5BR8E

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 5br8E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5br8E02
2UXCE 2UXDE 4X8WA 5A2QQ 2YT4A 2RS7A 1YYWA 4JI7E 1BKNA 1J5EE 4LFBI 2VQFE 4DR2E 1N33I 1WHQA 3WU4A 1RREA 4URLA 4B3SE 2LTSA 1FKAE 4WUBA 4OX9E 1FJGE 1MX0A 4XTJA 2V8PA 1HNZI 2R42A 3CWVA 1HNXE 3QT7A 1YYKA 1Z5CA 2L2NA 4GKJI 4LFAE 1XNQI 2MDRA 3Q1QA 1PIEA 2L3JA 4OOGC 4LF4I 4LF7I 3J7AM 2DEIA 1KTVA 4WYQB 2XEXA 4JI3I 2A2DA 4LF8I 3PYDA 3M6AA 4DV2I 4DV1E 4M1KA 2LUQA 2ZITA 5BR8E 1RQ0A 1PKPA 5LMUI 4JG4A 1Z0CA 4DV6I 3T1YI 4X62I 1ZM2A 3ADJA 4M2ZA 4JYAI 4Z7YA 4K0KI 2LJPA 2OI2A 1IBMI 4R1FA 5GMEA 4DUZI 2ZM6E 4JI1I 3ZKBA 1IBLI 4WFTA 3C4BA 2UUCE 3ADLA 1NHHA 4DPTA 1H7SA 4DPUA 4JI2I 1IBKE 2Q2EB 3F0NA 4P7AA 4NXNI 2E5LE 3V5RA 1T4NA 2UUAI 2B7VA 4JI4E 1EA6A 3ZZ0A 4YHHE 4KHPI 2VF3A 2BV3A 4LF5I 2F4VI 4X66I 4DR3I 1Z0BA 4M30A 1N36I 5LMNE 2JVAA 4NXMI 3J7Yp 1XMOE 2DIXA 4DV4E 2HKJA 1HR0E 4UT4A 1Z0GA 1XNRE 4JI0E 4DR5E 2NUGA 2ZBKB 4B3TI 2UUBI 4B3RE 2AJ4A 4DR1I 3T1HI 4USMA 4DV7I 3P1XA 2HHHE 5IWAI 4X64E 1KIJA 1NHIA 4JI6E 3V2UC 2JY9A 1XHKA 4DV0I 4DV5E 1KKHA 2LUPB 4B3ME 4DV3E 4MYUA 1J5EI 4DUYI 4HACB 4JI5I 1J26A 3B78A 5FLXC 3J7AG 2NA2A 3WU5A 4DR6E 4LFBE 3B82A 1Z0TA 3D4JA 1N33E 1X49A 2V2ZA 4DKKA 1XMQE 2N3GA 1QU6A 2DMYA 4FN5A 2HFSA 1UHZA 3OTOI 1HNZE 4JI8I 3C4TA 2GS8A 2LJHA 3HULA 1HNWE 4P52A 2L2KB 4GKJE 3WU3A 5IT9C 4DPWA 4DR7I 2L2MA 3ZZUA 1DARA 1ZXMA 1GQEA 1EKZA 5A2QC 1MG7A 4LF4E 4LF7E 4Z7CA 4JI3E 2LRSA 1I94I 3K1JA 2L33A 1S4EA 2NUFA 4DV2E 4GKKI 2EZ6A 1O0WA 5LMUE 2UUCI 4LFCI 3T1YE 4X62E 2EFGA 1Z0VA 4K0KE 2VQEI 3H4LA 4HACA 2B7TA 3ZKDA 3ADGA 1IBLE 4AQYI 4HXZA 3J81Q 2RTXA 4LF9I 2UU9I 4JI4I 4DU7A 4LF6I 4JI2E 4HY1A 1YZ9A 4X65E 2HK2A 4NXNE 2V2VA 4YY3E 1H72C 3J80C 2RSMA 4I3HA 2UXBI 2UUAE 4RPFA 2CZ9A 4DPYA 1Z5AA 2BM0A 3PYEA 4JV5I 4FWHA 4KHPE 3WU6A 3JAMC 3PYGA 1Z0EA 4LF5E 2KHXA 2F4VE 4X66E 4DR3E 1N36E 2WW4A 1VISA 4FWGA 1Z5BA 4MYTA 1U2RA 3ZZTA 1UILA 3LNUA 4DPXA 1RC7A 1N32I 3ZM7A 4DR4I 4WUCA 2UXCI 2UXDI 2UUBE 1B63A 1N0UA 4DR1E 3T1HE 4JI7I 1NZ0A 1N34E 1K47A 5IWAE 2VQFI 4DR2I 2LBSB 2B3TB 2IHR1 4B3SI 3QT8A 1H73A 4OX9I 4DR6I 1FJGI 4DV0E 4USKA 1H74A 3HTXA 2NUEA 4ZVIA 4DUYE 3QT5A 1HNXI 4HYMA 1ZM9A 4LFAI 4JI5E 1XMQI 2E1RA 1STUA 1YYOA 4WUDA 1EI1A 2NPFA 2V2QA 3LPSA 2HFUA 3VYYA 2BM1A 1NHJA 2HK3A 1XNQE 4DV1I 1HNWI 1T4LB 4PRXA 5BR8I 4KQVA 1N0VC 1X47A 4DU8A 2CPNA 4DXLA 1QZRA 2X36A 1S16A 3OTOE 4JI8E 4LF8E 1FWKA 4DR7E 1X48A 4FW9A 2ZM6I 2A2CA 2L3CA 1ELOA 4DV6E 3GONA 1ZM3A 1FWLA 3J80Q 4ED4A 1FNMA 4JYAE 1IBKI 1I94E 1B62A 1IBME 3ADIA 1ZBTA 2E5LI 4DUZE 4GKKE 4JI1E 1D6TA 1KVKA 3JAMQ 4FWDA 1Z0WA 2J7KA 1T4OA 4LFCE 4YHHI 1OJ4A 3LTOA 2VQEE 1A6FA 4X65I 5LL6R 1DI2A 4PRVA 1UEKA 5LMNI 4YY3I 4AQYE 4LF9E 2UU9E 4EMDA 4LF6E 1XMOI 4DV4I 2R3VA 1HR0I 3K17A 3LLHA 1XNRI 4JI0I 2HKEA 4DR5I 5FLXQ 1WUUA 5L3JA 4NXME 4B3RI 3PYFA 2UXBE 3B8HA 1Z59A 4JV5E 2HHHI 4X64I 4JI6I 2LTRA 1FI4A 3QT6A 4B3TE 1ZM4A 3J81C 1H7UA 1MU5A 2V34A 1PVGA 4UTGA 4PU9A 4DV5I 4B3MI 4DV7E 5GMDA 4DV3I 2RS6A 1WHNA 1N34I 3VYXA 2DB2A 1RR9A 2DEJA 1N32E 2X7IA 2N3HA 5CFFE 5IT9Q 4DR4E 1ZXNA
chains in the Genus database with same CATH superfamily
2UXCE 2UXDE 2EN6A 4X8WA 2EM3A 2GQ0A 5A2QQ 2YT4A 3THNA 2RS7A 4GEQB 1YYWA 2F1DA 4BC9A 4JI7E 1BKNA 1J5EE 4LFBI 2MC5A 3HPSA 5K36D 1R6MA 4ISAA 2VQFE 4DR2E 4ZYDA 1N33I 5FWKA 2O1VA 2JEAB 1WHQA 3WU4A 3P3CA 1RREA 4O43A 1RMDA 2YTOA 3P06A 4URLA 3KWRA 4B3SE 2LTSA 1FKAE 2C39B 4WUBA 5DRPA 2VE7C 2FTXB 4OX9E 1FJGE 4LCGA 4OKGA 2PNZB 1X6FA 5JEAB 1MX0A 4XTJA 4OO1F 1UN6B 4FW4A 3U1YA 2KONA 2V8PA 1HNZI 1YH8A 1EH6A 5DRRA 4BA1A 2R42A 3PS3A 2C38A 3CWVA 2EMLA 2BA1G 1HNXE 3QT7A 1BBGA 3VK6A 1YYKA 1Z5CA 2L2NA 2PRTA 3CDIA 4WX9A 4LFAE 4IS9A 4MU3A 5C0XE 4GKJI 1XNQI 2MDRA 3Q1QA 3AV0A 3BF2A 1PIEA 4QNKA 2L3JA 4OOGC 4MLVA 4LF4I 4LF7I 3J7AM 4WXDA 5K36C 2NN6B 2O3ZA 2DEIA 1KTVA 2C37A 4WYQB 4OO1D 5A6JA 3THOB 2XEXA 4JI3I 1PJQA 4R2PA 1YUJA 3FIGA 3RMPA 3AUZA 2A2DA 1A1LA 4LF8I 3PYDA 4GZNC 2PNLA 1EH7A 3M6AA 4DV2I 4DV1E 4M1KA 2LUQA 4WSGA 5BR8E 2ZITA 2Q8UA 1RQ0A 4R2EA 1PKPA 5LMUI 1F2IG 4JG4A 4IFDF 2DGCA 1Z0CA 1JK1A 3F6GA 2DMIA 4DV6I 1EH8A 3T1YI 4BS9A 4J8ZA 3GCMA 2EORA 4X62I 1ZM2A 3ADJA 4M2ZA 3HQ1A 4JYAI 4Z7YA 4K0KI 2LJPA 3MHHC 3CDJA 4FW5A 2OI2A 4FW6A 4IZKB 4R1FA 1IBMI 1TF6A 5GMEA 5ADZA 4DUZI 2ZM6E 4JI1I 3ZKBA 1IQOA 1IBLI 2HC5A 4F6NA 1NEIA 4WFTA 3C4BA 2UUCE 3ADLA 1NHHA 2BBGA 2EP3A 4DPTA 1H7SA 2JT2A 4DPUA 1IQSA 2LJUA 4JI2I 2NABA 1IBKE 4IJDA 2YTPA 2Q2EB 3F0NA 3NZKA 4P7AA 2EN7A 3M85G 4NXNI 4OO1E 2E5LE 1BBOA 2YTGA 5K36B 2M7QA 4BCAA 1KJKA 4MU4A 3PS1A 5T6JA 4F2JC 3V5RA 1T4NA 1USVA 1A1JA 2VESA 2ENHA 2UUAI 4BA1B 2B7VA 4JI4E 2C38B 5JEAA 1UDOA 1EA6A 4BHCA 2PNZA 1P47A 3ZZ0A 4BA2A 1USUA 2EMHA 2EWLA 4J3DA 4YHHE 4KHPI 4P7DA 4O24A 2VF3A 2EOQA 2EE8A 2BV3A 4LF5I 2F4VI 4R2AA 4X66I 4DR3I 1Z0BA 3HPZA 2O1UA 4M30A 1N36I 3B4TA 5LMNE 5AE3A 3HXLA 1OYPA 2EM8A 2JVAA 3TQMA 1R6LA 2EMAA 4NXMI 4N4RB 3J7Yp 5A6KA 4DMIA 4RHBB 1G2DC 2EPXA 2IOPA 2BA0D 4LCFA 4BC7A 1XMOE 2DIXA 4DV4E 2HKJA 4WXCA 1HR0E 4AIDA 4UT4A 2LMZA 1Z0GA 1XNRE 5IXMB 3Q6NA 4JI0E 5ELWA 1B69A 4WSPA 4DR5E 2NUGA 2LVHA 2VRDA 2ZBKB 4B3TI 3M7NG 2UUBI 4B3RE 3P3GA 1ZU1A 2AJ4A 5C0XD 2YWQA 4DR1I 4USMA 4DV7I 3T1HI 3QG5C 3P1XA 2CGEA 2CT1A 2HHHE 3P76A 5IWAI 2EPNA 1DQ3A 4X64E 2EPPA 1X6HA 1KIJA 1HK7A 1NHIA 4JI6E 2HGHA 3V2UC 5TSEA 4MLQA 2YTIA 3F6HA 2JY9A 1P42A 1XHKA 4DV0I 4DV5E 1KKHA 2LUPB 4B3ME 5A6BA 4DV3E 4MYUA 2ADRA 4L8NA 2EN2A 3DF6A 4DUYI 1J5EI 2R1FA 2DRPA 3BBGA 4HACB 4JI5I 4R2DA 2Z5CB 3EQ1A 5FLXC 1J26A 4O4KA 3B78A 2RPCA 2GHFA 3J7AG 2JEBB 2NA2A 5C0XC 3KRNA 3WU5A 2EOOA 4DR6E 3MHSC 5K36A 4BA2B 4U3DA 2YTFA 2YRHA 3IWCA 1PJSA 2EQ0A 2EQ1A 1N3GA 4LFBE 2MDGA 2EPRA 3B82A 1UDNA 1Z0TA 3D4JA 1N33E 1SFEA 1X49A 2EL4A 4R2CA 4U3BA 2ENCA 2V2ZA 4DKKA 2YTQA 1XMQE 1WXRA 2K7IA 2N3GA 1QU6A 2PNMA 5DNLA 5DNXA 2PO0B 2LO3A 4QNJA 2DMYA 4FN5A 3JU0A 3BGHA 2HFSA 1UHZA 5AASA 3OTOI 2RQLA 1HNZE 4MQYA 1ZR9A 4ZYGA 1UBDC 2IOQA 4JI8I 3C4TA 1YHCA 2GS8A 2BR2A 2LJHA 3HULA 1HNWE 4P52A 4ZYHA 2L2KB 2EM7A 3IWBA 5IT9C 2DLKA 4GKJE 3WU3A 4DPWA 4DR7I 4IS1C 2L2MA 3ZZUA 1DARA 1ZXMA 1GQEA 4OO1A 2EMWA 1EKZA 5A2QC 1MG7A 3C6MA 2JPAA 4LF4E 2K4VA 4WPYA 4LF7E 4BMJA 3L7ZB 4Z7CA 2M4IA 4JI3E 2LRSA 4BHBA 1I94I 5IV8B 3K1JA 3K6QA 2L33A 1LLMC 1S4EA 5C0XB 4RH8A 2EPMX 4F6MA 2NUFA 2EN3A 4DV2E 2EZ6A 4GKKI 2EMFA 5KL5A 1A1HA 1A1KA 4OO1C 2A25A 2JOXA 1O0WA 2V86A 1G2FC 5LMUE 2IERA 4IFDD 2EM2A 2CSHA 2UUCI 3BIDA 4LFCI 1BB8A 3T1YE 2EM5A 4X62E 2EPCA 2EFGA 1Z0VA 3L00A 1OYSA 5DRQA 2MC6A 2JXPA 5JEAF 4F9AB 4K0KE 2EMZA 4IZJD 2VQEI 2EM4A 3H4LA 3IWDA 2H36X 2EMIA 4HACA 2B7TA 1SR9A 3ZKDA 2Z5CA 3ADGA 1IBLE 4AQYI 1ZBQA 4HXZA 4NZVA 2JEBA 2GO4A 3J81Q 2RTXA 2PO2A 4LF9I 4X9JA 2UU9I 4JI4I 4DU7A 1PJTA 4AM3A 4LF6I 4JI2E 4HY1A 4I8OA 2EOZA 1YZ9A 4X65E 3KZYA 2CVEA 2NN6F 2HK2A 4NXNE 2ODRD 4IFDC 2V2VA 2BA1D 4YY3E 1H72C 3UK3C 2R76A 2V89A 1T39A 3J80C 2EMCA 2RSMA 4I3HA 2UXBI 2UUAE 4RPFA 2YTDA 4TUGA 2CZ9A 2EOMA 4DPYA 2PO0A 2BR2B 2WNRB 1Y5YA 4FK5C 1Z5AA 1X5WA 2I9IA 2BM0A 3PYEA 4JV5I 4FWHA 4KHPE 1Y4UA 3Q6MA 3WU6A 3JAMC 3PYGA 4IFDE 1Z0EA 2N8XA 2EMXA 4OO1B 2YSOA 4LF5E 2KHXA 2F4VE 4X66E 4DR3E 2EPKX 2EM0A 1N36E 2NN6D 2WW4A 1VISA 2EMKA 4FWGA 2ENAA 1Z5BA 1KYQA 2J7JA 2EL6A 2EOEA 2RSIA 4MYTA 1U2RA 3ZZTA 1UILA 4BBYA 4F54A 3L7ZA 3LNUA 4DPXA 4HEIA 1RC7A 1DGCA 2M1SA 1Y6ZA 4R8OA 2GO3A 4M9VC 2LV2A 1N32I 2O1TA 5C0XA 5AE1A 3ECRA 3ZM7A 2EMGA 4DR4I 4WUCA 2UXCI 2UXDI 2UUBE 2YTNA 3DD6A 1B63A 1N0UA 2WBSA 4DR1E 1WJPA 3T1HE 2JE6B 4LOMA 4JI7I 5L3JA 1NZ0A 5K36F 1N34E 1YPNA 4GQUA 1K47A 4NHRA 3GMEA 4LPFA 5IWAE 4IFDB 3EPJA 1X3CA 2VQFI 4DR2I 2V87A 4MDTA 2EJ4A 2YSPA 4KZSA 2LBSB 2B3TB 3MSWA 2FV4B 2IHR1 3M85D 2PO2B 4B3SI 3QT8A 2YPNA 2O1WA 2Z5BA 1H73A 4IZJB 2EOJA 4OX9I 2LE2A 4DR6I 1FJGI 4DV0E 4USKA 2EL5A 2NN6E 3PRYA 2EN1A 1TN9A 3U1KA 1H74A 3HTXA 3C6KA 2NUEA 1UDSA 2EPLX 4ZVIA 4DUYE 1JK2A 4LCHA 3QT5A 2YTJA 1HNXI 2PO1B 1NCSA 2L8TA 2LCEA 4HYMA 1MEYC 1ZM9A 5AE2A 3EPLA 4JI5E 4LFAI 2WBTA 4TUIA 2EPUA 1XMQI 2E1RA 4Q35B 3KZZA 5DROA 1STUA 3VHTB 1YYOA 2WP8B 2GLIA 2JOBA 4WUDA 2BB8A 1EI1A 2NPFA 2V2QA 1YUIA 5AC4A 2WNRA 1VI7A 2HFUA 1T38A 3LPSA 2KOUA 4Q28A 3VYYA 2BM1A 1NHJA 1Y4SA 1XNQE 2HK3A 4MU0A 4DV1I 1T4LB 1HNWI 2MKNA 5F3WA 4PRXA 5BR8I 4KQVA 1N0VC 2YRKA 1X47A 3ZOQB 2YTEA 2CPNA 4MU1A 4DU8A 4DXLA 2DLQA 2WCC3 1QZRA 2V85A 1S16A 2X36A 2BA0G 3LMLA 3M7ND 3OTOE 2EOHA 4LU9A 4JI8E 5A69A 4LF8E 4R2RA 3M99B 3EPKA 3H09A 3HJCA 1FWKA 2I13A 4DR7E 1X48A 3K85A 4FW9A 2ZM6I 5K36E 2A2CA 2HJJA 2EPAA 2V88A 2E1MA 2LT7A 1X6EA 2L3CA 4DV6E 1ELOA 3GONA 1ZM3A 4HTGA 5KL7A 1FWLA 4N3OA 3J80Q 2VF1A 2EOIA 1QNTA 4ED4A 1FNMA 2V83A 4R03A 2L6MA 4JYAE 1IBKI 1I94E 2JE6A 2ELZA 2JWOA 1MGTA 4R2QA 1B62A 1IBME 1A1IA 1A1FA 3ADIA 1ZBTA 2Z5BB 2E5LI 4IFDA 4DUZE 5KL6A 4GKKE 4JI1E 1D6TA 1KVKA 3JAMQ 5LLQA 4FWDA 1Z0WA 2J7KA 3JTZA 5A6AA 1T4OA 2JR1A 4P78A 4IZJA 4LFCE 2EMBA 1ZAAC 4YHHI 1OJ4A 4M0VA 3LTOA 1E3HA 2DSYA 2M9AA 4AIMA 2VQEE 1A6FA 5JEAD 1YSAC 1L4SA 4X65I 4KWYA 2CG9A 5LL6R 1YFHA 2AE8A 2PO1A 4R2SA 1DI2A 1UDQA 3HKMA 4PRVA 2EN8A 5KL3A 2JP9A 1UEKA 4FW3A 3DJWA 4YY3I 5LMNI 4AQYE 2JEAA 2EOXA 2EQ3A 2EM6A 1XXEA 4LF9E 1E3PA 2C39A 2UU9E 1GZ6A 2EOFA 4EMDA 4LF6E 2WP8A 2WZOA 1XMOI 4DV4I 2R3VA 1HR0I 2EPOA 2EN4A 3LLHA 3K17A 1XNRI 1TF3A 5DNYA 1RHYA 4OZEA 4JI0I 2EM9A 1A1GA 4F9BB 2HKEA 2Z5EA 4DR5I 2YRMA 1OYRA 5FLXQ 2B9DA 1GTKA 2JYAA 2V8QB 1WUUA 4NXME 2IESA 3H1CA 2MKDA 2C37B 2UXBE 3PYFA 5C0XF 4B3RI 5KL2A 4ZYEA 5EL9A 2ODRC 2ELYA 3B8HA 4FW7A 5JEAC 1Z59A 4JV5E 2EOSA 2NN6A 2HHHI 1AAYA 4X64I 2EPZA 5KL4A 4O5GA 2YU8A 2E72A 3OMLA 4JI6I 2GPIA 2LTRA 1FI4A 1PDAA 3QT6A 4NBQA 2CTDA 2WBUA 4LTYA 4L5NC 4B3TE 1IMUA 3J81C 1ZM4A 3PS2A 1H7UA 1MU5A 1Y60A 5JEAE 2V34A 1PVGA 4UTGA 3P3EA 1WRJA 4PU9A 4DV5I 3EPHA 4B3MI 4DV7E 2J65A 5GMDA 2G7HA 4DV3I 2FGGA 2RS6A 5EKWA 2EMYA 4F9CB 1WHNA 2NN6C 1N34I 3VYXA 2DB2A 3GLLA 2EOYA 1RR9A 5A6BD 1Z1BA 2YZTA 2DEJA 2YU5A 1N32E 2X7IA 2N3HA 2D9HA 2L92A 5CFFE 3UHMA 4IZKA 4DR4E 1ZXNA 5IT9Q 5AC5A 2F8BA 1AH5A
chains in the Genus database with same CATH topology
2UXCE 2UXDE 2GQ0A 4X8WA 5A2QQ 2YT4A 2RS7A 4GEQB 1YYWA 4BC9A 4JI7E 1BKNA 1J5EE 4LFBI 2MC5A 3HPSA 2VQFE 4DR2E 1N33I 5FWKA 2O1VA 1WHQA 3WU4A 1RREA 3P06A 4URLA 3KWRA 4B3SE 2LTSA 1FKAE 4WUBA 2VE7C 2FTXB 4OX9E 1FJGE 1MX0A 4XTJA 2KONA 2V8PA 1HNZI 2R42A 3CWVA 1HNXE 3QT7A 3VK6A 1YYKA 1Z5CA 2L2NA 4GKJI 4LFAE 1XNQI 2MDRA 3Q1QA 3AV0A 1PIEA 2L3JA 4OOGC 4LF4I 4LF7I 3J7AM 2DEIA 1KTVA 4WYQB 2XEXA 4JI3I 3FIGA 3RMPA 3AUZA 2A2DA 4LF8I 3PYDA 2PNLA 3M6AA 4DV2I 4DV1E 4M1KA 2LUQA 2ZITA 5BR8E 1RQ0A 1PKPA 5LMUI 4JG4A 1Z0CA 3F6GA 4DV6I 3T1YI 4BS9A 4J8ZA 4X62I 1ZM2A 3ADJA 4M2ZA 3HQ1A 4JYAI 4Z7YA 4K0KI 2LJPA 4IZKB 2OI2A 1IBMI 4R1FA 5GMEA 5ADZA 4DUZI 2ZM6E 4JI1I 3ZKBA 1IBLI 4WFTA 3C4BA 2UUCE 3ADLA 1NHHA 4DPTA 1H7SA 4DPUA 4JI2I 1IBKE 2Q2EB 3F0NA 4P7AA 4NXNI 2E5LE 2M7QA 4BCAA 5T6JA 3V5RA 1T4NA 1USVA 2UUAI 2B7VA 4JI4E 1EA6A 3ZZ0A 1USUA 2EWLA 4YHHE 4KHPI 4P7DA 2VF3A 2BV3A 4LF5I 2F4VI 4X66I 4DR3I 1Z0BA 3HPZA 2O1UA 4M30A 1N36I 5LMNE 5AE3A 3HXLA 2JVAA 4NXMI 3J7Yp 4DMIA 2IOPA 4BC7A 1XMOE 2DIXA 4DV4E 2HKJA 1HR0E 4UT4A 2LMZA 1Z0GA 1XNRE 3Q6NA 4JI0E 4WSPA 4DR5E 2NUGA 2ZBKB 4B3TI 2UUBI 4B3RE 2AJ4A 4DR1I 3T1HI 4USMA 4DV7I 3P1XA 2CGEA 2HHHE 5IWAI 1DQ3A 4X64E 1KIJA 1NHIA 1HK7A 4JI6E 3V2UC 3F6HA 2JY9A 1XHKA 4DV0I 4DV5E 1KKHA 2LUPB 4B3ME 4DV3E 4MYUA 4L8NA 3DF6A 4DUYI 1J5EI 4HACB 4JI5I 2Z5CB 1J26A 5FLXC 3B78A 3J7AG 2NA2A 3WU5A 4DR6E 3IWCA 4LFBE 3B82A 1Z0TA 3D4JA 1N33E 1X49A 2V2ZA 4DKKA 1XMQE 1WXRA 2N3GA 1QU6A 2PNMA 2DMYA 4FN5A 3JU0A 2HFSA 1UHZA 5AASA 3OTOI 1HNZE 4JI8I 2IOQA 3C4TA 2GS8A 2LJHA 3HULA 1HNWE 4P52A 2L2KB 3IWBA 5IT9C 4GKJE 3WU3A 4DPWA 4DR7I 2L2MA 3ZZUA 1DARA 1ZXMA 1GQEA 1EKZA 5A2QC 1MG7A 4LF4E 2K4VA 4WPYA 4LF7E 4BMJA 4Z7CA 2M4IA 4JI3E 2LRSA 1I94I 3K1JA 3K6QA 2L33A 1S4EA 2NUFA 4DV2E 4GKKI 2EZ6A 2JOXA 1O0WA 2V86A 5LMUE 2UUCI 4LFCI 3T1YE 4X62E 2EFGA 1Z0VA 2MC6A 4F9AB 4K0KE 2VQEI 4IZJD 3H4LA 3IWDA 2H36X 4HACA 2B7TA 1SR9A 3ZKDA 2Z5CA 3ADGA 1IBLE 4AQYI 1ZBQA 4HXZA 3J81Q 2RTXA 4LF9I 2UU9I 4JI4I 4DU7A 4LF6I 4JI2E 4HY1A 4I8OA 1YZ9A 4X65E 2HK2A 4NXNE 2ODRD 2V2VA 4YY3E 1H72C 2V89A 3J80C 2RSMA 4I3HA 2UXBI 2UUAE 4RPFA 4TUGA 2CZ9A 4DPYA 1Z5AA 2BM0A 3PYEA 4JV5I 4FWHA 4KHPE 1Y4UA 3Q6MA 3WU6A 3JAMC 3PYGA 1Z0EA 4LF5E 2KHXA 2F4VE 4X66E 4DR3E 1N36E 2WW4A 1VISA 4FWGA 1Z5BA 4MYTA 1U2RA 3ZZTA 1UILA 4BBYA 4F54A 3LNUA 4DPXA 1RC7A 2M1SA 1Y6ZA 4R8OA 1N32I 2O1TA 5AE1A 3ZM7A 4DR4I 4WUCA 2UXCI 2UXDI 2UUBE 1B63A 1N0UA 4DR1E 3T1HE 4JI7I 1NZ0A 1N34E 1K47A 5IWAE 2VQFI 4DR2I 2V87A 4KZSA 2LBSB 2B3TB 3MSWA 2FV4B 2IHR1 4B3SI 3QT8A 2Z5BA 2O1WA 1H73A 4IZJB 4OX9I 4DR6I 2LE2A 1FJGI 4DV0E 4USKA 3PRYA 1H74A 3HTXA 2NUEA 4ZVIA 4DUYE 3QT5A 1HNXI 2L8TA 4HYMA 1ZM9A 4LFAI 5AE2A 4JI5E 4TUIA 1XMQI 2E1RA 1STUA 1YYOA 2JOBA 4WUDA 1EI1A 2NPFA 2V2QA 2HFUA 3LPSA 2KOUA 4Q28A 3VYYA 2BM1A 1NHJA 1Y4SA 1XNQE 2HK3A 4DV1I 1HNWI 1T4LB 5F3WA 4PRXA 5BR8I 4KQVA 1N0VC 1X47A 3ZOQB 4DU8A 2CPNA 4DXLA 1QZRA 2V85A 1S16A 2X36A 3LMLA 3OTOE 4LU9A 4JI8E 4LF8E 3H09A 3HJCA 1FWKA 4DR7E 1X48A 3K85A 4FW9A 2ZM6I 2A2CA 2V88A 2E1MA 2L3CA 1ELOA 4DV6E 3GONA 1ZM3A 1FWLA 4N3OA 3J80Q 2VF1A 4ED4A 1FNMA 2V83A 4R03A 2L6MA 4JYAE 1IBKI 1I94E 2JWOA 1B62A 1IBME 3ADIA 1ZBTA 2Z5BB 2E5LI 4DUZE 4GKKE 4JI1E 1D6TA 1KVKA 3JAMQ 4FWDA 1Z0WA 2J7KA 3JTZA 1T4OA 2JR1A 4P78A 4IZJA 4LFCE 4YHHI 1OJ4A 4M0VA 3LTOA 2DSYA 2VQEE 1A6FA 4X65I 2CG9A 5LL6R 1DI2A 4PRVA 1UEKA 5LMNI 4YY3I 3DJWA 4AQYE 4LF9E 2UU9E 1GZ6A 4EMDA 4LF6E 2WZOA 1XMOI 4DV4I 2R3VA 1HR0I 3K17A 3LLHA 1XNRI 5DNYA 4JI0I 4F9BB 2HKEA 2Z5EA 4DR5I 5FLXQ 2B9DA 1WUUA 5L3JA 2V8QB 4NXME 4B3RI 3PYFA 2UXBE 2ODRC 3B8HA 1Z59A 4JV5E 2HHHI 4X64I 3OMLA 4JI6I 2LTRA 1FI4A 3QT6A 4LTYA 4L5NC 4B3TE 1ZM4A 3J81C 1H7UA 1MU5A 2V34A 1PVGA 4UTGA 4PU9A 4DV5I 4B3MI 4DV7E 5GMDA 2G7HA 4DV3I 2FGGA 2RS6A 4F9CB 1WHNA 1N34I 3VYXA 2DB2A 1RR9A 2YZTA 2DEJA 1N32E 2X7IA 2N3HA 2L92A 5CFFE 4IZKA 4DR4E 1ZXNA 5IT9Q 2F8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC E;  2UXD E;  4X8W A;  5A2Q Q;  2YT4 A;  2RS7 A;  1YYW A;  4JI7 E;  1BKN A;  1J5E E;  4LFB I;  2VQF E;  4DR2 E;  1N33 I;  1WHQ A;  3WU4 A;  1RRE A;  4URL A;  4B3S E;  2LTS A;  1FKA E;  4WUB A;  4OX9 E;  1FJG E;  1MX0 A;  4XTJ A;  2V8P A;  1HNZ I;  2R42 A;  3CWV A;  1HNX E;  3QT7 A;  1YYK A;  1Z5C A;  2L2N A;  4GKJ I;  4LFA E;  1XNQ I;  2MDR A;  3Q1Q A;  1PIE A;  2L3J A;  4OOG C;  4LF4 I;  4LF7 I;  3J7A M;  2DEI A;  1KTV A;  4WYQ B;  2XEX A;  4JI3 I;  2A2D A;  4LF8 I;  3PYD A;  3M6A A;  4DV2 I;  4DV1 E;  4M1K A;  2LUQ A;  2ZIT A;  5BR8 E;  1RQ0 A;  1PKP A;  5LMU I;  4JG4 A;  1Z0C A;  4DV6 I;  3T1Y I;  4X62 I;  1ZM2 A;  3ADJ A;  4M2Z A;  4JYA I;  4Z7Y A;  4K0K I;  2LJP A;  2OI2 A;  1IBM I;  4R1F A;  5GME A;  4DUZ I;  2ZM6 E;  4JI1 I;  3ZKB A;  1IBL I;  4WFT A;  3C4B A;  2UUC E;  3ADL A;  1NHH A;  4DPT A;  1H7S A;  4DPU A;  4JI2 I;  1IBK E;  2Q2E B;  3F0N A;  4P7A A;  4NXN I;  2E5L E;  3V5R A;  1T4N A;  2UUA I;  2B7V A;  4JI4 E;  1EA6 A;  3ZZ0 A;  4YHH E;  4KHP I;  2VF3 A;  2BV3 A;  4LF5 I;  2F4V I;  4X66 I;  4DR3 I;  1Z0B A;  4M30 A;  1N36 I;  5LMN E;  2JVA A;  4NXM I;  3J7Y p;  1XMO E;  2DIX A;  4DV4 E;  2HKJ A;  1HR0 E;  4UT4 A;  1Z0G A;  1XNR E;  4JI0 E;  4DR5 E;  2NUG A;  2ZBK B;  4B3T I;  2UUB I;  4B3R E;  2AJ4 A;  4DR1 I;  3T1H I;  4USM A;  4DV7 I;  3P1X A;  2HHH E;  5IWA I;  4X64 E;  1KIJ A;  1NHI A;  4JI6 E;  3V2U C;  2JY9 A;  1XHK A;  4DV0 I;  4DV5 E;  1KKH A;  2LUP B;  4B3M E;  4DV3 E;  4MYU A;  1J5E I;  4DUY I;  4HAC B;  4JI5 I;  1J26 A;  3B78 A;  5FLX C;  3J7A G;  2NA2 A;  3WU5 A;  4DR6 E;  4LFB E;  3B82 A;  1Z0T A;  3D4J A;  1N33 E;  1X49 A;  2V2Z A;  4DKK A;  1XMQ E;  2N3G A;  1QU6 A;  2DMY A;  4FN5 A;  2HFS A;  1UHZ A;  3OTO I;  1HNZ E;  4JI8 I;  3C4T A;  2GS8 A;  2LJH A;  3HUL A;  1HNW E;  4P52 A;  2L2K B;  4GKJ E;  3WU3 A;  5IT9 C;  4DPW A;  4DR7 I;  2L2M A;  3ZZU A;  1DAR A;  1ZXM A;  1GQE A;  1EKZ A;  5A2Q C;  1MG7 A;  4LF4 E;  4LF7 E;  4Z7C A;  4JI3 E;  2LRS A;  1I94 I;  3K1J A;  2L33 A;  1S4E A;  2NUF A;  4DV2 E;  4GKK I;  2EZ6 A;  1O0W A;  5LMU E;  2UUC I;  4LFC I;  3T1Y E;  4X62 E;  2EFG A;  1Z0V A;  4K0K E;  2VQE I;  3H4L A;  4HAC A;  2B7T A;  3ZKD A;  3ADG A;  1IBL E;  4AQY I;  4HXZ A;  3J81 Q;  2RTX A;  4LF9 I;  2UU9 I;  4JI4 I;  4DU7 A;  4LF6 I;  4JI2 E;  4HY1 A;  1YZ9 A;  4X65 E;  2HK2 A;  4NXN E;  2V2V A;  4YY3 E;  1H72 C;  3J80 C;  2RSM A;  4I3H A;  2UXB I;  2UUA E;  4RPF A;  2CZ9 A;  4DPY A;  1Z5A A;  2BM0 A;  3PYE A;  4JV5 I;  4FWH A;  4KHP E;  3WU6 A;  3JAM C;  3PYG A;  1Z0E A;  4LF5 E;  2KHX A;  2F4V E;  4X66 E;  4DR3 E;  1N36 E;  2WW4 A;  1VIS A;  4FWG A;  1Z5B A;  4MYT A;  1U2R A;  3ZZT A;  1UIL A;  3LNU A;  4DPX A;  1RC7 A;  1N32 I;  3ZM7 A;  4DR4 I;  4WUC A;  2UXC I;  2UXD I;  2UUB E;  1B63 A;  1N0U A;  4DR1 E;  3T1H E;  4JI7 I;  1NZ0 A;  1N34 E;  1K47 A;  5IWA E;  2VQF I;  4DR2 I;  2LBS B;  2B3T B;  2IHR 1;  4B3S I;  3QT8 A;  1H73 A;  4OX9 I;  4DR6 I;  1FJG I;  4DV0 E;  4USK A;  1H74 A;  3HTX A;  2NUE A;  4ZVI A;  4DUY E;  3QT5 A;  1HNX I;  4HYM A;  1ZM9 A;  4LFA I;  4JI5 E;  1XMQ I;  2E1R A;  1STU A;  1YYO A;  4WUD A;  1EI1 A;  2NPF A;  2V2Q A;  3LPS A;  2HFU A;  3VYY A;  2BM1 A;  1NHJ A;  2HK3 A;  1XNQ E;  4DV1 I;  1HNW I;  1T4L B;  4PRX A;  5BR8 I;  4KQV A;  1N0V C;  1X47 A;  4DU8 A;  2CPN A;  4DXL A;  1QZR A;  2X36 A;  1S16 A;  3OTO E;  4JI8 E;  4LF8 E;  1FWK A;  4DR7 E;  1X48 A;  4FW9 A;  2ZM6 I;  2A2C A;  2L3C A;  1ELO A;  4DV6 E;  3GON A;  1ZM3 A;  1FWL A;  3J80 Q;  4ED4 A;  1FNM A;  4JYA E;  1IBK I;  1I94 E;  1B62 A;  1IBM E;  3ADI A;  1ZBT A;  2E5L I;  4DUZ E;  4GKK E;  4JI1 E;  1D6T A;  1KVK A;  3JAM Q;  4FWD A;  1Z0W A;  2J7K A;  1T4O A;  4LFC E;  4YHH I;  1OJ4 A;  3LTO A;  2VQE E;  1A6F A;  4X65 I;  5LL6 R;  1DI2 A;  4PRV A;  1UEK A;  5LMN I;  4YY3 I;  4AQY E;  4LF9 E;  2UU9 E;  4EMD A;  4LF6 E;  1XMO I;  4DV4 I;  2R3V A;  1HR0 I;  3K17 A;  3LLH A;  1XNR I;  4JI0 I;  2HKE A;  4DR5 I;  5FLX Q;  1WUU A;  5L3J A;  4NXM E;  4B3R I;  3PYF A;  2UXB E;  3B8H A;  1Z59 A;  4JV5 E;  2HHH I;  4X64 I;  4JI6 I;  2LTR A;  1FI4 A;  3QT6 A;  4B3T E;  1ZM4 A;  3J81 C;  1H7U A;  1MU5 A;  2V34 A;  1PVG A;  4UTG A;  4PU9 A;  4DV5 I;  4B3M I;  4DV7 E;  5GMD A;  4DV3 I;  2RS6 A;  1WHN A;  1N34 I;  3VYX A;  2DB2 A;  1RR9 A;  2DEJ A;  1N32 E;  2X7I A;  2N3H A;  5CFF E;  5IT9 Q;  4DR4 E;  1ZXN A; 
#chains in the Genus database with same CATH topology
 2UXC E;  2UXD E;  2EN6 A;  4X8W A;  2EM3 A;  2GQ0 A;  5A2Q Q;  2YT4 A;  3THN A;  2RS7 A;  4GEQ B;  1YYW A;  2F1D A;  4BC9 A;  4JI7 E;  1BKN A;  1J5E E;  4LFB I;  2MC5 A;  3HPS A;  5K36 D;  1R6M A;  4ISA A;  2VQF E;  4DR2 E;  4ZYD A;  1N33 I;  5FWK A;  2O1V A;  2JEA B;  1WHQ A;  3WU4 A;  3P3C A;  1RRE A;  4O43 A;  1RMD A;  2YTO A;  3P06 A;  4URL A;  3KWR A;  4B3S E;  2LTS A;  1FKA E;  2C39 B;  4WUB A;  5DRP A;  2VE7 C;  2FTX B;  4OX9 E;  1FJG E;  4LCG A;  4OKG A;  2PNZ B;  1X6F A;  5JEA B;  1MX0 A;  4XTJ A;  4OO1 F;  1UN6 B;  4FW4 A;  3U1Y A;  2KON A;  2V8P A;  1HNZ I;  1YH8 A;  1EH6 A;  5DRR A;  4BA1 A;  2R42 A;  3PS3 A;  2C38 A;  3CWV A;  2EML A;  2BA1 G;  1HNX E;  3QT7 A;  1BBG A;  3VK6 A;  1YYK A;  1Z5C A;  2L2N A;  2PRT A;  3CDI A;  4WX9 A;  4LFA E;  4IS9 A;  4MU3 A;  5C0X E;  4GKJ I;  1XNQ I;  2MDR A;  3Q1Q A;  3AV0 A;  3BF2 A;  1PIE A;  4QNK A;  2L3J A;  4OOG C;  4MLV A;  4LF4 I;  4LF7 I;  3J7A M;  4WXD A;  5K36 C;  2NN6 B;  2O3Z A;  2DEI A;  1KTV A;  2C37 A;  4WYQ B;  4OO1 D;  5A6J A;  3THO B;  2XEX A;  4JI3 I;  1PJQ A;  4R2P A;  1YUJ A;  3FIG A;  3RMP A;  3AUZ A;  2A2D A;  1A1L A;  4LF8 I;  3PYD A;  4GZN C;  2PNL A;  1EH7 A;  3M6A A;  4DV2 I;  4DV1 E;  4M1K A;  2LUQ A;  4WSG A;  5BR8 E;  2ZIT A;  2Q8U A;  1RQ0 A;  4R2E A;  1PKP A;  5LMU I;  1F2I G;  4JG4 A;  4IFD F;  2DGC A;  1Z0C A;  1JK1 A;  3F6G A;  2DMI A;  4DV6 I;  1EH8 A;  3T1Y I;  4BS9 A;  4J8Z A;  3GCM A;  2EOR A;  4X62 I;  1ZM2 A;  3ADJ A;  4M2Z A;  3HQ1 A;  4JYA I;  4Z7Y A;  4K0K I;  2LJP A;  3MHH C;  3CDJ A;  4FW5 A;  2OI2 A;  4FW6 A;  4IZK B;  4R1F A;  1IBM I;  1TF6 A;  5GME A;  5ADZ A;  4DUZ I;  2ZM6 E;  4JI1 I;  3ZKB A;  1IQO A;  1IBL I;  2HC5 A;  4F6N A;  1NEI A;  4WFT A;  3C4B A;  2UUC E;  3ADL A;  1NHH A;  2BBG A;  2EP3 A;  4DPT A;  1H7S A;  2JT2 A;  4DPU A;  1IQS A;  2LJU A;  4JI2 I;  2NAB A;  1IBK E;  4IJD A;  2YTP A;  2Q2E B;  3F0N A;  3NZK A;  4P7A A;  2EN7 A;  3M85 G;  4NXN I;  4OO1 E;  2E5L E;  1BBO A;  2YTG A;  5K36 B;  2M7Q A;  4BCA A;  1KJK A;  4MU4 A;  3PS1 A;  5T6J A;  4F2J C;  3V5R A;  1T4N A;  1USV A;  1A1J A;  2VES A;  2ENH A;  2UUA I;  4BA1 B;  2B7V A;  4JI4 E;  2C38 B;  5JEA A;  1UDO A;  1EA6 A;  4BHC A;  2PNZ A;  1P47 A;  3ZZ0 A;  4BA2 A;  1USU A;  2EMH A;  2EWL A;  4J3D A;  4YHH E;  4KHP I;  4P7D A;  4O24 A;  2VF3 A;  2EOQ A;  2EE8 A;  2BV3 A;  4LF5 I;  2F4V I;  4R2A A;  4X66 I;  4DR3 I;  1Z0B A;  3HPZ A;  2O1U A;  4M30 A;  1N36 I;  3B4T A;  5LMN E;  5AE3 A;  3HXL A;  1OYP A;  2EM8 A;  2JVA A;  3TQM A;  1R6L A;  2EMA A;  4NXM I;  4N4R B;  3J7Y p;  5A6K A;  4DMI A;  4RHB B;  1G2D C;  2EPX A;  2IOP A;  2BA0 D;  4LCF A;  4BC7 A;  1XMO E;  2DIX A;  4DV4 E;  2HKJ A;  4WXC A;  1HR0 E;  4AID A;  4UT4 A;  2LMZ A;  1Z0G A;  1XNR E;  5IXM B;  3Q6N A;  4JI0 E;  5ELW A;  1B69 A;  4WSP A;  4DR5 E;  2NUG A;  2LVH A;  2VRD A;  2ZBK B;  4B3T I;  3M7N G;  2UUB I;  4B3R E;  3P3G A;  1ZU1 A;  2AJ4 A;  5C0X D;  2YWQ A;  4DR1 I;  4USM A;  4DV7 I;  3T1H I;  3QG5 C;  3P1X A;  2CGE A;  2CT1 A;  2HHH E;  3P76 A;  5IWA I;  2EPN A;  1DQ3 A;  4X64 E;  2EPP A;  1X6H A;  1KIJ A;  1HK7 A;  1NHI A;  4JI6 E;  2HGH A;  3V2U C;  5TSE A;  4MLQ A;  2YTI A;  3F6H A;  2JY9 A;  1P42 A;  1XHK A;  4DV0 I;  4DV5 E;  1KKH A;  2LUP B;  4B3M E;  5A6B A;  4DV3 E;  4MYU A;  2ADR A;  4L8N A;  2EN2 A;  3DF6 A;  4DUY I;  1J5E I;  2R1F A;  2DRP A;  3BBG A;  4HAC B;  4JI5 I;  4R2D A;  2Z5C B;  3EQ1 A;  5FLX C;  1J26 A;  4O4K A;  3B78 A;  2RPC A;  2GHF A;  3J7A G;  2JEB B;  2NA2 A;  5C0X C;  3KRN A;  3WU5 A;  2EOO A;  4DR6 E;  3MHS C;  5K36 A;  4BA2 B;  4U3D A;  2YTF A;  2YRH A;  3IWC A;  1PJS A;  2EQ0 A;  2EQ1 A;  1N3G A;  4LFB E;  2MDG A;  2EPR A;  3B82 A;  1UDN A;  1Z0T A;  3D4J A;  1N33 E;  1SFE A;  1X49 A;  2EL4 A;  4R2C A;  4U3B A;  2ENC A;  2V2Z A;  4DKK A;  2YTQ A;  1XMQ E;  1WXR A;  2K7I A;  2N3G A;  1QU6 A;  2PNM A;  5DNL A;  5DNX A;  2PO0 B;  2LO3 A;  4QNJ A;  2DMY A;  4FN5 A;  3JU0 A;  3BGH A;  2HFS A;  1UHZ A;  5AAS A;  3OTO I;  2RQL A;  1HNZ E;  4MQY A;  1ZR9 A;  4ZYG A;  1UBD C;  2IOQ A;  4JI8 I;  3C4T A;  1YHC A;  2GS8 A;  2BR2 A;  2LJH A;  3HUL A;  1HNW E;  4P52 A;  4ZYH A;  2L2K B;  2EM7 A;  3IWB A;  5IT9 C;  2DLK A;  4GKJ E;  3WU3 A;  4DPW A;  4DR7 I;  4IS1 C;  2L2M A;  3ZZU A;  1DAR A;  1ZXM A;  1GQE A;  4OO1 A;  2EMW A;  1EKZ A;  5A2Q C;  1MG7 A;  3C6M A;  2JPA A;  4LF4 E;  2K4V A;  4WPY A;  4LF7 E;  4BMJ A;  3L7Z B;  4Z7C A;  2M4I A;  4JI3 E;  2LRS A;  4BHB A;  1I94 I;  5IV8 B;  3K1J A;  3K6Q A;  2L33 A;  1LLM C;  1S4E A;  5C0X B;  4RH8 A;  2EPM X;  4F6M A;  2NUF A;  2EN3 A;  4DV2 E;  2EZ6 A;  4GKK I;  2EMF A;  5KL5 A;  1A1H A;  1A1K A;  4OO1 C;  2A25 A;  2JOX A;  1O0W A;  2V86 A;  1G2F C;  5LMU E;  2IER A;  4IFD D;  2EM2 A;  2CSH A;  2UUC I;  3BID A;  4LFC I;  1BB8 A;  3T1Y E;  2EM5 A;  4X62 E;  2EPC A;  2EFG A;  1Z0V A;  3L00 A;  1OYS A;  5DRQ A;  2MC6 A;  2JXP A;  5JEA F;  4F9A B;  4K0K E;  2EMZ A;  4IZJ D;  2VQE I;  2EM4 A;  3H4L A;  3IWD A;  2H36 X;  2EMI A;  4HAC A;  2B7T A;  1SR9 A;  3ZKD A;  2Z5C A;  3ADG A;  1IBL E;  4AQY I;  1ZBQ A;  4HXZ A;  4NZV A;  2JEB A;  2GO4 A;  3J81 Q;  2RTX A;  2PO2 A;  4LF9 I;  4X9J A;  2UU9 I;  4JI4 I;  4DU7 A;  1PJT A;  4AM3 A;  4LF6 I;  4JI2 E;  4HY1 A;  4I8O A;  2EOZ A;  1YZ9 A;  4X65 E;  3KZY A;  2CVE A;  2NN6 F;  2HK2 A;  4NXN E;  2ODR D;  4IFD C;  2V2V A;  2BA1 D;  4YY3 E;  1H72 C;  3UK3 C;  2R76 A;  2V89 A;  1T39 A;  3J80 C;  2EMC A;  2RSM A;  4I3H A;  2UXB I;  2UUA E;  4RPF A;  2YTD A;  4TUG A;  2CZ9 A;  2EOM A;  4DPY A;  2PO0 A;  2BR2 B;  2WNR B;  1Y5Y A;  4FK5 C;  1Z5A A;  1X5W A;  2I9I A;  2BM0 A;  3PYE A;  4JV5 I;  4FWH A;  4KHP E;  1Y4U A;  3Q6M A;  3WU6 A;  3JAM C;  3PYG A;  4IFD E;  1Z0E A;  2N8X A;  2EMX A;  4OO1 B;  2YSO A;  4LF5 E;  2KHX A;  2F4V E;  4X66 E;  4DR3 E;  2EPK X;  2EM0 A;  1N36 E;  2NN6 D;  2WW4 A;  1VIS A;  2EMK A;  4FWG A;  2ENA A;  1Z5B A;  1KYQ A;  2J7J A;  2EL6 A;  2EOE A;  2RSI A;  4MYT A;  1U2R A;  3ZZT A;  1UIL A;  4BBY A;  4F54 A;  3L7Z A;  3LNU A;  4DPX A;  4HEI A;  1RC7 A;  1DGC A;  2M1S A;  1Y6Z A;  4R8O A;  2GO3 A;  4M9V C;  2LV2 A;  1N32 I;  2O1T A;  5C0X A;  5AE1 A;  3ECR A;  3ZM7 A;  2EMG A;  4DR4 I;  4WUC A;  2UXC I;  2UXD I;  2UUB E;  2YTN A;  3DD6 A;  1B63 A;  1N0U A;  2WBS A;  4DR1 E;  1WJP A;  3T1H E;  2JE6 B;  4LOM A;  4JI7 I;  5L3J A;  1NZ0 A;  5K36 F;  1N34 E;  1YPN A;  4GQU A;  1K47 A;  4NHR A;  3GME A;  4LPF A;  5IWA E;  4IFD B;  3EPJ A;  1X3C A;  2VQF I;  4DR2 I;  2V87 A;  4MDT A;  2EJ4 A;  2YSP A;  4KZS A;  2LBS B;  2B3T B;  3MSW A;  2FV4 B;  2IHR 1;  3M85 D;  2PO2 B;  4B3S I;  3QT8 A;  2YPN A;  2O1W A;  2Z5B A;  1H73 A;  4IZJ B;  2EOJ A;  4OX9 I;  2LE2 A;  4DR6 I;  1FJG I;  4DV0 E;  4USK A;  2EL5 A;  2NN6 E;  3PRY A;  2EN1 A;  1TN9 A;  3U1K A;  1H74 A;  3HTX A;  3C6K A;  2NUE A;  1UDS A;  2EPL X;  4ZVI A;  4DUY E;  1JK2 A;  4LCH A;  3QT5 A;  2YTJ A;  1HNX I;  2PO1 B;  1NCS A;  2L8T A;  2LCE A;  4HYM A;  1MEY C;  1ZM9 A;  5AE2 A;  3EPL A;  4JI5 E;  4LFA I;  2WBT A;  4TUI A;  2EPU A;  1XMQ I;  2E1R A;  4Q35 B;  3KZZ A;  5DRO A;  1STU A;  3VHT B;  1YYO A;  2WP8 B;  2GLI A;  2JOB A;  4WUD A;  2BB8 A;  1EI1 A;  2NPF A;  2V2Q A;  1YUI A;  5AC4 A;  2WNR A;  1VI7 A;  2HFU A;  1T38 A;  3LPS A;  2KOU A;  4Q28 A;  3VYY A;  2BM1 A;  1NHJ A;  1Y4S A;  1XNQ E;  2HK3 A;  4MU0 A;  4DV1 I;  1T4L B;  1HNW I;  2MKN A;  5F3W A;  4PRX A;  5BR8 I;  4KQV A;  1N0V C;  2YRK A;  1X47 A;  3ZOQ B;  2YTE A;  2CPN A;  4MU1 A;  4DU8 A;  4DXL A;  2DLQ A;  2WCC 3;  1QZR A;  2V85 A;  1S16 A;  2X36 A;  2BA0 G;  3LML A;  3M7N D;  3OTO E;  2EOH A;  4LU9 A;  4JI8 E;  5A69 A;  4LF8 E;  4R2R A;  3M99 B;  3EPK A;  3H09 A;  3HJC A;  1FWK A;  2I13 A;  4DR7 E;  1X48 A;  3K85 A;  4FW9 A;  2ZM6 I;  5K36 E;  2A2C A;  2HJJ A;  2EPA A;  2V88 A;  2E1M A;  2LT7 A;  1X6E A;  2L3C A;  4DV6 E;  1ELO A;  3GON A;  1ZM3 A;  4HTG A;  5KL7 A;  1FWL A;  4N3O A;  3J80 Q;  2VF1 A;  2EOI A;  1QNT A;  4ED4 A;  1FNM A;  2V83 A;  4R03 A;  2L6M A;  4JYA E;  1IBK I;  1I94 E;  2JE6 A;  2ELZ A;  2JWO A;  1MGT A;  4R2Q A;  1B62 A;  1IBM E;  1A1I A;  1A1F A;  3ADI A;  1ZBT A;  2Z5B B;  2E5L I;  4IFD A;  4DUZ E;  5KL6 A;  4GKK E;  4JI1 E;  1D6T A;  1KVK A;  3JAM Q;  5LLQ A;  4FWD A;  1Z0W A;  2J7K A;  3JTZ A;  5A6A A;  1T4O A;  2JR1 A;  4P78 A;  4IZJ A;  4LFC E;  2EMB A;  1ZAA C;  4YHH I;  1OJ4 A;  4M0V A;  3LTO A;  1E3H A;  2DSY A;  2M9A A;  4AIM A;  2VQE E;  1A6F A;  5JEA D;  1YSA C;  1L4S A;  4X65 I;  4KWY A;  2CG9 A;  5LL6 R;  1YFH A;  2AE8 A;  2PO1 A;  4R2S A;  1DI2 A;  1UDQ A;  3HKM A;  4PRV A;  2EN8 A;  5KL3 A;  2JP9 A;  1UEK A;  4FW3 A;  3DJW A;  4YY3 I;  5LMN I;  4AQY E;  2JEA A;  2EOX A;  2EQ3 A;  2EM6 A;  1XXE A;  4LF9 E;  1E3P A;  2C39 A;  2UU9 E;  1GZ6 A;  2EOF A;  4EMD A;  4LF6 E;  2WP8 A;  2WZO A;  1XMO I;  4DV4 I;  2R3V A;  1HR0 I;  2EPO A;  2EN4 A;  3LLH A;  3K17 A;  1XNR I;  1TF3 A;  5DNY A;  1RHY A;  4OZE A;  4JI0 I;  2EM9 A;  1A1G A;  4F9B B;  2HKE A;  2Z5E A;  4DR5 I;  2YRM A;  1OYR A;  5FLX Q;  2B9D A;  1GTK A;  2JYA A;  2V8Q B;  1WUU A;  4NXM E;  2IES A;  3H1C A;  2MKD A;  2C37 B;  2UXB E;  3PYF A;  5C0X F;  4B3R I;  5KL2 A;  4ZYE A;  5EL9 A;  2ODR C;  2ELY A;  3B8H A;  4FW7 A;  5JEA C;  1Z59 A;  4JV5 E;  2EOS A;  2NN6 A;  2HHH I;  1AAY A;  4X64 I;  2EPZ A;  5KL4 A;  4O5G A;  2YU8 A;  2E72 A;  3OML A;  4JI6 I;  2GPI A;  2LTR A;  1FI4 A;  1PDA A;  3QT6 A;  4NBQ A;  2CTD A;  2WBU A;  4LTY A;  4L5N C;  4B3T E;  1IMU A;  3J81 C;  1ZM4 A;  3PS2 A;  1H7U A;  1MU5 A;  1Y60 A;  5JEA E;  2V34 A;  1PVG A;  4UTG A;  3P3E A;  1WRJ A;  4PU9 A;  4DV5 I;  3EPH A;  4B3M I;  4DV7 E;  2J65 A;  5GMD A;  2G7H A;  4DV3 I;  2FGG A;  2RS6 A;  5EKW A;  2EMY A;  4F9C B;  1WHN A;  2NN6 C;  1N34 I;  3VYX A;  2DB2 A;  3GLL A;  2EOY A;  1RR9 A;  5A6B D;  1Z1B A;  2YZT A;  2DEJ A;  2YU5 A;  1N32 E;  2X7I A;  2N3H A;  2D9H A;  2L92 A;  5CFF E;  3UHM A;  4IZK A;  4DR4 E;  1ZXN A;  5IT9 Q;  5AC5 A;  2F8B A;  1AH5 A; 
#chains in the Genus database with same CATH homology
 2UXC E;  2UXD E;  2GQ0 A;  4X8W A;  5A2Q Q;  2YT4 A;  2RS7 A;  4GEQ B;  1YYW A;  4BC9 A;  4JI7 E;  1BKN A;  1J5E E;  4LFB I;  2MC5 A;  3HPS A;  2VQF E;  4DR2 E;  1N33 I;  5FWK A;  2O1V A;  1WHQ A;  3WU4 A;  1RRE A;  3P06 A;  4URL A;  3KWR A;  4B3S E;  2LTS A;  1FKA E;  4WUB A;  2VE7 C;  2FTX B;  4OX9 E;  1FJG E;  1MX0 A;  4XTJ A;  2KON A;  2V8P A;  1HNZ I;  2R42 A;  3CWV A;  1HNX E;  3QT7 A;  3VK6 A;  1YYK A;  1Z5C A;  2L2N A;  4GKJ I;  4LFA E;  1XNQ I;  2MDR A;  3Q1Q A;  3AV0 A;  1PIE A;  2L3J A;  4OOG C;  4LF4 I;  4LF7 I;  3J7A M;  2DEI A;  1KTV A;  4WYQ B;  2XEX A;  4JI3 I;  3FIG A;  3RMP A;  3AUZ A;  2A2D A;  4LF8 I;  3PYD A;  2PNL A;  3M6A A;  4DV2 I;  4DV1 E;  4M1K A;  2LUQ A;  2ZIT A;  5BR8 E;  1RQ0 A;  1PKP A;  5LMU I;  4JG4 A;  1Z0C A;  3F6G A;  4DV6 I;  3T1Y I;  4BS9 A;  4J8Z A;  4X62 I;  1ZM2 A;  3ADJ A;  4M2Z A;  3HQ1 A;  4JYA I;  4Z7Y A;  4K0K I;  2LJP A;  4IZK B;  2OI2 A;  1IBM I;  4R1F A;  5GME A;  5ADZ A;  4DUZ I;  2ZM6 E;  4JI1 I;  3ZKB A;  1IBL I;  4WFT A;  3C4B A;  2UUC E;  3ADL A;  1NHH A;  4DPT A;  1H7S A;  4DPU A;  4JI2 I;  1IBK E;  2Q2E B;  3F0N A;  4P7A A;  4NXN I;  2E5L E;  2M7Q A;  4BCA A;  5T6J A;  3V5R A;  1T4N A;  1USV A;  2UUA I;  2B7V A;  4JI4 E;  1EA6 A;  3ZZ0 A;  1USU A;  2EWL A;  4YHH E;  4KHP I;  4P7D A;  2VF3 A;  2BV3 A;  4LF5 I;  2F4V I;  4X66 I;  4DR3 I;  1Z0B A;  3HPZ A;  2O1U A;  4M30 A;  1N36 I;  5LMN E;  5AE3 A;  3HXL A;  2JVA A;  4NXM I;  3J7Y p;  4DMI A;  2IOP A;  4BC7 A;  1XMO E;  2DIX A;  4DV4 E;  2HKJ A;  1HR0 E;  4UT4 A;  2LMZ A;  1Z0G A;  1XNR E;  3Q6N A;  4JI0 E;  4WSP A;  4DR5 E;  2NUG A;  2ZBK B;  4B3T I;  2UUB I;  4B3R E;  2AJ4 A;  4DR1 I;  3T1H I;  4USM A;  4DV7 I;  3P1X A;  2CGE A;  2HHH E;  5IWA I;  1DQ3 A;  4X64 E;  1KIJ A;  1NHI A;  1HK7 A;  4JI6 E;  3V2U C;  3F6H A;  2JY9 A;  1XHK A;  4DV0 I;  4DV5 E;  1KKH A;  2LUP B;  4B3M E;  4DV3 E;  4MYU A;  4L8N A;  3DF6 A;  4DUY I;  1J5E I;  4HAC B;  4JI5 I;  2Z5C B;  1J26 A;  5FLX C;  3B78 A;  3J7A G;  2NA2 A;  3WU5 A;  4DR6 E;  3IWC A;  4LFB E;  3B82 A;  1Z0T A;  3D4J A;  1N33 E;  1X49 A;  2V2Z A;  4DKK A;  1XMQ E;  1WXR A;  2N3G A;  1QU6 A;  2PNM A;  2DMY A;  4FN5 A;  3JU0 A;  2HFS A;  1UHZ A;  5AAS A;  3OTO I;  1HNZ E;  4JI8 I;  2IOQ A;  3C4T A;  2GS8 A;  2LJH A;  3HUL A;  1HNW E;  4P52 A;  2L2K B;  3IWB A;  5IT9 C;  4GKJ E;  3WU3 A;  4DPW A;  4DR7 I;  2L2M A;  3ZZU A;  1DAR A;  1ZXM A;  1GQE A;  1EKZ A;  5A2Q C;  1MG7 A;  4LF4 E;  2K4V A;  4WPY A;  4LF7 E;  4BMJ A;  4Z7C A;  2M4I A;  4JI3 E;  2LRS A;  1I94 I;  3K1J A;  3K6Q A;  2L33 A;  1S4E A;  2NUF A;  4DV2 E;  4GKK I;  2EZ6 A;  2JOX A;  1O0W A;  2V86 A;  5LMU E;  2UUC I;  4LFC I;  3T1Y E;  4X62 E;  2EFG A;  1Z0V A;  2MC6 A;  4F9A B;  4K0K E;  2VQE I;  4IZJ D;  3H4L A;  3IWD A;  2H36 X;  4HAC A;  2B7T A;  1SR9 A;  3ZKD A;  2Z5C A;  3ADG A;  1IBL E;  4AQY I;  1ZBQ A;  4HXZ A;  3J81 Q;  2RTX A;  4LF9 I;  2UU9 I;  4JI4 I;  4DU7 A;  4LF6 I;  4JI2 E;  4HY1 A;  4I8O A;  1YZ9 A;  4X65 E;  2HK2 A;  4NXN E;  2ODR D;  2V2V A;  4YY3 E;  1H72 C;  2V89 A;  3J80 C;  2RSM A;  4I3H A;  2UXB I;  2UUA E;  4RPF A;  4TUG A;  2CZ9 A;  4DPY A;  1Z5A A;  2BM0 A;  3PYE A;  4JV5 I;  4FWH A;  4KHP E;  1Y4U A;  3Q6M A;  3WU6 A;  3JAM C;  3PYG A;  1Z0E A;  4LF5 E;  2KHX A;  2F4V E;  4X66 E;  4DR3 E;  1N36 E;  2WW4 A;  1VIS A;  4FWG A;  1Z5B A;  4MYT A;  1U2R A;  3ZZT A;  1UIL A;  4BBY A;  4F54 A;  3LNU A;  4DPX A;  1RC7 A;  2M1S A;  1Y6Z A;  4R8O A;  1N32 I;  2O1T A;  5AE1 A;  3ZM7 A;  4DR4 I;  4WUC A;  2UXC I;  2UXD I;  2UUB E;  1B63 A;  1N0U A;  4DR1 E;  3T1H E;  4JI7 I;  1NZ0 A;  1N34 E;  1K47 A;  5IWA E;  2VQF I;  4DR2 I;  2V87 A;  4KZS A;  2LBS B;  2B3T B;  3MSW A;  2FV4 B;  2IHR 1;  4B3S I;  3QT8 A;  2Z5B A;  2O1W A;  1H73 A;  4IZJ B;  4OX9 I;  4DR6 I;  2LE2 A;  1FJG I;  4DV0 E;  4USK A;  3PRY A;  1H74 A;  3HTX A;  2NUE A;  4ZVI A;  4DUY E;  3QT5 A;  1HNX I;  2L8T A;  4HYM A;  1ZM9 A;  4LFA I;  5AE2 A;  4JI5 E;  4TUI A;  1XMQ I;  2E1R A;  1STU A;  1YYO A;  2JOB A;  4WUD A;  1EI1 A;  2NPF A;  2V2Q A;  2HFU A;  3LPS A;  2KOU A;  4Q28 A;  3VYY A;  2BM1 A;  1NHJ A;  1Y4S A;  1XNQ E;  2HK3 A;  4DV1 I;  1HNW I;  1T4L B;  5F3W A;  4PRX A;  5BR8 I;  4KQV A;  1N0V C;  1X47 A;  3ZOQ B;  4DU8 A;  2CPN A;  4DXL A;  1QZR A;  2V85 A;  1S16 A;  2X36 A;  3LML A;  3OTO E;  4LU9 A;  4JI8 E;  4LF8 E;  3H09 A;  3HJC A;  1FWK A;  4DR7 E;  1X48 A;  3K85 A;  4FW9 A;  2ZM6 I;  2A2C A;  2V88 A;  2E1M A;  2L3C A;  1ELO A;  4DV6 E;  3GON A;  1ZM3 A;  1FWL A;  4N3O A;  3J80 Q;  2VF1 A;  4ED4 A;  1FNM A;  2V83 A;  4R03 A;  2L6M A;  4JYA E;  1IBK I;  1I94 E;  2JWO A;  1B62 A;  1IBM E;  3ADI A;  1ZBT A;  2Z5B B;  2E5L I;  4DUZ E;  4GKK E;  4JI1 E;  1D6T A;  1KVK A;  3JAM Q;  4FWD A;  1Z0W A;  2J7K A;  3JTZ A;  1T4O A;  2JR1 A;  4P78 A;  4IZJ A;  4LFC E;  4YHH I;  1OJ4 A;  4M0V A;  3LTO A;  2DSY A;  2VQE E;  1A6F A;  4X65 I;  2CG9 A;  5LL6 R;  1DI2 A;  4PRV A;  1UEK A;  5LMN I;  4YY3 I;  3DJW A;  4AQY E;  4LF9 E;  2UU9 E;  1GZ6 A;  4EMD A;  4LF6 E;  2WZO A;  1XMO I;  4DV4 I;  2R3V A;  1HR0 I;  3K17 A;  3LLH A;  1XNR I;  5DNY A;  4JI0 I;  4F9B B;  2HKE A;  2Z5E A;  4DR5 I;  5FLX Q;  2B9D A;  1WUU A;  5L3J A;  2V8Q B;  4NXM E;  4B3R I;  3PYF A;  2UXB E;  2ODR C;  3B8H A;  1Z59 A;  4JV5 E;  2HHH I;  4X64 I;  3OML A;  4JI6 I;  2LTR A;  1FI4 A;  3QT6 A;  4LTY A;  4L5N C;  4B3T E;  1ZM4 A;  3J81 C;  1H7U A;  1MU5 A;  2V34 A;  1PVG A;  4UTG A;  4PU9 A;  4DV5 I;  4B3M I;  4DV7 E;  5GMD A;  2G7H A;  4DV3 I;  2FGG A;  2RS6 A;  4F9C B;  1WHN A;  1N34 I;  3VYX A;  2DB2 A;  1RR9 A;  2YZT A;  2DEJ A;  1N32 E;  2X7I A;  2N3H A;  2L92 A;  5CFF E;  4IZK A;  4DR4 E;  1ZXN A;  5IT9 Q;  2F8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...