5C0XF

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
245
structure length
215
Chain Sequence
b'QDRRRLLGPAAAKPMAFSNTESEQELSLHTGFIENCNGSALVEARSLGHQTSLISAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 58
structure length 215
sequence length 245
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5c0xF00
3DD6A 4NBQA 1OYRA 4IFDD 2JEBB 2NN6F 4OO1D 5JEAB 2WNRB 2WP8A 5K36F 4IFDC 4OO1C 2C37B 3H1CA 4BA2A 3L7ZB 5JEAE 4AIMA 1OYSA 1E3HA 2C38B 2JE6A 3GCMA 2JEAA 2NN6D 1R6MA 2PO0B 5K36D 3GLLA 2NN6C 3M85D 5C0XE 5K36C 2BA0G 2BR2B 2PO1B 4IFDB 4OO1B 3GMEA 2C39B 4AM3A 1UDNA 2PO2B 1UDSA 3M85G 3CDIA 3HKMA 5C0XA 2PNZB 5JEAF 2BA0D 1UDOA 2NN6B 1R6LA 1UDQA 5K36B 3U1KA 4BA1B 5C0XF 3B4TA 1OYPA 2JEBA 2WNRA 5JEAA 2WP8B 2PO2A 5JEAC 2C37A 4BA2B 5C0XD 3L7ZA 3KRNA 4IFDE 4OO1E 3CDJA 5C0XC 2C38A 2BA1D 2JE6B 2JEAB 4BA1A 2PO0A 1E3PA 3M7NG 2BR2A 2PO1A 4IFDA 4OO1A 2C39A 2BA1G 2NN6E 5JEAD 5K36E 4AIDA 5C0XB 3M7ND 4IFDF 2PNZA 4OO1F 2NN6A 5K36A
chains in the Genus database with same CATH superfamily
1XNQI 4QNJA 2Z5CA 4DR3E 1USVA 1XNQE 4URLA 1PKPA 1YHCA 3PS2A 2DEJA 1USUA 2NPFA 3H1CA 4ED4A 4DR7I 4DR4I 4DR7E 1QZRA 4AIMA 1NHHA 3PYFA 5LMUE 4HACA 3H4LA 4LFBI 3GLLA 4DXLA 4LFBE 4AQYI 2BR2B 1Y5YA 4OO1B 4B3TI 2V8PA 4AQYE 4LOMA 1XMOI 4B3TE 4DPUA 1ZM2A 3CDIA 1XMOE 4ISAA 2AJ4A 4LF9I 3P3GA 1R6LA 5BR8I 4LF9E 2ZBKB 3ZZUA 4HYMA 4DPXA 4MU4A 2Z5CB 2O3ZA 5BR8E 1DARA 3Q6NA 4USMA 5ELWA 1HNXI 2JEBA 2WNRA 1Z0BA 5JEAA 2PO2A 1HNXE 4JI5E 5JEAC 2C37A 4DR6I 4XTJA 1FJGI 1N32I 1NZ0A 1H7SA 3ZM7A 1FKAE 1D6TA 4DR6E 4LF6I 1FJGE 1N32E 2Z5BB 4LF6E 1Z0TA 4HACB 4PRXA 1E3PA 1OJ4A 2UXDI 4DU7A 3J80C 4B3SE 4YY3I 1U2RA 1ZXMA 2HKJA 4QNKA 2PO1A 5IWAI 2UXDE 3PYGA 4DV3I 4YY3E 5IWAE 4FW4A 4DV3E 3PYDA 1MG7A 4N3OA 3M7ND 5LMNI 4IZJB 4ZVIA 5LL6R 2VF3A 5LMNE 3J7AG 2A2CA 1NHIA 3Q1QA 2X36A 1ZM4A 3DD6A 1K47A 4FW5A 4NBQA 3PRYA 4JYAI 5GMEA 1VISA 2JT2A 1OYRA 2JEBB 2HHHI 4OO1D 2WNRB 5JEAB 3B78A 4JYAE 4Z7YA 4OO1C 2OI2A 2HHHE 2C37B 4HXZA 1FI4A 1XXEA 5JEAE 4JV5I 4MU0A 1E3HA 2JE6A 4JI7I 2JEAA 1R6MA 4MU1A 4JV5E 3U1YA 1Z0VA 4KHPI 2UU9E 1Z0CA 3F0NA 4JI7E 4LF4I 4P52A 2PO1B 4KHPE 2UXCI 4LF4E 1MX0A 2XEXA 4HY1A 1KVKA 2UXCE 4GQUA 2CVEA 4WUCA 2X7IA 2V2ZA 3HKMA 5C0XA 1A6FA 2R3VA 4DV5I 5GMDA 3P06A 2VESA 1N0VC 3HJCA 4DV5E 4FW3A 4MDTA 2UUCI 1UDQA 4DR4E 3B8HA 4BA1B 5C0XF 3T1HI 5DRPA 1B63A 4MU3A 2UUCE 3T1HE 4IS9A 1Z0WA 2ZITA 1NHJA 4DV4I 4PU9A 4WUDA 1Z59A 5L3JA 2IERA 4DV4E 3L7ZA 2VQEI 4IZJD 2O1VA 3WU6A 4OO1E 3CDJA 2JE6B 2VQEE 3ZKBA 2JEAB 4Z7CA 2BM0A 1Y4SA 1I94I 1RHYA 4DV6I 4LFAI 1ZXNA 1P42A 2IOPA 1I94E 4DV6E 5DRRA 4LFAE 4IFDA 1Z0EA 5IT9C 4JI2I 2C39A 5JEAD 4DV7I 4R1FA 4X66I 1Y6ZA 4JI2E 4DUZI 2HFUA 4DV7E 4JG4A 4X66E 5C0XB 4IFDF 2PNZA 4MQYA 4DUZE 1EA6A 4JI0I 1ZM3A 3LTOA 2NN6A 2PNLA 4DU8A 1RREA 1ELOA 4JI0E 5K36A 3OTOI 2BM1A 5A2QC 1YH8A 3OTOE 5FLXQ 4DPTA 4MYUA 1MU5A 4K0KI 2HK3A 4GKJI 2NN6F 3WU5A 1Y60A 5K36F 4K0KE 4GKJE 4FWHA 4JI4I 4BA2A 2BV3A 4LF7I 3P3EA 1RR9A 3L7ZB 4JI4E 4LF7E 1OYSA 4B3RI 4U3DA 3K85A 3GCMA 4DV0I 3P3CA 4DR5I 1H74A 1Z5AA 4B3RE 1FNMA 5DNLA 4DV0E 3M85D 3Q6MA 4JI3I 4DR5E 3K1JA 3J81C 3ZZ0A 2BA0G 3V5RA 1N36I 4IFDB 4JI3E 2E1RA 2WW4A 3GMEA 3QT6A 4DPYA 2C39B 1N36E 1UDNA 3CWVA 2PO2B 1N0UA 2V34A 3PS3A 4B3MI 3M85G 2F1DA 4MYTA 3M6AA 4DR1I 4B3ME 2PNZB 1IBMI 4EMDA 4LF5I 1Z5BA 3ZKDA 4DR1E 2NN6B 3PS1A 1IBME 4X64I 1XNRI 4LF5E 5K36B 4USKA 2O1WA 4X64E 1XNRE 1UEKA 2CZ9A 2F4VI 4BA2B 2EFGA 5C0XD 3KRNA 4JI6I 5DRQA 2V2QA 2F4VE 1WUUA 2HFSA 5C0XC 2C38A 2BA1D 4JI6E 1BKNA 1PVGA 2PO0A 2Z5EA 4OKGA 3HULA 1FWLA 3K17A 2BA1G 4LFCI 3ZZTA 4PRVA 4OX9I 2J7KA 4FWDA 1ZM9A 4LFCE 4FWGA 3JAMC 4OX9E 4AIDA 5A2QQ 5LMUI 2Z5BA 4M1KA 1S4EA 5EL9A 3J80Q 4DV1I 4J3DA 2CGEA 4DV1E 1J5EI 3QT5A 4UTGA 2O1UA 4DV2I 2UUBI 1J5EE 2PNMA 2CG9A 4DV2E 2UUBE 1B62A 1IBKI 4IFDD 3PYEA 1N33I 2WP8A 2GO4A 4U3BA 4DUYI 1IBKE 4IFDC 1N34I 2ZM6I 1VI7A 2DEIA 4OZEA 1N33E 4DUYE 2E5LI 1H73A 1KIJA 4IZJA 5DNXA 1N34E 2ZM6E 4DR2I 1KTVA 3J81Q 2J65A 2E5LE 1Y4UA 5DROA 2Q2EB 4DPWA 4IZKA 4DR2E 2C38B 2NN6D 4JI1I 2PO0B 2VQFI 5K36D 2NN6C 3WU4A 4FW7A 5C0XE 3T1YI 4JI1E 3UHMA 1HNWI 2VQFE 5K36C 4JI5I 2AE8A 1IBLI 4NXMI 3T1YE 1HNWE 2IESA 1IBLE 4NXME 4UT4A 4AM3A 4X62I 3B82A 4LF8I 1UDSA 2GQ0A 1Z0GA 2HK2A 4X62E 4LF8E 4LPFA 5JEAF 4GKKI 2BA0D 4FN5A 4LCHA 3GONA 1UDOA 4JI8I 4B3SI 4GKKE 3V2UC 3U1KA 4JI8E 3B4TA 1Z5CA 4FW6A 1OYPA 2GS8A 3QT7A 1PIEA 2UUAI 2WP8B 1XHKA 2A2DA 1HK7A 4I3HA 4YHHI 4P7AA 2UUAE 3QT8A 1H7UA 4YHHE 4WUBA 4IFDE 4KQVA 2V2VA 3LPSA 3J7AM 4IZKB 1EI1A 2LJPA 3NZKA 1HR0I 3WU3A 3LNUA 4BA1A 2UXBI 2IOQA 3M7NG 1HR0E 3JAMQ 2UXBE 1HNZI 2BR2A 5EKWA 4OO1A 4LCFA 2O1TA 1H72C 1KKHA 4NXNI 4FW9A 1HNZE 2NN6E 5K36E 4NXNE 4LCGA 1S16A 5FLXC 4X65I 1FWKA 3P76A 2R42A 2HKEA 4OO1F 1XMQI 4X65E 2GO3A 2UU9I 3D4JA 5FWKA 4DR3I 5IT9Q 1XMQE 4RPFA
chains in the Genus database with same CATH topology
3DD6A 4NBQA 1OYRA 4IFDD 2JEBB 2NN6F 4OO1D 5JEAB 2WNRB 2WP8A 5K36F 4IFDC 4OO1C 2C37B 3H1CA 4BA2A 3L7ZB 5JEAE 4AIMA 1OYSA 1E3HA 2C38B 2JE6A 3GCMA 2JEAA 2NN6D 1R6MA 2PO0B 5K36D 3GLLA 2NN6C 3M85D 5C0XE 5K36C 2BA0G 2BR2B 2PO1B 4IFDB 4OO1B 3GMEA 2C39B 4AM3A 1UDNA 2PO2B 1UDSA 3M85G 3CDIA 3HKMA 5C0XA 2PNZB 5JEAF 2BA0D 1UDOA 2NN6B 1R6LA 1UDQA 5K36B 3U1KA 4BA1B 5C0XF 3B4TA 1OYPA 2JEBA 2WNRA 5JEAA 2WP8B 2PO2A 5JEAC 2C37A 4BA2B 5C0XD 3L7ZA 3KRNA 4IFDE 4OO1E 3CDJA 5C0XC 2C38A 2BA1D 2JE6B 2JEAB 4BA1A 2PO0A 1E3PA 3M7NG 2BR2A 2PO1A 4IFDA 4OO1A 2C39A 2BA1G 2NN6E 5JEAD 5K36E 4AIDA 5C0XB 3M7ND 4IFDF 2PNZA 4OO1F 2NN6A 5K36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD6 A;  4NBQ A;  1OYR A;  4IFD D;  2JEB B;  2NN6 F;  4OO1 D;  5JEA B;  2WNR B;  2WP8 A;  5K36 F;  4IFD C;  4OO1 C;  2C37 B;  3H1C A;  4BA2 A;  3L7Z B;  5JEA E;  4AIM A;  1OYS A;  1E3H A;  2C38 B;  2JE6 A;  3GCM A;  2JEA A;  2NN6 D;  1R6M A;  2PO0 B;  5K36 D;  3GLL A;  2NN6 C;  3M85 D;  5C0X E;  5K36 C;  2BA0 G;  2BR2 B;  2PO1 B;  4IFD B;  4OO1 B;  3GME A;  2C39 B;  4AM3 A;  1UDN A;  2PO2 B;  1UDS A;  3M85 G;  3CDI A;  3HKM A;  5C0X A;  2PNZ B;  5JEA F;  2BA0 D;  1UDO A;  2NN6 B;  1R6L A;  1UDQ A;  5K36 B;  3U1K A;  4BA1 B;  5C0X F;  3B4T A;  1OYP A;  2JEB A;  2WNR A;  5JEA A;  2WP8 B;  2PO2 A;  5JEA C;  2C37 A;  4BA2 B;  5C0X D;  3L7Z A;  3KRN A;  4IFD E;  4OO1 E;  3CDJ A;  5C0X C;  2C38 A;  2BA1 D;  2JE6 B;  2JEA B;  4BA1 A;  2PO0 A;  1E3P A;  3M7N G;  2BR2 A;  2PO1 A;  4IFD A;  4OO1 A;  2C39 A;  2BA1 G;  2NN6 E;  5JEA D;  5K36 E;  4AID A;  5C0X B;  3M7N D;  4IFD F;  2PNZ A;  4OO1 F;  2NN6 A;  5K36 A; 
#chains in the Genus database with same CATH topology
 1XNQ I;  4QNJ A;  2Z5C A;  4DR3 E;  1USV A;  1XNQ E;  4URL A;  1PKP A;  1YHC A;  3PS2 A;  2DEJ A;  1USU A;  2NPF A;  3H1C A;  4ED4 A;  4DR7 I;  4DR4 I;  4DR7 E;  1QZR A;  4AIM A;  1NHH A;  3PYF A;  5LMU E;  4HAC A;  3H4L A;  4LFB I;  3GLL A;  4DXL A;  4LFB E;  4AQY I;  2BR2 B;  1Y5Y A;  4OO1 B;  4B3T I;  2V8P A;  4AQY E;  4LOM A;  1XMO I;  4B3T E;  4DPU A;  1ZM2 A;  3CDI A;  1XMO E;  4ISA A;  2AJ4 A;  4LF9 I;  3P3G A;  1R6L A;  5BR8 I;  4LF9 E;  2ZBK B;  3ZZU A;  4HYM A;  4DPX A;  4MU4 A;  2Z5C B;  2O3Z A;  5BR8 E;  1DAR A;  3Q6N A;  4USM A;  5ELW A;  1HNX I;  2JEB A;  2WNR A;  1Z0B A;  5JEA A;  2PO2 A;  1HNX E;  4JI5 E;  5JEA C;  2C37 A;  4DR6 I;  4XTJ A;  1FJG I;  1N32 I;  1NZ0 A;  1H7S A;  3ZM7 A;  1FKA E;  1D6T A;  4DR6 E;  4LF6 I;  1FJG E;  1N32 E;  2Z5B B;  4LF6 E;  1Z0T A;  4HAC B;  4PRX A;  1E3P A;  1OJ4 A;  2UXD I;  4DU7 A;  3J80 C;  4B3S E;  4YY3 I;  1U2R A;  1ZXM A;  2HKJ A;  4QNK A;  2PO1 A;  5IWA I;  2UXD E;  3PYG A;  4DV3 I;  4YY3 E;  5IWA E;  4FW4 A;  4DV3 E;  3PYD A;  1MG7 A;  4N3O A;  3M7N D;  5LMN I;  4IZJ B;  4ZVI A;  5LL6 R;  2VF3 A;  5LMN E;  3J7A G;  2A2C A;  1NHI A;  3Q1Q A;  2X36 A;  1ZM4 A;  3DD6 A;  1K47 A;  4FW5 A;  4NBQ A;  3PRY A;  4JYA I;  5GME A;  1VIS A;  2JT2 A;  1OYR A;  2JEB B;  2HHH I;  4OO1 D;  2WNR B;  5JEA B;  3B78 A;  4JYA E;  4Z7Y A;  4OO1 C;  2OI2 A;  2HHH E;  2C37 B;  4HXZ A;  1FI4 A;  1XXE A;  5JEA E;  4JV5 I;  4MU0 A;  1E3H A;  2JE6 A;  4JI7 I;  2JEA A;  1R6M A;  4MU1 A;  4JV5 E;  3U1Y A;  1Z0V A;  4KHP I;  2UU9 E;  1Z0C A;  3F0N A;  4JI7 E;  4LF4 I;  4P52 A;  2PO1 B;  4KHP E;  2UXC I;  4LF4 E;  1MX0 A;  2XEX A;  4HY1 A;  1KVK A;  2UXC E;  4GQU A;  2CVE A;  4WUC A;  2X7I A;  2V2Z A;  3HKM A;  5C0X A;  1A6F A;  2R3V A;  4DV5 I;  5GMD A;  3P06 A;  2VES A;  1N0V C;  3HJC A;  4DV5 E;  4FW3 A;  4MDT A;  2UUC I;  1UDQ A;  4DR4 E;  3B8H A;  4BA1 B;  5C0X F;  3T1H I;  5DRP A;  1B63 A;  4MU3 A;  2UUC E;  3T1H E;  4IS9 A;  1Z0W A;  2ZIT A;  1NHJ A;  4DV4 I;  4PU9 A;  4WUD A;  1Z59 A;  5L3J A;  2IER A;  4DV4 E;  3L7Z A;  2VQE I;  4IZJ D;  2O1V A;  3WU6 A;  4OO1 E;  3CDJ A;  2JE6 B;  2VQE E;  3ZKB A;  2JEA B;  4Z7C A;  2BM0 A;  1Y4S A;  1I94 I;  1RHY A;  4DV6 I;  4LFA I;  1ZXN A;  1P42 A;  2IOP A;  1I94 E;  4DV6 E;  5DRR A;  4LFA E;  4IFD A;  1Z0E A;  5IT9 C;  4JI2 I;  2C39 A;  5JEA D;  4DV7 I;  4R1F A;  4X66 I;  1Y6Z A;  4JI2 E;  4DUZ I;  2HFU A;  4DV7 E;  4JG4 A;  4X66 E;  5C0X B;  4IFD F;  2PNZ A;  4MQY A;  4DUZ E;  1EA6 A;  4JI0 I;  1ZM3 A;  3LTO A;  2NN6 A;  2PNL A;  4DU8 A;  1RRE A;  1ELO A;  4JI0 E;  5K36 A;  3OTO I;  2BM1 A;  5A2Q C;  1YH8 A;  3OTO E;  5FLX Q;  4DPT A;  4MYU A;  1MU5 A;  4K0K I;  2HK3 A;  4GKJ I;  2NN6 F;  3WU5 A;  1Y60 A;  5K36 F;  4K0K E;  4GKJ E;  4FWH A;  4JI4 I;  4BA2 A;  2BV3 A;  4LF7 I;  3P3E A;  1RR9 A;  3L7Z B;  4JI4 E;  4LF7 E;  1OYS A;  4B3R I;  4U3D A;  3K85 A;  3GCM A;  4DV0 I;  3P3C A;  4DR5 I;  1H74 A;  1Z5A A;  4B3R E;  1FNM A;  5DNL A;  4DV0 E;  3M85 D;  3Q6M A;  4JI3 I;  4DR5 E;  3K1J A;  3J81 C;  3ZZ0 A;  2BA0 G;  3V5R A;  1N36 I;  4IFD B;  4JI3 E;  2E1R A;  2WW4 A;  3GME A;  3QT6 A;  4DPY A;  2C39 B;  1N36 E;  1UDN A;  3CWV A;  2PO2 B;  1N0U A;  2V34 A;  3PS3 A;  4B3M I;  3M85 G;  2F1D A;  4MYT A;  3M6A A;  4DR1 I;  4B3M E;  2PNZ B;  1IBM I;  4EMD A;  4LF5 I;  1Z5B A;  3ZKD A;  4DR1 E;  2NN6 B;  3PS1 A;  1IBM E;  4X64 I;  1XNR I;  4LF5 E;  5K36 B;  4USK A;  2O1W A;  4X64 E;  1XNR E;  1UEK A;  2CZ9 A;  2F4V I;  4BA2 B;  2EFG A;  5C0X D;  3KRN A;  4JI6 I;  5DRQ A;  2V2Q A;  2F4V E;  1WUU A;  2HFS A;  5C0X C;  2C38 A;  2BA1 D;  4JI6 E;  1BKN A;  1PVG A;  2PO0 A;  2Z5E A;  4OKG A;  3HUL A;  1FWL A;  3K17 A;  2BA1 G;  4LFC I;  3ZZT A;  4PRV A;  4OX9 I;  2J7K A;  4FWD A;  1ZM9 A;  4LFC E;  4FWG A;  3JAM C;  4OX9 E;  4AID A;  5A2Q Q;  5LMU I;  2Z5B A;  4M1K A;  1S4E A;  5EL9 A;  3J80 Q;  4DV1 I;  4J3D A;  2CGE A;  4DV1 E;  1J5E I;  3QT5 A;  4UTG A;  2O1U A;  4DV2 I;  2UUB I;  1J5E E;  2PNM A;  2CG9 A;  4DV2 E;  2UUB E;  1B62 A;  1IBK I;  4IFD D;  3PYE A;  1N33 I;  2WP8 A;  2GO4 A;  4U3B A;  4DUY I;  1IBK E;  4IFD C;  1N34 I;  2ZM6 I;  1VI7 A;  2DEI A;  4OZE A;  1N33 E;  4DUY E;  2E5L I;  1H73 A;  1KIJ A;  4IZJ A;  5DNX A;  1N34 E;  2ZM6 E;  4DR2 I;  1KTV A;  3J81 Q;  2J65 A;  2E5L E;  1Y4U A;  5DRO A;  2Q2E B;  4DPW A;  4IZK A;  4DR2 E;  2C38 B;  2NN6 D;  4JI1 I;  2PO0 B;  2VQF I;  5K36 D;  2NN6 C;  3WU4 A;  4FW7 A;  5C0X E;  3T1Y I;  4JI1 E;  3UHM A;  1HNW I;  2VQF E;  5K36 C;  4JI5 I;  2AE8 A;  1IBL I;  4NXM I;  3T1Y E;  1HNW E;  2IES A;  1IBL E;  4NXM E;  4UT4 A;  4AM3 A;  4X62 I;  3B82 A;  4LF8 I;  1UDS A;  2GQ0 A;  1Z0G A;  2HK2 A;  4X62 E;  4LF8 E;  4LPF A;  5JEA F;  4GKK I;  2BA0 D;  4FN5 A;  4LCH A;  3GON A;  1UDO A;  4JI8 I;  4B3S I;  4GKK E;  3V2U C;  3U1K A;  4JI8 E;  3B4T A;  1Z5C A;  4FW6 A;  1OYP A;  2GS8 A;  3QT7 A;  1PIE A;  2UUA I;  2WP8 B;  1XHK A;  2A2D A;  1HK7 A;  4I3H A;  4YHH I;  4P7A A;  2UUA E;  3QT8 A;  1H7U A;  4YHH E;  4WUB A;  4IFD E;  4KQV A;  2V2V A;  3LPS A;  3J7A M;  4IZK B;  1EI1 A;  2LJP A;  3NZK A;  1HR0 I;  3WU3 A;  3LNU A;  4BA1 A;  2UXB I;  2IOQ A;  3M7N G;  1HR0 E;  3JAM Q;  2UXB E;  1HNZ I;  2BR2 A;  5EKW A;  4OO1 A;  4LCF A;  2O1T A;  1H72 C;  1KKH A;  4NXN I;  4FW9 A;  1HNZ E;  2NN6 E;  5K36 E;  4NXN E;  4LCG A;  1S16 A;  5FLX C;  4X65 I;  1FWK A;  3P76 A;  2R42 A;  2HKE A;  4OO1 F;  1XMQ I;  4X65 E;  2GO3 A;  2UU9 I;  3D4J A;  5FWK A;  4DR3 I;  5IT9 Q;  1XMQ E;  4RPF A; 
#chains in the Genus database with same CATH homology
 3DD6 A;  4NBQ A;  1OYR A;  4IFD D;  2JEB B;  2NN6 F;  4OO1 D;  5JEA B;  2WNR B;  2WP8 A;  5K36 F;  4IFD C;  4OO1 C;  2C37 B;  3H1C A;  4BA2 A;  3L7Z B;  5JEA E;  4AIM A;  1OYS A;  1E3H A;  2C38 B;  2JE6 A;  3GCM A;  2JEA A;  2NN6 D;  1R6M A;  2PO0 B;  5K36 D;  3GLL A;  2NN6 C;  3M85 D;  5C0X E;  5K36 C;  2BA0 G;  2BR2 B;  2PO1 B;  4IFD B;  4OO1 B;  3GME A;  2C39 B;  4AM3 A;  1UDN A;  2PO2 B;  1UDS A;  3M85 G;  3CDI A;  3HKM A;  5C0X A;  2PNZ B;  5JEA F;  2BA0 D;  1UDO A;  2NN6 B;  1R6L A;  1UDQ A;  5K36 B;  3U1K A;  4BA1 B;  5C0X F;  3B4T A;  1OYP A;  2JEB A;  2WNR A;  5JEA A;  2WP8 B;  2PO2 A;  5JEA C;  2C37 A;  4BA2 B;  5C0X D;  3L7Z A;  3KRN A;  4IFD E;  4OO1 E;  3CDJ A;  5C0X C;  2C38 A;  2BA1 D;  2JE6 B;  2JEA B;  4BA1 A;  2PO0 A;  1E3P A;  3M7N G;  2BR2 A;  2PO1 A;  4IFD A;  4OO1 A;  2C39 A;  2BA1 G;  2NN6 E;  5JEA D;  5K36 E;  4AID A;  5C0X B;  3M7N D;  4IFD F;  2PNZ A;  4OO1 F;  2NN6 A;  5K36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...