5C0XF

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
215
Chain Sequence
QDRRRLLGPAAAKPMAFSNTESEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 58
structure length 215
sequence length 245
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xF00
2BA1D 2C38B 3L7ZA 2JEAB 1UDNA 2WNRA 2JE6B 2C37B 2BR2B 2C39B 2NN6E 4BA2B 2NN6A 2BA0G 3KRNA 2NN6C 3M85D 2JEBA 2PO0A 5JEAB 3HKMA 5JEAF 4OO1C 5C0XD 5C0XE 4IFDC 3M7ND 4AIMA 5C0XA 4OO1B 4IFDB 4OO1F 4IFDF 1E3HA 3H1CA 1R6LA 5K36D 3GMEA 5K36E 1UDSA 3L7ZB 5K36A 2PO2A 2WNRB 2PO1A 1OYRA 1OYSA 4BA1A 2WP8A 2PO2B 3DD6A 3GCMA 2NN6B 2NN6F 1E3PA 4AM3A 2JEBB 2PO0B 3M7NG 1UDOA 2BA1G 2PNZA 3CDIA 5C0XC 1OYPA 3B4TA 5JEAD 5C0XB 2BA0D 5C0XF 3GLLA 5K36C 4NBQA 2C38A 5K36B 2JEAA 5K36F 1R6MA 3M85G 3U1KA 2JE6A 2PO1B 2C37A 4BA1B 2WP8B 2BR2A 2C39A 4BA2A 5JEAE 2NN6D 5JEAA 2PNZB 1UDQA 5JEAC 4AIDA 4OO1D 3CDJA 4IFDD 4OO1E 4IFDE 4OO1A 4IFDA
chains in the Genus database with same CATH superfamily
4FW6A 4DR5I 1FKAE 1Z0WA 2BA1D 4JYAI 5DNXA 5BR8E 4LF6I 2CGEA 2JEAB 2WNRA 4DR5E 4DR6I 2GQ0A 2JE6B 4DR2I 4JYAE 4LF6E 4LFCI 1ZXMA 2X7IA 2NN6E 1J5EI 4RPFA 2BA0G 3PS2A 4DR6E 4DR2E 5IT9C 4U3DA 1PIEA 2O1VA 2JEBA 4LCFA 4LFCE 4ZVIA 2R42A 4DXLA 1J5EE 1Z0VA 5JEAF 4X65I 2Z5BB 5C0XD 4DPUA 4LF4I 5C0XA 4OO1B 1HNZI 4IFDF 4X65E 4FWHA 1WUUA 1S16A 4LF4E 5K36D 3GMEA 3K1JA 3PRYA 2GO4A 1XNRI 5K36A 4NXNI 3ZM7A 1HNZE 3P06A 1EA6A 3GONA 5ELWA 2PO1A 2V2ZA 5DRRA 3F0NA 1OYSA 1HNXI 1XNRE 3HULA 4URLA 3J7AG 4NXNE 2NN6B 1E3PA 2HKEA 4P7AA 4DPWA 4DV0I 1NHIA 1RHYA 4YY3I 1HNXE 3PS3A 4FW3A 2OI2A 5DRPA 3CWVA 4B3MI 3B4TA 5A2QQ 1Z59A 1KIJA 4DV0E 4YY3E 4JV5I 5C0XF 1Y6ZA 4HACA 3LPSA 4GQUA 1USVA 4B3ME 1XHKA 3WU6A 2C38A 1K47A 3B8HA 4JV5E 5K36F 1I94I 3LNUA 3QT7A 1B62A 3U1KA 4LF7I 3PYEA 2A2DA 2WP8B 4MU1A 2C39A 2Z5CA 4IZJB 2CG9A 3D4JA 1I94E 1Y60A 4LF7E 1Z0GA 4Z7CA 2NN6D 3QT6A 4DV1I 4GKKI 1N0UA 4HXZA 2F1DA 2HK3A 3Q6NA 3ZZ0A 2R3VA 4DV1E 1S4EA 4GKKE 5LMUI 2V8PA 2UXDI 3L7ZA 2GO3A 4U3BA 2HHHI 3H4LA 5LMUE 4DV7I 2C37B 2UXDE 2BR2B 3B82A 4B3SI 3PS1A 4P52A 4EMDA 4MQYA 4BA2B 3V5RA 2HFSA 1A6FA 4DV6I 2J7KA 5DNLA 2HHHE 2DEIA 4DV7E 1HR0I 4B3SE 4PRVA 4DUYI 4DV6E 4IFDC 3M7ND 2UUCI 1HR0E 3P3EA 2BV3A 4DUYE 5FWKA 5IT9Q 4DR4I 3H1CA 4MU4A 1R6LA 4JI1I 3ZZTA 2UUCE 1ZM4A 4B3TI 4JI5I 4WUDA 4DR4E 1FJGI 2CVEA 3J80Q 4JI1E 1Y4SA 2IOPA 4B3TE 3GCMA 4JI5E 2XEXA 1FJGE 1NHHA 4FW7A 4AQYI 1IBLI 4QNJA 2PO0B 4DV3I 2AJ4A 3J80C 1H7SA 2UXCI 2PNZA 5C0XC 1FWKA 1OYPA 4FWGA 4ISAA 4JI2I 4AQYE 1IBLE 3ZZUA 2BA0D 4QNKA 4DV3E 2ZBKB 2UXCE 3PYDA 5K36C 4USKA 4DPTA 4JI2E 4JI4I 1ZXNA 2JEAA 2WW4A 3M85G 2JE6A 4BA1B 4JI4E 2V2VA 1N33I 1HNWI 4FN5A 4DR3I 1BKNA 3LTOA 1UEKA 2V2QA 4ED4A 5JEAE 3T1HI 4HY1A 4UTGA 3NZKA 3ZKBA 3UHMA 1UDQA 5EKWA 4LCGA 1XMQI 2Z5BA 1KVKA 1N33E 1HNWE 4DPYA 4DR3E 4OO1D 4IFDE 4LCHA 4OO1A 3T1HE 4LPFA 1HK7A 4R1FA 1YH8A 3J81C 4JI7I 2O1UA 1XMQE 4UT4A 1VISA 4PRXA 4OZEA 4M1KA 1N34I 4USMA 2IOQA 4IZKB 2VQFI 4N3OA 2E1RA 1P42A 3WU5A 4GKJI 2CZ9A 1B63A 1UDNA 4JI7E 1Y4UA 4DPXA 4DUZI 2UU9I 1N34E 2VQFE 3T1YI 4LFAI 2HFUA 4GKJE 2NN6A 3KRNA 2NN6C 4DUZE 2UU9E 5JEAB 3HKMA 3T1YE 4LFAE 1H73A 1MX0A 4MDTA 1XNQI 2PNMA 1Y5YA 1VI7A 5C0XE 1KKHA 4AIMA 4PU9A 1Z5BA 4HYMA 2VQEI 4DV4I 1EI1A 4IFDB 3Q6MA 4OO1F 4X64I 4JI3I 1XNQE 5GMDA 1XXEA 4LF5I 2O1TA 5K36E 2VQEE 1UDSA 1Z0TA 2JT2A 4DV4E 1N32I 2PO2A 2WNRB 1PKPA 4X64E 4JI3E 1N0VC 1U2RA 4IS9A 4LF5E 2F4VI 4IZJD 1RREA 2WP8A 4IZJA 1N32E 4WUBA 4LOMA 2BM1A 5FLXQ 2NN6F 2ZITA 4AM3A 3WU3A 2JEBB 4FW9A 1USUA 2F4VE 1RR9A 2GS8A 3M7NG 1IBKI 2BA1G 4WUCA 3CDIA 2X36A 4X62I 1FI4A 5JEAD 2O1WA 1D6TA 5FLXC 5C0XB 2HK2A 3JAMQ 1ZM9A 1IBKE 3PYFA 3U1YA 1MG7A 3GLLA 4X62E 2NPFA 5L3JA 3J7AM 3K85A 2EFGA 3V2UC 3WU4A 5K36B 4FW4A 2LJPA 1R6MA 4DV2I 3JAMC 2UUAI 2PO1B 2IESA 2O3ZA 2C37A 2BR2A 3ZKDA 4OKGA 2E5LI 4JI6I 1Z5AA 4BA2A 2HKJA 4DV2E 2UUAE 4MU0A 2UXBI 2J65A 1H74A 2E5LE 4JI6E 3OTOI 3B78A 4MYTA 4AIDA 4LF8I 2UXBE 3CDJA 1XMOI 4LF9I 1MU5A 4OX9I 1YHCA 1NHJA 1Z5CA 4HACB 3OTOE 4LF8E 4DR1I 4KHPI 2C38B 1XMOE 4LF9E 4OX9E 4Z7YA 4DR1E 1N36I 3QT8A 2AE8A 4KHPE 4I3HA 3J81Q 2C39B 2VF3A 2Z5CB 3QT5A 2PNLA 4DU8A 5GMEA 5EL9A 5LMNI 1N36E 4LFBI 5LL6R 3M85D 2PO0A 1Z0BA 4FWDA 4OO1C 5LMNE 3HJCA 4FW5A 4LFBE 1IBMI 3PYGA 1KTVA 3K17A 1E3HA 3P3CA 1Z0CA 4MYUA 4KQVA 2ZM6I 4NXMI 1IBME 2A2CA 3L7ZB 1PVGA 4JI8I 4K0KI 4JI0I 2ZM6E 4DR7I 1OYRA 4BA1A 2UUBI 4NXME 5A2QC 2PO2B 4MU3A 5DROA 3DD6A 2IERA 4JI8E 1ZM3A 4DU7A 4K0KE 4JI0E 4YHHI 4DV5I 4DR7E 2UUBE 1UDOA 4X66I 1NZ0A 2V34A 2Z5EA 2DEJA 3Q1QA 4YHHE 4DV5E 1FNMA 4X66E 4B3RI 1DARA 4NBQA 4IZKA 1OJ4A 3M6AA 1ELOA 1FWLA 4XTJA 3P3GA 4JG4A 1ZM2A 2VESA 4B3RE 1H72C 5DRQA 2Q2EB 5IWAI 2BM0A 1QZRA 5JEAA 1H7UA 4J3DA 2PNZB 5JEAC 1Z0EA 3P76A 5BR8I 5IWAE 4OO1E 4IFDD 4IFDA
chains in the Genus database with same CATH topology
2BA1D 2C38B 3L7ZA 2JEAB 1UDNA 2WNRA 2JE6B 2C37B 2BR2B 2C39B 2NN6E 4BA2B 2NN6A 2BA0G 3KRNA 2NN6C 3M85D 2JEBA 2PO0A 5JEAB 3HKMA 5JEAF 4OO1C 5C0XD 5C0XE 4IFDC 3M7ND 4AIMA 5C0XA 4OO1B 4IFDB 4OO1F 4IFDF 1E3HA 3H1CA 1R6LA 5K36D 3GMEA 5K36E 1UDSA 3L7ZB 5K36A 2PO2A 2WNRB 2PO1A 1OYRA 1OYSA 4BA1A 2WP8A 2PO2B 3DD6A 3GCMA 2NN6B 2NN6F 1E3PA 4AM3A 2JEBB 2PO0B 3M7NG 1UDOA 2BA1G 2PNZA 3CDIA 5C0XC 1OYPA 3B4TA 5JEAD 5C0XB 2BA0D 5C0XF 3GLLA 5K36C 4NBQA 2C38A 5K36B 2JEAA 5K36F 1R6MA 3M85G 3U1KA 2JE6A 2PO1B 2C37A 4BA1B 2WP8B 2BR2A 2C39A 4BA2A 5JEAE 2NN6D 5JEAA 2PNZB 1UDQA 5JEAC 4AIDA 4OO1D 3CDJA 4IFDD 4OO1E 4IFDE 4OO1A 4IFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA1 D;  2C38 B;  3L7Z A;  2JEA B;  1UDN A;  2WNR A;  2JE6 B;  2C37 B;  2BR2 B;  2C39 B;  2NN6 E;  4BA2 B;  2NN6 A;  2BA0 G;  3KRN A;  2NN6 C;  3M85 D;  2JEB A;  2PO0 A;  5JEA B;  3HKM A;  5JEA F;  4OO1 C;  5C0X D;  5C0X E;  4IFD C;  3M7N D;  4AIM A;  5C0X A;  4OO1 B;  4IFD B;  4OO1 F;  4IFD F;  1E3H A;  3H1C A;  1R6L A;  5K36 D;  3GME A;  5K36 E;  1UDS A;  3L7Z B;  5K36 A;  2PO2 A;  2WNR B;  2PO1 A;  1OYR A;  1OYS A;  4BA1 A;  2WP8 A;  2PO2 B;  3DD6 A;  3GCM A;  2NN6 B;  2NN6 F;  1E3P A;  4AM3 A;  2JEB B;  2PO0 B;  3M7N G;  1UDO A;  2BA1 G;  2PNZ A;  3CDI A;  5C0X C;  1OYP A;  3B4T A;  5JEA D;  5C0X B;  2BA0 D;  5C0X F;  3GLL A;  5K36 C;  4NBQ A;  2C38 A;  5K36 B;  2JEA A;  5K36 F;  1R6M A;  3M85 G;  3U1K A;  2JE6 A;  2PO1 B;  2C37 A;  4BA1 B;  2WP8 B;  2BR2 A;  2C39 A;  4BA2 A;  5JEA E;  2NN6 D;  5JEA A;  2PNZ B;  1UDQ A;  5JEA C;  4AID A;  4OO1 D;  3CDJ A;  4IFD D;  4OO1 E;  4IFD E;  4OO1 A;  4IFD A; 
#chains in the Genus database with same CATH topology
 4FW6 A;  4DR5 I;  1FKA E;  1Z0W A;  2BA1 D;  4JYA I;  5DNX A;  5BR8 E;  4LF6 I;  2CGE A;  2JEA B;  2WNR A;  4DR5 E;  4DR6 I;  2GQ0 A;  2JE6 B;  4DR2 I;  4JYA E;  4LF6 E;  4LFC I;  1ZXM A;  2X7I A;  2NN6 E;  1J5E I;  4RPF A;  2BA0 G;  3PS2 A;  4DR6 E;  4DR2 E;  5IT9 C;  4U3D A;  1PIE A;  2O1V A;  2JEB A;  4LCF A;  4LFC E;  4ZVI A;  2R42 A;  4DXL A;  1J5E E;  1Z0V A;  5JEA F;  4X65 I;  2Z5B B;  5C0X D;  4DPU A;  4LF4 I;  5C0X A;  4OO1 B;  1HNZ I;  4IFD F;  4X65 E;  4FWH A;  1WUU A;  1S16 A;  4LF4 E;  5K36 D;  3GME A;  3K1J A;  3PRY A;  2GO4 A;  1XNR I;  5K36 A;  4NXN I;  3ZM7 A;  1HNZ E;  3P06 A;  1EA6 A;  3GON A;  5ELW A;  2PO1 A;  2V2Z A;  5DRR A;  3F0N A;  1OYS A;  1HNX I;  1XNR E;  3HUL A;  4URL A;  3J7A G;  4NXN E;  2NN6 B;  1E3P A;  2HKE A;  4P7A A;  4DPW A;  4DV0 I;  1NHI A;  1RHY A;  4YY3 I;  1HNX E;  3PS3 A;  4FW3 A;  2OI2 A;  5DRP A;  3CWV A;  4B3M I;  3B4T A;  5A2Q Q;  1Z59 A;  1KIJ A;  4DV0 E;  4YY3 E;  4JV5 I;  5C0X F;  1Y6Z A;  4HAC A;  3LPS A;  4GQU A;  1USV A;  4B3M E;  1XHK A;  3WU6 A;  2C38 A;  1K47 A;  3B8H A;  4JV5 E;  5K36 F;  1I94 I;  3LNU A;  3QT7 A;  1B62 A;  3U1K A;  4LF7 I;  3PYE A;  2A2D A;  2WP8 B;  4MU1 A;  2C39 A;  2Z5C A;  4IZJ B;  2CG9 A;  3D4J A;  1I94 E;  1Y60 A;  4LF7 E;  1Z0G A;  4Z7C A;  2NN6 D;  3QT6 A;  4DV1 I;  4GKK I;  1N0U A;  4HXZ A;  2F1D A;  2HK3 A;  3Q6N A;  3ZZ0 A;  2R3V A;  4DV1 E;  1S4E A;  4GKK E;  5LMU I;  2V8P A;  2UXD I;  3L7Z A;  2GO3 A;  4U3B A;  2HHH I;  3H4L A;  5LMU E;  4DV7 I;  2C37 B;  2UXD E;  2BR2 B;  3B82 A;  4B3S I;  3PS1 A;  4P52 A;  4EMD A;  4MQY A;  4BA2 B;  3V5R A;  2HFS A;  1A6F A;  4DV6 I;  2J7K A;  5DNL A;  2HHH E;  2DEI A;  4DV7 E;  1HR0 I;  4B3S E;  4PRV A;  4DUY I;  4DV6 E;  4IFD C;  3M7N D;  2UUC I;  1HR0 E;  3P3E A;  2BV3 A;  4DUY E;  5FWK A;  5IT9 Q;  4DR4 I;  3H1C A;  4MU4 A;  1R6L A;  4JI1 I;  3ZZT A;  2UUC E;  1ZM4 A;  4B3T I;  4JI5 I;  4WUD A;  4DR4 E;  1FJG I;  2CVE A;  3J80 Q;  4JI1 E;  1Y4S A;  2IOP A;  4B3T E;  3GCM A;  4JI5 E;  2XEX A;  1FJG E;  1NHH A;  4FW7 A;  4AQY I;  1IBL I;  4QNJ A;  2PO0 B;  4DV3 I;  2AJ4 A;  3J80 C;  1H7S A;  2UXC I;  2PNZ A;  5C0X C;  1FWK A;  1OYP A;  4FWG A;  4ISA A;  4JI2 I;  4AQY E;  1IBL E;  3ZZU A;  2BA0 D;  4QNK A;  4DV3 E;  2ZBK B;  2UXC E;  3PYD A;  5K36 C;  4USK A;  4DPT A;  4JI2 E;  4JI4 I;  1ZXN A;  2JEA A;  2WW4 A;  3M85 G;  2JE6 A;  4BA1 B;  4JI4 E;  2V2V A;  1N33 I;  1HNW I;  4FN5 A;  4DR3 I;  1BKN A;  3LTO A;  1UEK A;  2V2Q A;  4ED4 A;  5JEA E;  3T1H I;  4HY1 A;  4UTG A;  3NZK A;  3ZKB A;  3UHM A;  1UDQ A;  5EKW A;  4LCG A;  1XMQ I;  2Z5B A;  1KVK A;  1N33 E;  1HNW E;  4DPY A;  4DR3 E;  4OO1 D;  4IFD E;  4LCH A;  4OO1 A;  3T1H E;  4LPF A;  1HK7 A;  4R1F A;  1YH8 A;  3J81 C;  4JI7 I;  2O1U A;  1XMQ E;  4UT4 A;  1VIS A;  4PRX A;  4OZE A;  4M1K A;  1N34 I;  4USM A;  2IOQ A;  4IZK B;  2VQF I;  4N3O A;  2E1R A;  1P42 A;  3WU5 A;  4GKJ I;  2CZ9 A;  1B63 A;  1UDN A;  4JI7 E;  1Y4U A;  4DPX A;  4DUZ I;  2UU9 I;  1N34 E;  2VQF E;  3T1Y I;  4LFA I;  2HFU A;  4GKJ E;  2NN6 A;  3KRN A;  2NN6 C;  4DUZ E;  2UU9 E;  5JEA B;  3HKM A;  3T1Y E;  4LFA E;  1H73 A;  1MX0 A;  4MDT A;  1XNQ I;  2PNM A;  1Y5Y A;  1VI7 A;  5C0X E;  1KKH A;  4AIM A;  4PU9 A;  1Z5B A;  4HYM A;  2VQE I;  4DV4 I;  1EI1 A;  4IFD B;  3Q6M A;  4OO1 F;  4X64 I;  4JI3 I;  1XNQ E;  5GMD A;  1XXE A;  4LF5 I;  2O1T A;  5K36 E;  2VQE E;  1UDS A;  1Z0T A;  2JT2 A;  4DV4 E;  1N32 I;  2PO2 A;  2WNR B;  1PKP A;  4X64 E;  4JI3 E;  1N0V C;  1U2R A;  4IS9 A;  4LF5 E;  2F4V I;  4IZJ D;  1RRE A;  2WP8 A;  4IZJ A;  1N32 E;  4WUB A;  4LOM A;  2BM1 A;  5FLX Q;  2NN6 F;  2ZIT A;  4AM3 A;  3WU3 A;  2JEB B;  4FW9 A;  1USU A;  2F4V E;  1RR9 A;  2GS8 A;  3M7N G;  1IBK I;  2BA1 G;  4WUC A;  3CDI A;  2X36 A;  4X62 I;  1FI4 A;  5JEA D;  2O1W A;  1D6T A;  5FLX C;  5C0X B;  2HK2 A;  3JAM Q;  1ZM9 A;  1IBK E;  3PYF A;  3U1Y A;  1MG7 A;  3GLL A;  4X62 E;  2NPF A;  5L3J A;  3J7A M;  3K85 A;  2EFG A;  3V2U C;  3WU4 A;  5K36 B;  4FW4 A;  2LJP A;  1R6M A;  4DV2 I;  3JAM C;  2UUA I;  2PO1 B;  2IES A;  2O3Z A;  2C37 A;  2BR2 A;  3ZKD A;  4OKG A;  2E5L I;  4JI6 I;  1Z5A A;  4BA2 A;  2HKJ A;  4DV2 E;  2UUA E;  4MU0 A;  2UXB I;  2J65 A;  1H74 A;  2E5L E;  4JI6 E;  3OTO I;  3B78 A;  4MYT A;  4AID A;  4LF8 I;  2UXB E;  3CDJ A;  1XMO I;  4LF9 I;  1MU5 A;  4OX9 I;  1YHC A;  1NHJ A;  1Z5C A;  4HAC B;  3OTO E;  4LF8 E;  4DR1 I;  4KHP I;  2C38 B;  1XMO E;  4LF9 E;  4OX9 E;  4Z7Y A;  4DR1 E;  1N36 I;  3QT8 A;  2AE8 A;  4KHP E;  4I3H A;  3J81 Q;  2C39 B;  2VF3 A;  2Z5C B;  3QT5 A;  2PNL A;  4DU8 A;  5GME A;  5EL9 A;  5LMN I;  1N36 E;  4LFB I;  5LL6 R;  3M85 D;  2PO0 A;  1Z0B A;  4FWD A;  4OO1 C;  5LMN E;  3HJC A;  4FW5 A;  4LFB E;  1IBM I;  3PYG A;  1KTV A;  3K17 A;  1E3H A;  3P3C A;  1Z0C A;  4MYU A;  4KQV A;  2ZM6 I;  4NXM I;  1IBM E;  2A2C A;  3L7Z B;  1PVG A;  4JI8 I;  4K0K I;  4JI0 I;  2ZM6 E;  4DR7 I;  1OYR A;  4BA1 A;  2UUB I;  4NXM E;  5A2Q C;  2PO2 B;  4MU3 A;  5DRO A;  3DD6 A;  2IER A;  4JI8 E;  1ZM3 A;  4DU7 A;  4K0K E;  4JI0 E;  4YHH I;  4DV5 I;  4DR7 E;  2UUB E;  1UDO A;  4X66 I;  1NZ0 A;  2V34 A;  2Z5E A;  2DEJ A;  3Q1Q A;  4YHH E;  4DV5 E;  1FNM A;  4X66 E;  4B3R I;  1DAR A;  4NBQ A;  4IZK A;  1OJ4 A;  3M6A A;  1ELO A;  1FWL A;  4XTJ A;  3P3G A;  4JG4 A;  1ZM2 A;  2VES A;  4B3R E;  1H72 C;  5DRQ A;  2Q2E B;  5IWA I;  2BM0 A;  1QZR A;  5JEA A;  1H7U A;  4J3D A;  2PNZ B;  5JEA C;  1Z0E A;  3P76 A;  5BR8 I;  5IWA E;  4OO1 E;  4IFD D;  4IFD A; 
#chains in the Genus database with same CATH homology
 2BA1 D;  2C38 B;  3L7Z A;  2JEA B;  1UDN A;  2WNR A;  2JE6 B;  2C37 B;  2BR2 B;  2C39 B;  2NN6 E;  4BA2 B;  2NN6 A;  2BA0 G;  3KRN A;  2NN6 C;  3M85 D;  2JEB A;  2PO0 A;  5JEA B;  3HKM A;  5JEA F;  4OO1 C;  5C0X D;  5C0X E;  4IFD C;  3M7N D;  4AIM A;  5C0X A;  4OO1 B;  4IFD B;  4OO1 F;  4IFD F;  1E3H A;  3H1C A;  1R6L A;  5K36 D;  3GME A;  5K36 E;  1UDS A;  3L7Z B;  5K36 A;  2PO2 A;  2WNR B;  2PO1 A;  1OYR A;  1OYS A;  4BA1 A;  2WP8 A;  2PO2 B;  3DD6 A;  3GCM A;  2NN6 B;  2NN6 F;  1E3P A;  4AM3 A;  2JEB B;  2PO0 B;  3M7N G;  1UDO A;  2BA1 G;  2PNZ A;  3CDI A;  5C0X C;  1OYP A;  3B4T A;  5JEA D;  5C0X B;  2BA0 D;  5C0X F;  3GLL A;  5K36 C;  4NBQ A;  2C38 A;  5K36 B;  2JEA A;  5K36 F;  1R6M A;  3M85 G;  3U1K A;  2JE6 A;  2PO1 B;  2C37 A;  4BA1 B;  2WP8 B;  2BR2 A;  2C39 A;  4BA2 A;  5JEA E;  2NN6 D;  5JEA A;  2PNZ B;  1UDQ A;  5JEA C;  4AID A;  4OO1 D;  3CDJ A;  4IFD D;  4OO1 E;  4IFD E;  4OO1 A;  4IFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...