4JI2E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji2E02
2NPFA 4B3RE 1N36E 4AQYE 1XMQI 4DR6E 1OJ4A 3T1HE 3VYYA 2L2KB 4DR3I 4JG4A 2RSMA 4I3HA 2L3JA 2ZITA 4X62I 4LF6E 2UUBE 1KKHA 4NXME 1PIEA 2DEJA 3J7AG 1YYOA 5IT9Q 4OOGC 1H7UA 1Z0BA 2VF3A 3ZKBA 4DR4E 4DV7I 2XEXA 4GKJI 4GKKE 4DR2I 2F4VI 4B3SI 4KHPI 4B3ME 3ZZ0A 4EMDA 2CPNA 5CFFE 1NZ0A 1NHHA 1XMOE 3QT7A 4MYTA 1NHIA 2L2MA 4JI1I 2RS6A 4M2ZA 1N33E 2E5LI 1RR9A 2NUFA 3CWVA 1IBLI 3B8HA 4PRVA 1XMQE 3H4LA 3LPSA 2A2CA 4DPWA 3OTOI 1RC7A 2VQFI 4DV6I 1GQEA 1Z5BA 4DR3E 1N0UA 5A2QQ 1N32I 2LUQA 4X62E 4OX9I 1IBMI 4DR1I 1UILA 1J5EE 1HR0I 2J7KA 1DARA 2JY9A 1WUUA 1BKNA 2EFGA 2V2VA 4DR2E 2F4VE 2CZ9A 1FKAE 4B3SE 1S4EA 4JI5I 4RPFA 2LTSA 1EKZA 4JI1E 3C4TA 3PYFA 1T4NA 3B82A 1Z5CA 3LNUA 4XTJA 1N34I 1RREA 4LF8E 3ZKDA 2DIXA 3WU3A 3QT6A 1O0WA 4LF7I 1ZM4A 5BR8I 3OTOE 2VQFE 3JAMC 5LL6R 3ADIA 4DR7I 4OX9E 4WUDA 1STUA 1IBME 1X48A 1HR0E 1H7SA 4DV3I 2LTRA 3ADGA 4YY3I 4DUZI 4HACB 2E1RA 2YT4A 3V5RA 1RQ0A 2V34A 3ZM7A 1PKPA 4JI5E 2LRSA 1ZM9A 4LF9I 4HYMA 1U2RA 4JI0I 4LF5I 2HHHI 4FW9A 4X8WA 1A6FA 1N34E 4JI8I 4ED4A 1Z0EA 4FN5A 5FLXC 4LF7E 4JI7I 5BR8E 4LF4I 5LMUI 4JI2I 1Z0GA 2MDRA 4DV4E 1I94I 4FWHA 2UU9E 1YYKA 2EZ6A 4X65I 4DV3E 4HXZA 1QU6A 4DUZE 4JI3I 4KQVA 3J81Q 1DI2A 3PYGA 4LF9E 4DU8A 2X36A 4PRXA 1HNZE 4JI0E 4LF5E 2HHHE 1FI4A 3J7Yp 2V8PA 3C4BA 2HK2A 5FLXQ 3ZZUA 4JI7E 4JI6I 4LF4E 1YZ9A 5LMUE 2X7IA 1HNWI 3K17A 4JI2E 4NXNI 1I94E 4X65E 1X49A 2DMYA 3B78A 4DV7E 1S16A 4GKJE 2UUAI 4WYQB 4KHPE 1UHZA 2V2ZA 4JYAI 4DV1I 4R1FA 1Z0WA 1Z0TA 2E5LE 4DV5I 3ADLA 2RS7A 1IBLE 3QT8A 3J80C 3LLHA 1QZRA 1N0VC 3VYXA 2UXDI 1T4OA 4WUCA 3PYEA 2UXCI 4UT4A 4B3TI 4USKA 4K0KI 1HNWE 2RTXA 4DV6E 4NXNE 1N32E 1B63A 3WU5A 4LFBI 4DXLA 5IWAI 1MG7A 2GS8A 1WHQA 2ZM6I 4HACA 4DR1E 4JV5I 4M1KA 1XNRI 2HFUA 4DV2I 4UTGA 4ZVIA 4MYUA 1HNXI 2UUAE 4B3RI 3K1JA 1MU5A 4DV1E 2BM1A 2N3HA 2AJ4A 2BV3A 1K47A 2JVAA 3PYDA 4NXMI 4DUYI 2UXDE 1XNQI 4WFTA 5IT9C 4DR4I 4K0KE 3JAMQ 3D4JA 1FWLA 1KTVA 1J26A 4LFBE 5IWAE 1Z5AA 4DR7E 2ZM6E 3T1YI 1ZM2A 4JV5E 4DPUA 1XNRE 4YY3E 2UUCI 4YHHI 1ZXNA 3ZZTA 1HNXE 1KVKA 2R3VA 2UXBI 3M6AA 2LJHA 3ADJA 3HTXA 4DPYA 2VQEI 4Z7YA 2HKEA 4X66I 2DEIA 4DR5I 5A2QC 2LJPA 4JI8E 1WHNA 4DUYE 1J5EI 1H73A 2HFSA 2IHR1 2KHXA 1XNQE 5L3JA 4X64I 3WU4A 2NUGA 2B3TB 1YYWA 4WUBA 1NHJA 1IBKI 1T4LB 1ELOA 1X47A 3T1YE 1UEKA 1MX0A 4JI3E 2UUCE 3GONA 4YHHE 3F0NA 2L3CA 4M30A 2UXBE 4LF8I 2ZBKB 5GMEA 2LUPB 2VQEE 4X66E 1H72C 2OI2A 2NUEA 4P7AA 4DR5E 1FJGI 1H74A 4LFCI 2NA2A 1ZM3A 2B7TA 1VISA 4DPXA 4X64E 1EI1A 4DV0I 2L2NA 4JI6E 5LMNI 2BM0A 1IBKE 1ZXMA 3WU6A 4LFAI 4JI4I 3HULA 1EA6A 2A2DA 2HKJA 2V2QA 1PVGA 4DKKA 4DU7A 3J7AM 1N36I 4AQYI 5GMDA 4JYAE 4DR6I 2Q2EB 1Z59A 3T1HI 2HK3A 1FJGE 1Z0CA 4LFCE 2LBSB 4DV4I 4USMA 4DV5E 3J80Q 2UU9I 4LF6I 2UUBI 3LTOA 1XHKA 1Z0VA 2L33A 2R42A 3V2UC 2UXCE 4DV0E 5LMNE 4B3TE 2DB2A 3J81C 4GKKI 3Q1QA 4HY1A 1FNMA 1KIJA 2WW4A 4B3MI 4Z7CA 2B7VA 1B62A 4LFAE 1FWKA 1HNZI 4JI4E 3QT5A 1XMOI 4PU9A 4DPTA 1ZBTA 4FWDA 4URLA 1N33I 4DV2E 4FWGA 4P52A 2N3GA 1D6TA 3P1XA
chains in the Genus database with same CATH superfamily
3QG5C 4B3RE 2NPFA 2YTPA 1N36E 4AQYE 4R2EA 1XMQI 3M85D 2EPUA 4DR6E 2FGGA 3AV0A 1OJ4A 2EMAA 4FW4A 2R1FA 3T1HE 2CT1A 3P76A 3VYYA 2M9AA 2L2KB 4GEQB 4DR3I 4JG4A 2RSMA 4LTYA 3EPKA 2EM5A 1A1HA 2L3JA 2JPAA 2BR2A 3K85A 2CG9A 2Z5BA 2PO2A 2ZITA 1BB8A 4X62I 4LF6E 2UUBE 1KKHA 2H36X 4NXME 5IV8B 1PIEA 3J7AG 2DEJA 1Y4SA 2RSIA 1YYOA 5IT9Q 4OOGC 2CTDA 2EPRA 4NHRA 1H7UA 4HTGA 1Z0BA 2EMFA 2VF3A 3ZKBA 4DR4E 4DV7I 2XEXA 2Z5EA 3U1YA 4GKJI 4GKKE 4O43A 4DR2I 2F4VI 2G7HA 1OYPA 4B3SI 4B3ME 4KHPI 2A25A 2PNZA 3ZZ0A 4EMDA 2CPNA 5CFFE 1NZ0A 1UDSA 2EM2A 2EQ1A 1NHHA 4OKGA 5EL9A 1XMOE 3QT7A 4MYTA 1NHIA 2L2MA 3M7ND 2EN2A 3PS1A 4IFDB 1T38A 1XXEA 2PO1B 2Z5CA 2RS6A 4JI1I 2EOHA 4M2ZA 1N33E 1ZAAC 2E5LI 1RR9A 4BA1A 3THNA 2NUFA 2L8TA 2DLKA 3CWVA 1IBLI 2VE7C 4O24A 3GMEA 3B8HA 4PRVA 1XMQE 3H4LA 3LPSA 2AE8A 4Q35B 1E3PA 1R6LA 1X6HA 2K4VA 3TQMA 3RMPA 2A2CA 4DPWA 4N4RB 3OTOI 1RC7A 2VQFI 4DV6I 1GQEA 3C6KA 1Z5BA 4DR3E 4IZJB 1N0UA 4R2SA 2YTQA 3UK3C 4QNKA 5A2QQ 1N32I 5K36B 3BF2A 2LUQA 2HC5A 4P7DA 2PO0B 2N8XA 1A1FA 1KYQA 4X62E 4OO1B 1YFHA 4OX9I 1IBMI 4DR1I 1UILA 1J5EE 1HR0I 4DMIA 1UDNA 2ELYA 2J7KA 4FK5C 2O1WA 1DARA 2JY9A 1WUUA 2EL4A 1AH5A 5JEAC 1BKNA 2EFGA 2O1TA 4X9JA 2V2VA 4DR2E 2F4VE 2GO3A 4U3BA 2CZ9A 1FKAE 4B3SE 4NBQA 5T6JA 1S4EA 1BBGA 4KWYA 3FIGA 4JI5I 3NZKA 4FW6A 4GZNC 4RPFA 2C39A 3BIDA 1GZ6A 2EMKA 2J7JA 2JE6B 4WSPA 2LTSA 5A6BD 2LMZA 3IWDA 2EPCA 1EKZA 4MQYA 4JI1E 4R2QA 2YU8A 3C4TA 3PYFA 1T4NA 3B82A 1Z5CA 3LNUA 4XTJA 1N34I 3P3EA 1RREA 1EH7A 4LF8E 3ZKDA 2DIXA 3WU3A 2WNRB 4F9AB 3QT6A 1OYSA 2JEBA 1O0WA 1PJQA 4LF7I 1ZM4A 2EOIA 5BR8I 2V86A 3OTOE 3JAMC 2VQFE 1LLMC 1UDOA 2C37A 5LL6R 2EOXA 3HPSA 4U3DA 3ADIA 3AUZA 4DR7I 2LO3A 4OX9E 4WUDA 1STUA 1IBME 1X48A 2YZTA 2JOXA 4F9BB 1HR0E 1H7SA 2WZOA 4DV3I 4RH8A 1PJTA 2LTRA 3ADGA 4YY3I 4DUZI 4HACB 2E1RA 2YT4A 3V5RA 1RQ0A 1SR9A 2YTGA 2V34A 5K36C 4BA2A 1A1JA 4IJDA 2YWQA 1G2FC 3ZM7A 1PKPA 2MDGA 4JI5E 3B4TA 2YTNA 5K36F 2KOUA 1HK7A 2LRSA 1DGCA 5A6BA 1ZM9A 4LF9I 4HYMA 1U2RA 5ADZA 2NN6D 2ENAA 4IFDD 4F2JC 1TN9A 4JI0I 5C0XC 2EMGA 5LLQA 2NABA 4X8WA 4FW5A 4FW9A 2HHHI 4LF5I 3JTZA 1A6FA 2E1MA 2EMCA 1N34E 4JI8I 3IWBA 2KONA 4R2DA 4AIMA 4ED4A 1JK2A 1Z0EA 1X5WA 4FN5A 5FLXC 2O1UA 4WPYA 4LF7E 4JI7I 5BR8E 1X6EA 4LF4I 2R76A 4R2PA 2PRTA 4IZJD 5LMUI 5DRRA 4JI2I 2EOJA 1Z0GA 2FV4B 2NN6E 5K36D 4J3DA 2EPNA 3DJWA 2MDRA 1DQ3A 2EMHA 4DV4E 5AE2A 1I94I 4OO1D 3C6MA 1T39A 4FWHA 2UU9E 1YYKA 2EZ6A 4X65I 4DV3E 2LT7A 2WP8B 4HXZA 1QU6A 2EMBA 1IQOA 4DUZE 4JI3I 1WXRA 1RHYA 4KQVA 2EPZA 3J81Q 3KZZA 1DI2A 3L7ZA 2EOQA 3PRYA 1UN6B 3PYGA 3M85G 2NN6F 3GLLA 2NN6A 4LF9E 4IFDF 2F1DA 3EPLA 1A1IA 2X36A 4DU8A 4PRXA 4L5NC 4IFDA 1HNZE 4MLQA 3IWCA 4JI0E 4LF5E 2HHHE 4LCFA 5FWKA 1A1LA 1PJSA 2JR1A 3F6GA 4BC7A 1OYRA 2EOMA 1FI4A 2EOOA 5DNYA 3J7Yp 2V8PA 3C4BA 3VHTB 2Z5BB 2HK2A 1ZU1A 2EM8A 2MKDA 5FLXQ 1UDQA 2EQ0A 4AM3A 3ZZUA 2JYAA 4JI7E 4LU9A 3PS2A 4IZJA 2B9DA 4JI6I 1SFEA 4LF4E 1YZ9A 1IMUA 2EOEA 2L92A 4R2CA 5LMUE 2X7IA 4LCGA 3ZOQB 2PO0A 2EOSA 4GQUA 3K17A 4IZKB 4JI2E 4OO1F 4NXNI 4OO1A 3VK6A 2M7QA 4M0VA 1P47A 5K36A 1I94E 2CVEA 2WBSA 1TF3A 4X65E 3M7NG 1HNWI 1X49A 2EMZA 2DMYA 2GHFA 1B69A 3B78A 2YTIA 3F0NA 2YSOA 3EPHA 2BA1D 3H09A 5DNXA 1USVA 4DV7E 2JT2A 1S16A 2EM7A 4GKJE 1Z1BA 2EN8A 4MU0A 4BA1B 5C0XB 2O1VA 5EKWA 1NCSA 2K7IA 4WYQB 4KHPE 2UUAI 4BMJA 5DRQA 1UBDC 1UHZA 2EN3A 2V2ZA 4JYAI 3HJCA 4DV1I 2DSYA 2IOPA 1QNTA 4FW3A 4R1FA 2EM3A 1Z0WA 1F2IG 2GPIA 2YTJA 3EQ1A 4F6MA 2JWOA 1Z0TA 2E5LE 4DV5I 3ADLA 2WNRA 4N3OA 2RS7A 5KL3A 1IBLE 3J80C 5KL5A 3QT8A 3LLHA 1QZRA 2EM9A 3K6QA 1N0VC 2HJJA 3MHSC 1T4OA 3VYXA 2BA1G 4WUCA 3U1KA 3PYEA 2UXDI 2UXCI 4UT4A 4B3TI 4USKA 4K0KI 3BGHA 2VRDA 4BHCA 1HNWE 3KZYA 2RTXA 4ZYDA 4DV6E 4NXNE 3UHMA 1A1KA 2V88A 4TUIA 5JEAD 4O4KA 4FW7A 1N32E 1B63A 3WU5A 4LFBI 4DXLA 5IWAI 4WXCA 1MG7A 2BBGA 2GS8A 1WHQA 2ZM6I 1ZBQA 4KZSA 2EMIA 4NZVA 2C39B 4HACA 2EPPA 4DR1E 1Y60A 2GO4A 4JV5I 4M1KA 1XNRI 2YTEA 5KL2A 2C38B 2HFUA 2EN6A 1G2DC 4IS1C 2JOBA 5AC5A 4DV2I 2ODRC 4UTGA 4WSGA 4ZVIA 4MYUA 1HNXI 4P78A 2UUAE 4ZYHA 4B3RI 3K1JA 5JEAE 1MU5A 1E3HA 3OMLA 3EPJA 4DV1E 2CSHA 1BBOA 2BM1A 1AAYA 2N3HA 3THOB 5KL4A 2LJUA 2EL5A 2AJ4A 1MGTA 2CGEA 2BV3A 2C37B 1K47A 4MU3A 5JEAB 5DROA 4F54A 2VESA 2HGHA 2JVAA 2JXPA 3PYDA 4NXMI 5F3WA 4DUYI 2ADRA 2WCC3 1GTKA 4R8OA 2UXDE 1YHCA 2IOQA 1XNQI 4WFTA 5IT9C 2J65A 4DR4I 4K0KE 3JAMQ 3GCMA 5JEAF 3KRNA 5JEAA 3D4JA 1FWLA 1A1GA 2M1SA 1KTVA 2YTOA 1PDAA 2BB8A 2ODRD 1J26A 5A69A 1N3GA 4LFBE 5IWAE 1Z5AA 2WP8A 4IFDE 2DLQA 4DR7E 2ZM6E 2M4IA 2V8QB 4WX9A 1ZM2A 4F9CB 4JV5E 4DPUA 3T1YI 1WJPA 1XNRE 5A6AA 4YY3E 2EPMX 2UUCI 5C0XD 4YHHI 1ZXNA 3Q6MA 3ZZTA 2YRHA 2EOFA 2EM4A 1WRJA 2YTFA 1HNXE 1KVKA 2IESA 2R3VA 2UXBI 3M6AA 4AIDA 2Q8UA 2LJHA 3ADJA 3HTXA 4DPYA 2VQEI 4Z7YA 2JEAB 5K36E 4WXDA 4M9VC 2HKEA 4X66I 1L4SA 2DEIA 4LOMA 2PO1A 2LE2A 1YPNA 4BBYA 1R6MA 1MEYC 2EOZA 3HPZA 1VI7A 2MKNA 4OO1E 1KJKA 2VF1A 2IERA 4DR5I 5A2QC 2EPKX 2I9IA 4BS9A 2LJPA 4JI8E 3DD6A 1TF6A 1RMDA 2BR2B 1WHNA 4DUYE 1EH6A 4OZEA 2EMYA 2O3ZA 1H73A 2PO2B 2HFSA 5DNLA 5C0XE 1YUJA 2IHR1 1YH8A 2KHXA 2EN7A 1XNQE 3P06A 4IZKA 5L3JA 2JP9A 4X64I 2EN4A 2EM6A 3WU4A 2NUGA 2V89A 2B3TB 1YYWA 2EE8A 2BA0D 3JU0A 4WUBA 2EQ3A 1NHJA 1IBKI 4HEIA 1T4LB 3L7ZB 1J5EI 1Y6ZA 1ELOA 2YRKA 4IS9A 2WBTA 1X47A 3T1YE 2NN6B 2PNZB 4TUGA 1UEKA 2RPCA 3HXLA 5ELWA 5C0XF 1MX0A 5C0XA 4JI3E 2LVHA 4R2RA 2UUCE 5IXMB 3GONA 4R03A 4YHHE 2LV2A 3M99B 5KL6A 2L3CA 1Y5YA 2EOYA 1NEIA 4M30A 4BHBA 2EORA 5AC4A 2UXBE 2Z5CB 2ZBKB 3CDJA 5GMEA 4LF8I 2JE6A 2LUPB 2GQ0A 2VQEE 2EP3A 4X66E 2BA0G 3P3CA 1H72C 5AE1A 2OI2A 3CDIA 2EM0A 2EPAA 4RHBB 2I13A 2NUEA 1USUA 4LCHA 2EMWA 4P7AA 2F8BA 4DR5E 1H74A 5DRPA 1FJGI 4LFCI 4MLVA 2DRPA 5A6KA 2V83A 2NA2A 4ZYEA 1ZM3A 2B7TA 5AASA 1VISA 2EPOA 2ENCA 5A6JA 1JK1A 4DPXA 4X64E 1EI1A 3HQ1A 4ZYGA 2L2NA 4JI6E 4QNJA 2YRMA 2BM0A 4F6NA 2DGCA 5LMNI 4DV0I 1IQSA 1EH8A 2DMIA 1IBKE 1ZXMA 3F6HA 4MDTA 3HKMA 3LMLA 3WU6A 4LFAI 4I3HA 2C38A 4JI4I 2V85A 3HULA 1EA6A 3P3GA 4O5GA 2A2DA 2HKJA 2GLIA 2EMLA 3PS3A 2V2QA 1PVGA 4R2AA 2EWLA 4BCAA 2L6MA 2D9HA 4DKKA 2NN6C 3H1CA 3ECRA 4DU7A 3J7AM 4IFDC 1N36I 4AQYI 5GMDA 2PNLA 4JYAE 4DR6I 2Q2EB 1Z59A 2MC6A 2JEBB 4I8OA 4Q28A 3DF6A 3T1HI 2YTDA 2EN1A 2RQLA 1FJGE 2HK3A 3BBGA 4MU4A 2EPXA 4BC9A 1Z0CA 2EL6A 4L8NA 4LFCE 2LBSB 4MU1A 4DV4I 4J8ZA 2YSPA 2FTXB 4USMA 4DV5E 3J80Q 2UU9I 4LF6I 2ELZA 2UUBI 3LTOA 1XHKA 2EPLX 1Z0VA 2L33A 4ISAA 2R42A 2YU5A 3V2UC 2UXCE 2YPNA 4DV0E 1P42A 5LMNE 4B3TE 2PNMA 2DB2A 1ZR9A 3MHHC 3Q6NA 3J81C 2JEAA 2MC5A 4OO1C 4GKKI 1X6FA 3Q1QA 4HY1A 2E72A 1YUIA 1FNMA 2WBUA 4LPFA 1KIJA 2WW4A 4B3MI 4BA2B 4Z7CA 2B7VA 1B62A 4LFAE 1FWKA 3KWRA 2EMXA 1HNZI 2EJ4A 1X3CA 4JI4E 3QT5A 1XMOI 2LCEA 3MSWA 5AE3A 5KL7A 1YSAC 3L00A 4PU9A 4DPTA 1ZBTA 2V87A 4FWDA 4URLA 1N33I 1Y4UA 4DV2E 5TSEA 4FWGA 4P52A 2N3GA 2ENHA 1D6TA 3P1XA
chains in the Genus database with same CATH topology
2NPFA 4B3RE 1N36E 4AQYE 1XMQI 4DR6E 2FGGA 3AV0A 1OJ4A 3T1HE 3VYYA 2L2KB 4DR3I 4GEQB 4JG4A 2RSMA 4LTYA 4I3HA 3K85A 2L3JA 2CG9A 2Z5BA 2ZITA 4X62I 4LF6E 2UUBE 1KKHA 2H36X 4NXME 1PIEA 3J7AG 2DEJA 1Y4SA 1YYOA 5IT9Q 4OOGC 1H7UA 1Z0BA 2VF3A 3ZKBA 4DR4E 4DV7I 2XEXA 2Z5EA 4GKJI 4GKKE 4DR2I 2F4VI 2G7HA 4B3SI 4KHPI 4B3ME 3ZZ0A 4EMDA 2CPNA 5CFFE 1NZ0A 1NHHA 1XMOE 3QT7A 4MYTA 1NHIA 2L2MA 2Z5CA 2RS6A 4JI1I 4M2ZA 1N33E 2E5LI 1RR9A 2NUFA 2L8TA 3CWVA 1IBLI 2VE7C 3B8HA 4PRVA 1XMQE 3H4LA 3LPSA 2K4VA 2A2CA 3RMPA 4DPWA 3OTOI 1RC7A 2VQFI 4DV6I 1GQEA 1Z5BA 4IZJB 4DR3E 1N0UA 5A2QQ 1N32I 2LUQA 4P7DA 4X62E 4OX9I 1IBMI 4DR1I 1UILA 1J5EE 1HR0I 4DMIA 2J7KA 2O1WA 1DARA 2JY9A 1WUUA 1BKNA 2EFGA 2O1TA 2V2VA 4DR2E 2F4VE 2CZ9A 1FKAE 4B3SE 5T6JA 1S4EA 3FIGA 4JI5I 4RPFA 1GZ6A 4WSPA 2LTSA 2LMZA 3IWDA 1EKZA 4JI1E 3C4TA 3PYFA 1T4NA 3B82A 1Z5CA 3LNUA 4XTJA 1N34I 1RREA 4LF8E 3ZKDA 2DIXA 3WU3A 4F9AB 3QT6A 1O0WA 4LF7I 1ZM4A 5BR8I 2V86A 3OTOE 3JAMC 2VQFE 5LL6R 3HPSA 3ADIA 3AUZA 4DR7I 4OX9E 4WUDA 1STUA 1IBME 1X48A 2YZTA 2JOXA 4F9BB 1HR0E 1H7SA 2WZOA 4DV3I 2LTRA 3ADGA 4YY3I 4DUZI 4HACB 2E1RA 2YT4A 3V5RA 1RQ0A 1SR9A 2V34A 3ZM7A 1PKPA 4JI5E 2KOUA 1HK7A 2LRSA 1ZM9A 4LF9I 4HYMA 1U2RA 5ADZA 4JI0I 4LF5I 2HHHI 4FW9A 4X8WA 3JTZA 1A6FA 2E1MA 1N34E 4JI8I 3IWBA 2KONA 4ED4A 1Z0EA 4FN5A 5FLXC 2O1UA 4WPYA 4LF7E 4JI7I 5BR8E 4LF4I 4IZJD 5LMUI 4JI2I 1Z0GA 2FV4B 3DJWA 2MDRA 1DQ3A 4DV4E 1I94I 5AE2A 4FWHA 2UU9E 1YYKA 2EZ6A 4X65I 4DV3E 4HXZA 1QU6A 4DUZE 4JI3I 1WXRA 4KQVA 3J81Q 1DI2A 3PRYA 3PYGA 4LF9E 4DU8A 2X36A 4PRXA 4L5NC 1HNZE 3IWCA 4JI0E 4LF5E 2HHHE 5FWKA 2JR1A 3F6GA 4BC7A 1FI4A 5DNYA 3J7Yp 2V8PA 3C4BA 2Z5BB 2HK2A 5FLXQ 3ZZUA 4JI7E 4LU9A 4IZJA 2B9DA 4JI6I 4LF4E 1YZ9A 5LMUE 2L92A 2X7IA 3ZOQB 1HNWI 4IZKB 3K17A 4JI2E 4NXNI 3VK6A 2M7QA 4M0VA 1I94E 4X65E 1X49A 2DMYA 3B78A 3H09A 1USVA 4DV7E 1S16A 4GKJE 2O1VA 2UUAI 4WYQB 4KHPE 4BMJA 1UHZA 2V2ZA 4JYAI 3HJCA 4DV1I 2DSYA 2IOPA 4R1FA 1Z0WA 2JWOA 1Z0TA 2E5LE 4DV5I 3ADLA 4N3OA 2RS7A 1IBLE 3J80C 3QT8A 3LLHA 1QZRA 3K6QA 1N0VC 3VYXA 2UXDI 1T4OA 4WUCA 3PYEA 2UXCI 4UT4A 4B3TI 4USKA 4K0KI 1HNWE 2RTXA 4DV6E 4NXNE 2V88A 4TUIA 1N32E 1B63A 3WU5A 4LFBI 4DXLA 5IWAI 1MG7A 2GS8A 1WHQA 2ZM6I 1ZBQA 4KZSA 4HACA 4DR1E 4JV5I 4M1KA 1XNRI 2HFUA 2JOBA 4DV2I 2ODRC 4UTGA 4ZVIA 4MYUA 1HNXI 4P78A 2UUAE 4B3RI 3K1JA 1MU5A 3OMLA 4DV1E 2BM1A 2N3HA 2AJ4A 2CGEA 2BV3A 1K47A 4F54A 2JVAA 3PYDA 4NXMI 5F3WA 4DUYI 2UXDE 4R8OA 2IOQA 1XNQI 4WFTA 5IT9C 4DR4I 4K0KE 3JAMQ 3D4JA 1FWLA 2M1SA 1KTVA 2ODRD 1J26A 4LFBE 5IWAE 1Z5AA 4DR7E 2ZM6E 2M4IA 2V8QB 1ZM2A 3T1YI 4F9CB 4JV5E 4DPUA 1XNRE 4YY3E 2UUCI 4YHHI 1ZXNA 3Q6MA 3ZZTA 1HNXE 1KVKA 2R3VA 2UXBI 3M6AA 2LJHA 3ADJA 3HTXA 4DPYA 2VQEI 4Z7YA 2HKEA 4X66I 2DEIA 2LE2A 4BBYA 3HPZA 2VF1A 4DR5I 5A2QC 4BS9A 2LJPA 4JI8E 1WHNA 4DUYE 1J5EI 1H73A 2HFSA 2IHR1 3P06A 2KHXA 1XNQE 5L3JA 4IZKA 4X64I 3WU4A 2NUGA 2V89A 2B3TB 1YYWA 3JU0A 4WUBA 1NHJA 1IBKI 1T4LB 1Y6ZA 1ELOA 1X47A 3T1YE 4TUGA 1UEKA 3HXLA 1MX0A 4JI3E 2UUCE 3GONA 4R03A 4YHHE 3F0NA 2L3CA 2Z5CB 4M30A 2UXBE 4LF8I 2ZBKB 5GMEA 2LUPB 2GQ0A 2VQEE 4X66E 1H72C 5AE1A 2OI2A 2NUEA 1USUA 4P7AA 2F8BA 4DR5E 1H74A 1FJGI 4LFCI 2V83A 2NA2A 1ZM3A 2B7TA 5AASA 1VISA 4DPXA 4X64E 1EI1A 3HQ1A 4DV0I 2L2NA 4JI6E 5LMNI 2BM0A 1IBKE 1ZXMA 3F6HA 3LMLA 3WU6A 4LFAI 4JI4I 2V85A 3HULA 1EA6A 2A2DA 2HKJA 2V2QA 1PVGA 2EWLA 4BCAA 2L6MA 4DKKA 4DU7A 3J7AM 1N36I 4AQYI 5GMDA 2PNLA 4JYAE 4DR6I 2Q2EB 1Z59A 2MC6A 4I8OA 4Q28A 3DF6A 3T1HI 2HK3A 1FJGE 4BC9A 1Z0CA 4L8NA 4LFCE 2LBSB 4DV4I 4J8ZA 2FTXB 4USMA 4DV5E 3J80Q 2UU9I 4LF6I 2UUBI 3LTOA 1XHKA 1Z0VA 2L33A 2R42A 3V2UC 2UXCE 4DV0E 5LMNE 4B3TE 2PNMA 2DB2A 3Q6NA 3J81C 2MC5A 4GKKI 3Q1QA 4HY1A 1FNMA 1KIJA 2WW4A 4B3MI 4Z7CA 2B7VA 1B62A 4LFAE 1FWKA 3KWRA 1HNZI 4JI4E 3QT5A 1XMOI 3MSWA 5AE3A 4PU9A 4DPTA 1ZBTA 2V87A 4FWDA 4URLA 1N33I 1Y4UA 4DV2E 4FWGA 4P52A 2N3GA 1D6TA 3P1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPF A;  4B3R E;  1N36 E;  4AQY E;  1XMQ I;  4DR6 E;  1OJ4 A;  3T1H E;  3VYY A;  2L2K B;  4DR3 I;  4JG4 A;  2RSM A;  4I3H A;  2L3J A;  2ZIT A;  4X62 I;  4LF6 E;  2UUB E;  1KKH A;  4NXM E;  1PIE A;  2DEJ A;  3J7A G;  1YYO A;  5IT9 Q;  4OOG C;  1H7U A;  1Z0B A;  2VF3 A;  3ZKB A;  4DR4 E;  4DV7 I;  2XEX A;  4GKJ I;  4GKK E;  4DR2 I;  2F4V I;  4B3S I;  4KHP I;  4B3M E;  3ZZ0 A;  4EMD A;  2CPN A;  5CFF E;  1NZ0 A;  1NHH A;  1XMO E;  3QT7 A;  4MYT A;  1NHI A;  2L2M A;  4JI1 I;  2RS6 A;  4M2Z A;  1N33 E;  2E5L I;  1RR9 A;  2NUF A;  3CWV A;  1IBL I;  3B8H A;  4PRV A;  1XMQ E;  3H4L A;  3LPS A;  2A2C A;  4DPW A;  3OTO I;  1RC7 A;  2VQF I;  4DV6 I;  1GQE A;  1Z5B A;  4DR3 E;  1N0U A;  5A2Q Q;  1N32 I;  2LUQ A;  4X62 E;  4OX9 I;  1IBM I;  4DR1 I;  1UIL A;  1J5E E;  1HR0 I;  2J7K A;  1DAR A;  2JY9 A;  1WUU A;  1BKN A;  2EFG A;  2V2V A;  4DR2 E;  2F4V E;  2CZ9 A;  1FKA E;  4B3S E;  1S4E A;  4JI5 I;  4RPF A;  2LTS A;  1EKZ A;  4JI1 E;  3C4T A;  3PYF A;  1T4N A;  3B82 A;  1Z5C A;  3LNU A;  4XTJ A;  1N34 I;  1RRE A;  4LF8 E;  3ZKD A;  2DIX A;  3WU3 A;  3QT6 A;  1O0W A;  4LF7 I;  1ZM4 A;  5BR8 I;  3OTO E;  2VQF E;  3JAM C;  5LL6 R;  3ADI A;  4DR7 I;  4OX9 E;  4WUD A;  1STU A;  1IBM E;  1X48 A;  1HR0 E;  1H7S A;  4DV3 I;  2LTR A;  3ADG A;  4YY3 I;  4DUZ I;  4HAC B;  2E1R A;  2YT4 A;  3V5R A;  1RQ0 A;  2V34 A;  3ZM7 A;  1PKP A;  4JI5 E;  2LRS A;  1ZM9 A;  4LF9 I;  4HYM A;  1U2R A;  4JI0 I;  4LF5 I;  2HHH I;  4FW9 A;  4X8W A;  1A6F A;  1N34 E;  4JI8 I;  4ED4 A;  1Z0E A;  4FN5 A;  5FLX C;  4LF7 E;  4JI7 I;  5BR8 E;  4LF4 I;  5LMU I;  4JI2 I;  1Z0G A;  2MDR A;  4DV4 E;  1I94 I;  4FWH A;  2UU9 E;  1YYK A;  2EZ6 A;  4X65 I;  4DV3 E;  4HXZ A;  1QU6 A;  4DUZ E;  4JI3 I;  4KQV A;  3J81 Q;  1DI2 A;  3PYG A;  4LF9 E;  4DU8 A;  2X36 A;  4PRX A;  1HNZ E;  4JI0 E;  4LF5 E;  2HHH E;  1FI4 A;  3J7Y p;  2V8P A;  3C4B A;  2HK2 A;  5FLX Q;  3ZZU A;  4JI7 E;  4JI6 I;  4LF4 E;  1YZ9 A;  5LMU E;  2X7I A;  1HNW I;  3K17 A;  4JI2 E;  4NXN I;  1I94 E;  4X65 E;  1X49 A;  2DMY A;  3B78 A;  4DV7 E;  1S16 A;  4GKJ E;  2UUA I;  4WYQ B;  4KHP E;  1UHZ A;  2V2Z A;  4JYA I;  4DV1 I;  4R1F A;  1Z0W A;  1Z0T A;  2E5L E;  4DV5 I;  3ADL A;  2RS7 A;  1IBL E;  3QT8 A;  3J80 C;  3LLH A;  1QZR A;  1N0V C;  3VYX A;  2UXD I;  1T4O A;  4WUC A;  3PYE A;  2UXC I;  4UT4 A;  4B3T I;  4USK A;  4K0K I;  1HNW E;  2RTX A;  4DV6 E;  4NXN E;  1N32 E;  1B63 A;  3WU5 A;  4LFB I;  4DXL A;  5IWA I;  1MG7 A;  2GS8 A;  1WHQ A;  2ZM6 I;  4HAC A;  4DR1 E;  4JV5 I;  4M1K A;  1XNR I;  2HFU A;  4DV2 I;  4UTG A;  4ZVI A;  4MYU A;  1HNX I;  2UUA E;  4B3R I;  3K1J A;  1MU5 A;  4DV1 E;  2BM1 A;  2N3H A;  2AJ4 A;  2BV3 A;  1K47 A;  2JVA A;  3PYD A;  4NXM I;  4DUY I;  2UXD E;  1XNQ I;  4WFT A;  5IT9 C;  4DR4 I;  4K0K E;  3JAM Q;  3D4J A;  1FWL A;  1KTV A;  1J26 A;  4LFB E;  5IWA E;  1Z5A A;  4DR7 E;  2ZM6 E;  3T1Y I;  1ZM2 A;  4JV5 E;  4DPU A;  1XNR E;  4YY3 E;  2UUC I;  4YHH I;  1ZXN A;  3ZZT A;  1HNX E;  1KVK A;  2R3V A;  2UXB I;  3M6A A;  2LJH A;  3ADJ A;  3HTX A;  4DPY A;  2VQE I;  4Z7Y A;  2HKE A;  4X66 I;  2DEI A;  4DR5 I;  5A2Q C;  2LJP A;  4JI8 E;  1WHN A;  4DUY E;  1J5E I;  1H73 A;  2HFS A;  2IHR 1;  2KHX A;  1XNQ E;  5L3J A;  4X64 I;  3WU4 A;  2NUG A;  2B3T B;  1YYW A;  4WUB A;  1NHJ A;  1IBK I;  1T4L B;  1ELO A;  1X47 A;  3T1Y E;  1UEK A;  1MX0 A;  4JI3 E;  2UUC E;  3GON A;  4YHH E;  3F0N A;  2L3C A;  4M30 A;  2UXB E;  4LF8 I;  2ZBK B;  5GME A;  2LUP B;  2VQE E;  4X66 E;  1H72 C;  2OI2 A;  2NUE A;  4P7A A;  4DR5 E;  1FJG I;  1H74 A;  4LFC I;  2NA2 A;  1ZM3 A;  2B7T A;  1VIS A;  4DPX A;  4X64 E;  1EI1 A;  4DV0 I;  2L2N A;  4JI6 E;  5LMN I;  2BM0 A;  1IBK E;  1ZXM A;  3WU6 A;  4LFA I;  4JI4 I;  3HUL A;  1EA6 A;  2A2D A;  2HKJ A;  2V2Q A;  1PVG A;  4DKK A;  4DU7 A;  3J7A M;  1N36 I;  4AQY I;  5GMD A;  4JYA E;  4DR6 I;  2Q2E B;  1Z59 A;  3T1H I;  2HK3 A;  1FJG E;  1Z0C A;  4LFC E;  2LBS B;  4DV4 I;  4USM A;  4DV5 E;  3J80 Q;  2UU9 I;  4LF6 I;  2UUB I;  3LTO A;  1XHK A;  1Z0V A;  2L33 A;  2R42 A;  3V2U C;  2UXC E;  4DV0 E;  5LMN E;  4B3T E;  2DB2 A;  3J81 C;  4GKK I;  3Q1Q A;  4HY1 A;  1FNM A;  1KIJ A;  2WW4 A;  4B3M I;  4Z7C A;  2B7V A;  1B62 A;  4LFA E;  1FWK A;  1HNZ I;  4JI4 E;  3QT5 A;  1XMO I;  4PU9 A;  4DPT A;  1ZBT A;  4FWD A;  4URL A;  1N33 I;  4DV2 E;  4FWG A;  4P52 A;  2N3G A;  1D6T A;  3P1X A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  4B3R E;  2NPF A;  2YTP A;  1N36 E;  4AQY E;  4R2E A;  1XMQ I;  3M85 D;  2EPU A;  4DR6 E;  2FGG A;  3AV0 A;  1OJ4 A;  2EMA A;  4FW4 A;  2R1F A;  3T1H E;  2CT1 A;  3P76 A;  3VYY A;  2M9A A;  2L2K B;  4GEQ B;  4DR3 I;  4JG4 A;  2RSM A;  4LTY A;  3EPK A;  2EM5 A;  1A1H A;  2L3J A;  2JPA A;  2BR2 A;  3K85 A;  2CG9 A;  2Z5B A;  2PO2 A;  2ZIT A;  1BB8 A;  4X62 I;  4LF6 E;  2UUB E;  1KKH A;  2H36 X;  4NXM E;  5IV8 B;  1PIE A;  3J7A G;  2DEJ A;  1Y4S A;  2RSI A;  1YYO A;  5IT9 Q;  4OOG C;  2CTD A;  2EPR A;  4NHR A;  1H7U A;  4HTG A;  1Z0B A;  2EMF A;  2VF3 A;  3ZKB A;  4DR4 E;  4DV7 I;  2XEX A;  2Z5E A;  3U1Y A;  4GKJ I;  4GKK E;  4O43 A;  4DR2 I;  2F4V I;  2G7H A;  1OYP A;  4B3S I;  4B3M E;  4KHP I;  2A25 A;  2PNZ A;  3ZZ0 A;  4EMD A;  2CPN A;  5CFF E;  1NZ0 A;  1UDS A;  2EM2 A;  2EQ1 A;  1NHH A;  4OKG A;  5EL9 A;  1XMO E;  3QT7 A;  4MYT A;  1NHI A;  2L2M A;  3M7N D;  2EN2 A;  3PS1 A;  4IFD B;  1T38 A;  1XXE A;  2PO1 B;  2Z5C A;  2RS6 A;  4JI1 I;  2EOH A;  4M2Z A;  1N33 E;  1ZAA C;  2E5L I;  1RR9 A;  4BA1 A;  3THN A;  2NUF A;  2L8T A;  2DLK A;  3CWV A;  1IBL I;  2VE7 C;  4O24 A;  3GME A;  3B8H A;  4PRV A;  1XMQ E;  3H4L A;  3LPS A;  2AE8 A;  4Q35 B;  1E3P A;  1R6L A;  1X6H A;  2K4V A;  3TQM A;  3RMP A;  2A2C A;  4DPW A;  4N4R B;  3OTO I;  1RC7 A;  2VQF I;  4DV6 I;  1GQE A;  3C6K A;  1Z5B A;  4DR3 E;  4IZJ B;  1N0U A;  4R2S A;  2YTQ A;  3UK3 C;  4QNK A;  5A2Q Q;  1N32 I;  5K36 B;  3BF2 A;  2LUQ A;  2HC5 A;  4P7D A;  2PO0 B;  2N8X A;  1A1F A;  1KYQ A;  4X62 E;  4OO1 B;  1YFH A;  4OX9 I;  1IBM I;  4DR1 I;  1UIL A;  1J5E E;  1HR0 I;  4DMI A;  1UDN A;  2ELY A;  2J7K A;  4FK5 C;  2O1W A;  1DAR A;  2JY9 A;  1WUU A;  2EL4 A;  1AH5 A;  5JEA C;  1BKN A;  2EFG A;  2O1T A;  4X9J A;  2V2V A;  4DR2 E;  2F4V E;  2GO3 A;  4U3B A;  2CZ9 A;  1FKA E;  4B3S E;  4NBQ A;  5T6J A;  1S4E A;  1BBG A;  4KWY A;  3FIG A;  4JI5 I;  3NZK A;  4FW6 A;  4GZN C;  4RPF A;  2C39 A;  3BID A;  1GZ6 A;  2EMK A;  2J7J A;  2JE6 B;  4WSP A;  2LTS A;  5A6B D;  2LMZ A;  3IWD A;  2EPC A;  1EKZ A;  4MQY A;  4JI1 E;  4R2Q A;  2YU8 A;  3C4T A;  3PYF A;  1T4N A;  3B82 A;  1Z5C A;  3LNU A;  4XTJ A;  1N34 I;  3P3E A;  1RRE A;  1EH7 A;  4LF8 E;  3ZKD A;  2DIX A;  3WU3 A;  2WNR B;  4F9A B;  3QT6 A;  1OYS A;  2JEB A;  1O0W A;  1PJQ A;  4LF7 I;  1ZM4 A;  2EOI A;  5BR8 I;  2V86 A;  3OTO E;  3JAM C;  2VQF E;  1LLM C;  1UDO A;  2C37 A;  5LL6 R;  2EOX A;  3HPS A;  4U3D A;  3ADI A;  3AUZ A;  4DR7 I;  2LO3 A;  4OX9 E;  4WUD A;  1STU A;  1IBM E;  1X48 A;  2YZT A;  2JOX A;  4F9B B;  1HR0 E;  1H7S A;  2WZO A;  4DV3 I;  4RH8 A;  1PJT A;  2LTR A;  3ADG A;  4YY3 I;  4DUZ I;  4HAC B;  2E1R A;  2YT4 A;  3V5R A;  1RQ0 A;  1SR9 A;  2YTG A;  2V34 A;  5K36 C;  4BA2 A;  1A1J A;  4IJD A;  2YWQ A;  1G2F C;  3ZM7 A;  1PKP A;  2MDG A;  4JI5 E;  3B4T A;  2YTN A;  5K36 F;  2KOU A;  1HK7 A;  2LRS A;  1DGC A;  5A6B A;  1ZM9 A;  4LF9 I;  4HYM A;  1U2R A;  5ADZ A;  2NN6 D;  2ENA A;  4IFD D;  4F2J C;  1TN9 A;  4JI0 I;  5C0X C;  2EMG A;  5LLQ A;  2NAB A;  4X8W A;  4FW5 A;  4FW9 A;  2HHH I;  4LF5 I;  3JTZ A;  1A6F A;  2E1M A;  2EMC A;  1N34 E;  4JI8 I;  3IWB A;  2KON A;  4R2D A;  4AIM A;  4ED4 A;  1JK2 A;  1Z0E A;  1X5W A;  4FN5 A;  5FLX C;  2O1U A;  4WPY A;  4LF7 E;  4JI7 I;  5BR8 E;  1X6E A;  4LF4 I;  2R76 A;  4R2P A;  2PRT A;  4IZJ D;  5LMU I;  5DRR A;  4JI2 I;  2EOJ A;  1Z0G A;  2FV4 B;  2NN6 E;  5K36 D;  4J3D A;  2EPN A;  3DJW A;  2MDR A;  1DQ3 A;  2EMH A;  4DV4 E;  5AE2 A;  1I94 I;  4OO1 D;  3C6M A;  1T39 A;  4FWH A;  2UU9 E;  1YYK A;  2EZ6 A;  4X65 I;  4DV3 E;  2LT7 A;  2WP8 B;  4HXZ A;  1QU6 A;  2EMB A;  1IQO A;  4DUZ E;  4JI3 I;  1WXR A;  1RHY A;  4KQV A;  2EPZ A;  3J81 Q;  3KZZ A;  1DI2 A;  3L7Z A;  2EOQ A;  3PRY A;  1UN6 B;  3PYG A;  3M85 G;  2NN6 F;  3GLL A;  2NN6 A;  4LF9 E;  4IFD F;  2F1D A;  3EPL A;  1A1I A;  2X36 A;  4DU8 A;  4PRX A;  4L5N C;  4IFD A;  1HNZ E;  4MLQ A;  3IWC A;  4JI0 E;  4LF5 E;  2HHH E;  4LCF A;  5FWK A;  1A1L A;  1PJS A;  2JR1 A;  3F6G A;  4BC7 A;  1OYR A;  2EOM A;  1FI4 A;  2EOO A;  5DNY A;  3J7Y p;  2V8P A;  3C4B A;  3VHT B;  2Z5B B;  2HK2 A;  1ZU1 A;  2EM8 A;  2MKD A;  5FLX Q;  1UDQ A;  2EQ0 A;  4AM3 A;  3ZZU A;  2JYA A;  4JI7 E;  4LU9 A;  3PS2 A;  4IZJ A;  2B9D A;  4JI6 I;  1SFE A;  4LF4 E;  1YZ9 A;  1IMU A;  2EOE A;  2L92 A;  4R2C A;  5LMU E;  2X7I A;  4LCG A;  3ZOQ B;  2PO0 A;  2EOS A;  4GQU A;  3K17 A;  4IZK B;  4JI2 E;  4OO1 F;  4NXN I;  4OO1 A;  3VK6 A;  2M7Q A;  4M0V A;  1P47 A;  5K36 A;  1I94 E;  2CVE A;  2WBS A;  1TF3 A;  4X65 E;  3M7N G;  1HNW I;  1X49 A;  2EMZ A;  2DMY A;  2GHF A;  1B69 A;  3B78 A;  2YTI A;  3F0N A;  2YSO A;  3EPH A;  2BA1 D;  3H09 A;  5DNX A;  1USV A;  4DV7 E;  2JT2 A;  1S16 A;  2EM7 A;  4GKJ E;  1Z1B A;  2EN8 A;  4MU0 A;  4BA1 B;  5C0X B;  2O1V A;  5EKW A;  1NCS A;  2K7I A;  4WYQ B;  4KHP E;  2UUA I;  4BMJ A;  5DRQ A;  1UBD C;  1UHZ A;  2EN3 A;  2V2Z A;  4JYA I;  3HJC A;  4DV1 I;  2DSY A;  2IOP A;  1QNT A;  4FW3 A;  4R1F A;  2EM3 A;  1Z0W A;  1F2I G;  2GPI A;  2YTJ A;  3EQ1 A;  4F6M A;  2JWO A;  1Z0T A;  2E5L E;  4DV5 I;  3ADL A;  2WNR A;  4N3O A;  2RS7 A;  5KL3 A;  1IBL E;  3J80 C;  5KL5 A;  3QT8 A;  3LLH A;  1QZR A;  2EM9 A;  3K6Q A;  1N0V C;  2HJJ A;  3MHS C;  1T4O A;  3VYX A;  2BA1 G;  4WUC A;  3U1K A;  3PYE A;  2UXD I;  2UXC I;  4UT4 A;  4B3T I;  4USK A;  4K0K I;  3BGH A;  2VRD A;  4BHC A;  1HNW E;  3KZY A;  2RTX A;  4ZYD A;  4DV6 E;  4NXN E;  3UHM A;  1A1K A;  2V88 A;  4TUI A;  5JEA D;  4O4K A;  4FW7 A;  1N32 E;  1B63 A;  3WU5 A;  4LFB I;  4DXL A;  5IWA I;  4WXC A;  1MG7 A;  2BBG A;  2GS8 A;  1WHQ A;  2ZM6 I;  1ZBQ A;  4KZS A;  2EMI A;  4NZV A;  2C39 B;  4HAC A;  2EPP A;  4DR1 E;  1Y60 A;  2GO4 A;  4JV5 I;  4M1K A;  1XNR I;  2YTE A;  5KL2 A;  2C38 B;  2HFU A;  2EN6 A;  1G2D C;  4IS1 C;  2JOB A;  5AC5 A;  4DV2 I;  2ODR C;  4UTG A;  4WSG A;  4ZVI A;  4MYU A;  1HNX I;  4P78 A;  2UUA E;  4ZYH A;  4B3R I;  3K1J A;  5JEA E;  1MU5 A;  1E3H A;  3OML A;  3EPJ A;  4DV1 E;  2CSH A;  1BBO A;  2BM1 A;  1AAY A;  2N3H A;  3THO B;  5KL4 A;  2LJU A;  2EL5 A;  2AJ4 A;  1MGT A;  2CGE A;  2BV3 A;  2C37 B;  1K47 A;  4MU3 A;  5JEA B;  5DRO A;  4F54 A;  2VES A;  2HGH A;  2JVA A;  2JXP A;  3PYD A;  4NXM I;  5F3W A;  4DUY I;  2ADR A;  2WCC 3;  1GTK A;  4R8O A;  2UXD E;  1YHC A;  2IOQ A;  1XNQ I;  4WFT A;  5IT9 C;  2J65 A;  4DR4 I;  4K0K E;  3JAM Q;  3GCM A;  5JEA F;  3KRN A;  5JEA A;  3D4J A;  1FWL A;  1A1G A;  2M1S A;  1KTV A;  2YTO A;  1PDA A;  2BB8 A;  2ODR D;  1J26 A;  5A69 A;  1N3G A;  4LFB E;  5IWA E;  1Z5A A;  2WP8 A;  4IFD E;  2DLQ A;  4DR7 E;  2ZM6 E;  2M4I A;  2V8Q B;  4WX9 A;  1ZM2 A;  4F9C B;  4JV5 E;  4DPU A;  3T1Y I;  1WJP A;  1XNR E;  5A6A A;  4YY3 E;  2EPM X;  2UUC I;  5C0X D;  4YHH I;  1ZXN A;  3Q6M A;  3ZZT A;  2YRH A;  2EOF A;  2EM4 A;  1WRJ A;  2YTF A;  1HNX E;  1KVK A;  2IES A;  2R3V A;  2UXB I;  3M6A A;  4AID A;  2Q8U A;  2LJH A;  3ADJ A;  3HTX A;  4DPY A;  2VQE I;  4Z7Y A;  2JEA B;  5K36 E;  4WXD A;  4M9V C;  2HKE A;  4X66 I;  1L4S A;  2DEI A;  4LOM A;  2PO1 A;  2LE2 A;  1YPN A;  4BBY A;  1R6M A;  1MEY C;  2EOZ A;  3HPZ A;  1VI7 A;  2MKN A;  4OO1 E;  1KJK A;  2VF1 A;  2IER A;  4DR5 I;  5A2Q C;  2EPK X;  2I9I A;  4BS9 A;  2LJP A;  4JI8 E;  3DD6 A;  1TF6 A;  1RMD A;  2BR2 B;  1WHN A;  4DUY E;  1EH6 A;  4OZE A;  2EMY A;  2O3Z A;  1H73 A;  2PO2 B;  2HFS A;  5DNL A;  5C0X E;  1YUJ A;  2IHR 1;  1YH8 A;  2KHX A;  2EN7 A;  1XNQ E;  3P06 A;  4IZK A;  5L3J A;  2JP9 A;  4X64 I;  2EN4 A;  2EM6 A;  3WU4 A;  2NUG A;  2V89 A;  2B3T B;  1YYW A;  2EE8 A;  2BA0 D;  3JU0 A;  4WUB A;  2EQ3 A;  1NHJ A;  1IBK I;  4HEI A;  1T4L B;  3L7Z B;  1J5E I;  1Y6Z A;  1ELO A;  2YRK A;  4IS9 A;  2WBT A;  1X47 A;  3T1Y E;  2NN6 B;  2PNZ B;  4TUG A;  1UEK A;  2RPC A;  3HXL A;  5ELW A;  5C0X F;  1MX0 A;  5C0X A;  4JI3 E;  2LVH A;  4R2R A;  2UUC E;  5IXM B;  3GON A;  4R03 A;  4YHH E;  2LV2 A;  3M99 B;  5KL6 A;  2L3C A;  1Y5Y A;  2EOY A;  1NEI A;  4M30 A;  4BHB A;  2EOR A;  5AC4 A;  2UXB E;  2Z5C B;  2ZBK B;  3CDJ A;  5GME A;  4LF8 I;  2JE6 A;  2LUP B;  2GQ0 A;  2VQE E;  2EP3 A;  4X66 E;  2BA0 G;  3P3C A;  1H72 C;  5AE1 A;  2OI2 A;  3CDI A;  2EM0 A;  2EPA A;  4RHB B;  2I13 A;  2NUE A;  1USU A;  4LCH A;  2EMW A;  4P7A A;  2F8B A;  4DR5 E;  1H74 A;  5DRP A;  1FJG I;  4LFC I;  4MLV A;  2DRP A;  5A6K A;  2V83 A;  2NA2 A;  4ZYE A;  1ZM3 A;  2B7T A;  5AAS A;  1VIS A;  2EPO A;  2ENC A;  5A6J A;  1JK1 A;  4DPX A;  4X64 E;  1EI1 A;  3HQ1 A;  4ZYG A;  2L2N A;  4JI6 E;  4QNJ A;  2YRM A;  2BM0 A;  4F6N A;  2DGC A;  5LMN I;  4DV0 I;  1IQS A;  1EH8 A;  2DMI A;  1IBK E;  1ZXM A;  3F6H A;  4MDT A;  3HKM A;  3LML A;  3WU6 A;  4LFA I;  4I3H A;  2C38 A;  4JI4 I;  2V85 A;  3HUL A;  1EA6 A;  3P3G A;  4O5G A;  2A2D A;  2HKJ A;  2GLI A;  2EML A;  3PS3 A;  2V2Q A;  1PVG A;  4R2A A;  2EWL A;  4BCA A;  2L6M A;  2D9H A;  4DKK A;  2NN6 C;  3H1C A;  3ECR A;  4DU7 A;  3J7A M;  4IFD C;  1N36 I;  4AQY I;  5GMD A;  2PNL A;  4JYA E;  4DR6 I;  2Q2E B;  1Z59 A;  2MC6 A;  2JEB B;  4I8O A;  4Q28 A;  3DF6 A;  3T1H I;  2YTD A;  2EN1 A;  2RQL A;  1FJG E;  2HK3 A;  3BBG A;  4MU4 A;  2EPX A;  4BC9 A;  1Z0C A;  2EL6 A;  4L8N A;  4LFC E;  2LBS B;  4MU1 A;  4DV4 I;  4J8Z A;  2YSP A;  2FTX B;  4USM A;  4DV5 E;  3J80 Q;  2UU9 I;  4LF6 I;  2ELZ A;  2UUB I;  3LTO A;  1XHK A;  2EPL X;  1Z0V A;  2L33 A;  4ISA A;  2R42 A;  2YU5 A;  3V2U C;  2UXC E;  2YPN A;  4DV0 E;  1P42 A;  5LMN E;  4B3T E;  2PNM A;  2DB2 A;  1ZR9 A;  3MHH C;  3Q6N A;  3J81 C;  2JEA A;  2MC5 A;  4OO1 C;  4GKK I;  1X6F A;  3Q1Q A;  4HY1 A;  2E72 A;  1YUI A;  1FNM A;  2WBU A;  4LPF A;  1KIJ A;  2WW4 A;  4B3M I;  4BA2 B;  4Z7C A;  2B7V A;  1B62 A;  4LFA E;  1FWK A;  3KWR A;  2EMX A;  1HNZ I;  2EJ4 A;  1X3C A;  4JI4 E;  3QT5 A;  1XMO I;  2LCE A;  3MSW A;  5AE3 A;  5KL7 A;  1YSA C;  3L00 A;  4PU9 A;  4DPT A;  1ZBT A;  2V87 A;  4FWD A;  4URL A;  1N33 I;  1Y4U A;  4DV2 E;  5TSE A;  4FWG A;  4P52 A;  2N3G A;  2ENH A;  1D6T A;  3P1X A; 
#chains in the Genus database with same CATH homology
 2NPF A;  4B3R E;  1N36 E;  4AQY E;  1XMQ I;  4DR6 E;  2FGG A;  3AV0 A;  1OJ4 A;  3T1H E;  3VYY A;  2L2K B;  4DR3 I;  4GEQ B;  4JG4 A;  2RSM A;  4LTY A;  4I3H A;  3K85 A;  2L3J A;  2CG9 A;  2Z5B A;  2ZIT A;  4X62 I;  4LF6 E;  2UUB E;  1KKH A;  2H36 X;  4NXM E;  1PIE A;  3J7A G;  2DEJ A;  1Y4S A;  1YYO A;  5IT9 Q;  4OOG C;  1H7U A;  1Z0B A;  2VF3 A;  3ZKB A;  4DR4 E;  4DV7 I;  2XEX A;  2Z5E A;  4GKJ I;  4GKK E;  4DR2 I;  2F4V I;  2G7H A;  4B3S I;  4KHP I;  4B3M E;  3ZZ0 A;  4EMD A;  2CPN A;  5CFF E;  1NZ0 A;  1NHH A;  1XMO E;  3QT7 A;  4MYT A;  1NHI A;  2L2M A;  2Z5C A;  2RS6 A;  4JI1 I;  4M2Z A;  1N33 E;  2E5L I;  1RR9 A;  2NUF A;  2L8T A;  3CWV A;  1IBL I;  2VE7 C;  3B8H A;  4PRV A;  1XMQ E;  3H4L A;  3LPS A;  2K4V A;  2A2C A;  3RMP A;  4DPW A;  3OTO I;  1RC7 A;  2VQF I;  4DV6 I;  1GQE A;  1Z5B A;  4IZJ B;  4DR3 E;  1N0U A;  5A2Q Q;  1N32 I;  2LUQ A;  4P7D A;  4X62 E;  4OX9 I;  1IBM I;  4DR1 I;  1UIL A;  1J5E E;  1HR0 I;  4DMI A;  2J7K A;  2O1W A;  1DAR A;  2JY9 A;  1WUU A;  1BKN A;  2EFG A;  2O1T A;  2V2V A;  4DR2 E;  2F4V E;  2CZ9 A;  1FKA E;  4B3S E;  5T6J A;  1S4E A;  3FIG A;  4JI5 I;  4RPF A;  1GZ6 A;  4WSP A;  2LTS A;  2LMZ A;  3IWD A;  1EKZ A;  4JI1 E;  3C4T A;  3PYF A;  1T4N A;  3B82 A;  1Z5C A;  3LNU A;  4XTJ A;  1N34 I;  1RRE A;  4LF8 E;  3ZKD A;  2DIX A;  3WU3 A;  4F9A B;  3QT6 A;  1O0W A;  4LF7 I;  1ZM4 A;  5BR8 I;  2V86 A;  3OTO E;  3JAM C;  2VQF E;  5LL6 R;  3HPS A;  3ADI A;  3AUZ A;  4DR7 I;  4OX9 E;  4WUD A;  1STU A;  1IBM E;  1X48 A;  2YZT A;  2JOX A;  4F9B B;  1HR0 E;  1H7S A;  2WZO A;  4DV3 I;  2LTR A;  3ADG A;  4YY3 I;  4DUZ I;  4HAC B;  2E1R A;  2YT4 A;  3V5R A;  1RQ0 A;  1SR9 A;  2V34 A;  3ZM7 A;  1PKP A;  4JI5 E;  2KOU A;  1HK7 A;  2LRS A;  1ZM9 A;  4LF9 I;  4HYM A;  1U2R A;  5ADZ A;  4JI0 I;  4LF5 I;  2HHH I;  4FW9 A;  4X8W A;  3JTZ A;  1A6F A;  2E1M A;  1N34 E;  4JI8 I;  3IWB A;  2KON A;  4ED4 A;  1Z0E A;  4FN5 A;  5FLX C;  2O1U A;  4WPY A;  4LF7 E;  4JI7 I;  5BR8 E;  4LF4 I;  4IZJ D;  5LMU I;  4JI2 I;  1Z0G A;  2FV4 B;  3DJW A;  2MDR A;  1DQ3 A;  4DV4 E;  1I94 I;  5AE2 A;  4FWH A;  2UU9 E;  1YYK A;  2EZ6 A;  4X65 I;  4DV3 E;  4HXZ A;  1QU6 A;  4DUZ E;  4JI3 I;  1WXR A;  4KQV A;  3J81 Q;  1DI2 A;  3PRY A;  3PYG A;  4LF9 E;  4DU8 A;  2X36 A;  4PRX A;  4L5N C;  1HNZ E;  3IWC A;  4JI0 E;  4LF5 E;  2HHH E;  5FWK A;  2JR1 A;  3F6G A;  4BC7 A;  1FI4 A;  5DNY A;  3J7Y p;  2V8P A;  3C4B A;  2Z5B B;  2HK2 A;  5FLX Q;  3ZZU A;  4JI7 E;  4LU9 A;  4IZJ A;  2B9D A;  4JI6 I;  4LF4 E;  1YZ9 A;  5LMU E;  2L92 A;  2X7I A;  3ZOQ B;  1HNW I;  4IZK B;  3K17 A;  4JI2 E;  4NXN I;  3VK6 A;  2M7Q A;  4M0V A;  1I94 E;  4X65 E;  1X49 A;  2DMY A;  3B78 A;  3H09 A;  1USV A;  4DV7 E;  1S16 A;  4GKJ E;  2O1V A;  2UUA I;  4WYQ B;  4KHP E;  4BMJ A;  1UHZ A;  2V2Z A;  4JYA I;  3HJC A;  4DV1 I;  2DSY A;  2IOP A;  4R1F A;  1Z0W A;  2JWO A;  1Z0T A;  2E5L E;  4DV5 I;  3ADL A;  4N3O A;  2RS7 A;  1IBL E;  3J80 C;  3QT8 A;  3LLH A;  1QZR A;  3K6Q A;  1N0V C;  3VYX A;  2UXD I;  1T4O A;  4WUC A;  3PYE A;  2UXC I;  4UT4 A;  4B3T I;  4USK A;  4K0K I;  1HNW E;  2RTX A;  4DV6 E;  4NXN E;  2V88 A;  4TUI A;  1N32 E;  1B63 A;  3WU5 A;  4LFB I;  4DXL A;  5IWA I;  1MG7 A;  2GS8 A;  1WHQ A;  2ZM6 I;  1ZBQ A;  4KZS A;  4HAC A;  4DR1 E;  4JV5 I;  4M1K A;  1XNR I;  2HFU A;  2JOB A;  4DV2 I;  2ODR C;  4UTG A;  4ZVI A;  4MYU A;  1HNX I;  4P78 A;  2UUA E;  4B3R I;  3K1J A;  1MU5 A;  3OML A;  4DV1 E;  2BM1 A;  2N3H A;  2AJ4 A;  2CGE A;  2BV3 A;  1K47 A;  4F54 A;  2JVA A;  3PYD A;  4NXM I;  5F3W A;  4DUY I;  2UXD E;  4R8O A;  2IOQ A;  1XNQ I;  4WFT A;  5IT9 C;  4DR4 I;  4K0K E;  3JAM Q;  3D4J A;  1FWL A;  2M1S A;  1KTV A;  2ODR D;  1J26 A;  4LFB E;  5IWA E;  1Z5A A;  4DR7 E;  2ZM6 E;  2M4I A;  2V8Q B;  1ZM2 A;  3T1Y I;  4F9C B;  4JV5 E;  4DPU A;  1XNR E;  4YY3 E;  2UUC I;  4YHH I;  1ZXN A;  3Q6M A;  3ZZT A;  1HNX E;  1KVK A;  2R3V A;  2UXB I;  3M6A A;  2LJH A;  3ADJ A;  3HTX A;  4DPY A;  2VQE I;  4Z7Y A;  2HKE A;  4X66 I;  2DEI A;  2LE2 A;  4BBY A;  3HPZ A;  2VF1 A;  4DR5 I;  5A2Q C;  4BS9 A;  2LJP A;  4JI8 E;  1WHN A;  4DUY E;  1J5E I;  1H73 A;  2HFS A;  2IHR 1;  3P06 A;  2KHX A;  1XNQ E;  5L3J A;  4IZK A;  4X64 I;  3WU4 A;  2NUG A;  2V89 A;  2B3T B;  1YYW A;  3JU0 A;  4WUB A;  1NHJ A;  1IBK I;  1T4L B;  1Y6Z A;  1ELO A;  1X47 A;  3T1Y E;  4TUG A;  1UEK A;  3HXL A;  1MX0 A;  4JI3 E;  2UUC E;  3GON A;  4R03 A;  4YHH E;  3F0N A;  2L3C A;  2Z5C B;  4M30 A;  2UXB E;  4LF8 I;  2ZBK B;  5GME A;  2LUP B;  2GQ0 A;  2VQE E;  4X66 E;  1H72 C;  5AE1 A;  2OI2 A;  2NUE A;  1USU A;  4P7A A;  2F8B A;  4DR5 E;  1H74 A;  1FJG I;  4LFC I;  2V83 A;  2NA2 A;  1ZM3 A;  2B7T A;  5AAS A;  1VIS A;  4DPX A;  4X64 E;  1EI1 A;  3HQ1 A;  4DV0 I;  2L2N A;  4JI6 E;  5LMN I;  2BM0 A;  1IBK E;  1ZXM A;  3F6H A;  3LML A;  3WU6 A;  4LFA I;  4JI4 I;  2V85 A;  3HUL A;  1EA6 A;  2A2D A;  2HKJ A;  2V2Q A;  1PVG A;  2EWL A;  4BCA A;  2L6M A;  4DKK A;  4DU7 A;  3J7A M;  1N36 I;  4AQY I;  5GMD A;  2PNL A;  4JYA E;  4DR6 I;  2Q2E B;  1Z59 A;  2MC6 A;  4I8O A;  4Q28 A;  3DF6 A;  3T1H I;  2HK3 A;  1FJG E;  4BC9 A;  1Z0C A;  4L8N A;  4LFC E;  2LBS B;  4DV4 I;  4J8Z A;  2FTX B;  4USM A;  4DV5 E;  3J80 Q;  2UU9 I;  4LF6 I;  2UUB I;  3LTO A;  1XHK A;  1Z0V A;  2L33 A;  2R42 A;  3V2U C;  2UXC E;  4DV0 E;  5LMN E;  4B3T E;  2PNM A;  2DB2 A;  3Q6N A;  3J81 C;  2MC5 A;  4GKK I;  3Q1Q A;  4HY1 A;  1FNM A;  1KIJ A;  2WW4 A;  4B3M I;  4Z7C A;  2B7V A;  1B62 A;  4LFA E;  1FWK A;  3KWR A;  1HNZ I;  4JI4 E;  3QT5 A;  1XMO I;  3MSW A;  5AE3 A;  4PU9 A;  4DPT A;  1ZBT A;  2V87 A;  4FWD A;  4URL A;  1N33 I;  1Y4U A;  4DV2 E;  4FWG A;  4P52 A;  2N3G A;  1D6T A;  3P1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...