5C0XF

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
215
Chain Sequence
QDRRRLLGPAAAKPMAFSNTESEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 58
structure length 215
sequence length 245
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xF00
2JEAB 5C0XD 2PO1B 1UDQA 2JEBB 4OO1E 1E3PA 5C0XF 4OO1B 4AIMA 4BA1B 3HKMA 3U1KA 5K36D 2PNZB 1OYRA 4IFDC 4IFDB 2C38B 4OO1A 2PO0B 4BA1A 2PO2A 3GMEA 2BR2B 5JEAC 5JEAB 2C38A 3L7ZA 2C39B 1R6LA 5K36C 3CDIA 4OO1F 2JEAA 2BA1D 2BR2A 4AM3A 2PO1A 3CDJA 1OYPA 4IFDE 2JEBA 2C39A 3GCMA 2BA1G 2NN6C 2NN6B 3KRNA 5C0XC 3DD6A 5C0XB 1UDNA 2PNZA 2WP8B 5JEAE 3M7ND 4IFDA 2C37B 4BA2B 1UDOA 2WNRB 2PO0A 2BA0D 4OO1D 2NN6A 5K36E 3B4TA 5K36B 3M7NG 1R6MA 2C37A 5JEAA 2JE6B 3M85D 2BA0G 4IFDD 2NN6E 5C0XE 4IFDF 5K36A 3M85G 2NN6F 2JE6A 3GLLA 1UDSA 5JEAD 4OO1C 4AIDA 1E3HA 2PO2B 5JEAF 5C0XA 3H1CA 2WP8A 1OYSA 3L7ZB 5K36F 4BA2A 2WNRA 4NBQA 2NN6D
chains in the Genus database with same CATH superfamily
4DPYA 4MU0A 4DR3E 1J5EE 2PO1B 1UDQA 4U3BA 3J7AM 4OO1E 1E3PA 1K47A 2DEJA 4DV5I 4X65I 1MX0A 4GQUA 3HKMA 5K36D 2PNZB 3V2UC 3ZKBA 5FLXQ 1OYRA 4OZEA 4DR5E 4QNJA 1H7SA 2C38B 4JI6E 1N32I 1XNRE 4JI7I 2GS8A 2BM1A 1Z0VA 1XMQE 4GKKE 2F4VE 1HNXE 4DV4E 4HXZA 4PRXA 4DR3I 5JEAB 1J5EI 2C38A 4DV2E 3Q1QA 4ED4A 4DPTA 3P3EA 4ISAA 5K36C 2JEAA 2BA1D 4LF7E 1RHYA 1FNMA 2GO4A 2UU9E 4IZJB 4OKGA 4DR5I 1KVKA 4JI6I 1UEKA 1XNRI 2O3ZA 3P3GA 4IS9A 4GKKI 2UXDE 4X66E 3QT6A 4DV4I 2WP8B 1EI1A 4HYMA 4IZJA 4LF5E 4FW6A 4LFAE 3M7ND 4IFDA 1HNWE 4BA2B 2EFGA 4OO1D 3M6AA 4DV2I 4AQYE 1KIJA 2CGEA 3UHMA 1B63A 3B4TA 4USKA 2IOPA 2LJPA 1R6MA 4DV3E 1FKAE 2VQEE 4LF7I 4WUCA 3M85D 4NXNE 2BA0G 4IFDD 2UU9I 2AE8A 1ZM2A 3QT8A 1VISA 4JI4E 2UUAE 3PYFA 2HHHE 4DR6E 2GO3A 4R1FA 2CVEA 2UXDI 4X66I 4OO1C 2A2DA 1HNWI 4DV0I 3PYDA 2PO2B 2VF3A 5C0XA 1Y6ZA 3PS1A 2ZM6E 2HFUA 4DPUA 1OYSA 3J7AG 2AJ4A 3QT7A 3F0NA 1XMOI 4DV3I 5K36F 2WNRA 2VQEI 1YH8A 5IWAE 5LMUE 4NBQA 4LF6E 5IT9Q 1NHIA 4DXLA 1Z59A 5FLXC 2NN6D 4JI1I 1HNZE 5C0XD 4JI4I 1USUA 2UUAI 4QNKA 2HHHI 4JI3E 1HK7A 2O1UA 3ZKDA 2X36A 3K17A 1ZXNA 4DU7A 1USVA 4DR4E 4UTGA 4I3HA 4WUDA 3B78A 4B3ME 4Z7YA 4JI7E 2ZM6I 2GQ0A 4U3DA 2PO0B 2V8PA 4PU9A 2V2QA 1ZM3A 5LMUI 5IWAI 3LNUA 3PS3A 4MU1A 4LF6I 1HNZI 4JI3I 3L7ZA 2C39B 4HY1A 2J65A 4DPWA 4LCHA 1IBLI 4GKJI 3P06A 4JYAI 4OO1F 4DR4I 2PO1A 1OYPA 1Y5YA 2CG9A 2V34A 4IFDE 2NPFA 2C39A 3GCMA 4MU4A 4B3MI 3WU4A 2UUBE 2HFSA 1I94E 2PNZA 4HACB 4K0KI 2V2VA 1N0UA 4JI0E 3P76A 4PRVA 1ZM9A 5A2QQ 4HACA 4DPXA 1FI4A 1NHHA 5JEAA 3B8HA 1RREA 1XHKA 2A2CA 2E5LE 2NN6E 2DEIA 5C0XE 3PYGA 1IBMI 2JT2A 2UUBI 2UXBE 2NN6F 4FW7A 1S16A 4M1KA 5JEAD 5IT9C 1I94I 1NHJA 3WU6A 1Z0TA 4DV0E 4FW5A 3T1YE 5EL9A 3J81Q 4DR7E 1PIEA 3H1CA 4YHHE 5L3JA 4B3TE 4JI0I 1U2RA 2WP8A 4EMDA 1XMOE 3D4JA 4FN5A 5DRRA 4IZJD 4BA2A 1FWLA 1EA6A 3GONA 1Y60A 4JI1E 2HK2A 2E5LI 1YHCA 5LMNE 1N0VC 2JEBB 3HULA 2UXBI 1P42A 4DUYI 5EKWA 4LFBE 1Z0WA 4BA1B 4LF4E 4LPFA 1MU5A 3T1YI 5LL6R 4FWDA 1IBKE 1BKNA 1VI7A 4JI8I 4FW9A 1H7UA 4URLA 4DR7I 2HKJA 4YHHI 4IFDC 4B3TI 3PRYA 5DRPA 3WU3A 4BA1A 2BM0A 1Y4UA 2PO2A 2Q2EB 5ELWA 2VQFE 4JI2E 4OX9I 4X64E 1Y4SA 4XTJA 2O1VA 4P52A 5LMNI 4KQVA 4DUZE 3P3CA 2R3VA 1OJ4A 1Z5BA 1R6LA 1IBLE 4GKJE 3ZZ0A 2IERA 2UXCI 3K85A 4JYAE 1MG7A 4LFBI 3CDIA 4LF4I 4AM3A 4ZVIA 1IBKI 3CDJA 1FWKA 1S4EA 4DV1E 2ZITA 1Z5CA 4KHPE 5A2QC 2BA1G 2NN6C 4LF8E 1ZXMA 3KRNA 5C0XC 4WUBA 4LOMA 4K0KE 4FW3A 5JEAE 2VQFI 2Z5BB 4JI2I 2C37B 4X64I 4LCFA 1XXEA 4DUZI 1H74A 2O1WA 2PO0A 2BA0D 2V2ZA 3B82A 2PNLA 5K36B 4B3SI 4JV5I 4MU3A 3M7NG 1XNQE 3ZZTA 1Z0BA 4DV7E 2C37A 2JE6B 3K1JA 4DR1E 3JAMQ 1N34E 3J81C 4DV1I 1ELOA 4FWGA 4IFDF 4LF9E 4MYUA 4KHPI 5K36A 3J80C 1IBME 4LF8I 3M85G 4YY3E 3T1HI 2JE6A 3CWVA 3GLLA 1UDSA 2F1DA 3H4LA 4DV6E 4RPFA 4JG4A 5GMDA 4MDTA 1ZM4A 5DNXA 1KTVA 4FWHA 2XEXA 2Z5EA 1XNQI 4DV7I 4NXME 4DR1I 4UT4A 1N34I 3LTOA 4DR2I 3ZM7A 2JEAB 1H73A 1D6TA 4X62E 4LF9I 3Q6MA 2CZ9A 4DUYE 5C0XF 4YY3I 2VESA 4IZKB 4OO1B 2J7KA 4AIMA 2X7IA 4JI8E 4DV6I 1KKHA 5BR8E 1DARA 3U1KA 5FWKA 4IFDB 1Z0GA 5DROA 3J80Q 4IZKA 4OO1A 3OTOE 1N36E 3WU5A 2OI2A 3GMEA 4NXMI 4MYTA 1XMQI 4LFCE 4OX9E 2F4VI 1HNXI 4B3RE 2BR2B 3HJCA 5JEAC 4X62I 4FW4A 1PKPA 3PS2A 2UXCE 1NZ0A 3ZZUA 4N3OA 2O1TA 2Z5CB 2BR2A 1Z5AA 5BR8I 4JI5E 5DNLA 2PNMA 2JEBA 5GMEA 2IOQA 2IESA 3NZKA 1HR0E 2NN6B 3OTOI 1N36I 2Z5CA 3DD6A 1UDNA 5C0XB 2E1RA 3JAMC 2UUCE 4LFCI 4Z7CA 4B3RI 4USMA 1B62A 4LCGA 4LF5I 4LFAI 1UDOA 2WNRB 1A6FA 2NN6A 5K36E 4P7AA 1PVGA 4B3SE 3LPSA 4JV5E 4AQYI 2WW4A 2R42A 1FJGE 1N33E 4JI5I 4NXNI 2HK3A 3QT5A 1WUUA 2BV3A 3Q6NA 1HR0I 1Z0CA 3T1HE 4MQYA 1H72C 4DR6I 1RR9A 4DV5E 4X65E 2UUCI 4AIDA 1E3HA 2ZBKB 1QZRA 5DRQA 5JEAF 2HKEA 4DU8A 3PYEA 1N32E 2Z5BA 3L7ZB 1FJGI 3U1YA 1N33I 4DR2E 1Z0EA 4J3DA 3V5RA
chains in the Genus database with same CATH topology
2JEAB 5C0XD 2PO1B 1UDQA 2JEBB 4OO1E 1E3PA 5C0XF 4OO1B 4AIMA 4BA1B 3HKMA 3U1KA 5K36D 2PNZB 1OYRA 4IFDC 4IFDB 2C38B 4OO1A 2PO0B 4BA1A 2PO2A 3GMEA 2BR2B 5JEAC 5JEAB 2C38A 3L7ZA 2C39B 1R6LA 5K36C 3CDIA 4OO1F 2JEAA 2BA1D 2BR2A 4AM3A 2PO1A 3CDJA 1OYPA 4IFDE 2JEBA 2C39A 3GCMA 2BA1G 2NN6C 2NN6B 3KRNA 5C0XC 3DD6A 5C0XB 1UDNA 2PNZA 2WP8B 5JEAE 3M7ND 4IFDA 2C37B 4BA2B 1UDOA 2WNRB 2PO0A 2BA0D 4OO1D 2NN6A 5K36E 3B4TA 5K36B 3M7NG 1R6MA 2C37A 5JEAA 2JE6B 3M85D 2BA0G 4IFDD 2NN6E 5C0XE 4IFDF 5K36A 3M85G 2NN6F 2JE6A 3GLLA 1UDSA 5JEAD 4OO1C 4AIDA 1E3HA 2PO2B 5JEAF 5C0XA 3H1CA 2WP8A 1OYSA 3L7ZB 5K36F 4BA2A 2WNRA 4NBQA 2NN6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEA B;  5C0X D;  2PO1 B;  1UDQ A;  2JEB B;  4OO1 E;  1E3P A;  5C0X F;  4OO1 B;  4AIM A;  4BA1 B;  3HKM A;  3U1K A;  5K36 D;  2PNZ B;  1OYR A;  4IFD C;  4IFD B;  2C38 B;  4OO1 A;  2PO0 B;  4BA1 A;  2PO2 A;  3GME A;  2BR2 B;  5JEA C;  5JEA B;  2C38 A;  3L7Z A;  2C39 B;  1R6L A;  5K36 C;  3CDI A;  4OO1 F;  2JEA A;  2BA1 D;  2BR2 A;  4AM3 A;  2PO1 A;  3CDJ A;  1OYP A;  4IFD E;  2JEB A;  2C39 A;  3GCM A;  2BA1 G;  2NN6 C;  2NN6 B;  3KRN A;  5C0X C;  3DD6 A;  5C0X B;  1UDN A;  2PNZ A;  2WP8 B;  5JEA E;  3M7N D;  4IFD A;  2C37 B;  4BA2 B;  1UDO A;  2WNR B;  2PO0 A;  2BA0 D;  4OO1 D;  2NN6 A;  5K36 E;  3B4T A;  5K36 B;  3M7N G;  1R6M A;  2C37 A;  5JEA A;  2JE6 B;  3M85 D;  2BA0 G;  4IFD D;  2NN6 E;  5C0X E;  4IFD F;  5K36 A;  3M85 G;  2NN6 F;  2JE6 A;  3GLL A;  1UDS A;  5JEA D;  4OO1 C;  4AID A;  1E3H A;  2PO2 B;  5JEA F;  5C0X A;  3H1C A;  2WP8 A;  1OYS A;  3L7Z B;  5K36 F;  4BA2 A;  2WNR A;  4NBQ A;  2NN6 D; 
#chains in the Genus database with same CATH topology
 4DPY A;  4MU0 A;  4DR3 E;  1J5E E;  2PO1 B;  1UDQ A;  4U3B A;  3J7A M;  4OO1 E;  1E3P A;  1K47 A;  2DEJ A;  4DV5 I;  4X65 I;  1MX0 A;  4GQU A;  3HKM A;  5K36 D;  2PNZ B;  3V2U C;  3ZKB A;  5FLX Q;  1OYR A;  4OZE A;  4DR5 E;  4QNJ A;  1H7S A;  2C38 B;  4JI6 E;  1N32 I;  1XNR E;  4JI7 I;  2GS8 A;  2BM1 A;  1Z0V A;  1XMQ E;  4GKK E;  2F4V E;  1HNX E;  4DV4 E;  4HXZ A;  4PRX A;  4DR3 I;  5JEA B;  1J5E I;  2C38 A;  4DV2 E;  3Q1Q A;  4ED4 A;  4DPT A;  3P3E A;  4ISA A;  5K36 C;  2JEA A;  2BA1 D;  4LF7 E;  1RHY A;  1FNM A;  2GO4 A;  2UU9 E;  4IZJ B;  4OKG A;  4DR5 I;  1KVK A;  4JI6 I;  1UEK A;  1XNR I;  2O3Z A;  3P3G A;  4IS9 A;  4GKK I;  2UXD E;  4X66 E;  3QT6 A;  4DV4 I;  2WP8 B;  1EI1 A;  4HYM A;  4IZJ A;  4LF5 E;  4FW6 A;  4LFA E;  3M7N D;  4IFD A;  1HNW E;  4BA2 B;  2EFG A;  4OO1 D;  3M6A A;  4DV2 I;  4AQY E;  1KIJ A;  2CGE A;  3UHM A;  1B63 A;  3B4T A;  4USK A;  2IOP A;  2LJP A;  1R6M A;  4DV3 E;  1FKA E;  2VQE E;  4LF7 I;  4WUC A;  3M85 D;  4NXN E;  2BA0 G;  4IFD D;  2UU9 I;  2AE8 A;  1ZM2 A;  3QT8 A;  1VIS A;  4JI4 E;  2UUA E;  3PYF A;  2HHH E;  4DR6 E;  2GO3 A;  4R1F A;  2CVE A;  2UXD I;  4X66 I;  4OO1 C;  2A2D A;  1HNW I;  4DV0 I;  3PYD A;  2PO2 B;  2VF3 A;  5C0X A;  1Y6Z A;  3PS1 A;  2ZM6 E;  2HFU A;  4DPU A;  1OYS A;  3J7A G;  2AJ4 A;  3QT7 A;  3F0N A;  1XMO I;  4DV3 I;  5K36 F;  2WNR A;  2VQE I;  1YH8 A;  5IWA E;  5LMU E;  4NBQ A;  4LF6 E;  5IT9 Q;  1NHI A;  4DXL A;  1Z59 A;  5FLX C;  2NN6 D;  4JI1 I;  1HNZ E;  5C0X D;  4JI4 I;  1USU A;  2UUA I;  4QNK A;  2HHH I;  4JI3 E;  1HK7 A;  2O1U A;  3ZKD A;  2X36 A;  3K17 A;  1ZXN A;  4DU7 A;  1USV A;  4DR4 E;  4UTG A;  4I3H A;  4WUD A;  3B78 A;  4B3M E;  4Z7Y A;  4JI7 E;  2ZM6 I;  2GQ0 A;  4U3D A;  2PO0 B;  2V8P A;  4PU9 A;  2V2Q A;  1ZM3 A;  5LMU I;  5IWA I;  3LNU A;  3PS3 A;  4MU1 A;  4LF6 I;  1HNZ I;  4JI3 I;  3L7Z A;  2C39 B;  4HY1 A;  2J65 A;  4DPW A;  4LCH A;  1IBL I;  4GKJ I;  3P06 A;  4JYA I;  4OO1 F;  4DR4 I;  2PO1 A;  1OYP A;  1Y5Y A;  2CG9 A;  2V34 A;  4IFD E;  2NPF A;  2C39 A;  3GCM A;  4MU4 A;  4B3M I;  3WU4 A;  2UUB E;  2HFS A;  1I94 E;  2PNZ A;  4HAC B;  4K0K I;  2V2V A;  1N0U A;  4JI0 E;  3P76 A;  4PRV A;  1ZM9 A;  5A2Q Q;  4HAC A;  4DPX A;  1FI4 A;  1NHH A;  5JEA A;  3B8H A;  1RRE A;  1XHK A;  2A2C A;  2E5L E;  2NN6 E;  2DEI A;  5C0X E;  3PYG A;  1IBM I;  2JT2 A;  2UUB I;  2UXB E;  2NN6 F;  4FW7 A;  1S16 A;  4M1K A;  5JEA D;  5IT9 C;  1I94 I;  1NHJ A;  3WU6 A;  1Z0T A;  4DV0 E;  4FW5 A;  3T1Y E;  5EL9 A;  3J81 Q;  4DR7 E;  1PIE A;  3H1C A;  4YHH E;  5L3J A;  4B3T E;  4JI0 I;  1U2R A;  2WP8 A;  4EMD A;  1XMO E;  3D4J A;  4FN5 A;  5DRR A;  4IZJ D;  4BA2 A;  1FWL A;  1EA6 A;  3GON A;  1Y60 A;  4JI1 E;  2HK2 A;  2E5L I;  1YHC A;  5LMN E;  1N0V C;  2JEB B;  3HUL A;  2UXB I;  1P42 A;  4DUY I;  5EKW A;  4LFB E;  1Z0W A;  4BA1 B;  4LF4 E;  4LPF A;  1MU5 A;  3T1Y I;  5LL6 R;  4FWD A;  1IBK E;  1BKN A;  1VI7 A;  4JI8 I;  4FW9 A;  1H7U A;  4URL A;  4DR7 I;  2HKJ A;  4YHH I;  4IFD C;  4B3T I;  3PRY A;  5DRP A;  3WU3 A;  4BA1 A;  2BM0 A;  1Y4U A;  2PO2 A;  2Q2E B;  5ELW A;  2VQF E;  4JI2 E;  4OX9 I;  4X64 E;  1Y4S A;  4XTJ A;  2O1V A;  4P52 A;  5LMN I;  4KQV A;  4DUZ E;  3P3C A;  2R3V A;  1OJ4 A;  1Z5B A;  1R6L A;  1IBL E;  4GKJ E;  3ZZ0 A;  2IER A;  2UXC I;  3K85 A;  4JYA E;  1MG7 A;  4LFB I;  3CDI A;  4LF4 I;  4AM3 A;  4ZVI A;  1IBK I;  3CDJ A;  1FWK A;  1S4E A;  4DV1 E;  2ZIT A;  1Z5C A;  4KHP E;  5A2Q C;  2BA1 G;  2NN6 C;  4LF8 E;  1ZXM A;  3KRN A;  5C0X C;  4WUB A;  4LOM A;  4K0K E;  4FW3 A;  5JEA E;  2VQF I;  2Z5B B;  4JI2 I;  2C37 B;  4X64 I;  4LCF A;  1XXE A;  4DUZ I;  1H74 A;  2O1W A;  2PO0 A;  2BA0 D;  2V2Z A;  3B82 A;  2PNL A;  5K36 B;  4B3S I;  4JV5 I;  4MU3 A;  3M7N G;  1XNQ E;  3ZZT A;  1Z0B A;  4DV7 E;  2C37 A;  2JE6 B;  3K1J A;  4DR1 E;  3JAM Q;  1N34 E;  3J81 C;  4DV1 I;  1ELO A;  4FWG A;  4IFD F;  4LF9 E;  4MYU A;  4KHP I;  5K36 A;  3J80 C;  1IBM E;  4LF8 I;  3M85 G;  4YY3 E;  3T1H I;  2JE6 A;  3CWV A;  3GLL A;  1UDS A;  2F1D A;  3H4L A;  4DV6 E;  4RPF A;  4JG4 A;  5GMD A;  4MDT A;  1ZM4 A;  5DNX A;  1KTV A;  4FWH A;  2XEX A;  2Z5E A;  1XNQ I;  4DV7 I;  4NXM E;  4DR1 I;  4UT4 A;  1N34 I;  3LTO A;  4DR2 I;  3ZM7 A;  2JEA B;  1H73 A;  1D6T A;  4X62 E;  4LF9 I;  3Q6M A;  2CZ9 A;  4DUY E;  5C0X F;  4YY3 I;  2VES A;  4IZK B;  4OO1 B;  2J7K A;  4AIM A;  2X7I A;  4JI8 E;  4DV6 I;  1KKH A;  5BR8 E;  1DAR A;  3U1K A;  5FWK A;  4IFD B;  1Z0G A;  5DRO A;  3J80 Q;  4IZK A;  4OO1 A;  3OTO E;  1N36 E;  3WU5 A;  2OI2 A;  3GME A;  4NXM I;  4MYT A;  1XMQ I;  4LFC E;  4OX9 E;  2F4V I;  1HNX I;  4B3R E;  2BR2 B;  3HJC A;  5JEA C;  4X62 I;  4FW4 A;  1PKP A;  3PS2 A;  2UXC E;  1NZ0 A;  3ZZU A;  4N3O A;  2O1T A;  2Z5C B;  2BR2 A;  1Z5A A;  5BR8 I;  4JI5 E;  5DNL A;  2PNM A;  2JEB A;  5GME A;  2IOQ A;  2IES A;  3NZK A;  1HR0 E;  2NN6 B;  3OTO I;  1N36 I;  2Z5C A;  3DD6 A;  1UDN A;  5C0X B;  2E1R A;  3JAM C;  2UUC E;  4LFC I;  4Z7C A;  4B3R I;  4USM A;  1B62 A;  4LCG A;  4LF5 I;  4LFA I;  1UDO A;  2WNR B;  1A6F A;  2NN6 A;  5K36 E;  4P7A A;  1PVG A;  4B3S E;  3LPS A;  4JV5 E;  4AQY I;  2WW4 A;  2R42 A;  1FJG E;  1N33 E;  4JI5 I;  4NXN I;  2HK3 A;  3QT5 A;  1WUU A;  2BV3 A;  3Q6N A;  1HR0 I;  1Z0C A;  3T1H E;  4MQY A;  1H72 C;  4DR6 I;  1RR9 A;  4DV5 E;  4X65 E;  2UUC I;  4AID A;  1E3H A;  2ZBK B;  1QZR A;  5DRQ A;  5JEA F;  2HKE A;  4DU8 A;  3PYE A;  1N32 E;  2Z5B A;  3L7Z B;  1FJG I;  3U1Y A;  1N33 I;  4DR2 E;  1Z0E A;  4J3D A;  3V5R A; 
#chains in the Genus database with same CATH homology
 2JEA B;  5C0X D;  2PO1 B;  1UDQ A;  2JEB B;  4OO1 E;  1E3P A;  5C0X F;  4OO1 B;  4AIM A;  4BA1 B;  3HKM A;  3U1K A;  5K36 D;  2PNZ B;  1OYR A;  4IFD C;  4IFD B;  2C38 B;  4OO1 A;  2PO0 B;  4BA1 A;  2PO2 A;  3GME A;  2BR2 B;  5JEA C;  5JEA B;  2C38 A;  3L7Z A;  2C39 B;  1R6L A;  5K36 C;  3CDI A;  4OO1 F;  2JEA A;  2BA1 D;  2BR2 A;  4AM3 A;  2PO1 A;  3CDJ A;  1OYP A;  4IFD E;  2JEB A;  2C39 A;  3GCM A;  2BA1 G;  2NN6 C;  2NN6 B;  3KRN A;  5C0X C;  3DD6 A;  5C0X B;  1UDN A;  2PNZ A;  2WP8 B;  5JEA E;  3M7N D;  4IFD A;  2C37 B;  4BA2 B;  1UDO A;  2WNR B;  2PO0 A;  2BA0 D;  4OO1 D;  2NN6 A;  5K36 E;  3B4T A;  5K36 B;  3M7N G;  1R6M A;  2C37 A;  5JEA A;  2JE6 B;  3M85 D;  2BA0 G;  4IFD D;  2NN6 E;  5C0X E;  4IFD F;  5K36 A;  3M85 G;  2NN6 F;  2JE6 A;  3GLL A;  1UDS A;  5JEA D;  4OO1 C;  4AID A;  1E3H A;  2PO2 B;  5JEA F;  5C0X A;  3H1C A;  2WP8 A;  1OYS A;  3L7Z B;  5K36 F;  4BA2 A;  2WNR A;  4NBQ A;  2NN6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...