  2EL5 A;  1KKH A;  2GO4 A;  3JAM C;  1GTK A;  4QNK A;  4B3R I;  1RC7 A;  4DKK A;  2B7T A;  4DU7 A;  1BBG A;  4B3T I;  4LFA E;  3ADL A;  3T1Y E;  1VI7 A;  2J65 A;  3DD6 A;  4MQY A;  2WBT A;  2EOQ A;  1ZM2 A;  1OJ4 A;  3H09 A;  5CFF E;  2UXD E;  5K36 F;  1RQ0 A;  2MDG A;  1EKZ A;  2L3J A;  1Z0V A;  3H1C A;  1QU6 A;  4BS9 A;  2HHH E;  4DXL A;  4ZYE A;  5JEA A;  2L2M A;  1WXR A;  2L2N A;  1IBM I;  4NZV A;  3PYD A;  1N32 E;  4HYM A;  4DU8 A;  1OYS A;  5IWA I;  4NXM E;  5A2Q C;  1ZXN A;  4JI7 E;  2CZ9 A;  3D4J A;  2CTD A;  5IV8 B;  5GMD A;  4MU0 A;  1I94 E;  1NEI A;  4AM3 A;  4BMJ A;  4L8N A;  4DR2 E;  1PVG A;  2GO3 A;  4HEI A;  3KWR A;  2NA2 A;  4OX9 I;  3JTZ A;  2EMA A;  5JEA B;  3GON A;  2EPL X;  4TUG A;  2N3H A;  4PRX A;  2J7J A;  4B3R E;  4KWY A;  1VIS A;  2EM0 A;  4B3T E;  5K36 C;  4GKK I;  4X8W A;  1SR9 A;  2JOB A;  2YPN A;  1HNZ I;  4URL A;  4JI1 I;  4FK5 C;  2EPR A;  4WSG A;  4AQY E;  1ZM9 A;  4LF7 E;  2AE8 A;  2UUB I;  3DF6 A;  2EMW A;  1IBM E;  2YRH A;  3HTX A;  4WFT A;  2GHF A;  1XNQ I;  5IWA E;  1E3H A;  2NN6 D;  2MDR A;  1ZR9 A;  1N3G A;  1E3P A;  1A1L A;  1ZAA C;  4ZYD A;  2MKN A;  5A6B D;  4OX9 E;  1DGC A;  1H73 A;  1ZXM A;  4O24 A;  2WCC 3;  2FTX B;  2HFU A;  5FWK A;  2YU5 A;  4BHC A;  1WRJ A;  3LML A;  3THN A;  2LMZ A;  2RS7 A;  4U3B A;  2YTO A;  1YZ9 A;  2L6M A;  1HNX I;  2VQE I;  4FW9 A;  4GKK E;  2UXC I;  3WU6 A;  4IFD A;  4ED4 A;  4KHP I;  1HNZ E;  2EPK X;  2LE2 A;  4JI1 E;  2N8X A;  4MYT A;  2YTG A;  3PS1 A;  2UUB E;  2YRK A;  1KIJ A;  1YFH A;  4X62 I;  4DV4 E;  3DJW A;  2IOQ A;  1XNQ E;  4LCH A;  4DV1 I;  4IFD B;  5K36 D;  3M99 B;  1TN9 A;  4BC9 A;  3RMP A;  4PRV A;  3V5R A;  1Y5Y A;  3P06 A;  1NZ0 A;  2A2C A;  2V89 A;  2EOF A;  4MLV A;  2YZT A;  4JI8 E;  4IFD E;  5A2Q Q;  2YU8 A;  2F1D A;  2LJU A;  4KQV A;  1BB8 A;  4WUB A;  3J80 C;  1HNX E;  2UXC E;  4BA1 A;  2VQE E;  2HHH I;  4IJD A;  1FWK A;  4KHP E;  2EPX A;  2EOE A;  1P42 A;  1FJG I;  1R6L A;  3M6A A;  4IZJ D;  5A6B A;  3JU0 A;  1IBL I;  4DR3 I;  1YHC A;  4O43 A;  2HGH A;  4MDT A;  1FI4 A;  1ELO A;  4WSP A;  4DV1 E;  4LCG A;  4BA1 B;  1HR0 I;  3ZZU A;  1QNT A;  2WBU A;  2PNZ A;  3F0N A;  2Q2E B;  4OZE A;  2BR2 A;  2EN4 A;  3MSW A;  2MC5 A;  5KL3 A;  1JK2 A;  4Z7C A;  2RPC A;  4JI4 I;  1Z0G A;  4M1K A;  5KL7 A;  1X6F A;  3WU3 A;  1TF3 A;  2O3Z A;  4FWG A;  3HXL A;  1H72 C;  3CWV A;  2K4V A;  1EH8 A;  1USU A;  2PNZ B;  4X65 I;  1H7U A;  5T6J A;  1FJG E;  2BR2 B;  3HKM A;  2X36 A;  4IZK A;  4RH8 A;  1IBL E;  4R2P A;  4OO1 A;  4BBY A;  4L5N C;  1WUU A;  2CVE A;  2L8T A;  4JYA I;  4LF5 I;  4DMI A;  3CDJ A;  4HAC A;  3J7A G;  1BBO A;  1HR0 E;  1UBD C;  4PU9 A;  4ZVI A;  2EM3 A;  1S16 A;  1O0W A;  4F6M A;  5DNY A;  2DLK A;  2RSI A;  2FGG A;  1HK7 A;  5LMU E;  2EMF A;  2LTR A;  1A1F A;  2EMY A;  2EM2 A;  2WZO A;  3HQ1 A;  4J8Z A;  1Z1B A;  1T39 A;  3IWD A;  2NN6 F;  2EMK A;  4JI4 E;  3V2U C;  4DR7 I;  5K36 E;  1Y4U A;  2LJH A;  3B78 A;  4HAC B;  2YTN A;  2BM1 A;  2C39 A;  5C0X F;  4O4K A;  5DNL A;  2VES A;  4X65 E;  3U1Y A;  4OO1 E;  1X6H A;  2YRM A;  1Z5B A;  5LMN I;  4AID A;  3F6H A;  3H4L A;  1XNR I;  3KZZ A;  3J80 Q;  3J81 C;  4FW5 A;  2A25 A;  2LCE A;  4YHH I;  2C38 A;  4JYA E;  4LF5 E;  5KL2 A;  3ZM7 A;  2EL4 A;  2C39 B;  4JI5 I;  1X5W A;  2EOS A;  2ZBK B;  3F6G A;  2NN6 C;  5A6J A;  1AAY A;  5ADZ A;  4LPF A;  4B3M I;  1YPN A;  1MU5 A;  3ZZT A;  3VK6 A;  2EN6 A;  4DR1 E;  2N3G A;  5BR8 E;  1USV A;  2HK3 A;  4GQU A;  3ZZ0 A;  2O1V A;  3CDI A;  5C0X C;  2YSP A;  4DR7 E;  2C38 B;  3EPL A;  1IMU A;  2R42 A;  3PRY A;  4X9J A;  3ZKB A;  4DV3 I;  4JI3 I;  2VF1 A;  2EQ3 A;  4R2E A;  4MLQ A;  2IOP A;  2AJ4 A;  1BKN A;  2R3V A;  4FN5 A;  5A69 A;  2YTJ A;  4IS1 C;  3Q6M A;  3TQM A;  1XNR E;  2JWO A;  5DRP A;  4R8O A;  3GLL A;  4YHH E;  2CG9 A;  1PJS A;  2YTI A;  3Q6N A;  4JI5 E;  4P78 A;  4R2R A;  3M7N G;  4B3M E;  2PO0 A;  2K7I A;  2MC6 A;  3EQ1 A;  5A6K A;  2GQ0 A;  2EM9 A;  2EPO A;  2ODR C;  2UUC I;  2VE7 C;  4JI3 E;  3KZY A;  2DGC A;  2A2D A;  2F8B A;  3QG5 C;  1KTV A;  3QT7 A;  2BA1 G;  2EN7 A;  3HJC A;  2KOU A;  2CT1 A;  4GEQ B;  1JK1 A;  2PO0 B;  2JE6 A;  1OYR A;  5IT9 C;  3ADJ A;  1ZBT A;  3THO B;  1T38 A;  2E5L I;  2EM4 A;  4BHB A;  2UU9 I;  3J7A M;  1B63 A;  3VHT B;  5C0X D;  1Z0E A;  2YTP A;  1A1J A;  1B69 A;  5IXM B;  5FLX C;  2HFS A;  1IQS A;  3PYG A;  5AC4 A;  2NPF A;  3Q1Q A;  3EPJ A;  2RQL A;  4OKG A;  2I13 A;  1WHN A;  2V2Z A;  3J81 Q;  2JE6 B;  2ELZ A;  2E1R A;  4ZYH A;  1XMO I;  3M85 G;  3JAM Q;  2ENA A;  1J26 A;  4M30 A;  2YTE A;  1ZU1 A;  4OOG C;  2EOO A;  3BGH A;  2B3T B;  1ZBQ A;  5AC5 A;  4F6N A;  4Q28 A;  2EOX A;  4IS9 A;  2B7V A;  1Z59 A;  1DQ3 A;  4DPX A;  1PJT A;  2F4V I;  1MEY C;  2LTS A;  3LTO A;  4J3D A;  3P3E A;  2UU9 E;  2EOI A;  3B8H A;  4X66 I;  4R2Q A;  2E1M A;  2ODR D;  4FW4 A;  3WU5 A;  2JPA A;  1PIE A;  2V86 A;  1Y60 A;  1L4S A;  2WW4 A;  3PS2 A;  5JEA F;  1WHQ A;  1UDQ A;  2UUA I;  2YTQ A;  2JOX A;  2DEJ A;  2NN6 A;  2L92 A;  1XMO E;  2M1S A;  1NHI A;  4LOM A;  4MU1 A;  1DI2 A;  5AE1 A;  4DV7 I;  1RMD A;  1UIL A;  2R76 A;  2V88 A;  4X62 E;  1NHH A;  2EN8 A;  2HK2 A;  2WNR A;  3ECR A;  3PS3 A;  4NXN I;  4M9V C;  2UXB I;  1N33 I;  3K6Q A;  2EFG A;  4GKJ I;  2NN6 B;  2BM0 A;  3HPZ A;  2F4V E;  4JI0 I;  1X49 A;  2H36 X;  1A6F A;  4LFC I;  4JV5 I;  2EQ1 A;  2RSM A;  2XEX A;  4LFB I;  4X66 E;  2DIX A;  3BID A;  4F9C B;  5JEA C;  1HNW I;  3LPS A;  3M7N D;  2JY9 A;  2WNR B;  5DNX A;  2D9H A;  2NN6 E;  2GS8 A;  4DPU A;  2EN2 A;  1UDO A;  1ZM3 A;  1Z0C A;  5IT9 Q;  2WP8 A;  2ENH A;  2UUA E;  4WXC A;  2HKJ A;  4DV5 I;  1IBK I;  5K36 A;  1SFE A;  4LF9 I;  4DUZ I;  3K85 A;  4JG4 A;  2EMX A;  2BA1 D;  4DR3 E;  3GME A;  4DV7 E;  2R1F A;  4NXN E;  1PJQ A;  3ZOQ B;  1T4O A;  2EPP A;  2EPZ A;  4DUY I;  2UXB E;  4KZS A;  4F9A B;  1N33 E;  1R6M A;  3PYF A;  2LUQ A;  4GKJ E;  5K36 B;  2V34 A;  4JI0 E;  2EML A;  4XTJ A;  5F3W A;  2NAB A;  1UDS A;  2GPI A;  4LFC E;  4JV5 E;  3PYE A;  4IZJ A;  3GCM A;  1G2D C;  4FW3 A;  2EE8 A;  2V85 A;  3J7Y p;  1XMQ I;  2KON A;  2EMH A;  1OYP A;  2HJJ A;  2C37 A;  1NCS A;  1LLM C;  2PNM A;  1MG7 A;  4QNJ A;  1MGT A;  5AE2 A;  1IBK E;  3M85 D;  5DRO A;  2LV2 A;  4DV6 I;  4U3D A;  4LF9 E;  2EMI A;  4DUZ E;  1X6E A;  3HPS A;  1YUJ A;  2EMZ A;  4R2C A;  4IZJ B;  4YY3 I;  2VQF I;  1TF6 A;  1A1H A;  1S4E A;  1X48 A;  4N4R B;  1FKA E;  2EZ6 A;  2DMY A;  2VRD A;  3L7Z A;  2V87 A;  4FW6 A;  5JEA D;  2Z5B A;  1U2R A;  2C37 B;  4LF6 I;  3BBG A;  4DR4 I;  2V2Q A;  4F9B B;  3P76 A;  3KRN A;  3VYX A;  1FWL A;  4P52 A;  2PRT A;  1T4L B;  3VYY A;  4DR5 I;  4WUD A;  2DMI A;  2E72 A;  2JXP A;  2PO2 A;  3L7Z B;  1XMQ E;  1K47 A;  2MKD A;  2Z5B B;  1A1K A;  1B62 A;  4GZN C;  3QT5 A;  2EN3 A;  1P47 A;  1EH7 A;  4NXM I;  1PDA A;  2PNL A;  1STU A;  4DV6 E;  4DPW A;  1AH5 A;  4YY3 E;  5LMN E; 
#chains in the Genus database with same CATH homology
 3WU4 A;  3AUZ A;  2G7H A;  2NUG A;  2M4I A;  2DEI A;  4LF6 E;  4DR4 E;  4BC7 A;  2HKE A;  2O1W A;  4P7D A;  4DR5 E;  4UTG A;  2J7K A;  2CGE A;  4AQY I;  4LTY A;  1NHJ A;  1X47 A;  3T1H I;  1MX0 A;  4LF7 I;  2CPN A;  4FWH A;  4DV3 E;  2EWL A;  4WUC A;  1Y4S A;  2Z5E A;  2B9D A;  1GQE A;  2V83 A;  3QT6 A;  1N0U A;  2X7I A;  1EA6 A;  2LUP B;  4M0V A;  4DR6 I;  4FWD A;  1UHZ A;  3C4T A;  3T1H E;  2OI2 A;  4LF8 I;  2UUC E;  1Z0B A;  2M7Q A;  4DV4 I;  3LLH A;  4N3O A;  4DV0 I;  4USK A;  1QZR A;  3K17 A;  1GZ6 A;  3P1X A;  2VF3 A;  2O1U A;  2E5L E;  1J5E I;  1XHK A;  4BCA A;  4JI8 I;  1Z5A A;  4MYU A;  2ZIT A;  5GME A;  2L3C A;  4DPT A;  4WPY A;  3QT8 A;  1YYK A;  4DR6 E;  1KVK A;  1H7S A;  2NUE A;  4F54 A;  4RPF A;  4LF8 E;  5AE3 A;  2LRS A;  4DV0 E;  1D6T A;  1H74 A;  4LF4 I;  1N36 I;  1ZM4 A;  1J5E E;  1FNM A;  1Z0T A;  4DV2 I;  4B3S I;  4Z7Y A;  4M2Z A;  4JI2 I;  2L2K B;  4K0K I;  1N34 I;  2FV4 B;  4UT4 A;  3OTO I;  3IWB A;  4JI6 I;  2RTX A;  1UEK A;  5FLX Q;  5L3J A;  3LNU A;  2DB2 A;  2LBS B;  4EMD A;  1RR9 A;  2DSY A;  4DPY A;  4USM A;  4LF4 E;  2JVA A;  1N36 E;  3IWC A;  5LL6 R;  5LMU I;  4R1F A;  2NUF A;  3K1J A;  5AAS A;  2ZM6 I;  4LFB E;  1Z0W A;  1HNW E;  4DV2 E;  3ADG A;  4X64 I;  4B3S E;  1RRE A;  4JI2 E;  4LU9 A;  4K0K E;  1N34 E;  2KHX A;  4DV5 E;  3OTO E;  4JI6 E;  1Z5C A;  4I8O A;  1EI1 A;  3B82 A;  4R03 A;  4TUI A;  1YYO A;  3C4B A;  4P7A A;  4DUY E;  2O1T A;  4LFA I;  4HXZ A;  2RS6 A;  3ADI A;  3T1Y I;  1T4N A;  2IHR 1;  2UXD I;  4I3H A;  2ZM6 E;  2BV3 A;  3ZKD A;  2Z5C A;  1N0V C;  2L33 A;  4HY1 A;  1YYW A;  2HHH I;  2JR1 A;  2V8P A;  4X64 E;  4WYQ B;  1DAR A;  3HUL A;  1N32 I;  2LJP A;  2YT4 A;  2V2V A;  4JI7 I;  1I94 I;  2V8Q B;  1Y6Z A;  1PKP A;  2VQF E;  3OML A;  4DR2 I;  2Z5C B;  3AV0 A;  3FIG A;  1KKH A;  3JAM C;  4B3R I;  1RC7 A;  4DKK A;  2B7T A;  4DU7 A;  4B3T I;  4LFA E;  3ADL A;  3T1Y E;  1ZM2 A;  1OJ4 A;  3H09 A;  5CFF E;  2UXD E;  1RQ0 A;  1EKZ A;  2L3J A;  1Z0V A;  1QU6 A;  4BS9 A;  2HHH E;  4DXL A;  2L2M A;  1WXR A;  2L2N A;  1IBM I;  3PYD A;  1N32 E;  4HYM A;  4DU8 A;  5IWA I;  4NXM E;  5A2Q C;  1ZXN A;  4JI7 E;  2CZ9 A;  3D4J A;  5GMD A;  1I94 E;  4BMJ A;  4L8N A;  4DR2 E;  1PVG A;  3KWR A;  2NA2 A;  4OX9 I;  3JTZ A;  3GON A;  4PRX A;  4TUG A;  2N3H A;  4B3R E;  1VIS A;  4B3T E;  4GKK I;  4X8W A;  1SR9 A;  2JOB A;  1HNZ I;  4URL A;  4JI1 I;  4AQY E;  1ZM9 A;  4LF7 E;  2UUB I;  3DF6 A;  1IBM E;  3HTX A;  4WFT A;  1XNQ I;  5IWA E;  2MDR A;  4OX9 E;  1H73 A;  1ZXM A;  2HFU A;  2FTX B;  5FWK A;  3LML A;  2LMZ A;  2RS7 A;  1HNX I;  1YZ9 A;  2UXC I;  2L6M A;  2VQE I;  4GKK E;  3WU6 A;  4ED4 A;  4KHP I;  1HNZ E;  2LE2 A;  4JI1 E;  4MYT A;  2UUB E;  1KIJ A;  4X62 I;  4DV4 E;  3DJW A;  2IOQ A;  1XNQ E;  4DV1 I;  4BC9 A;  3RMP A;  4PRV A;  3V5R A;  3P06 A;  1NZ0 A;  2A2C A;  2V89 A;  2YZT A;  4JI8 E;  5A2Q Q;  4WUB A;  4KQV A;  1HNX E;  3J80 C;  2UXC E;  2VQE E;  1FWK A;  4KHP E;  1FJG I;  3M6A A;  4IZJ D;  1IBL I;  3JU0 A;  4DR3 I;  1FI4 A;  1ELO A;  4WSP A;  4DV1 E;  1HR0 I;  3ZZU A;  3F0N A;  2Q2E B;  3MSW A;  2MC5 A;  4Z7C A;  4JI4 I;  1Z0G A;  4M1K A;  3WU3 A;  4FWG A;  3HXL A;  1H72 C;  3CWV A;  2K4V A;  1USU A;  4X65 I;  1H7U A;  5T6J A;  1FJG E;  2X36 A;  4IZK A;  1IBL E;  4BBY A;  4L5N C;  1WUU A;  2L8T A;  4JYA I;  4LF5 I;  4DMI A;  4HAC A;  3J7A G;  1HR0 E;  4ZVI A;  4PU9 A;  1S16 A;  1O0W A;  5DNY A;  2FGG A;  1HK7 A;  5LMU E;  4IZK B;  2LTR A;  4DR1 I;  5BR8 I;  2WZO A;  3HQ1 A;  4J8Z A;  3V2U C;  3IWD A;  4JI4 E;  4DR7 I;  1Y4U A;  2LJH A;  3B78 A;  4HAC B;  2BM1 A;  4X65 E;  1Z5B A;  5LMN I;  3F6H A;  3H4L A;  1XNR I;  3J80 Q;  3J81 C;  4YHH I;  4JYA E;  4LF5 E;  3ZM7 A;  4JI5 I;  2ZBK B;  3F6G A;  5ADZ A;  4B3M I;  1MU5 A;  3ZZT A;  3VK6 A;  4DR1 E;  2N3G A;  5BR8 E;  1USV A;  2HK3 A;  3ZZ0 A;  2O1V A;  4DR7 E;  2R42 A;  3PRY A;  4DV3 I;  3ZKB A;  4JI3 I;  2VF1 A;  2IOP A;  2AJ4 A;  1BKN A;  2R3V A;  4FN5 A;  3Q6M A;  1XNR E;  2JWO A;  4R8O A;  4YHH E;  2CG9 A;  3Q6N A;  4JI5 E;  4P78 A;  4B3M E;  2MC6 A;  2GQ0 A;  2UUC I;  2ODR C;  2VE7 C;  4JI3 E;  2A2D A;  2F8B A;  1KTV A;  3QT7 A;  3HJC A;  2KOU A;  4GEQ B;  5IT9 C;  3ADJ A;  1ZBT A;  2E5L I;  2UU9 I;  3J7A M;  1B63 A;  1Z0E A;  3Q1Q A;  5FLX C;  2HFS A;  3PYG A;  2NPF A;  1WHN A;  2V2Z A;  3J81 Q;  2E1R A;  1XMO I;  3JAM Q;  1J26 A;  4M30 A;  4OOG C;  2B3T B;  1ZBQ A;  4Q28 A;  2B7V A;  1Z59 A;  1DQ3 A;  4DPX A;  2F4V I;  2LTS A;  3LTO A;  2UU9 E;  3B8H A;  4X66 I;  2E1M A;  2ODR D;  3WU5 A;  1PIE A;  2V86 A;  2WW4 A;  1WHQ A;  2UUA I;  2JOX A;  2DEJ A;  2L92 A;  1XMO E;  2M1S A;  1NHI A;  1DI2 A;  5AE1 A;  4DV7 I;  1UIL A;  2V88 A;  4X62 E;  1NHH A;  2HK2 A;  4NXN I;  2UXB I;  1N33 I;  3K6Q A;  2EFG A;  4GKJ I;  2BM0 A;  3HPZ A;  2F4V E;  4JI0 I;  1X49 A;  2H36 X;  1A6F A;  4LFC I;  4JV5 I;  2RSM A;  2XEX A;  4LFB I;  4X66 E;  2DIX A;  4F9C B;  1HNW I;  3LPS A;  2JY9 A;  2GS8 A;  4DPU A;  1ZM3 A;  1Z0C A;  5IT9 Q;  2UUA E;  2HKJ A;  4DV5 I;  1IBK I;  4LF9 I;  4DUZ I;  3K85 A;  4JG4 A;  4DR3 E;  4DV7 E;  4NXN E;  3ZOQ B;  1T4O A;  4DUY I;  2UXB E;  4KZS A;  4F9A B;  1N33 E;  3PYF A;  2LUQ A;  4GKJ E;  2V34 A;  4JI0 E;  4XTJ A;  5F3W A;  4LFC E;  4JV5 E;  3PYE A;  4IZJ A;  2V85 A;  3J7Y p;  1XMQ I;  2KON A;  2PNM A;  1MG7 A;  5AE2 A;  1IBK E;  4DV6 I;  4LF9 E;  4DUZ E;  4YY3 I;  3HPS A;  2VQF I;  4IZJ B;  1S4E A;  1X48 A;  1FKA E;  2EZ6 A;  2DMY A;  4LF6 I;  2V87 A;  2Z5B A;  1U2R A;  4DR4 I;  2V2Q A;  4F9B B;  3VYX A;  1FWL A;  4P52 A;  1T4L B;  3VYY A;  4DR5 I;  4WUD A;  1XMQ E;  1K47 A;  2Z5B B;  1B62 A;  3QT5 A;  4NXM I;  2PNL A;  1STU A;  4DV6 E;  4DPW A;  4FW9 A;  4YY3 E;  5LMN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...