5BR8E

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5br8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8E02
2V2VA 3ADIA 1Z0GA 4DPWA 2YT4A 1QU6A 4DU7A 1J5EI 4DR1I 4JI3I 1UHZA 1NHIA 4LF9I 4K0KI 4DUZI 3WU6A 4FN5A 2BM0A 4ED4A 1H72C 2UUCI 1ELOA 4M1KA 1XHKA 4WFTA 1HNWE 3WU4A 4B3SI 4X65E 4X65I 4LFAE 4HACB 2LTRA 1KIJA 4DV6E 1KTVA 1N32E 1S16A 1PKPA 1PIEA 4HYMA 1IBKE 1RREA 3Q1QA 4JYAE 3J80Q 1YYOA 2V2ZA 2HFSA 4K0KE 1DI2A 4DR7I 1MU5A 4P7AA 4JI1I 4DV1I 2V34A 4R1FA 2N3HA 3D4JA 1H7UA 5BR8I 1HR0I 4X8WA 1B63A 3C4TA 1YYKA 4HACA 1Z0CA 4LF4I 2L33A 4JI8E 2RS7A 4FWDA 4NXNE 3JAMQ 4DR6E 1U2RA 2NUEA 4OX9I 4JI5I 1N0VC 1ZM4A 4JI2E 1Z0EA 1IBLE 3QT7A 4YHHI 1S4EA 4JV5E 4LF8E 1DARA 1FWKA 2L2KB 4UT4A 3ZKBA 1K47A 4X64I 4B3ME 4LFCE 4JI1E 1T4NA 1HNZI 1HNWI 3VYXA 4JI7E 1FJGI 2RTXA 2GS8A 3PYEA 4DU8A 2B7TA 3K17A 4DV3E 2ZM6E 2V2QA 1IBME 1OJ4A 1B62A 1N34I 1T4OA 4M30A 2LUPB 3ZKDA 2ZBKB 3QT8A 2LBSB 3H4LA 2UXBE 1EKZA 4X66I 4HXZA 2X7IA 4DR4E 1WHQA 2V8PA 2L3CA 4OX9E 1RR9A 4DV4E 3ADJA 2HK3A 2B7VA 1J5EE 5IT9C 1XMOI 4GKKE 2A2CA 1FKAE 4X64E 1N36I 1KKHA 3PYDA 1GQEA 3CWVA 3OTOI 4JI4I 1H7SA 1XMQE 4B3SE 3LNUA 4JI6E 1ZM2A 2L3JA 2RS6A 1N34E 4DV2I 4JI5E 4DR6I 4WUCA 2CPNA 4JYAI 1KVKA 2X36A 4DR1E 3T1YI 2NPFA 4PRVA 2VQFI 4YY3I 2L2NA 4B3TI 1BKNA 1XMOE 4DV5I 4LF5I 1NHHA 1UEKA 3F0NA 1FI4A 1EI1A 4X62E 1HR0E 4B3RE 1Z0BA 4DV0E 4DR3I 4DV7I 3HULA 4MYUA 5CFFE 3VYYA 2ZITA 4FWHA 2HFUA 3J81Q 4USKA 2LTSA 2OI2A 1X48A 4LF7I 4I3HA 4WUBA 2DEIA 2UXCI 1PVGA 2E1RA 2IHR1 3P1XA 4LF6E 3JAMC 1Z59A 3LTOA 2R3VA 4DPYA 4DXLA 4LF6I 5BR8E 1Z0VA 4DR5I 1Z5BA 3ZZ0A 3J80C 2NUFA 2UUCE 4DR7E 3J7Yp 2UXDE 4DPXA 1H73A 3M6AA 1Z0WA 4DKKA 4X66E 1FNMA 2BV3A 4JI8I 4LF4E 2UU9I 2UU9E 4JG4A 4GKKI 1YZ9A 2MDRA 4DR3E 2HKEA 4DV2E 1MG7A 2LJHA 4JI0E 1XMQI 1N33E 1ZBTA 4DR5E 5L3JA 5A2QC 4AQYI 4DUYI 1I94I 4DUYE 1I94E 4LF5E 1T4LB 4KQVA 2N3GA 3B78A 3LLHA 3ADGA 3GONA 3J7AG 2JY9A 4ZVIA 4HY1A 5IWAI 4JV5I 4YHHE 2UUBE 4MYTA 1N0UA 4GKJI 2KHXA 4KHPE 1XNQI 2J7KA 1MX0A 1UILA 4DV3I 1QZRA 1ZM9A 3T1HI 1A6FA 5FLXC 4DV7E 2UXDI 2L2MA 2NA2A 2UXBI 4LFBI 2F4VI 4DPTA 5IT9Q 4UTGA 2DIXA 4AQYE 4DR2I 1HNXE 2VQEE 5GMDA 5LMUE 1EA6A 2UXCE 4USMA 4DV1E 1N33I 1STUA 5A2QQ 4LF9E 4YY3E 3T1YE 1FWLA 1Z5CA 4KHPI 4DUZE 3PYGA 1YYWA 2R42A 4WYQB 4EMDA 3V2UC 4B3MI 1Z0TA 3C4BA 5LMNI 5IWAE 2DMYA 1FJGE 4JI7I 4B3RI 1X47A 2VF3A 1IBMI 4DV0I 3J7AM 4NXNI 2CZ9A 3OTOE 3PYFA 2LJPA 5GMEA 1H74A 4JI0I 1X49A 2VQFE 5LL6R 3WU5A 3ZZUA 4PRXA 3LPSA 4DV5E 1WHNA 2VQEI 2BM1A 5LMUI 1J26A 1IBKI 1XNRE 3J81C 4RPFA 2A2DA 2E5LE 1VISA 1D6TA 2NUGA 4JI3E 2XEXA 3QT6A 3WU3A 2LRSA 4DPUA 2HHHI 2UUAE 3ADLA 4FWGA 4URLA 1N36E 2DEJA 2EZ6A 5LMNE 2DB2A 5FLXQ 4JI4E 1HNZE 4GKJE 2ZM6I 4M2ZA 2B3TB 4Z7YA 4Z7CA 1N32I 2WW4A 4NXMI 3K1JA 4DR2E 3B82A 4DV4I 1IBLI 2F4VE 2E5LI 1NZ0A 4DR4I 4LF8I 1NHJA 1WUUA 2UUAI 2HK2A 4B3TE 2HHHE 4LF7E 2LUQA 1RC7A 3V5RA 2AJ4A 3T1HE 4XTJA 1Z5AA 4JI2I 3HTXA 1XNRI 1ZM3A 4X62I 4PU9A 3ZM7A 3ZZTA 1XNQE 4WUDA 2UUBI 2HKJA 1ZXMA 1RQ0A 4DV6I 2EFGA 4NXME 1HNXI 4OOGC 4LFCI 1ZXNA 2Q2EB 4FW9A 2JVAA 4P52A 4LFBE 4LFAI 4JI6I 3QT5A 1O0WA 2RSMA 3B8HA
chains in the Genus database with same CATH superfamily
2VRDA 1TF3A 2V2VA 4P7DA 2EQ3A 1P47A 5IV8B 3ADIA 4LOMA 4OO1D 2EPOA 1Z0GA 4DPWA 2YT4A 1QU6A 4BA2B 4DU7A 4DPUA 1J5EI 4DR1I 4JI3I 1UHZA 1NHIA 4ZYDA 4J3DA 4LF9I 1DQ3A 2C38A 2GO4A 4KWYA 4IJDA 2YTFA 1VI7A 4IS9A 2EL5A 4K0KI 3JU0A 1NEIA 3KZZA 2EJ4A 4DUZI 3WU6A 3FIGA 4FN5A 2G7HA 2BM0A 1T38A 4ED4A 2IOPA 4WXCA 1H72C 2YZTA 4R2PA 1X6HA 2C39A 4HTGA 2UUCI 2L92A 1ELOA 4M1KA 5TSEA 1XHKA 4WFTA 1HNWE 4AM3A 2WBTA 2EM4A 2EMYA 2ELZA 3WU4A 4B3SI 4IFDD 4X65E 4X65I 5JEAD 2E1MA 4F6MA 4LFAE 2DMIA 2C38B 2YTEA 4BHBA 1IQOA 4HACB 2LTRA 1KIJA 4MU1A 4DV6E 5K36D 1KTVA 1N32E 2GO3A 3WU3A 4R2DA 2K4VA 1S16A 3M85G 2MC6A 3P76A 1PKPA 2EMKA 1PIEA 2V87A 1IBKE 1RREA 4HYMA 2Z5CA 3OMLA 3BIDA 4JYAE 1R6MA 5JEAF 3J80Q 1HK7A 1YYOA 2V2ZA 2EOZA 2HFSA 4K0KE 1DI2A 2CSHA 3QG5C 3CDJA 1USUA 2M9AA 1UDOA 4DR7I 4HEIA 1MU5A 4P7AA 4JI1I 3VHTB 2ENAA 4DV1I 2EOQA 2YTJA 2NN6E 2BBGA 2V34A 2L6MA 4R1FA 2N3HA 3D4JA 1H7UA 5BR8I 1HR0I 4GZNC 2Z5BB 2VE7C 3AUZA 4MDTA 2EM5A 4X8WA 1SR9A 1B63A 2EOIA 3C4TA 2YPNA 1ZBQA 1YUIA 2WCC3 1X5WA 2EMLA 3L00A 1IQSA 2YTNA 4KZSA 5LLQA 2PO1A 1WRJA 1YYKA 4HACA 1Z1BA 2EMAA 2L33A 1Z0CA 4LF4I 4JI8E 2RQLA 2AE8A 2RS7A 5KL5A 4FWDA 3EPJA 1N3GA 4OZEA 5ADZA 2C37B 2EMBA 4F9CB 4NXNE 3HJCA 2EOOA 1A1JA 4BA1B 2Z5BA 3JAMQ 4DR6E 1U2RA 4OO1A 2NUEA 3Q6NA 4OX9I 4IFDC 4ZYEA 4JI5I 1N0VC 5K36B 2EPCA 2FV4B 4JI2E 1ZM4A 1Z0EA 3L7ZA 5AE3A 1IBLE 2EOXA 3IWBA 2PNLA 3P3EA 4MU4A 2M4IA 2EN3A 3QT7A 4AIMA 1QNTA 1S4EA 4LCFA 4Q28A 5ELWA 2M7QA 4JV5E 4LF8E 2JT2A 4LCGA 5C0XF 2R1FA 1DARA 2F8BA 4WPYA 1FWKA 2L2KB 4UT4A 5FWKA 3Q6MA 3ZKBA 2HC5A 1K47A 4ZYHA 2EMXA 2YSPA 5K36F 4X64I 4B3ME 2EOJA 4LFCE 4JI1E 2EL4A 3KRNA 1T4NA 1MGTA 3EPHA 2BA1G 3VK6A 2LV2A 1HNZI 1HNWI 4BS9A 4DMIA 4JI7E 2NABA 2MDGA 2RTXA 3VYXA 2BA0D 2GS8A 2V8QB 2B7TA 2EN1A 1T39A 3K17A 2DRPA 3PYEA 4DV3E 2ZM6E 2BV3A 2JE6B 2V2QA 4YHHI 2J7JA 4IZKB 1IBME 2V89A 1OJ4A 1B62A 4FW6A 5DRPA 1N34I 3DF6A 1T4OA 4M30A 2LUPB 2PO0A 3ZKDA 2EMCA 4L8NA 2ZBKB 1L4SA 5F3WA 1ZAAC 2FGGA 2LBSB 2EN8A 3H4LA 3QT8A 2UXBE 1EKZA 2O3ZA 4X66I 3HQ1A 3EPLA 2N8XA 2BB8A 4HXZA 2BR2A 2X7IA 4DR4E 2YU5A 3MHHC 2PRTA 1WHQA 1A1GA 3P3GA 2GHFA 2D9HA 2L3CA 2V8PA 3KZYA 4OX9E 2ELYA 2EM0A 1RR9A 2PNZB 5C0XB 4DV4E 5C0XC 3ADJA 2HK3A 2B7VA 1LLMC 2ODRC 2WZOA 1J5EE 5DRQA 4JI8I 1UBDC 3THOB 1TF6A 4O43A 2YSOA 5IT9C 2YRKA 4N4RB 1XMOI 4GKKE 2A2CA 1FKAE 3IWDA 4X64E 2V83A 1USVA 2EMZA 3MHSC 1A1KA 1N36I 1KKHA 3PYDA 4GQUA 1GQEA 3CWVA 2EMFA 1G2FC 1Y5YA 3OTOI 3ECRA 1JK2A 1BBGA 1XMQE 1H7SA 2PO2A 4JI4I 4IZKA 2NN6C 4B3SE 3LNUA 3C6KA 4LU9A 5A69A 4JI6E 1ZM2A 2L3JA 4R2AA 5AE1A 2C37A 2RS6A 1N34E 5JEAA 1JK1A 4DV2I 4JI5E 2EMWA 2JEAB 2WNRA 2LE2A 4DR6I 1PJQA 1AH5A 2EORA 4WUCA 5K36A 2CPNA 3MSWA 4JYAI 2I13A 4U3BA 2BR2B 3K85A 2A25A 2DLQA 2DGCA 1KVKA 3M7ND 2X36A 3K6QA 3M99B 2EN2A 4QNJA 5DROA 4DR1E 3T1YI 1BBOA 4PRVA 2NPFA 2VQFI 2EN7A 4YY3I 2L2NA 1DGCA 1BKNA 1XMOE 4B3TI 4GEQB 1PJTA 4DV5I 4LF5I 2EPPA 2YTOA 3F6GA 3QT6A 1NHHA 2WP8A 2YTQA 1UEKA 3C6MA 3F0NA 2EM7A 5K36C 4F2JC 1Y4SA 5JEAB 1FI4A 4QNKA 4WSPA 1EI1A 5EKWA 4X62E 5JEAC 1HR0E 1D6TA 5A6JA 2J65A 4ZYGA 3PS3A 1KYQA 4BC7A 4B3RE 4OO1B 2MKDA 1Z0BA 2C39B 2JOBA 1YH8A 4O4KA 4DV0E 2CG9A 4MLVA 2VF1A 3JTZA 2KONA 4DR3I 2UU9I 4BBYA 4MQYA 2WP8B 4DV7I 4IFDF 2WBSA 4R03A 5AC5A 5KL3A 1Y6ZA 2LO3A 5KL2A 4J8ZA 4O24A 2EPRA 3HULA 4OO1F 2B9DA 2DSYA 4MYUA 5CFFE 3VYYA 2ZITA 1P42A 2M1SA 4FWHA 2JEAA 1UDQA 1XXEA 2HFUA 5DNXA 3J81Q 4BMJA 4USKA 2EM6A 2Z5CB 2LTSA 2OI2A 3GCMA 4M9VC 1X48A 4LF7I 2EP3A 4I3HA 4WUBA 2DEIA 5C0XA 1PVGA 4NBQA 2UXCI 2ODRD 1UDSA 2E1RA 2IHR1 3P1XA 2O1TA 3JAMC 4LF6E 1Z59A 3LTOA 2R3VA 4DPYA 5DNYA 4DXLA 4LF6I 4LPFA 5BR8E 1KJKA 1Z0VA 4DR5I 1Z5BA 1YSAC 2LJUA 2EPMX 3ZZ0A 2MC5A 2GQ0A 3J80C 3DJWA 2NUFA 2UUCE 4DR7E 2MKNA 3J7Yp 1A1FA 1X3CA 2UXDE 2YTIA 4DPXA 1YPNA 2YRMA 3KWRA 1TN9A 1H73A 4FW5A 4OO1E 3M6AA 4BCAA 1AAYA 5A6BD 1Z0WA 4DKKA 5AASA 4X66E 2EE8A 3H09A 1EH8A 2KOUA 3F6HA 1WXRA 4LF4E 1FNMA 1OYPA 3THNA 1R6LA 2UU9E 2EQ1A 2EPAA 4X9JA 2RSIA 4JG4A 4GKKI 1YZ9A 2MDRA 4P78A 4DR3E 3BGHA 2CT1A 2HKEA 2JEBB 4DV2E 1EH6A 2PNMA 1MG7A 4IFDB 2YWQA 2ADRA 2LJHA 4JI0E 2YTPA 1XMQI 2JR1A 2HJJA 1N33E 2EPXA 1ZBTA 4DR5E 1WJPA 4MU0A 3L7ZB 3P06A 5L3JA 5A2QC 2JE6A 4DUYI 4AQYI 1I94I 4DUYE 1I94E 4LF5E 1T4LB 4KQVA 1RMDA 3U1KA 1OYRA 2N3GA 3B78A 3LLHA 3ADGA 3GONA 3J7AG 2EPNA 2JY9A 5A6BA 4BC9A 4IFDA 4ZVIA 4U3DA 4R8OA 4HY1A 4DU8A 5IWAI 4JV5I 3HXLA 4YHHE 2YTGA 2UUBE 1N0UA 1YHCA 4MYTA 2KHXA 4KHPE 1XNQI 4GKJI 2J7KA 1MX0A 1UILA 4DV3I 1QZRA 1ZM9A 5A6AA 3T1HI 1A6FA 2RPCA 5FLXC 4DV7E 2UXDI 2L2MA 3BBGA 2I9IA 4F54A 2NA2A 5IXMB 3Q1QA 2UXBI 1A1IA 1OYSA 4LFBI 3HPZA 2F4VI 2EN6A 4DPTA 4WSGA 2FTXB 2IERA 5IT9Q 5A6KA 1RHYA 4UTGA 3P3CA 2EMHA 2DIXA 4AQYE 4DR2I 1HNXE 2VQEE 5LMUE 5GMDA 2L8TA 2UXCE 1EA6A 4USMA 3M7NG 2EN4A 1GZ6A 2ENHA 3BF2A 4DV1E 2BA0G 5JEAE 1N33I 3UHMA 1STUA 5A2QQ 4IZJB 1PDAA 5T6JA 4LF9E 2PO2B 1X6EA 4YY3E 2ENCA 3T1YE 2EQ0A 2LVHA 1FWLA 1Z5CA 1YUJA 4KHPI 4DUZE 2LT7A 3PYGA 1YYWA 2R42A 2JOXA 2Z5EA 4F9AB 3HKMA 4WYQB 2EOMA 4NZVA 3V2UC 4EMDA 5EL9A 4TUIA 3GLLA 4B3MI 1Z0TA 2YU8A 3C4BA 5LMNI 5IWAE 4R2EA 2DMYA 1FJGE 4JI7I 2EOSA 1EH7A 4BA2A 4F6NA 3IWCA 4B3RI 2GPIA 2NN6B 2EPKX 1X47A 2VF3A 3HPSA 1IBMI 5KL7A 4DV0I 2JEBA 3PS1A 3J7AM 4NXNI 2CZ9A 2V88A 5AE2A 4FW4A 3OTOE 1Y4UA 1GTKA 4MU3A 2EOFA 2HGHA 3PYFA 4BA1A 2LJPA 4R2RA 5GMEA 2EMGA 1H74A 3M85D 3EQ1A 4RH8A 4OKGA 4JI0I 4Q35B 4FW3A 1X49A 2VESA 2VQFE 2NN6F 5LL6R 3WU5A 4M0VA 4IFDE 3ZZUA 4L5NC 4PRXA 1FJGI 3LPSA 1ZU1A 1WHNA 2LMZA 4R2SA 4DV5E 1A1HA 2BM1A 2CVEA 1J26A 2VQEI 5LMUI 4FW7A 1MEYC 3NZKA 4OO1C 1IBKI 1XNRE 3J81C 4RPFA 2EL6A 1A1LA 2EM9A 2E5LE 1E3HA 1VISA 2NUGA 2EOYA 4JI3E 2A2DA 2R76A 2LRSA 2IOQA 2XEXA 3PS2A 4F9BB 4N3OA 5C0XE 2JYAA 4TUGA 2HHHI 1F2IG 2UUAE 4BHCA 3ZOQB 1BB8A 3ADLA 2CTDA 2O1UA 3AV0A 2F1DA 4FWGA 4URLA 1N36E 2DEJA 2EZ6A 5LMNE 2DB2A 5FLXQ 4JI4E 3GMEA 1E3PA 1HNZE 3LMLA 4GKJE 2O1VA 2ZM6I 4M2ZA 2B3TB 3UK3C 2Q8UA 2JP9A 4Z7YA 4LCHA 5DNLA 4Z7CA 1N32I 2YRHA 5AC4A 1SFEA 1X6FA 5KL6A 1NCSA 2WW4A 4NXMI 3K1JA 3TQMA 2EMIA 2NN6D 4DR2E 3B82A 4DV4I 2E72A 5KL4A 3EPKA 1IBLI 2EM3A 2F4VE 2O1WA 4IZJA 1B69A 2E5LI 4WX9A 1NZ0A 1UDNA 2PO1B 4DR4I 4LF8I 1YFHA 1NHJA 4IS1C 1WUUA 2YTDA 4AIDA 2HK2A 4B3TE 3DD6A 2HHHE 2CGEA 2IESA 2UUAI 2EM2A 2LCEA 2LUQA 1RC7A 4LF7E 3V5RA 2AJ4A 1PJSA 3T1HE 1Y60A 1Z5AA 3HTXA 4XTJA 2PO0B 2EPLX 2H36X 1G2DC 4JI2I 1XNRI 4LTYA 1ZM3A 4X62I 4PU9A 3ZM7A 4O5GA 3ZZTA 2JPAA 2WBUA 2EWLA 5C0XD 3PRYA 1XNQE 5K36E 2BA1D 4WUDA 1IMUA 2UUBI 4FK5C 2HKJA 4R2QA 1ZXMA 1RQ0A 1UN6B 2JXPA 2NN6A 2EOEA 2DLKA 4ISAA 4DV6I 1ZR9A 4I8OA 4WXDA 4NXME 2EFGA 2EPZA 2EM8A 4OOGC 2PNZA 2K7IA 1HNXI 4LFCI 1ZXNA 2Q2EB 3H1CA 4FW9A 2JVAA 4IZJD 3B4TA 4NHRA 3RMPA 4RHBB 2WNRB 4P52A 4MLQA 2V85A 4LFBE 5DRRA 4LFAI 4R2CA 3CDIA 3QT5A 2GLIA 1O0WA 4JI6I 2EOHA 2RSMA 2JWOA 2EPUA 3U1YA 2V86A 3B8HA
chains in the Genus database with same CATH topology
2V2VA 4P7DA 3ADIA 1Z0GA 4DPWA 2YT4A 1QU6A 4DU7A 1J5EI 4DR1I 4JI3I 1UHZA 1NHIA 4LF9I 1DQ3A 4K0KI 3JU0A 4DUZI 3WU6A 3FIGA 4FN5A 2G7HA 2BM0A 4ED4A 2IOPA 1H72C 2YZTA 2UUCI 2L92A 1ELOA 4M1KA 1XHKA 4WFTA 1HNWE 3WU4A 4B3SI 4X65E 4X65I 2E1MA 4LFAE 4HACB 2LTRA 1KIJA 4DV6E 1KTVA 1N32E 2K4VA 1S16A 2MC6A 1PKPA 1PIEA 2V87A 1IBKE 1RREA 4HYMA 2Z5CA 3OMLA 4JYAE 3J80Q 3Q1QA 1HK7A 1YYOA 2V2ZA 2HFSA 4K0KE 1DI2A 1USUA 4DR7I 1MU5A 4P7AA 4JI1I 4DV1I 2V34A 2L6MA 4R1FA 2N3HA 3D4JA 1H7UA 5BR8I 1HR0I 2Z5BB 2VE7C 3AUZA 4X8WA 1SR9A 1B63A 3C4TA 1ZBQA 4KZSA 1YYKA 4HACA 1Z0CA 4LF4I 2L33A 4JI8E 2RS7A 4FWDA 5ADZA 4F9CB 4NXNE 3HJCA 3JAMQ 2Z5BA 4DR6E 1U2RA 2NUEA 3Q6NA 4OX9I 4JI5I 1N0VC 2FV4B 4JI2E 1ZM4A 1Z0EA 5AE3A 1IBLE 3IWBA 2PNLA 2M4IA 3QT7A 4YHHI 1S4EA 4Q28A 2M7QA 4JV5E 4LF8E 1DARA 2F8BA 4WPYA 1FWKA 2L2KB 4UT4A 5FWKA 3Q6MA 3ZKBA 1K47A 4X64I 4B3ME 4LFCE 4JI1E 1T4NA 3VK6A 1HNZI 1HNWI 4BS9A 4DMIA 4JI7E 3VYXA 2RTXA 1FJGI 2GS8A 3PYEA 2V8QB 2B7TA 3K17A 4DU8A 4DV3E 2ZM6E 2V2QA 4IZKB 1IBME 2V89A 1OJ4A 1B62A 1N34I 3DF6A 1T4OA 4M30A 2LUPB 3ZKDA 4L8NA 2ZBKB 5F3WA 2FGGA 2LBSB 3H4LA 3QT8A 2UXBE 1EKZA 4X66I 3HQ1A 4HXZA 2X7IA 4DR4E 1WHQA 2L3CA 2V8PA 4OX9E 1RR9A 4DV4E 3ADJA 2HK3A 2B7VA 2ODRC 2WZOA 1J5EE 5IT9C 1XMOI 4GKKE 2A2CA 1FKAE 3IWDA 4X64E 2V83A 1USVA 1N36I 1KKHA 3PYDA 1GQEA 3CWVA 3OTOI 4JI4I 1H7SA 1XMQE 4IZKA 4B3SE 3LNUA 4LU9A 4JI6E 1ZM2A 2L3JA 5AE1A 2RS6A 1N34E 4DV2I 4JI5E 4DR6I 2LE2A 4WUCA 2CPNA 3MSWA 4JYAI 3K85A 1KVKA 2X36A 3K6QA 4DR1E 3T1YI 2NPFA 4PRVA 2VQFI 4YY3I 2L2NA 4B3TI 1BKNA 1XMOE 4GEQB 4DV5I 4LF5I 3F6GA 1NHHA 1UEKA 3F0NA 1Y4SA 1FI4A 4WSPA 1EI1A 4X62E 1HR0E 4BC7A 4B3RE 1Z0BA 2JOBA 4DV0E 2CG9A 2VF1A 3JTZA 2KONA 4DR3I 4BBYA 4DV7I 4R03A 1Y6ZA 4J8ZA 3HULA 2B9DA 2DSYA 4MYUA 5CFFE 3VYYA 2ZITA 2M1SA 4FWHA 2HFUA 3J81Q 4BMJA 4USKA 2Z5CB 2LTSA 2OI2A 1X48A 4LF7I 4I3HA 4WUBA 2DEIA 2UXCI 1PVGA 2ODRD 2E1RA 2IHR1 3P1XA 2O1TA 3JAMC 4LF6E 1Z59A 3LTOA 2R3VA 4DPYA 5DNYA 4DXLA 4LF6I 5BR8E 1Z0VA 4DR5I 1Z5BA 3ZZ0A 2MC5A 2GQ0A 3J80C 3DJWA 2NUFA 2UUCE 4DR7E 3J7Yp 2UXDE 4DPXA 3KWRA 1H73A 3M6AA 4BCAA 1Z0WA 4DKKA 5AASA 4X66E 3H09A 1FNMA 2KOUA 3F6HA 1WXRA 4LF4E 2BV3A 4JI8I 2UU9I 2UU9E 4JG4A 4GKKI 1YZ9A 2MDRA 4P78A 4DR3E 2HKEA 4DV2E 2PNMA 1MG7A 2LJHA 4JI0E 1XMQI 2JR1A 1N33E 1ZBTA 4DR5E 3P06A 5L3JA 5A2QC 4AQYI 4DUYI 1I94I 4DUYE 1I94E 4LF5E 1T4LB 4KQVA 2N3GA 3B78A 3LLHA 3ADGA 3GONA 3J7AG 2JY9A 4BC9A 4ZVIA 4R8OA 4HY1A 5IWAI 4JV5I 3HXLA 4YHHE 2UUBE 4MYTA 1N0UA 4GKJI 2KHXA 4KHPE 1XNQI 2J7KA 1MX0A 1UILA 4DV3I 1QZRA 1ZM9A 3T1HI 1A6FA 5FLXC 4DV7E 2UXDI 2L2MA 4F54A 2NA2A 2UXBI 4LFBI 3HPZA 2F4VI 4DPTA 2FTXB 5IT9Q 4UTGA 2DIXA 4AQYE 4DR2I 1HNXE 2VQEE 5LMUE 5GMDA 2L8TA 2UXCE 1EA6A 4USMA 1GZ6A 4DV1E 1N33I 1STUA 5A2QQ 4IZJB 5T6JA 4LF9E 4YY3E 3T1YE 1FWLA 1Z5CA 4KHPI 4DUZE 3PYGA 1YYWA 2R42A 2JOXA 2Z5EA 4F9AB 4WYQB 4EMDA 3V2UC 4TUIA 4B3MI 1Z0TA 3C4BA 5LMNI 5IWAE 2DMYA 1FJGE 4JI7I 3IWCA 4B3RI 1X47A 2VF3A 3HPSA 1IBMI 4DV0I 3J7AM 4NXNI 2CZ9A 2V88A 5AE2A 3OTOE 1Y4UA 3PYFA 2LJPA 5GMEA 1H74A 4JI0I 1X49A 2VQFE 5LL6R 3WU5A 4M0VA 3ZZUA 4L5NC 4PRXA 3LPSA 2LMZA 1WHNA 4DV5E 2BM1A 2VQEI 5LMUI 1J26A 1IBKI 1XNRE 3J81C 4RPFA 2A2DA 2E5LE 1VISA 1D6TA 2NUGA 4JI3E 2XEXA 2IOQA 3QT6A 2LRSA 4N3OA 3WU3A 4DPUA 4F9BB 4TUGA 2HHHI 2UUAE 3ZOQB 3ADLA 2O1UA 3AV0A 4FWGA 4URLA 1N36E 2DEJA 2EZ6A 5LMNE 2DB2A 5FLXQ 4JI4E 1HNZE 3LMLA 4GKJE 2O1VA 2ZM6I 4M2ZA 2B3TB 4Z7YA 4Z7CA 1N32I 2WW4A 4NXMI 3K1JA 4DR2E 3B82A 4DV4I 1IBLI 2F4VE 2O1WA 4IZJA 2E5LI 1NZ0A 4DR4I 4LF8I 1NHJA 1WUUA 2UUAI 2HK2A 4B3TE 2HHHE 2CGEA 4LF7E 2LUQA 1RC7A 3V5RA 2AJ4A 3T1HE 4XTJA 1Z5AA 4JI2I 3HTXA 2H36X 1XNRI 4LTYA 1ZM3A 4X62I 4PU9A 3ZM7A 3ZZTA 2EWLA 3PRYA 1XNQE 4WUDA 2UUBI 2HKJA 1ZXMA 1RQ0A 4DV6I 4I8OA 2EFGA 4NXME 1HNXI 4OOGC 4LFCI 1ZXNA 2Q2EB 4FW9A 2JVAA 4IZJD 4P52A 3RMPA 2V85A 4LFBE 4LFAI 4JI6I 3QT5A 1O0WA 2RSMA 2JWOA 2V86A 3B8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2V A;  3ADI A;  1Z0G A;  4DPW A;  2YT4 A;  1QU6 A;  4DU7 A;  1J5E I;  4DR1 I;  4JI3 I;  1UHZ A;  1NHI A;  4LF9 I;  4K0K I;  4DUZ I;  3WU6 A;  4FN5 A;  2BM0 A;  4ED4 A;  1H72 C;  2UUC I;  1ELO A;  4M1K A;  1XHK A;  4WFT A;  1HNW E;  3WU4 A;  4B3S I;  4X65 E;  4X65 I;  4LFA E;  4HAC B;  2LTR A;  1KIJ A;  4DV6 E;  1KTV A;  1N32 E;  1S16 A;  1PKP A;  1PIE A;  4HYM A;  1IBK E;  1RRE A;  3Q1Q A;  4JYA E;  3J80 Q;  1YYO A;  2V2Z A;  2HFS A;  4K0K E;  1DI2 A;  4DR7 I;  1MU5 A;  4P7A A;  4JI1 I;  4DV1 I;  2V34 A;  4R1F A;  2N3H A;  3D4J A;  1H7U A;  5BR8 I;  1HR0 I;  4X8W A;  1B63 A;  3C4T A;  1YYK A;  4HAC A;  1Z0C A;  4LF4 I;  2L33 A;  4JI8 E;  2RS7 A;  4FWD A;  4NXN E;  3JAM Q;  4DR6 E;  1U2R A;  2NUE A;  4OX9 I;  4JI5 I;  1N0V C;  1ZM4 A;  4JI2 E;  1Z0E A;  1IBL E;  3QT7 A;  4YHH I;  1S4E A;  4JV5 E;  4LF8 E;  1DAR A;  1FWK A;  2L2K B;  4UT4 A;  3ZKB A;  1K47 A;  4X64 I;  4B3M E;  4LFC E;  4JI1 E;  1T4N A;  1HNZ I;  1HNW I;  3VYX A;  4JI7 E;  1FJG I;  2RTX A;  2GS8 A;  3PYE A;  4DU8 A;  2B7T A;  3K17 A;  4DV3 E;  2ZM6 E;  2V2Q A;  1IBM E;  1OJ4 A;  1B62 A;  1N34 I;  1T4O A;  4M30 A;  2LUP B;  3ZKD A;  2ZBK B;  3QT8 A;  2LBS B;  3H4L A;  2UXB E;  1EKZ A;  4X66 I;  4HXZ A;  2X7I A;  4DR4 E;  1WHQ A;  2V8P A;  2L3C A;  4OX9 E;  1RR9 A;  4DV4 E;  3ADJ A;  2HK3 A;  2B7V A;  1J5E E;  5IT9 C;  1XMO I;  4GKK E;  2A2C A;  1FKA E;  4X64 E;  1N36 I;  1KKH A;  3PYD A;  1GQE A;  3CWV A;  3OTO I;  4JI4 I;  1H7S A;  1XMQ E;  4B3S E;  3LNU A;  4JI6 E;  1ZM2 A;  2L3J A;  2RS6 A;  1N34 E;  4DV2 I;  4JI5 E;  4DR6 I;  4WUC A;  2CPN A;  4JYA I;  1KVK A;  2X36 A;  4DR1 E;  3T1Y I;  2NPF A;  4PRV A;  2VQF I;  4YY3 I;  2L2N A;  4B3T I;  1BKN A;  1XMO E;  4DV5 I;  4LF5 I;  1NHH A;  1UEK A;  3F0N A;  1FI4 A;  1EI1 A;  4X62 E;  1HR0 E;  4B3R E;  1Z0B A;  4DV0 E;  4DR3 I;  4DV7 I;  3HUL A;  4MYU A;  5CFF E;  3VYY A;  2ZIT A;  4FWH A;  2HFU A;  3J81 Q;  4USK A;  2LTS A;  2OI2 A;  1X48 A;  4LF7 I;  4I3H A;  4WUB A;  2DEI A;  2UXC I;  1PVG A;  2E1R A;  2IHR 1;  3P1X A;  4LF6 E;  3JAM C;  1Z59 A;  3LTO A;  2R3V A;  4DPY A;  4DXL A;  4LF6 I;  5BR8 E;  1Z0V A;  4DR5 I;  1Z5B A;  3ZZ0 A;  3J80 C;  2NUF A;  2UUC E;  4DR7 E;  3J7Y p;  2UXD E;  4DPX A;  1H73 A;  3M6A A;  1Z0W A;  4DKK A;  4X66 E;  1FNM A;  2BV3 A;  4JI8 I;  4LF4 E;  2UU9 I;  2UU9 E;  4JG4 A;  4GKK I;  1YZ9 A;  2MDR A;  4DR3 E;  2HKE A;  4DV2 E;  1MG7 A;  2LJH A;  4JI0 E;  1XMQ I;  1N33 E;  1ZBT A;  4DR5 E;  5L3J A;  5A2Q C;  4AQY I;  4DUY I;  1I94 I;  4DUY E;  1I94 E;  4LF5 E;  1T4L B;  4KQV A;  2N3G A;  3B78 A;  3LLH A;  3ADG A;  3GON A;  3J7A G;  2JY9 A;  4ZVI A;  4HY1 A;  5IWA I;  4JV5 I;  4YHH E;  2UUB E;  4MYT A;  1N0U A;  4GKJ I;  2KHX A;  4KHP E;  1XNQ I;  2J7K A;  1MX0 A;  1UIL A;  4DV3 I;  1QZR A;  1ZM9 A;  3T1H I;  1A6F A;  5FLX C;  4DV7 E;  2UXD I;  2L2M A;  2NA2 A;  2UXB I;  4LFB I;  2F4V I;  4DPT A;  5IT9 Q;  4UTG A;  2DIX A;  4AQY E;  4DR2 I;  1HNX E;  2VQE E;  5GMD A;  5LMU E;  1EA6 A;  2UXC E;  4USM A;  4DV1 E;  1N33 I;  1STU A;  5A2Q Q;  4LF9 E;  4YY3 E;  3T1Y E;  1FWL A;  1Z5C A;  4KHP I;  4DUZ E;  3PYG A;  1YYW A;  2R42 A;  4WYQ B;  4EMD A;  3V2U C;  4B3M I;  1Z0T A;  3C4B A;  5LMN I;  5IWA E;  2DMY A;  1FJG E;  4JI7 I;  4B3R I;  1X47 A;  2VF3 A;  1IBM I;  4DV0 I;  3J7A M;  4NXN I;  2CZ9 A;  3OTO E;  3PYF A;  2LJP A;  5GME A;  1H74 A;  4JI0 I;  1X49 A;  2VQF E;  5LL6 R;  3WU5 A;  3ZZU A;  4PRX A;  3LPS A;  4DV5 E;  1WHN A;  2VQE I;  2BM1 A;  5LMU I;  1J26 A;  1IBK I;  1XNR E;  3J81 C;  4RPF A;  2A2D A;  2E5L E;  1VIS A;  1D6T A;  2NUG A;  4JI3 E;  2XEX A;  3QT6 A;  3WU3 A;  2LRS A;  4DPU A;  2HHH I;  2UUA E;  3ADL A;  4FWG A;  4URL A;  1N36 E;  2DEJ A;  2EZ6 A;  5LMN E;  2DB2 A;  5FLX Q;  4JI4 E;  1HNZ E;  4GKJ E;  2ZM6 I;  4M2Z A;  2B3T B;  4Z7Y A;  4Z7C A;  1N32 I;  2WW4 A;  4NXM I;  3K1J A;  4DR2 E;  3B82 A;  4DV4 I;  1IBL I;  2F4V E;  2E5L I;  1NZ0 A;  4DR4 I;  4LF8 I;  1NHJ A;  1WUU A;  2UUA I;  2HK2 A;  4B3T E;  2HHH E;  4LF7 E;  2LUQ A;  1RC7 A;  3V5R A;  2AJ4 A;  3T1H E;  4XTJ A;  1Z5A A;  4JI2 I;  3HTX A;  1XNR I;  1ZM3 A;  4X62 I;  4PU9 A;  3ZM7 A;  3ZZT A;  1XNQ E;  4WUD A;  2UUB I;  2HKJ A;  1ZXM A;  1RQ0 A;  4DV6 I;  2EFG A;  4NXM E;  1HNX I;  4OOG C;  4LFC I;  1ZXN A;  2Q2E B;  4FW9 A;  2JVA A;  4P52 A;  4LFB E;  4LFA I;  4JI6 I;  3QT5 A;  1O0W A;  2RSM A;  3B8H A; 
#chains in the Genus database with same CATH topology
 2VRD A;  1TF3 A;  2V2V A;  4P7D A;  2EQ3 A;  1P47 A;  5IV8 B;  3ADI A;  4LOM A;  4OO1 D;  2EPO A;  1Z0G A;  4DPW A;  2YT4 A;  1QU6 A;  4BA2 B;  4DU7 A;  4DPU A;  1J5E I;  4DR1 I;  4JI3 I;  1UHZ A;  1NHI A;  4ZYD A;  4J3D A;  4LF9 I;  1DQ3 A;  2C38 A;  2GO4 A;  4KWY A;  4IJD A;  2YTF A;  1VI7 A;  4IS9 A;  2EL5 A;  4K0K I;  3JU0 A;  1NEI A;  3KZZ A;  2EJ4 A;  4DUZ I;  3WU6 A;  3FIG A;  4FN5 A;  2G7H A;  2BM0 A;  1T38 A;  4ED4 A;  2IOP A;  4WXC A;  1H72 C;  2YZT A;  4R2P A;  1X6H A;  2C39 A;  4HTG A;  2UUC I;  2L92 A;  1ELO A;  4M1K A;  5TSE A;  1XHK A;  4WFT A;  1HNW E;  4AM3 A;  2WBT A;  2EM4 A;  2EMY A;  2ELZ A;  3WU4 A;  4B3S I;  4IFD D;  4X65 E;  4X65 I;  5JEA D;  2E1M A;  4F6M A;  4LFA E;  2DMI A;  2C38 B;  2YTE A;  4BHB A;  1IQO A;  4HAC B;  2LTR A;  1KIJ A;  4MU1 A;  4DV6 E;  5K36 D;  1KTV A;  1N32 E;  2GO3 A;  3WU3 A;  4R2D A;  2K4V A;  1S16 A;  3M85 G;  2MC6 A;  3P76 A;  1PKP A;  2EMK A;  1PIE A;  2V87 A;  1IBK E;  1RRE A;  4HYM A;  2Z5C A;  3OML A;  3BID A;  4JYA E;  1R6M A;  5JEA F;  3J80 Q;  1HK7 A;  1YYO A;  2V2Z A;  2EOZ A;  2HFS A;  4K0K E;  1DI2 A;  2CSH A;  3QG5 C;  3CDJ A;  1USU A;  2M9A A;  1UDO A;  4DR7 I;  4HEI A;  1MU5 A;  4P7A A;  4JI1 I;  3VHT B;  2ENA A;  4DV1 I;  2EOQ A;  2YTJ A;  2NN6 E;  2BBG A;  2V34 A;  2L6M A;  4R1F A;  2N3H A;  3D4J A;  1H7U A;  5BR8 I;  1HR0 I;  4GZN C;  2Z5B B;  2VE7 C;  3AUZ A;  4MDT A;  2EM5 A;  4X8W A;  1SR9 A;  1B63 A;  2EOI A;  3C4T A;  2YPN A;  1ZBQ A;  1YUI A;  2WCC 3;  1X5W A;  2EML A;  3L00 A;  1IQS A;  2YTN A;  4KZS A;  5LLQ A;  2PO1 A;  1WRJ A;  1YYK A;  4HAC A;  1Z1B A;  2EMA A;  2L33 A;  1Z0C A;  4LF4 I;  4JI8 E;  2RQL A;  2AE8 A;  2RS7 A;  5KL5 A;  4FWD A;  3EPJ A;  1N3G A;  4OZE A;  5ADZ A;  2C37 B;  2EMB A;  4F9C B;  4NXN E;  3HJC A;  2EOO A;  1A1J A;  4BA1 B;  2Z5B A;  3JAM Q;  4DR6 E;  1U2R A;  4OO1 A;  2NUE A;  3Q6N A;  4OX9 I;  4IFD C;  4ZYE A;  4JI5 I;  1N0V C;  5K36 B;  2EPC A;  2FV4 B;  4JI2 E;  1ZM4 A;  1Z0E A;  3L7Z A;  5AE3 A;  1IBL E;  2EOX A;  3IWB A;  2PNL A;  3P3E A;  4MU4 A;  2M4I A;  2EN3 A;  3QT7 A;  4AIM A;  1QNT A;  1S4E A;  4LCF A;  4Q28 A;  5ELW A;  2M7Q A;  4JV5 E;  4LF8 E;  2JT2 A;  4LCG A;  5C0X F;  2R1F A;  1DAR A;  2F8B A;  4WPY A;  1FWK A;  2L2K B;  4UT4 A;  5FWK A;  3Q6M A;  3ZKB A;  2HC5 A;  1K47 A;  4ZYH A;  2EMX A;  2YSP A;  5K36 F;  4X64 I;  4B3M E;  2EOJ A;  4LFC E;  4JI1 E;  2EL4 A;  3KRN A;  1T4N A;  1MGT A;  3EPH A;  2BA1 G;  3VK6 A;  2LV2 A;  1HNZ I;  1HNW I;  4BS9 A;  4DMI A;  4JI7 E;  2NAB A;  2MDG A;  2RTX A;  3VYX A;  2BA0 D;  2GS8 A;  2V8Q B;  2B7T A;  2EN1 A;  1T39 A;  3K17 A;  2DRP A;  3PYE A;  4DV3 E;  2ZM6 E;  2BV3 A;  2JE6 B;  2V2Q A;  4YHH I;  2J7J A;  4IZK B;  1IBM E;  2V89 A;  1OJ4 A;  1B62 A;  4FW6 A;  5DRP A;  1N34 I;  3DF6 A;  1T4O A;  4M30 A;  2LUP B;  2PO0 A;  3ZKD A;  2EMC A;  4L8N A;  2ZBK B;  1L4S A;  5F3W A;  1ZAA C;  2FGG A;  2LBS B;  2EN8 A;  3H4L A;  3QT8 A;  2UXB E;  1EKZ A;  2O3Z A;  4X66 I;  3HQ1 A;  3EPL A;  2N8X A;  2BB8 A;  4HXZ A;  2BR2 A;  2X7I A;  4DR4 E;  2YU5 A;  3MHH C;  2PRT A;  1WHQ A;  1A1G A;  3P3G A;  2GHF A;  2D9H A;  2L3C A;  2V8P A;  3KZY A;  4OX9 E;  2ELY A;  2EM0 A;  1RR9 A;  2PNZ B;  5C0X B;  4DV4 E;  5C0X C;  3ADJ A;  2HK3 A;  2B7V A;  1LLM C;  2ODR C;  2WZO A;  1J5E E;  5DRQ A;  4JI8 I;  1UBD C;  3THO B;  1TF6 A;  4O43 A;  2YSO A;  5IT9 C;  2YRK A;  4N4R B;  1XMO I;  4GKK E;  2A2C A;  1FKA E;  3IWD A;  4X64 E;  2V83 A;  1USV A;  2EMZ A;  3MHS C;  1A1K A;  1N36 I;  1KKH A;  3PYD A;  4GQU A;  1GQE A;  3CWV A;  2EMF A;  1G2F C;  1Y5Y A;  3OTO I;  3ECR A;  1JK2 A;  1BBG A;  1XMQ E;  1H7S A;  2PO2 A;  4JI4 I;  4IZK A;  2NN6 C;  4B3S E;  3LNU A;  3C6K A;  4LU9 A;  5A69 A;  4JI6 E;  1ZM2 A;  2L3J A;  4R2A A;  5AE1 A;  2C37 A;  2RS6 A;  1N34 E;  5JEA A;  1JK1 A;  4DV2 I;  4JI5 E;  2EMW A;  2JEA B;  2WNR A;  2LE2 A;  4DR6 I;  1PJQ A;  1AH5 A;  2EOR A;  4WUC A;  5K36 A;  2CPN A;  3MSW A;  4JYA I;  2I13 A;  4U3B A;  2BR2 B;  3K85 A;  2A25 A;  2DLQ A;  2DGC A;  1KVK A;  3M7N D;  2X36 A;  3K6Q A;  3M99 B;  2EN2 A;  4QNJ A;  5DRO A;  4DR1 E;  3T1Y I;  1BBO A;  4PRV A;  2NPF A;  2VQF I;  2EN7 A;  4YY3 I;  2L2N A;  1DGC A;  1BKN A;  1XMO E;  4B3T I;  4GEQ B;  1PJT A;  4DV5 I;  4LF5 I;  2EPP A;  2YTO A;  3F6G A;  3QT6 A;  1NHH A;  2WP8 A;  2YTQ A;  1UEK A;  3C6M A;  3F0N A;  2EM7 A;  5K36 C;  4F2J C;  1Y4S A;  5JEA B;  1FI4 A;  4QNK A;  4WSP A;  1EI1 A;  5EKW A;  4X62 E;  5JEA C;  1HR0 E;  1D6T A;  5A6J A;  2J65 A;  4ZYG A;  3PS3 A;  1KYQ A;  4BC7 A;  4B3R E;  4OO1 B;  2MKD A;  1Z0B A;  2C39 B;  2JOB A;  1YH8 A;  4O4K A;  4DV0 E;  2CG9 A;  4MLV A;  2VF1 A;  3JTZ A;  2KON A;  4DR3 I;  2UU9 I;  4BBY A;  4MQY A;  2WP8 B;  4DV7 I;  4IFD F;  2WBS A;  4R03 A;  5AC5 A;  5KL3 A;  1Y6Z A;  2LO3 A;  5KL2 A;  4J8Z A;  4O24 A;  2EPR A;  3HUL A;  4OO1 F;  2B9D A;  2DSY A;  4MYU A;  5CFF E;  3VYY A;  2ZIT A;  1P42 A;  2M1S A;  4FWH A;  2JEA A;  1UDQ A;  1XXE A;  2HFU A;  5DNX A;  3J81 Q;  4BMJ A;  4USK A;  2EM6 A;  2Z5C B;  2LTS A;  2OI2 A;  3GCM A;  4M9V C;  1X48 A;  4LF7 I;  2EP3 A;  4I3H A;  4WUB A;  2DEI A;  5C0X A;  1PVG A;  4NBQ A;  2UXC I;  2ODR D;  1UDS A;  2E1R A;  2IHR 1;  3P1X A;  2O1T A;  3JAM C;  4LF6 E;  1Z59 A;  3LTO A;  2R3V A;  4DPY A;  5DNY A;  4DXL A;  4LF6 I;  4LPF A;  5BR8 E;  1KJK A;  1Z0V A;  4DR5 I;  1Z5B A;  1YSA C;  2LJU A;  2EPM X;  3ZZ0 A;  2MC5 A;  2GQ0 A;  3J80 C;  3DJW A;  2NUF A;  2UUC E;  4DR7 E;  2MKN A;  3J7Y p;  1A1F A;  1X3C A;  2UXD E;  2YTI A;  4DPX A;  1YPN A;  2YRM A;  3KWR A;  1TN9 A;  1H73 A;  4FW5 A;  4OO1 E;  3M6A A;  4BCA A;  1AAY A;  5A6B D;  1Z0W A;  4DKK A;  5AAS A;  4X66 E;  2EE8 A;  3H09 A;  1EH8 A;  2KOU A;  3F6H A;  1WXR A;  4LF4 E;  1FNM A;  1OYP A;  3THN A;  1R6L A;  2UU9 E;  2EQ1 A;  2EPA A;  4X9J A;  2RSI A;  4JG4 A;  4GKK I;  1YZ9 A;  2MDR A;  4P78 A;  4DR3 E;  3BGH A;  2CT1 A;  2HKE A;  2JEB B;  4DV2 E;  1EH6 A;  2PNM A;  1MG7 A;  4IFD B;  2YWQ A;  2ADR A;  2LJH A;  4JI0 E;  2YTP A;  1XMQ I;  2JR1 A;  2HJJ A;  1N33 E;  2EPX A;  1ZBT A;  4DR5 E;  1WJP A;  4MU0 A;  3L7Z B;  3P06 A;  5L3J A;  5A2Q C;  2JE6 A;  4DUY I;  4AQY I;  1I94 I;  4DUY E;  1I94 E;  4LF5 E;  1T4L B;  4KQV A;  1RMD A;  3U1K A;  1OYR A;  2N3G A;  3B78 A;  3LLH A;  3ADG A;  3GON A;  3J7A G;  2EPN A;  2JY9 A;  5A6B A;  4BC9 A;  4IFD A;  4ZVI A;  4U3D A;  4R8O A;  4HY1 A;  4DU8 A;  5IWA I;  4JV5 I;  3HXL A;  4YHH E;  2YTG A;  2UUB E;  1N0U A;  1YHC A;  4MYT A;  2KHX A;  4KHP E;  1XNQ I;  4GKJ I;  2J7K A;  1MX0 A;  1UIL A;  4DV3 I;  1QZR A;  1ZM9 A;  5A6A A;  3T1H I;  1A6F A;  2RPC A;  5FLX C;  4DV7 E;  2UXD I;  2L2M A;  3BBG A;  2I9I A;  4F54 A;  2NA2 A;  5IXM B;  3Q1Q A;  2UXB I;  1A1I A;  1OYS A;  4LFB I;  3HPZ A;  2F4V I;  2EN6 A;  4DPT A;  4WSG A;  2FTX B;  2IER A;  5IT9 Q;  5A6K A;  1RHY A;  4UTG A;  3P3C A;  2EMH A;  2DIX A;  4AQY E;  4DR2 I;  1HNX E;  2VQE E;  5LMU E;  5GMD A;  2L8T A;  2UXC E;  1EA6 A;  4USM A;  3M7N G;  2EN4 A;  1GZ6 A;  2ENH A;  3BF2 A;  4DV1 E;  2BA0 G;  5JEA E;  1N33 I;  3UHM A;  1STU A;  5A2Q Q;  4IZJ B;  1PDA A;  5T6J A;  4LF9 E;  2PO2 B;  1X6E A;  4YY3 E;  2ENC A;  3T1Y E;  2EQ0 A;  2LVH A;  1FWL A;  1Z5C A;  1YUJ A;  4KHP I;  4DUZ E;  2LT7 A;  3PYG A;  1YYW A;  2R42 A;  2JOX A;  2Z5E A;  4F9A B;  3HKM A;  4WYQ B;  2EOM A;  4NZV A;  3V2U C;  4EMD A;  5EL9 A;  4TUI A;  3GLL A;  4B3M I;  1Z0T A;  2YU8 A;  3C4B A;  5LMN I;  5IWA E;  4R2E A;  2DMY A;  1FJG E;  4JI7 I;  2EOS A;  1EH7 A;  4BA2 A;  4F6N A;  3IWC A;  4B3R I;  2GPI A;  2NN6 B;  2EPK X;  1X47 A;  2VF3 A;  3HPS A;  1IBM I;  5KL7 A;  4DV0 I;  2JEB A;  3PS1 A;  3J7A M;  4NXN I;  2CZ9 A;  2V88 A;  5AE2 A;  4FW4 A;  3OTO E;  1Y4U A;  1GTK A;  4MU3 A;  2EOF A;  2HGH A;  3PYF A;  4BA1 A;  2LJP A;  4R2R A;  5GME A;  2EMG A;  1H74 A;  3M85 D;  3EQ1 A;  4RH8 A;  4OKG A;  4JI0 I;  4Q35 B;  4FW3 A;  1X49 A;  2VES A;  2VQF E;  2NN6 F;  5LL6 R;  3WU5 A;  4M0V A;  4IFD E;  3ZZU A;  4L5N C;  4PRX A;  1FJG I;  3LPS A;  1ZU1 A;  1WHN A;  2LMZ A;  4R2S A;  4DV5 E;  1A1H A;  2BM1 A;  2CVE A;  1J26 A;  2VQE I;  5LMU I;  4FW7 A;  1MEY C;  3NZK A;  4OO1 C;  1IBK I;  1XNR E;  3J81 C;  4RPF A;  2EL6 A;  1A1L A;  2EM9 A;  2E5L E;  1E3H A;  1VIS A;  2NUG A;  2EOY A;  4JI3 E;  2A2D A;  2R76 A;  2LRS A;  2IOQ A;  2XEX A;  3PS2 A;  4F9B B;  4N3O A;  5C0X E;  2JYA A;  4TUG A;  2HHH I;  1F2I G;  2UUA E;  4BHC A;  3ZOQ B;  1BB8 A;  3ADL A;  2CTD A;  2O1U A;  3AV0 A;  2F1D A;  4FWG A;  4URL A;  1N36 E;  2DEJ A;  2EZ6 A;  5LMN E;  2DB2 A;  5FLX Q;  4JI4 E;  3GME A;  1E3P A;  1HNZ E;  3LML A;  4GKJ E;  2O1V A;  2ZM6 I;  4M2Z A;  2B3T B;  3UK3 C;  2Q8U A;  2JP9 A;  4Z7Y A;  4LCH A;  5DNL A;  4Z7C A;  1N32 I;  2YRH A;  5AC4 A;  1SFE A;  1X6F A;  5KL6 A;  1NCS A;  2WW4 A;  4NXM I;  3K1J A;  3TQM A;  2EMI A;  2NN6 D;  4DR2 E;  3B82 A;  4DV4 I;  2E72 A;  5KL4 A;  3EPK A;  1IBL I;  2EM3 A;  2F4V E;  2O1W A;  4IZJ A;  1B69 A;  2E5L I;  4WX9 A;  1NZ0 A;  1UDN A;  2PO1 B;  4DR4 I;  4LF8 I;  1YFH A;  1NHJ A;  4IS1 C;  1WUU A;  2YTD A;  4AID A;  2HK2 A;  4B3T E;  3DD6 A;  2HHH E;  2CGE A;  2IES A;  2UUA I;  2EM2 A;  2LCE A;  2LUQ A;  1RC7 A;  4LF7 E;  3V5R A;  2AJ4 A;  1PJS A;  3T1H E;  1Y60 A;  1Z5A A;  3HTX A;  4XTJ A;  2PO0 B;  2EPL X;  2H36 X;  1G2D C;  4JI2 I;  1XNR I;  4LTY A;  1ZM3 A;  4X62 I;  4PU9 A;  3ZM7 A;  4O5G A;  3ZZT A;  2JPA A;  2WBU A;  2EWL A;  5C0X D;  3PRY A;  1XNQ E;  5K36 E;  2BA1 D;  4WUD A;  1IMU A;  2UUB I;  4FK5 C;  2HKJ A;  4R2Q A;  1ZXM A;  1RQ0 A;  1UN6 B;  2JXP A;  2NN6 A;  2EOE A;  2DLK A;  4ISA A;  4DV6 I;  1ZR9 A;  4I8O A;  4WXD A;  4NXM E;  2EFG A;  2EPZ A;  2EM8 A;  4OOG C;  2PNZ A;  2K7I A;  1HNX I;  4LFC I;  1ZXN A;  2Q2E B;  3H1C A;  4FW9 A;  2JVA A;  4IZJ D;  3B4T A;  4NHR A;  3RMP A;  4RHB B;  2WNR B;  4P52 A;  4MLQ A;  2V85 A;  4LFB E;  5DRR A;  4LFA I;  4R2C A;  3CDI A;  3QT5 A;  2GLI A;  1O0W A;  4JI6 I;  2EOH A;  2RSM A;  2JWO A;  2EPU A;  3U1Y A;  2V86 A;  3B8H A; 
#chains in the Genus database with same CATH homology
 2V2V A;  4P7D A;  3ADI A;  1Z0G A;  4DPW A;  2YT4 A;  1QU6 A;  4DU7 A;  1J5E I;  4DR1 I;  4JI3 I;  1UHZ A;  1NHI A;  4LF9 I;  1DQ3 A;  4K0K I;  3JU0 A;  4DUZ I;  3WU6 A;  3FIG A;  4FN5 A;  2G7H A;  2BM0 A;  4ED4 A;  2IOP A;  1H72 C;  2YZT A;  2UUC I;  2L92 A;  1ELO A;  4M1K A;  1XHK A;  4WFT A;  1HNW E;  3WU4 A;  4B3S I;  4X65 E;  4X65 I;  2E1M A;  4LFA E;  4HAC B;  2LTR A;  1KIJ A;  4DV6 E;  1KTV A;  1N32 E;  2K4V A;  1S16 A;  2MC6 A;  1PKP A;  1PIE A;  2V87 A;  1IBK E;  1RRE A;  4HYM A;  2Z5C A;  3OML A;  4JYA E;  3J80 Q;  3Q1Q A;  1HK7 A;  1YYO A;  2V2Z A;  2HFS A;  4K0K E;  1DI2 A;  1USU A;  4DR7 I;  1MU5 A;  4P7A A;  4JI1 I;  4DV1 I;  2V34 A;  2L6M A;  4R1F A;  2N3H A;  3D4J A;  1H7U A;  5BR8 I;  1HR0 I;  2Z5B B;  2VE7 C;  3AUZ A;  4X8W A;  1SR9 A;  1B63 A;  3C4T A;  1ZBQ A;  4KZS A;  1YYK A;  4HAC A;  1Z0C A;  4LF4 I;  2L33 A;  4JI8 E;  2RS7 A;  4FWD A;  5ADZ A;  4F9C B;  4NXN E;  3HJC A;  3JAM Q;  2Z5B A;  4DR6 E;  1U2R A;  2NUE A;  3Q6N A;  4OX9 I;  4JI5 I;  1N0V C;  2FV4 B;  4JI2 E;  1ZM4 A;  1Z0E A;  5AE3 A;  1IBL E;  3IWB A;  2PNL A;  2M4I A;  3QT7 A;  4YHH I;  1S4E A;  4Q28 A;  2M7Q A;  4JV5 E;  4LF8 E;  1DAR A;  2F8B A;  4WPY A;  1FWK A;  2L2K B;  4UT4 A;  5FWK A;  3Q6M A;  3ZKB A;  1K47 A;  4X64 I;  4B3M E;  4LFC E;  4JI1 E;  1T4N A;  3VK6 A;  1HNZ I;  1HNW I;  4BS9 A;  4DMI A;  4JI7 E;  3VYX A;  2RTX A;  1FJG I;  2GS8 A;  3PYE A;  2V8Q B;  2B7T A;  3K17 A;  4DU8 A;  4DV3 E;  2ZM6 E;  2V2Q A;  4IZK B;  1IBM E;  2V89 A;  1OJ4 A;  1B62 A;  1N34 I;  3DF6 A;  1T4O A;  4M30 A;  2LUP B;  3ZKD A;  4L8N A;  2ZBK B;  5F3W A;  2FGG A;  2LBS B;  3H4L A;  3QT8 A;  2UXB E;  1EKZ A;  4X66 I;  3HQ1 A;  4HXZ A;  2X7I A;  4DR4 E;  1WHQ A;  2L3C A;  2V8P A;  4OX9 E;  1RR9 A;  4DV4 E;  3ADJ A;  2HK3 A;  2B7V A;  2ODR C;  2WZO A;  1J5E E;  5IT9 C;  1XMO I;  4GKK E;  2A2C A;  1FKA E;  3IWD A;  4X64 E;  2V83 A;  1USV A;  1N36 I;  1KKH A;  3PYD A;  1GQE A;  3CWV A;  3OTO I;  4JI4 I;  1H7S A;  1XMQ E;  4IZK A;  4B3S E;  3LNU A;  4LU9 A;  4JI6 E;  1ZM2 A;  2L3J A;  5AE1 A;  2RS6 A;  1N34 E;  4DV2 I;  4JI5 E;  4DR6 I;  2LE2 A;  4WUC A;  2CPN A;  3MSW A;  4JYA I;  3K85 A;  1KVK A;  2X36 A;  3K6Q A;  4DR1 E;  3T1Y I;  2NPF A;  4PRV A;  2VQF I;  4YY3 I;  2L2N A;  4B3T I;  1BKN A;  1XMO E;  4GEQ B;  4DV5 I;  4LF5 I;  3F6G A;  1NHH A;  1UEK A;  3F0N A;  1Y4S A;  1FI4 A;  4WSP A;  1EI1 A;  4X62 E;  1HR0 E;  4BC7 A;  4B3R E;  1Z0B A;  2JOB A;  4DV0 E;  2CG9 A;  2VF1 A;  3JTZ A;  2KON A;  4DR3 I;  4BBY A;  4DV7 I;  4R03 A;  1Y6Z A;  4J8Z A;  3HUL A;  2B9D A;  2DSY A;  4MYU A;  5CFF E;  3VYY A;  2ZIT A;  2M1S A;  4FWH A;  2HFU A;  3J81 Q;  4BMJ A;  4USK A;  2Z5C B;  2LTS A;  2OI2 A;  1X48 A;  4LF7 I;  4I3H A;  4WUB A;  2DEI A;  2UXC I;  1PVG A;  2ODR D;  2E1R A;  2IHR 1;  3P1X A;  2O1T A;  3JAM C;  4LF6 E;  1Z59 A;  3LTO A;  2R3V A;  4DPY A;  5DNY A;  4DXL A;  4LF6 I;  5BR8 E;  1Z0V A;  4DR5 I;  1Z5B A;  3ZZ0 A;  2MC5 A;  2GQ0 A;  3J80 C;  3DJW A;  2NUF A;  2UUC E;  4DR7 E;  3J7Y p;  2UXD E;  4DPX A;  3KWR A;  1H73 A;  3M6A A;  4BCA A;  1Z0W A;  4DKK A;  5AAS A;  4X66 E;  3H09 A;  1FNM A;  2KOU A;  3F6H A;  1WXR A;  4LF4 E;  2BV3 A;  4JI8 I;  2UU9 I;  2UU9 E;  4JG4 A;  4GKK I;  1YZ9 A;  2MDR A;  4P78 A;  4DR3 E;  2HKE A;  4DV2 E;  2PNM A;  1MG7 A;  2LJH A;  4JI0 E;  1XMQ I;  2JR1 A;  1N33 E;  1ZBT A;  4DR5 E;  3P06 A;  5L3J A;  5A2Q C;  4AQY I;  4DUY I;  1I94 I;  4DUY E;  1I94 E;  4LF5 E;  1T4L B;  4KQV A;  2N3G A;  3B78 A;  3LLH A;  3ADG A;  3GON A;  3J7A G;  2JY9 A;  4BC9 A;  4ZVI A;  4R8O A;  4HY1 A;  5IWA I;  4JV5 I;  3HXL A;  4YHH E;  2UUB E;  4MYT A;  1N0U A;  4GKJ I;  2KHX A;  4KHP E;  1XNQ I;  2J7K A;  1MX0 A;  1UIL A;  4DV3 I;  1QZR A;  1ZM9 A;  3T1H I;  1A6F A;  5FLX C;  4DV7 E;  2UXD I;  2L2M A;  4F54 A;  2NA2 A;  2UXB I;  4LFB I;  3HPZ A;  2F4V I;  4DPT A;  2FTX B;  5IT9 Q;  4UTG A;  2DIX A;  4AQY E;  4DR2 I;  1HNX E;  2VQE E;  5LMU E;  5GMD A;  2L8T A;  2UXC E;  1EA6 A;  4USM A;  1GZ6 A;  4DV1 E;  1N33 I;  1STU A;  5A2Q Q;  4IZJ B;  5T6J A;  4LF9 E;  4YY3 E;  3T1Y E;  1FWL A;  1Z5C A;  4KHP I;  4DUZ E;  3PYG A;  1YYW A;  2R42 A;  2JOX A;  2Z5E A;  4F9A B;  4WYQ B;  4EMD A;  3V2U C;  4TUI A;  4B3M I;  1Z0T A;  3C4B A;  5LMN I;  5IWA E;  2DMY A;  1FJG E;  4JI7 I;  3IWC A;  4B3R I;  1X47 A;  2VF3 A;  3HPS A;  1IBM I;  4DV0 I;  3J7A M;  4NXN I;  2CZ9 A;  2V88 A;  5AE2 A;  3OTO E;  1Y4U A;  3PYF A;  2LJP A;  5GME A;  1H74 A;  4JI0 I;  1X49 A;  2VQF E;  5LL6 R;  3WU5 A;  4M0V A;  3ZZU A;  4L5N C;  4PRX A;  3LPS A;  2LMZ A;  1WHN A;  4DV5 E;  2BM1 A;  2VQE I;  5LMU I;  1J26 A;  1IBK I;  1XNR E;  3J81 C;  4RPF A;  2A2D A;  2E5L E;  1VIS A;  1D6T A;  2NUG A;  4JI3 E;  2XEX A;  2IOQ A;  3QT6 A;  2LRS A;  4N3O A;  3WU3 A;  4DPU A;  4F9B B;  4TUG A;  2HHH I;  2UUA E;  3ZOQ B;  3ADL A;  2O1U A;  3AV0 A;  4FWG A;  4URL A;  1N36 E;  2DEJ A;  2EZ6 A;  5LMN E;  2DB2 A;  5FLX Q;  4JI4 E;  1HNZ E;  3LML A;  4GKJ E;  2O1V A;  2ZM6 I;  4M2Z A;  2B3T B;  4Z7Y A;  4Z7C A;  1N32 I;  2WW4 A;  4NXM I;  3K1J A;  4DR2 E;  3B82 A;  4DV4 I;  1IBL I;  2F4V E;  2O1W A;  4IZJ A;  2E5L I;  1NZ0 A;  4DR4 I;  4LF8 I;  1NHJ A;  1WUU A;  2UUA I;  2HK2 A;  4B3T E;  2HHH E;  2CGE A;  4LF7 E;  2LUQ A;  1RC7 A;  3V5R A;  2AJ4 A;  3T1H E;  4XTJ A;  1Z5A A;  4JI2 I;  3HTX A;  2H36 X;  1XNR I;  4LTY A;  1ZM3 A;  4X62 I;  4PU9 A;  3ZM7 A;  3ZZT A;  2EWL A;  3PRY A;  1XNQ E;  4WUD A;  2UUB I;  2HKJ A;  1ZXM A;  1RQ0 A;  4DV6 I;  4I8O A;  2EFG A;  4NXM E;  1HNX I;  4OOG C;  4LFC I;  1ZXN A;  2Q2E B;  4FW9 A;  2JVA A;  4IZJ D;  4P52 A;  3RMP A;  2V85 A;  4LFB E;  4LFA I;  4JI6 I;  3QT5 A;  1O0W A;  2RSM A;  2JWO A;  2V86 A;  3B8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...