5BR8E

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5br8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8E02
2CZ9A 1HNZI 1N36E 4JI5E 2NUFA 4DV3E 1T4NA 2LTRA 2B7TA 3QT5A 2V2ZA 3J7Yp 3JAMC 1N32I 1ZXNA 2UXCE 4DUYE 1H7SA 4GKKI 4LF4I 2VF3A 4DR6I 4X62E 1J5EE 3QT7A 4DV2E 4X65E 1H7UA 2L33A 3WU4A 1UHZA 1KTVA 2OI2A 2UXBI 5LMUI 1H74A 5IWAI 2EZ6A 1WHQA 3LPSA 1VISA 1KIJA 4FWDA 1RR9A 4YHHE 3J7AG 1PKPA 1HNWE 4B3MI 4LF7E 2N3GA 4WFTA 3F0NA 2ZITA 2L2KB 3B82A 3V5RA 3Q1QA 2V8PA 2ZM6I 1GQEA 2RSMA 1ELOA 4DV4E 1T4OA 4USMA 4HYMA 1D6TA 1J26A 2CPNA 1RQ0A 1STUA 1DARA 2B7VA 1HNXE 2MDRA 2L3CA 4LFCI 2UUAI 3D4JA 1XNRI 1N32E 4I3HA 4JV5I 2X36A 1B62A 4NXMI 2BM0A 4LF8I 5CFFE 3J80C 4OOGC 3M6AA 3PYFA 3LTOA 4DR5E 4JI5I 2HK3A 1ZBTA 4NXNI 4DV3I 4JG4A 1MX0A 1I94E 2HK2A 4LFAE 4WYQB 4DV1I 2UXCI 4DUYI 4DKKA 4WUBA 4DV5I 1KKHA 4FN5A 1X47A 1ZM3A 3HULA 4PRVA 4MYUA 4X62I 1J5EI 4PRXA 2E5LE 3PYGA 4DV2I 4X65I 4KQVA 2DMYA 4B3TE 3B78A 3ZM7A 4JI8E 4YHHI 1HNWI 2DEIA 3ZKBA 2BM1A 5GMEA 4LF7I 3QT6A 1NHHA 4UTGA 2HFSA 4P7AA 3J81C 4KHPI 2UU9E 1NHJA 4M1KA 2LRSA 4DV4I 1QU6A 1N0UA 5FLXQ 4EMDA 4JI4E 4NXNE 1Z5AA 4PU9A 4WUDA 4FW9A 5IT9Q 4MYTA 1HNXI 1RC7A 2DEJA 2UXDE 4Z7CA 4DV1E 2VQFE 4FWGA 4DPTA 4YY3E 4DV5E 4FWHA 4DXLA 4DV6I 2KHXA 1Z0GA 2RTXA 4DR5I 2VQEE 2XEXA 1PIEA 3OTOE 4HY1A 5L3JA 3LNUA 2JY9A 2B3TB 2IHR1 1I94I 3ADIA 4LFBE 1H73A 1FWKA 4LFAI 3WU3A 1K47A 3LLHA 1XHKA 4DR2E 2WW4A 1XMOE 2F4VE 2E5LI 4B3RE 3VYXA 4KHPE 3V2UC 3ZZ0A 1FJGE 2N3HA 4B3TI 2E1RA 1XNQE 3J7AM 4JI8I 3CWVA 4HACA 1S4EA 2JVAA 1EA6A 1Z0CA 5BR8E 1IBME 4R1FA 3JAMQ 2UU9I 1ZXMA 1FNMA 2V34A 2X7IA 1YYKA 1N34E 4DV6E 1RREA 4JI3E 2V2QA 4GKJE 5A2QC 2DIXA 1UILA 4JI4I 3C4TA 1U2RA 2UUBI 4P52A 5LL6R 4JI0E 1X49A 4M2ZA 1QZRA 1ZM2A 2NUEA 2UXDI 2RS7A 2VQFI 2HKEA 1UEKA 3WU5A 5LMNE 2R3VA 4YY3I 4ED4A 1XMQE 4DV0E 2L3JA 1B63A 1Z0EA 4HXZA 5FLXC 2VQEI 3OTOI 3PYEA 4DPWA 4X8WA 4X64E 4DPUA 4LFBI 1WUUA 1Z5CA 4B3SE 2NPFA 4DR7E 4JI7E 1IBKE 4DR2I 3ADLA 1XMOI 3B8HA 3ADGA 1FWLA 2F4VI 4URLA 4B3RI 2V2VA 3T1HE 1FJGI 3ZKDA 4ZVIA 4JI6E 3J80Q 1XNQI 3WU6A 1YYWA 1IBLI 4WUCA 1OJ4A 2NUGA 1HR0E 2LJPA 2UUBE 1ZM4A 5BR8I 3ADJA 4X66E 4JI1E 1IBMI 4DUZE 2RS6A 4Z7YA 4DR1E 1N34I 4JYAE 1KVKA 2R42A 3K1JA 4JI3I 4GKJI 2LBSB 2A2CA 1BKNA 3QT8A 2GS8A 1Z0WA 3ZZUA 1O0WA 2J7KA 4AQYE 4DPXA 4K0KE 4DR3E 1H72C 4JI0I 3T1YE 4OX9I 1FI4A 4LF6E 4DR4E 2LJHA 2UUCE 1Z0BA 1T4LB 4DV7E 2ZBKB 1FKAE 3PYDA 5LMNI 1XMQI 4DV0I 1EKZA 2LUPB 3GONA 3J81Q 1A6FA 4X64I 2HFUA 2AJ4A 1N33E 2HHHE 1ZM9A 4B3SI 2YT4A 1IBLE 4DU7A 4DR7I 1S16A 5GMDA 2BV3A 4JI7I 1IBKI 2A2DA 1NHIA 4LF5E 1YYOA 2DB2A 4JI2I 4DU8A 3T1HI 3VYYA 4JI6I 1N0VC 1HNZE 3ZZTA 2Q2EB 4LF9I 1HR0I 1Z5BA 4DPYA 4JI1I 4X66I 4OX9E 1WHNA 3K17A 4DUZI 1Z59A 4DR1I 4JYAI 2L2NA 4GKKE 4LF4E 1MU5A 4DR6E 1N36I 4XTJA 3P1XA 4AQYI 4RPFA 4K0KI 4HACB 4DR3I 5IT9C 2NA2A 2LUQA 4USKA 2UXBE 3T1YI 5LMUE 4LF6I 5IWAE 4DR4I 2UUCI 1PVGA 4DV7I 4B3ME 2EFGA 1MG7A 4JI2E 3HTXA 2LTSA 1NZ0A 4UT4A 1Z0TA 2ZM6E 4M30A 1N33I 2HHHI 3C4BA 1Z0VA 3H4LA 5A2QQ 1EI1A 4LF9E 1DI2A 4LF5I 4LFCE 2UUAE 1X48A 1XNRE 4JV5E 2L2MA 1YZ9A 2HKJA 4NXME 4LF8E
chains in the Genus database with same CATH superfamily
1YH8A 3KZYA 4KZSA 5KL5A 2CZ9A 2WP8A 4LCHA 1MEYC 2WBSA 1NEIA 1HNZI 1PJSA 2WBTA 4R2QA 1N36E 4JI5E 2IESA 2NUFA 3EPHA 5JEAE 5KL3A 4DV3E 1T4NA 2LTRA 2B7TA 3QT5A 2V2ZA 3AV0A 1XXEA 1A1LA 3KWRA 4QNJA 2EOQA 4IZJA 3J7Yp 3JAMC 1N32I 2I9IA 2YTPA 3P76A 2DSYA 2EMGA 2YSPA 1ZXNA 2UXCE 4DUYE 3KRNA 4L5NC 4ZYEA 5DNXA 1BB8A 1H7SA 2GO4A 2C39B 4GKKI 4LF4I 2VF3A 2Z5CB 4DR6I 2DMIA 5K36F 4X62E 1J5EE 3QT7A 5IXMB 4LTYA 2EM0A 4DV2E 4GEQB 4X65E 5KL6A 1H7UA 2EJ4A 2L33A 3WU4A 4LCFA 2LJUA 3EQ1A 1UHZA 1KTVA 2OI2A 2UXBI 5LMUI 1H74A 3TQMA 5IWAI 4IFDC 2EZ6A 4FW7A 4BBYA 1WHQA 3LPSA 3PRYA 1VISA 1KIJA 4FWDA 3F6HA 2EMLA 1RR9A 1TF6A 1R6LA 4YHHE 3J7AG 5K36A 1PKPA 1F2IG 4GQUA 2EP3A 5DRQA 1HNWE 4O5GA 5C0XB 2N8XA 4B3MI 2R76A 4LF7E 2N3GA 4WFTA 3F0NA 2ZITA 3P06A 3QG5C 2L2KB 2WNRA 3B82A 3V5RA 2LCEA 3Q1QA 2V8PA 2EM7A 2ZM6I 1GQEA 2BA0G 2RSMA 1ELOA 2YTOA 4DV4E 2BA1D 1T4OA 4USMA 5AASA 1Z1BA 4HEIA 3THNA 1G2FC 4HYMA 5JEAD 2C38B 1R6MA 5DRRA 1D6TA 2FV4B 1J26A 2CPNA 4R2EA 2CT1A 1RQ0A 2EMBA 2V85A 2CG9A 3M85G 4FK5C 1STUA 4FW5A 2EWLA 2EPNA 1DARA 2B7VA 1HNXE 2MDRA 2L3CA 4LFCI 2UUAI 3D4JA 4R2CA 3UHMA 2NN6B 1N32E 4I3HA 1XNRI 4JV5I 2PNLA 2PO1B 4I8OA 2X36A 1RMDA 5EL9A 1B62A 4NXMI 2PNZA 2BM0A 3ECRA 5CFFE 1WRJA 3J80C 2M4IA 4LF8I 4O4KA 3EPKA 4OOGC 3NZKA 1A1IA 3M6AA 3Q6NA 2EL5A 4N4RB 3OMLA 4TUIA 2JE6A 3LTOA 3PYFA 4DR5E 1P47A 1JK1A 2V86A 4JI5I 2HK3A 4U3BA 4MU4A 1ZBTA 1VI7A 5A6KA 2EPXA 1TF3A 4NXNI 3U1KA 4DV3I 4JG4A 2Z5BA 1Y60A 4OO1F 5K36B 1MX0A 2LE2A 2EOZA 2YTGA 5KL2A 4R2DA 1I94E 3B4TA 2EOMA 3K85A 3PS3A 3ZOQB 2HK2A 4LFAE 4WYQB 4DV1I 4NBQA 2EOOA 2UXCI 4DUYI 3DJWA 3BF2A 4DKKA 1L4SA 4WUBA 4DV5I 1KKHA 4FN5A 4N3OA 2BB8A 1X47A 1ZM3A 3DF6A 2YU8A 2F1DA 4AIMA 5A6BA 1A1FA 3HULA 2M9AA 4PRVA 5T6JA 4MYUA 4X62I 4PRXA 2E5LE 4OO1A 3PYGA 1QNTA 3U1YA 4DV2I 4X65I 4KQVA 2EL6A 1G2DC 2JYAA 2DMYA 2MKNA 4B3TE 5A6JA 2DLQA 2JR1A 1A1JA 4J3DA 4O24A 1UN6B 2BA1G 2EM3A 2IOQA 3B78A 3ZM7A 4JI8E 3JTZA 2L6MA 4YHHI 2EN3A 2ENHA 2WBUA 2O1WA 2PNZB 1X5WA 1EH8A 2DEIA 1HNWI 4IFDE 3ZKBA 2BM1A 5GMEA 4LF7I 2EMFA 2EOXA 1NHHA 3QT6A 4UTGA 2HFSA 1OYRA 5A6AA 4P7AA 3J81C 1MGTA 3H1CA 4KHPI 2UU9E 1NHJA 2EPLX 4RH8A 4M1KA 2JEAB 2EMAA 2JEBB 2LRSA 5C0XD 4DV4I 2PRTA 1ZR9A 5DNLA 1QU6A 4Q28A 3JU0A 1N0UA 3M85D 4F54A 1Y5YA 4FW6A 4JI4E 4EMDA 5FLXQ 4NXNE 1Z5AA 3CDJA 2WZOA 4PU9A 5AE1A 4WUDA 4FW9A 2M7QA 4MYTA 5IT9Q 2V88A 1HNXI 2PO0A 4BC7A 1RC7A 1X6FA 2DEJA 3RMPA 2EMZA 2BR2A 2UXDE 4Z7CA 3VK6A 4DV1E 2VQFE 4FWGA 4DPTA 1KYQA 2F8BA 2LMZA 4YY3E 2ELZA 2BBGA 4DV5E 4FWHA 1GTKA 4MDTA 1ZBQA 4DXLA 4DV6I 1UDQA 2PO2A 4IFDF 2KHXA 1Z0GA 2RTXA 2NN6D 4DR5I 1LLMC 2VQEE 2XEXA 1PIEA 3OTOE 1Y4UA 4HY1A 3THOB 2YTIA 5L3JA 3L00A 1ZU1A 2FGGA 3LNUA 2EPRA 2JY9A 2B3TB 2IHR1 1WXRA 1A1GA 1I94I 3ADIA 4MU3A 4LFBE 4BHCA 1H73A 4RHBB 1FWKA 4LFAI 2ADRA 2C37B 3WU3A 4IFDA 4F9CB 3F6GA 3LLHA 1K47A 1UDOA 1XHKA 2O1VA 2Z5EA 3GCMA 2RPCA 5K36D 4DR2E 2WW4A 1XMOE 3MHSC 4BMJA 2WP8B 1T38A 2EN7A 1BBGA 4R2AA 2F4VE 2E5LI 2YRMA 4B3RE 2MDGA 4P7DA 2WCC3 3VYXA 4KHPE 3V2UC 3ZZ0A 1FJGE 2N3HA 4B3TI 2E1RA 4OO1E 5A69A 3C6MA 4WSGA 1XNQE 4WSPA 4WPYA 3J7AM 2YTJA 3MHHC 2PO0B 2ODRD 4JI8I 4IZJB 1IQOA 2JP9A 3CWVA 4HACA 1S4EA 3AUZA 1T39A 2LO3A 2JVAA 1EA6A 2YWQA 2HJJA 1SR9A 1Z0CA 4BA2A 4HTGA 5BR8E 2DRPA 2EN2A 3P3CA 1IBME 4R1FA 5AE3A 1A1KA 4KWYA 1IMUA 2PO2B 3JAMQ 2O1TA 2M1SA 4QNKA 2UU9I 1ZXMA 3BBGA 1FNMA 1AAYA 3EPJA 2V34A 2X7IA 5JEAC 1YYKA 1AH5A 1N34E 4TUGA 1A1HA 2VESA 4MLVA 2YPNA 2FTXB 2EMXA 4DV6E 1RREA 4ZYHA 4JI3E 2V2QA 2EMYA 4GKJE 5A2QC 2DIXA 2YU5A 2IERA 2EPUA 1UILA 2VRDA 4R2SA 2A25A 3C4TA 4JI4I 4O43A 2GPIA 4IFDB 1U2RA 3IWCA 2UUBI 4P52A 1OYSA 5LL6R 2EN1A 4JI0E 1WJPA 1X49A 4M2ZA 1QZRA 1ZM2A 2NUEA 2UXDI 3HQ1A 2RS7A 2VQFI 2HKEA 1UEKA 2WNRB 2EPCA 5LMNE 3WU5A 2Q8UA 1X3CA 2EOJA 2EPZA 2R3VA 4YY3I 4ED4A 3IWDA 2EOEA 1XMQE 1DGCA 4DV0E 2L3JA 1B63A 1Z0EA 4HXZA 2EMKA 5FLXC 1OYPA 2LV2A 2IOPA 4OO1D 2VQEI 4R2RA 3OTOI 3DD6A 2JOXA 3P3GA 3PYEA 4GZNC 4DPWA 4X8WA 2EQ3A 2J7JA 5KL7A 1DQ3A 4X64E 4OKGA 2V87A 3EPLA 2E72A 1SFEA 5KL4A 4DPUA 4LFBI 2VE7C 1WUUA 1Z5CA 4J8ZA 4R2PA 4B3SE 2EQ1A 2NPFA 4DR7E 3M99B 1KJKA 4JI7E 1TN9A 1IBKE 1YUJA 2EM2A 4IZKA 4DR2I 1YPNA 3ADLA 3Q6MA 1XMOI 3B8HA 3ADGA 1FWLA 2F4VI 2E1MA 2EOFA 2EMHA 4NZVA 3HPZA 1UDSA 2JE6B 4U3DA 4URLA 2V2VA 4B3RI 3GLLA 3T1HE 1FJGI 3ZKDA 2JXPA 1RHYA 2C39A 4ZVIA 4JI6E 3J80Q 2Z5BB 2EN8A 2CTDA 1PDAA 1B69A 2I13A 2V83A 3WU6A 1XNQI 2EPMX 4DMIA 2K7IA 1GZ6A 1YYWA 2GQ0A 2EPAA 1IBLI 4WUCA 2CSHA 1OJ4A 1EH6A 1UDNA 2NUGA 5AC5A 1HR0E 2LJPA 3PS1A 4M9VC 3LMLA 2YTDA 3H09A 2UUBE 2GO3A 4NHRA 1ZM4A 2CGEA 5BR8I 3ADJA 3BIDA 4X66E 4JI1E 4P78A 2YTQA 1IBMI 4DUZE 2ELYA 1YUIA 3GMEA 4IZJD 2RS6A 2GHFA 4Z7YA 2YTNA 1J5EI 2YRHA 5C0XC 3M7NG 4OO1B 4DR1E 4X9JA 1N34I 2EM9A 4JYAE 1KVKA 4LCGA 2R1FA 2R42A 5C0XA 3K1JA 4JI3I 5TSEA 4GKJI 2LBSB 2A2CA 1BKNA 3QT8A 4AM3A 5F3WA 2GS8A 4F9AB 2H36X 1PJQA 1Z0WA 3ZZUA 2LT7A 4OZEA 4LPFA 1O0WA 5AE2A 4AQYE 2J7KA 2NN6F 4DPXA 3IWBA 4K0KE 1USVA 4DR3E 1H72C 4F6NA 4JI0I 3T1YE 4MU1A 4OX9I 1FI4A 4IZKB 4LF6E 2C38A 4DR4E 5DNYA 2LJHA 2UUCE 3BGHA 1Z0BA 3PS2A 4IFDD 4MLQA 4DV7E 1T4LB 1FKAE 4BS9A 2ZBKB 3L7ZA 3PYDA 5LMNI 2NN6C 5DROA 3VHTB 1XMQI 2EN6A 4DV0I 2EMWA 2DGCA 1EKZA 2NN6A 2V89A 2LUPB 3GONA 2PO1A 2L8TA 3J81Q 2LVHA 1A6FA 2EOYA 4X64I 4F6MA 2HFUA 2B9DA 2AJ4A 2EM8A 1N33E 2HHHE 1NCSA 4BCAA 1ZM9A 4ISAA 4B3SI 5K36C 2YT4A 1IBLE 4DU7A 2BR2B 4DR7I 1S16A 2O3ZA 5GMDA 1X6HA 5JEAF 2YTEA 4ZYGA 2BV3A 4WXCA 4JI7I 1IBKI 2A2DA 2EOIA 2KOUA 1PJTA 1NHIA 4LF5E 3CDIA 1N3GA 1YYOA 2DB2A 2EORA 4JI2I 4DU8A 3T1HI 1X6EA 2MC6A 3VYYA 2O1UA 4L8NA 2ODRC 4JI6I 1IQSA 1N0VC 2EM5A 2EL4A 5JEAA 2EOHA 1HNZE 5EKWA 2RSIA 2J65A 2Q2EB 3ZZTA 4BA1A 1HR0I 4LF9I 1Z5BA 3P3EA 4IJDA 4DPYA 2EPKX 3L7ZB 4JI1I 4X66I 4OX9E 1WHNA 2EQ0A 2MC5A 3K17A 4DUZI 3M7ND 1YHCA 2HC5A 3C6KA 1E3HA 2JOBA 3MSWA 1Z59A 4DR1I 4JYAI 2L2NA 4R8OA 2EM6A 4F2JC 2EPOA 1JK2A 4GKKE 4LF4E 1MU5A 4DR6E 2L92A 2YRKA 5A6BD 5IV8B 1N36I 2DLKA 2EMCA 5C0XE 4XTJA 3P1XA 4LOMA 2JWOA 2D9HA 2MKDA 2ENAA 4RPFA 4AQYI 3HXLA 2VF1A 4HACB 2JEBA 5IT9C 4DR3I 2NA2A 2JEAA 5LLQA 4K0KI 2LUQA 4USKA 2UXBE 3T1YI 5LMUE 4LF6I 1YSAC 2EN4A 4BA2B 5IWAE 4WXDA 4DR4I 3K6QA 2AE8A 2UUCI 1PVGA 4DV7I 1EH7A 4M0VA 1Y6ZA 2HGHA 1HK7A 4WX9A 4OO1C 4B3ME 2EFGA 1BBOA 4LU9A 1MG7A 2G7HA 2NABA 2JPAA 5JEAB 2K4VA 2RQLA 1P42A 4BC9A 4F9BB 4JI2E 3HTXA 2LTSA 1NZ0A 4UT4A 1Z0TA 4BA1B 2ZM6E 4M30A 4MU0A 2NN6E 2EE8A 4ZYDA 3HKMA 2ENCA 2PNMA 5AC4A 2Z5CA 1ZAAC 2GLIA 2EM4A 1N33I 2HHHI 3C4BA 1Z0VA 3H4LA 3UK3C 5A2QQ 5C0XF 4Q35B 4IS9A 1EI1A 4LF9E 2YZTA 3HPSA 5DRPA 5ELWA 4FW3A 3KZZA 1DI2A 4IS1C 1Y4SA 2YSOA 4MQYA 4LF5I 2JT2A 2EOSA 2V8QB 4LFCE 2CVEA 2UUAE 1X48A 5K36E 1XNRE 2C37A 4JV5E 1E3PA 1YFHA 2KONA 1UBDC 2YTFA 2L2MA 1YZ9A 2BA0D 4BHBA 3HJCA 4AIDA 5FWKA 4R03A 5ADZA 4NXME 2HKJA 3FIGA 4LF8E 4FW4A 2EMIA 1USUA 2EPPA
chains in the Genus database with same CATH topology
4KZSA 2CZ9A 1HNZI 1N36E 4JI5E 2NUFA 4DV3E 1T4NA 2LTRA 2B7TA 3QT5A 2V2ZA 3AV0A 3KWRA 4IZJA 3J7Yp 3JAMC 1N32I 2DSYA 1ZXNA 2UXCE 4DUYE 4L5NC 1H7SA 4GKKI 4LF4I 2VF3A 2Z5CB 4DR6I 4X62E 1J5EE 3QT7A 4LTYA 4DV2E 4GEQB 4X65E 1H7UA 2L33A 3WU4A 1UHZA 1KTVA 2OI2A 2UXBI 5LMUI 1H74A 5IWAI 2EZ6A 4BBYA 1WHQA 3LPSA 3PRYA 1VISA 1KIJA 4FWDA 3F6HA 1RR9A 4YHHE 3J7AG 1PKPA 1HNWE 4B3MI 4LF7E 2N3GA 4WFTA 3F0NA 2ZITA 3P06A 2L2KB 3B82A 3V5RA 3Q1QA 2V8PA 2ZM6I 1GQEA 2RSMA 1ELOA 4DV4E 1T4OA 4USMA 5AASA 4HYMA 1D6TA 2FV4B 1J26A 2CPNA 2CG9A 1RQ0A 2V85A 1STUA 2EWLA 1DARA 2B7VA 1HNXE 2MDRA 2L3CA 4LFCI 2UUAI 3D4JA 1XNRI 1N32E 4I3HA 4JV5I 2PNLA 4I8OA 2X36A 1B62A 4NXMI 2BM0A 4LF8I 5CFFE 3J80C 2M4IA 4OOGC 3M6AA 3Q6NA 3OMLA 4TUIA 3PYFA 3LTOA 4DR5E 2V86A 4JI5I 2HK3A 1ZBTA 4NXNI 4DV3I 4JG4A 2Z5BA 1MX0A 2LE2A 1I94E 3K85A 3ZOQB 2HK2A 4LFAE 4WYQB 4DV1I 2UXCI 4DUYI 3DJWA 4DKKA 4WUBA 4DV5I 1KKHA 4FN5A 4N3OA 1X47A 1ZM3A 3DF6A 3HULA 4PRVA 5T6JA 4MYUA 4X62I 4PRXA 2E5LE 1J5EI 3PYGA 4DV2I 4X65I 4KQVA 2DMYA 4B3TE 2JR1A 2IOQA 3B78A 3ZM7A 4JI8E 3JTZA 2L6MA 4YHHI 2O1WA 1HNWI 2DEIA 3ZKBA 2BM1A 5GMEA 4LF7I 3QT6A 1NHHA 4UTGA 2HFSA 4P7AA 3J81C 4KHPI 2UU9E 1NHJA 4M1KA 2LRSA 4DV4I 1QU6A 4Q28A 3JU0A 1N0UA 4F54A 4EMDA 5FLXQ 4JI4E 4NXNE 1Z5AA 2WZOA 4PU9A 5AE1A 4WUDA 4FW9A 2M7QA 4MYTA 5IT9Q 2V88A 1HNXI 4BC7A 1RC7A 2DEJA 3RMPA 2UXDE 4Z7CA 3VK6A 4DV1E 2VQFE 4FWGA 4DPTA 2LMZA 2F8BA 4YY3E 4DV5E 4FWHA 4DXLA 4DV6I 1ZBQA 2KHXA 1Z0GA 2RTXA 4DR5I 2VQEE 2XEXA 1PIEA 3OTOE 1Y4UA 4HY1A 5L3JA 2FGGA 3LNUA 2JY9A 2B3TB 2IHR1 1WXRA 1I94I 3ADIA 4LFBE 1H73A 1FWKA 4LFAI 3WU3A 4F9CB 3F6GA 3LLHA 1K47A 1XHKA 2O1VA 2Z5EA 4DR2E 2WW4A 1XMOE 4BMJA 2F4VE 2E5LI 4B3RE 4P7DA 3VYXA 4KHPE 3V2UC 3ZZ0A 1FJGE 2N3HA 4B3TI 2E1RA 1XNQE 4WSPA 4WPYA 3J7AM 2ODRD 4JI8I 4IZJB 3CWVA 4HACA 1S4EA 3AUZA 2JVAA 1EA6A 1Z0CA 1SR9A 5BR8E 1IBME 4R1FA 5AE3A 3JAMQ 2O1TA 2M1SA 2UU9I 1ZXMA 1FNMA 2V34A 2X7IA 1YYKA 1N34E 4TUGA 2FTXB 4DV6E 1RREA 4JI3E 2V2QA 4GKJE 5A2QC 2DIXA 1UILA 4JI4I 3C4TA 1U2RA 3IWCA 2UUBI 4P52A 5LL6R 4JI0E 1X49A 4M2ZA 1QZRA 1ZM2A 2NUEA 2UXDI 3HQ1A 2RS7A 2VQFI 2HKEA 1UEKA 3WU5A 5LMNE 2R3VA 4YY3I 4ED4A 3IWDA 1XMQE 4DV0E 2L3JA 1B63A 1Z0EA 4HXZA 5FLXC 2IOPA 2VQEI 3OTOI 3PYEA 2JOXA 4DPWA 4X8WA 1DQ3A 4X64E 2V87A 4DPUA 4LFBI 2VE7C 1WUUA 1Z5CA 4J8ZA 4B3SE 2NPFA 4DR7E 4JI7E 1IBKE 4IZKA 4DR2I 3ADLA 3Q6MA 1XMOI 3B8HA 3ADGA 1FWLA 2F4VI 2E1MA 3HPZA 4URLA 4B3RI 2V2VA 3T1HE 1FJGI 3ZKDA 4ZVIA 4JI6E 3J80Q 2Z5BB 1XNQI 3WU6A 2V83A 4DMIA 2GQ0A 1GZ6A 1YYWA 1IBLI 4WUCA 1OJ4A 2NUGA 1HR0E 2LJPA 3LMLA 3H09A 2UUBE 1ZM4A 2CGEA 5BR8I 3ADJA 4X66E 4JI1E 4P78A 1IBMI 4DUZE 4IZJD 2RS6A 4Z7YA 4DR1E 1N34I 4JYAE 1KVKA 2R42A 3K1JA 4JI3I 4GKJI 2LBSB 2A2CA 1BKNA 3QT8A 5F3WA 2GS8A 4F9AB 2H36X 1Z0WA 3ZZUA 1O0WA 5AE2A 4AQYE 2J7KA 4DPXA 3IWBA 4K0KE 1USVA 4DR3E 1H72C 4JI0I 3T1YE 4OX9I 1FI4A 4IZKB 4LF6E 4DR4E 5DNYA 2LJHA 2UUCE 1Z0BA 1T4LB 4DV7E 2ZBKB 1FKAE 4BS9A 3PYDA 5LMNI 1XMQI 4DV0I 1EKZA 2V89A 2LUPB 3GONA 2L8TA 3J81Q 1A6FA 4X64I 2HFUA 2B9DA 2AJ4A 1N33E 2HHHE 1ZM9A 4BCAA 4B3SI 2YT4A 1IBLE 4DU7A 4DR7I 1S16A 5GMDA 2BV3A 4JI7I 1IBKI 2A2DA 2KOUA 1NHIA 4LF5E 1YYOA 2DB2A 4JI2I 4DU8A 3T1HI 2MC6A 3VYYA 2O1UA 4L8NA 2ODRC 4JI6I 1N0VC 1HNZE 3ZZTA 2Q2EB 4LF9I 1HR0I 1Z5BA 4DPYA 4JI1I 4X66I 4OX9E 1WHNA 3K17A 2MC5A 4DUZI 2JOBA 3MSWA 1Z59A 4DR1I 4JYAI 2L2NA 4R8OA 4GKKE 4LF4E 1MU5A 4DR6E 2L92A 1N36I 4XTJA 3P1XA 2JWOA 4AQYI 4RPFA 3HXLA 2VF1A 4HACB 4DR3I 5IT9C 4K0KI 2NA2A 2LUQA 4USKA 2UXBE 3T1YI 5LMUE 4LF6I 5IWAE 4DR4I 3K6QA 2UUCI 1PVGA 4DV7I 4M0VA 1Y6ZA 1HK7A 4B3ME 2EFGA 4LU9A 1MG7A 2G7HA 2K4VA 4BC9A 4F9BB 4JI2E 3HTXA 2LTSA 1NZ0A 4UT4A 1Z0TA 2ZM6E 4M30A 2PNMA 2Z5CA 1N33I 2HHHI 3C4BA 1Z0VA 3H4LA 5A2QQ 1EI1A 4LF9E 2YZTA 3HPSA 1DI2A 1Y4SA 4LF5I 2V8QB 4LFCE 2UUAE 1X48A 1XNRE 4JV5E 3HJCA 2KONA 2L2MA 1YZ9A 5FWKA 4R03A 4NXME 5ADZA 2HKJA 3FIGA 4LF8E 1USUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ9 A;  1HNZ I;  1N36 E;  4JI5 E;  2NUF A;  4DV3 E;  1T4N A;  2LTR A;  2B7T A;  3QT5 A;  2V2Z A;  3J7Y p;  3JAM C;  1N32 I;  1ZXN A;  2UXC E;  4DUY E;  1H7S A;  4GKK I;  4LF4 I;  2VF3 A;  4DR6 I;  4X62 E;  1J5E E;  3QT7 A;  4DV2 E;  4X65 E;  1H7U A;  2L33 A;  3WU4 A;  1UHZ A;  1KTV A;  2OI2 A;  2UXB I;  5LMU I;  1H74 A;  5IWA I;  2EZ6 A;  1WHQ A;  3LPS A;  1VIS A;  1KIJ A;  4FWD A;  1RR9 A;  4YHH E;  3J7A G;  1PKP A;  1HNW E;  4B3M I;  4LF7 E;  2N3G A;  4WFT A;  3F0N A;  2ZIT A;  2L2K B;  3B82 A;  3V5R A;  3Q1Q A;  2V8P A;  2ZM6 I;  1GQE A;  2RSM A;  1ELO A;  4DV4 E;  1T4O A;  4USM A;  4HYM A;  1D6T A;  1J26 A;  2CPN A;  1RQ0 A;  1STU A;  1DAR A;  2B7V A;  1HNX E;  2MDR A;  2L3C A;  4LFC I;  2UUA I;  3D4J A;  1XNR I;  1N32 E;  4I3H A;  4JV5 I;  2X36 A;  1B62 A;  4NXM I;  2BM0 A;  4LF8 I;  5CFF E;  3J80 C;  4OOG C;  3M6A A;  3PYF A;  3LTO A;  4DR5 E;  4JI5 I;  2HK3 A;  1ZBT A;  4NXN I;  4DV3 I;  4JG4 A;  1MX0 A;  1I94 E;  2HK2 A;  4LFA E;  4WYQ B;  4DV1 I;  2UXC I;  4DUY I;  4DKK A;  4WUB A;  4DV5 I;  1KKH A;  4FN5 A;  1X47 A;  1ZM3 A;  3HUL A;  4PRV A;  4MYU A;  4X62 I;  1J5E I;  4PRX A;  2E5L E;  3PYG A;  4DV2 I;  4X65 I;  4KQV A;  2DMY A;  4B3T E;  3B78 A;  3ZM7 A;  4JI8 E;  4YHH I;  1HNW I;  2DEI A;  3ZKB A;  2BM1 A;  5GME A;  4LF7 I;  3QT6 A;  1NHH A;  4UTG A;  2HFS A;  4P7A A;  3J81 C;  4KHP I;  2UU9 E;  1NHJ A;  4M1K A;  2LRS A;  4DV4 I;  1QU6 A;  1N0U A;  5FLX Q;  4EMD A;  4JI4 E;  4NXN E;  1Z5A A;  4PU9 A;  4WUD A;  4FW9 A;  5IT9 Q;  4MYT A;  1HNX I;  1RC7 A;  2DEJ A;  2UXD E;  4Z7C A;  4DV1 E;  2VQF E;  4FWG A;  4DPT A;  4YY3 E;  4DV5 E;  4FWH A;  4DXL A;  4DV6 I;  2KHX A;  1Z0G A;  2RTX A;  4DR5 I;  2VQE E;  2XEX A;  1PIE A;  3OTO E;  4HY1 A;  5L3J A;  3LNU A;  2JY9 A;  2B3T B;  2IHR 1;  1I94 I;  3ADI A;  4LFB E;  1H73 A;  1FWK A;  4LFA I;  3WU3 A;  1K47 A;  3LLH A;  1XHK A;  4DR2 E;  2WW4 A;  1XMO E;  2F4V E;  2E5L I;  4B3R E;  3VYX A;  4KHP E;  3V2U C;  3ZZ0 A;  1FJG E;  2N3H A;  4B3T I;  2E1R A;  1XNQ E;  3J7A M;  4JI8 I;  3CWV A;  4HAC A;  1S4E A;  2JVA A;  1EA6 A;  1Z0C A;  5BR8 E;  1IBM E;  4R1F A;  3JAM Q;  2UU9 I;  1ZXM A;  1FNM A;  2V34 A;  2X7I A;  1YYK A;  1N34 E;  4DV6 E;  1RRE A;  4JI3 E;  2V2Q A;  4GKJ E;  5A2Q C;  2DIX A;  1UIL A;  4JI4 I;  3C4T A;  1U2R A;  2UUB I;  4P52 A;  5LL6 R;  4JI0 E;  1X49 A;  4M2Z A;  1QZR A;  1ZM2 A;  2NUE A;  2UXD I;  2RS7 A;  2VQF I;  2HKE A;  1UEK A;  3WU5 A;  5LMN E;  2R3V A;  4YY3 I;  4ED4 A;  1XMQ E;  4DV0 E;  2L3J A;  1B63 A;  1Z0E A;  4HXZ A;  5FLX C;  2VQE I;  3OTO I;  3PYE A;  4DPW A;  4X8W A;  4X64 E;  4DPU A;  4LFB I;  1WUU A;  1Z5C A;  4B3S E;  2NPF A;  4DR7 E;  4JI7 E;  1IBK E;  4DR2 I;  3ADL A;  1XMO I;  3B8H A;  3ADG A;  1FWL A;  2F4V I;  4URL A;  4B3R I;  2V2V A;  3T1H E;  1FJG I;  3ZKD A;  4ZVI A;  4JI6 E;  3J80 Q;  1XNQ I;  3WU6 A;  1YYW A;  1IBL I;  4WUC A;  1OJ4 A;  2NUG A;  1HR0 E;  2LJP A;  2UUB E;  1ZM4 A;  5BR8 I;  3ADJ A;  4X66 E;  4JI1 E;  1IBM I;  4DUZ E;  2RS6 A;  4Z7Y A;  4DR1 E;  1N34 I;  4JYA E;  1KVK A;  2R42 A;  3K1J A;  4JI3 I;  4GKJ I;  2LBS B;  2A2C A;  1BKN A;  3QT8 A;  2GS8 A;  1Z0W A;  3ZZU A;  1O0W A;  2J7K A;  4AQY E;  4DPX A;  4K0K E;  4DR3 E;  1H72 C;  4JI0 I;  3T1Y E;  4OX9 I;  1FI4 A;  4LF6 E;  4DR4 E;  2LJH A;  2UUC E;  1Z0B A;  1T4L B;  4DV7 E;  2ZBK B;  1FKA E;  3PYD A;  5LMN I;  1XMQ I;  4DV0 I;  1EKZ A;  2LUP B;  3GON A;  3J81 Q;  1A6F A;  4X64 I;  2HFU A;  2AJ4 A;  1N33 E;  2HHH E;  1ZM9 A;  4B3S I;  2YT4 A;  1IBL E;  4DU7 A;  4DR7 I;  1S16 A;  5GMD A;  2BV3 A;  4JI7 I;  1IBK I;  2A2D A;  1NHI A;  4LF5 E;  1YYO A;  2DB2 A;  4JI2 I;  4DU8 A;  3T1H I;  3VYY A;  4JI6 I;  1N0V C;  1HNZ E;  3ZZT A;  2Q2E B;  4LF9 I;  1HR0 I;  1Z5B A;  4DPY A;  4JI1 I;  4X66 I;  4OX9 E;  1WHN A;  3K17 A;  4DUZ I;  1Z59 A;  4DR1 I;  4JYA I;  2L2N A;  4GKK E;  4LF4 E;  1MU5 A;  4DR6 E;  1N36 I;  4XTJ A;  3P1X A;  4AQY I;  4RPF A;  4K0K I;  4HAC B;  4DR3 I;  5IT9 C;  2NA2 A;  2LUQ A;  4USK A;  2UXB E;  3T1Y I;  5LMU E;  4LF6 I;  5IWA E;  4DR4 I;  2UUC I;  1PVG A;  4DV7 I;  4B3M E;  2EFG A;  1MG7 A;  4JI2 E;  3HTX A;  2LTS A;  1NZ0 A;  4UT4 A;  1Z0T A;  2ZM6 E;  4M30 A;  1N33 I;  2HHH I;  3C4B A;  1Z0V A;  3H4L A;  5A2Q Q;  1EI1 A;  4LF9 E;  1DI2 A;  4LF5 I;  4LFC E;  2UUA E;  1X48 A;  1XNR E;  4JV5 E;  2L2M A;  1YZ9 A;  2HKJ A;  4NXM E;  4LF8 E; 
#chains in the Genus database with same CATH topology
 1YH8 A;  3KZY A;  4KZS A;  5KL5 A;  2CZ9 A;  2WP8 A;  4LCH A;  1MEY C;  2WBS A;  1NEI A;  1HNZ I;  1PJS A;  2WBT A;  4R2Q A;  1N36 E;  4JI5 E;  2IES A;  2NUF A;  3EPH A;  5JEA E;  5KL3 A;  4DV3 E;  1T4N A;  2LTR A;  2B7T A;  3QT5 A;  2V2Z A;  3AV0 A;  1XXE A;  1A1L A;  3KWR A;  4QNJ A;  2EOQ A;  4IZJ A;  3J7Y p;  3JAM C;  1N32 I;  2I9I A;  2YTP A;  3P76 A;  2DSY A;  2EMG A;  2YSP A;  1ZXN A;  2UXC E;  4DUY E;  3KRN A;  4L5N C;  4ZYE A;  5DNX A;  1BB8 A;  1H7S A;  2GO4 A;  2C39 B;  4GKK I;  4LF4 I;  2VF3 A;  2Z5C B;  4DR6 I;  2DMI A;  5K36 F;  4X62 E;  1J5E E;  3QT7 A;  5IXM B;  4LTY A;  2EM0 A;  4DV2 E;  4GEQ B;  4X65 E;  5KL6 A;  1H7U A;  2EJ4 A;  2L33 A;  3WU4 A;  4LCF A;  2LJU A;  3EQ1 A;  1UHZ A;  1KTV A;  2OI2 A;  2UXB I;  5LMU I;  1H74 A;  3TQM A;  5IWA I;  4IFD C;  2EZ6 A;  4FW7 A;  4BBY A;  1WHQ A;  3LPS A;  3PRY A;  1VIS A;  1KIJ A;  4FWD A;  3F6H A;  2EML A;  1RR9 A;  1TF6 A;  1R6L A;  4YHH E;  3J7A G;  5K36 A;  1PKP A;  1F2I G;  4GQU A;  2EP3 A;  5DRQ A;  1HNW E;  4O5G A;  5C0X B;  2N8X A;  4B3M I;  2R76 A;  4LF7 E;  2N3G A;  4WFT A;  3F0N A;  2ZIT A;  3P06 A;  3QG5 C;  2L2K B;  2WNR A;  3B82 A;  3V5R A;  2LCE A;  3Q1Q A;  2V8P A;  2EM7 A;  2ZM6 I;  1GQE A;  2BA0 G;  2RSM A;  1ELO A;  2YTO A;  4DV4 E;  2BA1 D;  1T4O A;  4USM A;  5AAS A;  1Z1B A;  4HEI A;  3THN A;  1G2F C;  4HYM A;  5JEA D;  2C38 B;  1R6M A;  5DRR A;  1D6T A;  2FV4 B;  1J26 A;  2CPN A;  4R2E A;  2CT1 A;  1RQ0 A;  2EMB A;  2V85 A;  2CG9 A;  3M85 G;  4FK5 C;  1STU A;  4FW5 A;  2EWL A;  2EPN A;  1DAR A;  2B7V A;  1HNX E;  2MDR A;  2L3C A;  4LFC I;  2UUA I;  3D4J A;  4R2C A;  3UHM A;  2NN6 B;  1N32 E;  4I3H A;  1XNR I;  4JV5 I;  2PNL A;  2PO1 B;  4I8O A;  2X36 A;  1RMD A;  5EL9 A;  1B62 A;  4NXM I;  2PNZ A;  2BM0 A;  3ECR A;  5CFF E;  1WRJ A;  3J80 C;  2M4I A;  4LF8 I;  4O4K A;  3EPK A;  4OOG C;  3NZK A;  1A1I A;  3M6A A;  3Q6N A;  2EL5 A;  4N4R B;  3OML A;  4TUI A;  2JE6 A;  3LTO A;  3PYF A;  4DR5 E;  1P47 A;  1JK1 A;  2V86 A;  4JI5 I;  2HK3 A;  4U3B A;  4MU4 A;  1ZBT A;  1VI7 A;  5A6K A;  2EPX A;  1TF3 A;  4NXN I;  3U1K A;  4DV3 I;  4JG4 A;  2Z5B A;  1Y60 A;  4OO1 F;  5K36 B;  1MX0 A;  2LE2 A;  2EOZ A;  2YTG A;  5KL2 A;  4R2D A;  1I94 E;  3B4T A;  2EOM A;  3K85 A;  3PS3 A;  3ZOQ B;  2HK2 A;  4LFA E;  4WYQ B;  4DV1 I;  4NBQ A;  2EOO A;  2UXC I;  4DUY I;  3DJW A;  3BF2 A;  4DKK A;  1L4S A;  4WUB A;  4DV5 I;  1KKH A;  4FN5 A;  4N3O A;  2BB8 A;  1X47 A;  1ZM3 A;  3DF6 A;  2YU8 A;  2F1D A;  4AIM A;  5A6B A;  1A1F A;  3HUL A;  2M9A A;  4PRV A;  5T6J A;  4MYU A;  4X62 I;  4PRX A;  2E5L E;  4OO1 A;  3PYG A;  1QNT A;  3U1Y A;  4DV2 I;  4X65 I;  4KQV A;  2EL6 A;  1G2D C;  2JYA A;  2DMY A;  2MKN A;  4B3T E;  5A6J A;  2DLQ A;  2JR1 A;  1A1J A;  4J3D A;  4O24 A;  1UN6 B;  2BA1 G;  2EM3 A;  2IOQ A;  3B78 A;  3ZM7 A;  4JI8 E;  3JTZ A;  2L6M A;  4YHH I;  2EN3 A;  2ENH A;  2WBU A;  2O1W A;  2PNZ B;  1X5W A;  1EH8 A;  2DEI A;  1HNW I;  4IFD E;  3ZKB A;  2BM1 A;  5GME A;  4LF7 I;  2EMF A;  2EOX A;  1NHH A;  3QT6 A;  4UTG A;  2HFS A;  1OYR A;  5A6A A;  4P7A A;  3J81 C;  1MGT A;  3H1C A;  4KHP I;  2UU9 E;  1NHJ A;  2EPL X;  4RH8 A;  4M1K A;  2JEA B;  2EMA A;  2JEB B;  2LRS A;  5C0X D;  4DV4 I;  2PRT A;  1ZR9 A;  5DNL A;  1QU6 A;  4Q28 A;  3JU0 A;  1N0U A;  3M85 D;  4F54 A;  1Y5Y A;  4FW6 A;  4JI4 E;  4EMD A;  5FLX Q;  4NXN E;  1Z5A A;  3CDJ A;  2WZO A;  4PU9 A;  5AE1 A;  4WUD A;  4FW9 A;  2M7Q A;  4MYT A;  5IT9 Q;  2V88 A;  1HNX I;  2PO0 A;  4BC7 A;  1RC7 A;  1X6F A;  2DEJ A;  3RMP A;  2EMZ A;  2BR2 A;  2UXD E;  4Z7C A;  3VK6 A;  4DV1 E;  2VQF E;  4FWG A;  4DPT A;  1KYQ A;  2F8B A;  2LMZ A;  4YY3 E;  2ELZ A;  2BBG A;  4DV5 E;  4FWH A;  1GTK A;  4MDT A;  1ZBQ A;  4DXL A;  4DV6 I;  1UDQ A;  2PO2 A;  4IFD F;  2KHX A;  1Z0G A;  2RTX A;  2NN6 D;  4DR5 I;  1LLM C;  2VQE E;  2XEX A;  1PIE A;  3OTO E;  1Y4U A;  4HY1 A;  3THO B;  2YTI A;  5L3J A;  3L00 A;  1ZU1 A;  2FGG A;  3LNU A;  2EPR A;  2JY9 A;  2B3T B;  2IHR 1;  1WXR A;  1A1G A;  1I94 I;  3ADI A;  4MU3 A;  4LFB E;  4BHC A;  1H73 A;  4RHB B;  1FWK A;  4LFA I;  2ADR A;  2C37 B;  3WU3 A;  4IFD A;  4F9C B;  3F6G A;  3LLH A;  1K47 A;  1UDO A;  1XHK A;  2O1V A;  2Z5E A;  3GCM A;  2RPC A;  5K36 D;  4DR2 E;  2WW4 A;  1XMO E;  3MHS C;  4BMJ A;  2WP8 B;  1T38 A;  2EN7 A;  1BBG A;  4R2A A;  2F4V E;  2E5L I;  2YRM A;  4B3R E;  2MDG A;  4P7D A;  2WCC 3;  3VYX A;  4KHP E;  3V2U C;  3ZZ0 A;  1FJG E;  2N3H A;  4B3T I;  2E1R A;  4OO1 E;  5A69 A;  3C6M A;  4WSG A;  1XNQ E;  4WSP A;  4WPY A;  3J7A M;  2YTJ A;  3MHH C;  2PO0 B;  2ODR D;  4JI8 I;  4IZJ B;  1IQO A;  2JP9 A;  3CWV A;  4HAC A;  1S4E A;  3AUZ A;  1T39 A;  2LO3 A;  2JVA A;  1EA6 A;  2YWQ A;  2HJJ A;  1SR9 A;  1Z0C A;  4BA2 A;  4HTG A;  5BR8 E;  2DRP A;  2EN2 A;  3P3C A;  1IBM E;  4R1F A;  5AE3 A;  1A1K A;  4KWY A;  1IMU A;  2PO2 B;  3JAM Q;  2O1T A;  2M1S A;  4QNK A;  2UU9 I;  1ZXM A;  3BBG A;  1FNM A;  1AAY A;  3EPJ A;  2V34 A;  2X7I A;  5JEA C;  1YYK A;  1AH5 A;  1N34 E;  4TUG A;  1A1H A;  2VES A;  4MLV A;  2YPN A;  2FTX B;  2EMX A;  4DV6 E;  1RRE A;  4ZYH A;  4JI3 E;  2V2Q A;  2EMY A;  4GKJ E;  5A2Q C;  2DIX A;  2YU5 A;  2IER A;  2EPU A;  1UIL A;  2VRD A;  4R2S A;  2A25 A;  3C4T A;  4JI4 I;  4O43 A;  2GPI A;  4IFD B;  1U2R A;  3IWC A;  2UUB I;  4P52 A;  1OYS A;  5LL6 R;  2EN1 A;  4JI0 E;  1WJP A;  1X49 A;  4M2Z A;  1QZR A;  1ZM2 A;  2NUE A;  2UXD I;  3HQ1 A;  2RS7 A;  2VQF I;  2HKE A;  1UEK A;  2WNR B;  2EPC A;  5LMN E;  3WU5 A;  2Q8U A;  1X3C A;  2EOJ A;  2EPZ A;  2R3V A;  4YY3 I;  4ED4 A;  3IWD A;  2EOE A;  1XMQ E;  1DGC A;  4DV0 E;  2L3J A;  1B63 A;  1Z0E A;  4HXZ A;  2EMK A;  5FLX C;  1OYP A;  2LV2 A;  2IOP A;  4OO1 D;  2VQE I;  4R2R A;  3OTO I;  3DD6 A;  2JOX A;  3P3G A;  3PYE A;  4GZN C;  4DPW A;  4X8W A;  2EQ3 A;  2J7J A;  5KL7 A;  1DQ3 A;  4X64 E;  4OKG A;  2V87 A;  3EPL A;  2E72 A;  1SFE A;  5KL4 A;  4DPU A;  4LFB I;  2VE7 C;  1WUU A;  1Z5C A;  4J8Z A;  4R2P A;  4B3S E;  2EQ1 A;  2NPF A;  4DR7 E;  3M99 B;  1KJK A;  4JI7 E;  1TN9 A;  1IBK E;  1YUJ A;  2EM2 A;  4IZK A;  4DR2 I;  1YPN A;  3ADL A;  3Q6M A;  1XMO I;  3B8H A;  3ADG A;  1FWL A;  2F4V I;  2E1M A;  2EOF A;  2EMH A;  4NZV A;  3HPZ A;  1UDS A;  2JE6 B;  4U3D A;  4URL A;  2V2V A;  4B3R I;  3GLL A;  3T1H E;  1FJG I;  3ZKD A;  2JXP A;  1RHY A;  2C39 A;  4ZVI A;  4JI6 E;  3J80 Q;  2Z5B B;  2EN8 A;  2CTD A;  1PDA A;  1B69 A;  2I13 A;  2V83 A;  3WU6 A;  1XNQ I;  2EPM X;  4DMI A;  2K7I A;  1GZ6 A;  1YYW A;  2GQ0 A;  2EPA A;  1IBL I;  4WUC A;  2CSH A;  1OJ4 A;  1EH6 A;  1UDN A;  2NUG A;  5AC5 A;  1HR0 E;  2LJP A;  3PS1 A;  4M9V C;  3LML A;  2YTD A;  3H09 A;  2UUB E;  2GO3 A;  4NHR A;  1ZM4 A;  2CGE A;  5BR8 I;  3ADJ A;  3BID A;  4X66 E;  4JI1 E;  4P78 A;  2YTQ A;  1IBM I;  4DUZ E;  2ELY A;  1YUI A;  3GME A;  4IZJ D;  2RS6 A;  2GHF A;  4Z7Y A;  2YTN A;  1J5E I;  2YRH A;  5C0X C;  3M7N G;  4OO1 B;  4DR1 E;  4X9J A;  1N34 I;  2EM9 A;  4JYA E;  1KVK A;  4LCG A;  2R1F A;  2R42 A;  5C0X A;  3K1J A;  4JI3 I;  5TSE A;  4GKJ I;  2LBS B;  2A2C A;  1BKN A;  3QT8 A;  4AM3 A;  5F3W A;  2GS8 A;  4F9A B;  2H36 X;  1PJQ A;  1Z0W A;  3ZZU A;  2LT7 A;  4OZE A;  4LPF A;  1O0W A;  5AE2 A;  4AQY E;  2J7K A;  2NN6 F;  4DPX A;  3IWB A;  4K0K E;  1USV A;  4DR3 E;  1H72 C;  4F6N A;  4JI0 I;  3T1Y E;  4MU1 A;  4OX9 I;  1FI4 A;  4IZK B;  4LF6 E;  2C38 A;  4DR4 E;  5DNY A;  2LJH A;  2UUC E;  3BGH A;  1Z0B A;  3PS2 A;  4IFD D;  4MLQ A;  4DV7 E;  1T4L B;  1FKA E;  4BS9 A;  2ZBK B;  3L7Z A;  3PYD A;  5LMN I;  2NN6 C;  5DRO A;  3VHT B;  1XMQ I;  2EN6 A;  4DV0 I;  2EMW A;  2DGC A;  1EKZ A;  2NN6 A;  2V89 A;  2LUP B;  3GON A;  2PO1 A;  2L8T A;  3J81 Q;  2LVH A;  1A6F A;  2EOY A;  4X64 I;  4F6M A;  2HFU A;  2B9D A;  2AJ4 A;  2EM8 A;  1N33 E;  2HHH E;  1NCS A;  4BCA A;  1ZM9 A;  4ISA A;  4B3S I;  5K36 C;  2YT4 A;  1IBL E;  4DU7 A;  2BR2 B;  4DR7 I;  1S16 A;  2O3Z A;  5GMD A;  1X6H A;  5JEA F;  2YTE A;  4ZYG A;  2BV3 A;  4WXC A;  4JI7 I;  1IBK I;  2A2D A;  2EOI A;  2KOU A;  1PJT A;  1NHI A;  4LF5 E;  3CDI A;  1N3G A;  1YYO A;  2DB2 A;  2EOR A;  4JI2 I;  4DU8 A;  3T1H I;  1X6E A;  2MC6 A;  3VYY A;  2O1U A;  4L8N A;  2ODR C;  4JI6 I;  1IQS A;  1N0V C;  2EM5 A;  2EL4 A;  5JEA A;  2EOH A;  1HNZ E;  5EKW A;  2RSI A;  2J65 A;  2Q2E B;  3ZZT A;  4BA1 A;  1HR0 I;  4LF9 I;  1Z5B A;  3P3E A;  4IJD A;  4DPY A;  2EPK X;  3L7Z B;  4JI1 I;  4X66 I;  4OX9 E;  1WHN A;  2EQ0 A;  2MC5 A;  3K17 A;  4DUZ I;  3M7N D;  1YHC A;  2HC5 A;  3C6K A;  1E3H A;  2JOB A;  3MSW A;  1Z59 A;  4DR1 I;  4JYA I;  2L2N A;  4R8O A;  2EM6 A;  4F2J C;  2EPO A;  1JK2 A;  4GKK E;  4LF4 E;  1MU5 A;  4DR6 E;  2L92 A;  2YRK A;  5A6B D;  5IV8 B;  1N36 I;  2DLK A;  2EMC A;  5C0X E;  4XTJ A;  3P1X A;  4LOM A;  2JWO A;  2D9H A;  2MKD A;  2ENA A;  4RPF A;  4AQY I;  3HXL A;  2VF1 A;  4HAC B;  2JEB A;  5IT9 C;  4DR3 I;  2NA2 A;  2JEA A;  5LLQ A;  4K0K I;  2LUQ A;  4USK A;  2UXB E;  3T1Y I;  5LMU E;  4LF6 I;  1YSA C;  2EN4 A;  4BA2 B;  5IWA E;  4WXD A;  4DR4 I;  3K6Q A;  2AE8 A;  2UUC I;  1PVG A;  4DV7 I;  1EH7 A;  4M0V A;  1Y6Z A;  2HGH A;  1HK7 A;  4WX9 A;  4OO1 C;  4B3M E;  2EFG A;  1BBO A;  4LU9 A;  1MG7 A;  2G7H A;  2NAB A;  2JPA A;  5JEA B;  2K4V A;  2RQL A;  1P42 A;  4BC9 A;  4F9B B;  4JI2 E;  3HTX A;  2LTS A;  1NZ0 A;  4UT4 A;  1Z0T A;  4BA1 B;  2ZM6 E;  4M30 A;  4MU0 A;  2NN6 E;  2EE8 A;  4ZYD A;  3HKM A;  2ENC A;  2PNM A;  5AC4 A;  2Z5C A;  1ZAA C;  2GLI A;  2EM4 A;  1N33 I;  2HHH I;  3C4B A;  1Z0V A;  3H4L A;  3UK3 C;  5A2Q Q;  5C0X F;  4Q35 B;  4IS9 A;  1EI1 A;  4LF9 E;  2YZT A;  3HPS A;  5DRP A;  5ELW A;  4FW3 A;  3KZZ A;  1DI2 A;  4IS1 C;  1Y4S A;  2YSO A;  4MQY A;  4LF5 I;  2JT2 A;  2EOS A;  2V8Q B;  4LFC E;  2CVE A;  2UUA E;  1X48 A;  5K36 E;  1XNR E;  2C37 A;  4JV5 E;  1E3P A;  1YFH A;  2KON A;  1UBD C;  2YTF A;  2L2M A;  1YZ9 A;  2BA0 D;  4BHB A;  3HJC A;  4AID A;  5FWK A;  4R03 A;  5ADZ A;  4NXM E;  2HKJ A;  3FIG A;  4LF8 E;  4FW4 A;  2EMI A;  1USU A;  2EPP A; 
#chains in the Genus database with same CATH homology
 4KZS A;  2CZ9 A;  1HNZ I;  1N36 E;  4JI5 E;  2NUF A;  4DV3 E;  1T4N A;  2LTR A;  2B7T A;  3QT5 A;  2V2Z A;  3AV0 A;  3KWR A;  4IZJ A;  3J7Y p;  3JAM C;  1N32 I;  2DSY A;  1ZXN A;  2UXC E;  4DUY E;  4L5N C;  1H7S A;  4GKK I;  4LF4 I;  2VF3 A;  2Z5C B;  4DR6 I;  4X62 E;  1J5E E;  3QT7 A;  4LTY A;  4DV2 E;  4GEQ B;  4X65 E;  1H7U A;  2L33 A;  3WU4 A;  1UHZ A;  1KTV A;  2OI2 A;  2UXB I;  5LMU I;  1H74 A;  5IWA I;  2EZ6 A;  4BBY A;  1WHQ A;  3LPS A;  3PRY A;  1VIS A;  1KIJ A;  4FWD A;  3F6H A;  1RR9 A;  4YHH E;  3J7A G;  1PKP A;  1HNW E;  4B3M I;  4LF7 E;  2N3G A;  4WFT A;  3F0N A;  2ZIT A;  3P06 A;  2L2K B;  3B82 A;  3V5R A;  3Q1Q A;  2V8P A;  2ZM6 I;  1GQE A;  2RSM A;  1ELO A;  4DV4 E;  1T4O A;  4USM A;  5AAS A;  4HYM A;  1D6T A;  2FV4 B;  1J26 A;  2CPN A;  2CG9 A;  1RQ0 A;  2V85 A;  1STU A;  2EWL A;  1DAR A;  2B7V A;  1HNX E;  2MDR A;  2L3C A;  4LFC I;  2UUA I;  3D4J A;  1XNR I;  1N32 E;  4I3H A;  4JV5 I;  2PNL A;  4I8O A;  2X36 A;  1B62 A;  4NXM I;  2BM0 A;  4LF8 I;  5CFF E;  3J80 C;  2M4I A;  4OOG C;  3M6A A;  3Q6N A;  3OML A;  4TUI A;  3PYF A;  3LTO A;  4DR5 E;  2V86 A;  4JI5 I;  2HK3 A;  1ZBT A;  4NXN I;  4DV3 I;  4JG4 A;  2Z5B A;  1MX0 A;  2LE2 A;  1I94 E;  3K85 A;  3ZOQ B;  2HK2 A;  4LFA E;  4WYQ B;  4DV1 I;  2UXC I;  4DUY I;  3DJW A;  4DKK A;  4WUB A;  4DV5 I;  1KKH A;  4FN5 A;  4N3O A;  1X47 A;  1ZM3 A;  3DF6 A;  3HUL A;  4PRV A;  5T6J A;  4MYU A;  4X62 I;  4PRX A;  2E5L E;  1J5E I;  3PYG A;  4DV2 I;  4X65 I;  4KQV A;  2DMY A;  4B3T E;  2JR1 A;  2IOQ A;  3B78 A;  3ZM7 A;  4JI8 E;  3JTZ A;  2L6M A;  4YHH I;  2O1W A;  1HNW I;  2DEI A;  3ZKB A;  2BM1 A;  5GME A;  4LF7 I;  3QT6 A;  1NHH A;  4UTG A;  2HFS A;  4P7A A;  3J81 C;  4KHP I;  2UU9 E;  1NHJ A;  4M1K A;  2LRS A;  4DV4 I;  1QU6 A;  4Q28 A;  3JU0 A;  1N0U A;  4F54 A;  4EMD A;  5FLX Q;  4JI4 E;  4NXN E;  1Z5A A;  2WZO A;  4PU9 A;  5AE1 A;  4WUD A;  4FW9 A;  2M7Q A;  4MYT A;  5IT9 Q;  2V88 A;  1HNX I;  4BC7 A;  1RC7 A;  2DEJ A;  3RMP A;  2UXD E;  4Z7C A;  3VK6 A;  4DV1 E;  2VQF E;  4FWG A;  4DPT A;  2LMZ A;  2F8B A;  4YY3 E;  4DV5 E;  4FWH A;  4DXL A;  4DV6 I;  1ZBQ A;  2KHX A;  1Z0G A;  2RTX A;  4DR5 I;  2VQE E;  2XEX A;  1PIE A;  3OTO E;  1Y4U A;  4HY1 A;  5L3J A;  2FGG A;  3LNU A;  2JY9 A;  2B3T B;  2IHR 1;  1WXR A;  1I94 I;  3ADI A;  4LFB E;  1H73 A;  1FWK A;  4LFA I;  3WU3 A;  4F9C B;  3F6G A;  3LLH A;  1K47 A;  1XHK A;  2O1V A;  2Z5E A;  4DR2 E;  2WW4 A;  1XMO E;  4BMJ A;  2F4V E;  2E5L I;  4B3R E;  4P7D A;  3VYX A;  4KHP E;  3V2U C;  3ZZ0 A;  1FJG E;  2N3H A;  4B3T I;  2E1R A;  1XNQ E;  4WSP A;  4WPY A;  3J7A M;  2ODR D;  4JI8 I;  4IZJ B;  3CWV A;  4HAC A;  1S4E A;  3AUZ A;  2JVA A;  1EA6 A;  1Z0C A;  1SR9 A;  5BR8 E;  1IBM E;  4R1F A;  5AE3 A;  3JAM Q;  2O1T A;  2M1S A;  2UU9 I;  1ZXM A;  1FNM A;  2V34 A;  2X7I A;  1YYK A;  1N34 E;  4TUG A;  2FTX B;  4DV6 E;  1RRE A;  4JI3 E;  2V2Q A;  4GKJ E;  5A2Q C;  2DIX A;  1UIL A;  4JI4 I;  3C4T A;  1U2R A;  3IWC A;  2UUB I;  4P52 A;  5LL6 R;  4JI0 E;  1X49 A;  4M2Z A;  1QZR A;  1ZM2 A;  2NUE A;  2UXD I;  3HQ1 A;  2RS7 A;  2VQF I;  2HKE A;  1UEK A;  3WU5 A;  5LMN E;  2R3V A;  4YY3 I;  4ED4 A;  3IWD A;  1XMQ E;  4DV0 E;  2L3J A;  1B63 A;  1Z0E A;  4HXZ A;  5FLX C;  2IOP A;  2VQE I;  3OTO I;  3PYE A;  2JOX A;  4DPW A;  4X8W A;  1DQ3 A;  4X64 E;  2V87 A;  4DPU A;  4LFB I;  2VE7 C;  1WUU A;  1Z5C A;  4J8Z A;  4B3S E;  2NPF A;  4DR7 E;  4JI7 E;  1IBK E;  4IZK A;  4DR2 I;  3ADL A;  3Q6M A;  1XMO I;  3B8H A;  3ADG A;  1FWL A;  2F4V I;  2E1M A;  3HPZ A;  4URL A;  4B3R I;  2V2V A;  3T1H E;  1FJG I;  3ZKD A;  4ZVI A;  4JI6 E;  3J80 Q;  2Z5B B;  1XNQ I;  3WU6 A;  2V83 A;  4DMI A;  2GQ0 A;  1GZ6 A;  1YYW A;  1IBL I;  4WUC A;  1OJ4 A;  2NUG A;  1HR0 E;  2LJP A;  3LML A;  3H09 A;  2UUB E;  1ZM4 A;  2CGE A;  5BR8 I;  3ADJ A;  4X66 E;  4JI1 E;  4P78 A;  1IBM I;  4DUZ E;  4IZJ D;  2RS6 A;  4Z7Y A;  4DR1 E;  1N34 I;  4JYA E;  1KVK A;  2R42 A;  3K1J A;  4JI3 I;  4GKJ I;  2LBS B;  2A2C A;  1BKN A;  3QT8 A;  5F3W A;  2GS8 A;  4F9A B;  2H36 X;  1Z0W A;  3ZZU A;  1O0W A;  5AE2 A;  4AQY E;  2J7K A;  4DPX A;  3IWB A;  4K0K E;  1USV A;  4DR3 E;  1H72 C;  4JI0 I;  3T1Y E;  4OX9 I;  1FI4 A;  4IZK B;  4LF6 E;  4DR4 E;  5DNY A;  2LJH A;  2UUC E;  1Z0B A;  1T4L B;  4DV7 E;  2ZBK B;  1FKA E;  4BS9 A;  3PYD A;  5LMN I;  1XMQ I;  4DV0 I;  1EKZ A;  2V89 A;  2LUP B;  3GON A;  2L8T A;  3J81 Q;  1A6F A;  4X64 I;  2HFU A;  2B9D A;  2AJ4 A;  1N33 E;  2HHH E;  1ZM9 A;  4BCA A;  4B3S I;  2YT4 A;  1IBL E;  4DU7 A;  4DR7 I;  1S16 A;  5GMD A;  2BV3 A;  4JI7 I;  1IBK I;  2A2D A;  2KOU A;  1NHI A;  4LF5 E;  1YYO A;  2DB2 A;  4JI2 I;  4DU8 A;  3T1H I;  2MC6 A;  3VYY A;  2O1U A;  4L8N A;  2ODR C;  4JI6 I;  1N0V C;  1HNZ E;  3ZZT A;  2Q2E B;  4LF9 I;  1HR0 I;  1Z5B A;  4DPY A;  4JI1 I;  4X66 I;  4OX9 E;  1WHN A;  3K17 A;  2MC5 A;  4DUZ I;  2JOB A;  3MSW A;  1Z59 A;  4DR1 I;  4JYA I;  2L2N A;  4R8O A;  4GKK E;  4LF4 E;  1MU5 A;  4DR6 E;  2L92 A;  1N36 I;  4XTJ A;  3P1X A;  2JWO A;  4AQY I;  4RPF A;  3HXL A;  2VF1 A;  4HAC B;  4DR3 I;  5IT9 C;  4K0K I;  2NA2 A;  2LUQ A;  4USK A;  2UXB E;  3T1Y I;  5LMU E;  4LF6 I;  5IWA E;  4DR4 I;  3K6Q A;  2UUC I;  1PVG A;  4DV7 I;  4M0V A;  1Y6Z A;  1HK7 A;  4B3M E;  2EFG A;  4LU9 A;  1MG7 A;  2G7H A;  2K4V A;  4BC9 A;  4F9B B;  4JI2 E;  3HTX A;  2LTS A;  1NZ0 A;  4UT4 A;  1Z0T A;  2ZM6 E;  4M30 A;  2PNM A;  2Z5C A;  1N33 I;  2HHH I;  3C4B A;  1Z0V A;  3H4L A;  5A2Q Q;  1EI1 A;  4LF9 E;  2YZT A;  3HPS A;  1DI2 A;  1Y4S A;  4LF5 I;  2V8Q B;  4LFC E;  2UUA E;  1X48 A;  1XNR E;  4JV5 E;  3HJC A;  2KON A;  2L2M A;  1YZ9 A;  5FWK A;  4R03 A;  4NXM E;  5ADZ A;  2HKJ A;  3FIG A;  4LF8 E;  1USU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...