4JI2E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji2E02
3B82A 4LF6I 1ZXMA 3WU3A 3ADIA 4X62I 1KIJA 1RC7A 1B63A 1S16A 2L2MA 2NPFA 1N33E 5LMNI 2UUAE 2HK3A 3T1YI 4JI0I 3T1HI 4WUBA 2HKJA 4MYTA 2LTSA 4DUZI 5BR8E 4X66E 2B3TB 2L3JA 2A2CA 4FWGA 1HNWE 4I3HA 1UHZA 3Q1QA 4GKKI 4M30A 4R1FA 4LF7I 4JI8E 4PRXA 4WYQB 4JI3E 4JI4E 4LF8E 3QT6A 2N3HA 4XTJA 2UXCE 4P7AA 1XMQI 4YHHI 4HXZA 5IT9Q 1NHHA 1HR0I 1Z5CA 1ZXNA 3VYYA 4DR4I 4X64E 4DU8A 4DV6E 2HFSA 5IT9C 3D4JA 4DXLA 4EMDA 2UXBI 1IBME 2B7VA 1IBKI 3ZM7A 2J7KA 3JAMQ 4OX9I 4YY3E 1NHJA 2X7IA 1YYOA 4KQVA 2UXDI 1BKNA 4OOGC 5GMDA 2L33A 3LLHA 4K0KE 2LTRA 4HACB 4UTGA 2L2KB 4DV1E 1DARA 3JAMC 1EA6A 1H72C 3GONA 4HYMA 4RPFA 3LPSA 4MYUA 1OJ4A 1J5EE 4HY1A 2CZ9A 4LF6E 4URLA 2ZBKB 5LMUI 4PU9A 4DR1I 4X62E 3B8HA 1T4LB 2JVAA 4WFTA 1N36I 3LTOA 3WU6A 4DV0I 4LF4I 5LMNE 1X49A 3T1YE 3T1HE 4JI0E 1RR9A 1XMOI 4DV5I 4AQYI 1N34I 1RQ0A 4DUZE 3J7AG 3B78A 4FW9A 4DR6I 2UUBI 4GKKE 1WHQA 2LBSB 2NUFA 4LF7E 1FJGI 1N32I 4LFAI 1QU6A 1STUA 4DR7E 2MDRA 3V2UC 2YT4A 4FWDA 1XMQE 2CPNA 4YHHE 2EZ6A 4ZVIA 1T4OA 3C4TA 1HR0E 1NZ0A 5FLXQ 3QT5A 4DR4E 1U2RA 2E5LI 2UUCI 4DR3I 1J26A 4M1KA 2LUPB 3ADLA 1HNXI 2UXBE 1MG7A 4DUYI 2V2QA 1IBKE 5FLXC 3HULA 2N3GA 4B3SE 4DPUA 4OX9E 2ZITA 1Z0CA 1IBLE 2WW4A 1Z0TA 1FWKA 4FN5A 2UXDE 4DPXA 2HFUA 2LJHA 4DV3I 2B7TA 4DV2I 4WUCA 3OTOI 1KTVA 3J80Q 1EKZA 2NA2A 4DV4I 4B3RI 3PYDA 5IWAI 4DPYA 5LMUE 3P1XA 4DR1E 4JI7I 1VISA 3J80C 1FNMA 1N36E 2R42A 3J81C 4LFCI 4DV7I 4Z7YA 4DPTA 4DV0E 4LF4E 1YYWA 2DEIA 4JI8I 4GKJI 1PIEA 1I94I 1XMOE 4DV5E 2RS6A 4AQYE 1N34E 3QT7A 4DU7A 1XNQI 4DR2I 1HNZI 1WUUA 1N0VC 1EI1A 3J7AM 1ELOA 1K47A 4DR6E 2UUBE 4LFBI 2KHXA 4X8WA 1FWLA 1N32E 2DMYA 3H4LA 4LFAE 3VYXA 1Z5AA 4LF5I 1O0WA 4JI2I 4KHPI 4LF9I 4DV6I 2DEJA 1XNRI 3ZZUA 2LUQA 2VQEI 4DR5I 3ADGA 1PVGA 4B3MI 4JI1I 4PRVA 2E5LE 4NXNI 1H74A 4DR3E 1S4EA 3K17A 3PYGA 1DI2A 1HNXE 1MX0A 4DUYE 1KVKA 3V5RA 1Z0GA 4ED4A 4JV5I 1WHNA 2UU9I 3CWVA 2RS7A 1FKAE 3M6AA 1D6TA 1H7UA 1KKHA 2ZM6I 2NUGA 1X47A 2VQFI 4DV3E 3WU4A 4DV2E 3OTOE 2EFGA 2HHHI 2BV3A 1A6FA 1N0UA 2XEXA 2BM1A 4JI6I 1Z59A 1ZBTA 1X48A 4B3TI 3ZZTA 1PKPA 4DV4E 4DKKA 2AJ4A 4B3RE 1Z5BA 4UT4A 4JI5I 4NXMI 2V8PA 4X65I 5IWAE 4JYAI 1H7SA 1Z0WA 3J7Yp 4JI7E 2V2ZA 2F4VI 4LFCE 4DV7E 1ZM3A 4GKJE 1I94E 5GMEA 1ZM9A 4DR7I 1ZM2A 1UILA 1ZM4A 3HTXA 5A2QQ 3LNUA 3J81Q 1XNQE 3ZZ0A 2LRSA 4DR2E 5L3JA 1HNZE 1Z0EA 2A2DA 1N33I 2UUAI 2RSMA 1QZRA 4HACA 4LFBE 2R3VA 1Z0BA 5BR8I 4X66I 2NUEA 3ADJA 1HNWI 4P52A 4LF5E 2DB2A 4JI2E 4KHPE 1UEKA 4LF9E 1YYKA 5A2QC 5LL6R 2E1RA 2HKEA 1XNRE 1XHKA 4JI3I 4JI4I 4LF8I 4B3SI 2UXCI 2X36A 2VQEE 4DR5E 4USKA 1T4NA 4WUDA 2LJPA 4B3ME 3K1JA 1IBLI 4JI1E 5CFFE 4JG4A 4NXNE 1FJGE 1RREA 4X64I 1B62A 2GS8A 1GQEA 2RTXA 2OI2A 2L3CA 2IHR1 1YZ9A 3PYFA 3ZKBA 2JY9A 1IBMI 4JV5E 4FWHA 3C4BA 2UU9E 4Z7CA 2ZM6E 3F0NA 2HK2A 2VF3A 4YY3I 2VQFE 1MU5A 2HHHE 2UUCE 1Z0VA 4JI6E 2V34A 4USMA 2BM0A 1H73A 4B3TE 4K0KI 4DV1I 2Q2EB 2V2VA 3PYEA 2DIXA 4JI5E 4NXME 4X65E 4JYAE 1FI4A 4DPWA 3ZKDA 1NHIA 2L2NA 3QT8A 1J5EI 2F4VE 3WU5A 4M2ZA
chains in the Genus database with same CATH superfamily
3B82A 4LF6I 3L7ZA 3ZOQB 1ZXMA 3WU3A 3ADIA 4IS9A 4X62I 1KIJA 1RC7A 2I13A 2EM7A 1B63A 1S16A 4IFDB 2L2MA 2EMXA 2NPFA 2BA1G 1N33E 2YU5A 5LMNI 2UUAE 2HK3A 3T1YI 4JI0I 3T1HI 2JT2A 4NBQA 4WUBA 4BC9A 4BS9A 1ZAAC 2HKJA 5C0XE 4MYTA 2M1SA 2LTSA 4DUZI 2L6MA 5BR8E 4X66E 2B3TB 2L3JA 2A2CA 4FWGA 1HNWE 4I3HA 1UHZA 2O1UA 2EN2A 4J8ZA 3Q1QA 4F2JC 5KL5A 4GKKI 4M30A 4R1FA 3F6GA 4LF7I 2MC6A 1A1IA 4F9AB 5ELWA 2V8QB 4JI8E 1UDOA 5JEAB 4FW6A 4PRXA 3HQ1A 3IWDA 2EORA 5K36F 4WYQB 4JI3E 2PNMA 1G2FC 4JI4E 4LF8E 3QT6A 1BBGA 4LCGA 2N3HA 2NN6D 2PO2A 2UXCE 4P7AA 5A6JA 4XTJA 2YTQA 1OYPA 4IZJB 1XMQI 2E1MA 4YHHI 4HXZA 2NN6E 1NHHA 5IT9Q 2JXPA 1JK1A 4MU1A 2EN4A 4O5GA 5JEAD 2DLQA 1UN6B 1HR0I 3OMLA 4AIDA 1Z5CA 2YTOA 1ZXNA 2PO0A 3VYYA 4OO1F 5KL2A 4R2RA 2R76A 4DR4I 1WJPA 3DF6A 1UBDC 4IZJD 4X64E 1X6FA 4DU8A 4F54A 4DV6E 1JK2A 2EJ4A 4M9VC 3P3GA 2LO3A 2HFSA 4WXDA 5IT9C 3D4JA 4DXLA 1N33I 2WBUA 4EMDA 2UXBI 2YRHA 1IBME 2B7VA 1IBKI 1GZ6A 2VESA 3ZM7A 1NEIA 5TSEA 2J7KA 1OYRA 3KRNA 3JAMQ 2C38A 4OX9I 1KYQA 4YY3E 4MQYA 1NHJA 2X7IA 2EPCA 1YYOA 1TN9A 5AASA 4KQVA 4LOMA 2EMIA 2V87A 2UXDI 1BKNA 2RSIA 4HEIA 2KONA 4OOGC 4WX9A 2GPIA 4R2CA 5GMDA 2L33A 2KOUA 2YTJA 3LLHA 2LTRA 4K0KE 3PS1A 4HACB 2L2KB 5T6JA 4DV1E 3GCMA 4UTGA 2PNZB 1DARA 3JAMC 2EN7A 2WP8B 1EA6A 2BR2A 4LCFA 1H72C 2JEAA 1BB8A 5DRQA 3GONA 4HYMA 4U3BA 2ELYA 4P78A 2D9HA 2DRPA 4RPFA 1AH5A 2FGGA 3LPSA 2YU8A 2Z5EA 4MYUA 2BA0G 1OJ4A 1J5EE 3PS3A 4HY1A 1MEYC 1EH8A 5KL4A 2CZ9A 3KZZA 3JTZA 2GO4A 4LF6E 2CTDA 4MU0A 4URLA 1KJKA 3M85D 2PO1A 2ZBKB 2C37A 5LMUI 4PU9A 4DR1I 4X62E 1OYSA 2EOQA 3B8HA 1YSAC 1T4LB 3H1CA 2EPNA 2EN6A 2JVAA 2L8TA 4WFTA 1N36I 2EOOA 3RMPA 2WNRA 3LTOA 2F1DA 2C39B 3THOB 2BBGA 4O4KA 3WU6A 2WBTA 3F6HA 4DV0I 4LF4I 5LMNE 1X49A 2WBSA 2EL4A 3T1YE 3T1HE 2ENAA 4JI0E 1RR9A 1XMOI 4DV5I 4AQYI 1N34I 1RQ0A 4DUZE 1TF6A 1E3HA 3J7AG 2Q8UA 2EOIA 1R6LA 4IFDA 5KL6A 3DJWA 3B78A 3HXLA 4FW9A 4DR6I 2UUBI 4MLVA 4GKKE 1WHQA 2LBSB 1B69A 2GQ0A 4R2DA 4FW5A 5C0XB 4AM3A 2NUFA 4LF7E 1FJGI 2LJUA 2EMKA 1N32I 4LFAI 4GZNC 1QU6A 5K36A 1PJQA 1STUA 2V83A 4DR7E 2MDRA 3V2UC 2EN1A 2JOXA 3P06A 2YT4A 2Z5BB 1PDAA 4FWDA 5AC5A 1XMQE 3M7NG 2CPNA 4YHHE 5C0XD 4R2QA 3PRYA 2EZ6A 4ZVIA 1T4OA 5DRRA 4QNJA 5JEAA 3C4TA 1HR0E 3MHHC 1SFEA 1Y60A 4OO1A 1NZ0A 2V86A 5FLXQ 3QT5A 4DR4E 3L00A 1U2RA 3CDIA 2EOHA 4IZJA 2MKDA 4BMJA 4IFDF 2NN6B 1ZU1A 2EOFA 2EPMX 2E5LI 4R2PA 2LV2A 2UUCI 2WCC3 4O43A 4DR3I 2EOMA 4R2SA 4L5NC 1J26A 5A6BA 1YFHA 4M1KA 1UDNA 5A6KA 2LUPB 3ADLA 2JE6B 2BB8A 2EM3A 1HNXI 2UXBE 1MG7A 2WZOA 4DUYI 2DSYA 2GHFA 2YTPA 1IBKE 5FLXC 2V2QA 3HULA 2EM2A 2N3GA 4B3SE 2NN6F 1N3GA 4DPUA 3BF2A 5ADZA 5DNYA 2NABA 2BA1D 4OX9E 2ZITA 4OKGA 4QNKA 4IFDC 1Z0CA 2YTDA 4WSPA 1YPNA 1IBLE 2WW4A 5JEAF 1X5WA 1Y5YA 1G2DC 2V85A 1FWKA 1Z0TA 2O1VA 4FN5A 2EMLA 5KL3A 2K7IA 2UXDE 1ZBQA 4DPXA 5LLQA 2HFUA 2IESA 4FW4A 1WXRA 2LJHA 4DV3I 1R6MA 2B7TA 2EM5A 5K36C 4DV2I 2LT7A 4WUCA 3OTOI 2Z5CB 1KTVA 4B3MI 3J80Q 1WRJA 3HPZA 2YZTA 1EKZA 4IZKB 1EH7A 5K36E 1USUA 3VHTB 2JYAA 2N8XA 2NA2A 4R2EA 1T39A 5IV8B 4DV4I 5JEAC 3BBGA 3P3EA 4KWYA 2O3ZA 4B3RI 4OO1C 2JEBA 3PYDA 2JR1A 4ZYGA 1YHCA 2PNZA 5IWAI 5DROA 4DPYA 2WP8A 4F6NA 2DLKA 5LMUE 3MSWA 4OO1E 2YRMA 1GTKA 3P1XA 4N4RB 4DR1E 1VISA 4JI7I 2ODRC 3J80C 1FNMA 2EPKX 1N36E 2PO2B 2R42A 4BA1B 3J81C 3FIGA 4LFCI 4DV7I 4Z7YA 3HPSA 4WXCA 4DPTA 2EPAA 4DV0E 4TUGA 2B9DA 4LF4E 1YYWA 2DEIA 4JI8I 1PIEA 3U1KA 1Z1BA 1I94I 4GKJI 1XMOE 2PO0B 4DV5E 3K6QA 2EPOA 4BA2B 3TQMA 2RS6A 3NZKA 4GQUA 2EPXA 4AQYE 1N34E 3QT7A 4U3DA 2YTEA 4DU7A 1XNQI 4MDTA 2YTFA 3M85G 1XXEA 4DR2I 1HNZI 1WUUA 2YSPA 2EPPA 1E3PA 1N0VC 2L92A 1EI1A 5AE3A 3J7AM 1ELOA 1K47A 2EMYA 2EMGA 2G7HA 4DR6E 2UUBE 1EH6A 5EKWA 5L3JA 4X9JA 4LFBI 2EMCA 1PJTA 2KHXA 4HTGA 2JOBA 4X8WA 4NHRA 1FWLA 2GLIA 1N32E 2DMYA 2YTGA 3H4LA 4LFAE 3VYXA 4BBYA 1Z5AA 4BC7A 1O0WA 4LF5I 4JI2I 4KHPI 4LF9I 4DV6I 1PJSA 1RHYA 4DMIA 2M9AA 2CGEA 5EL9A 3KZYA 5C0XA 1P47A 2DEJA 2H36X 3MHSC 4FW7A 1TF3A 1XNRI 2RPCA 3B4TA 3GLLA 3ZZUA 3JU0A 2GO3A 2LUQA 3AV0A 2V88A 2VQEI 3BIDA 4M0VA 1RMDA 2CT1A 1P42A 4DR5I 3ADGA 2Z5BA 2EMBA 4F9CB 1NCSA 2EM0A 5IXMB 1IMUA 1PVGA 4JI1I 4PRVA 2E5LE 2HC5A 2HGHA 2BA0D 2J7JA 4NXNI 2BR2B 1H74A 4DR3E 1S4EA 1YUJA 3K17A 1DGCA 5AE2A 3PYGA 1DI2A 3Q6MA 3LMLA 1HNXE 2HJJA 5F3WA 4ISAA 1MX0A 2EQ1A 4DUYE 1KVKA 2NN6A 2EL5A 4I8OA 1AAYA 3V5RA 2RQLA 4R8OA 3EPHA 1Z0GA 2YTNA 1IQOA 2JWOA 5C0XF 1X6EA 4ED4A 1YH8A 1WHNA 3U1YA 4JV5I 3HJCA 2JE6A 2EQ0A 2UU9I 3CWVA 2WNRB 1X6HA 2RS7A 1FKAE 3M6AA 3IWCA 1D6TA 1IQSA 1H7UA 1KKHA 1Y4UA 2ZM6I 2CSHA 4TUIA 2NUGA 1X47A 2M7QA 2VQFI 4DV3E 3H09A 1Y6ZA 1T38A 3WU4A 4DV2E 4GEQB 3OTOE 2IOQA 2EFGA 2HHHI 2EM9A 4WPYA 1A1GA 2BV3A 1A6FA 1N0UA 2XEXA 4F6MA 2MDGA 2BM1A 4JI6I 2EOJA 1Z59A 1ZBTA 5C0XC 1X48A 2M4IA 5KL7A 4B3TI 3ZZTA 1PKPA 2VF1A 4DKKA 4DV4E 2AJ4A 3GMEA 2EOZA 2YTIA 1UDSA 4B3RE 1UDQA 1Z5BA 3L7ZB 4R2AA 2Z5CA 4UT4A 4JI5I 4NXMI 2V8PA 2YSOA 4X65I 3EPLA 5IWAE 4JYAI 3M7ND 1H7SA 3UK3C 5K36B 4IZKA 1Z0WA 4RHBB 3AUZA 2EN3A 2EL6A 3J7Yp 1A1KA 4IFDD 2LMZA 4JI7E 2PRTA 2F8BA 2V2ZA 2F4VI 2EMAA 4IFDE 4MLQA 2EM8A 4ZYDA 1DQ3A 4LFCE 4DV7E 3K85A 5AC4A 4FK5C 2AE8A 4BHBA 1ZM3A 2I9IA 3CDJA 4AIMA 3VK6A 4GKJE 1MGTA 2V89A 1I94E 5GMEA 1A1HA 2VE7C 4OO1B 1HK7A 5K36D 1ZM9A 1USVA 4DR7I 2JP9A 1ZM2A 2NN6C 1UILA 1ZM4A 3HTXA 5A2QQ 3LNUA 1QNTA 1XNQE 3ZZ0A 4BA1A 3J81Q 2LRSA 3BGHA 4DR2E 1YUIA 4LCHA 1HNZE 2FTXB 4L8NA 2ELZA 1Z0EA 4R03A 2A2DA 4MU3A 5DNXA 2UUAI 2RSMA 2CG9A 3ECRA 2EM4A 5A69A 5DRPA 2LCEA 1QZRA 3EQ1A 2EMFA 4LFBE 1VI7A 2J65A 2PNLA 1A1JA 4HACA 4BA2A 2ENCA 3M99B 4OO1D 4RH8A 1Z0BA 2R3VA 5JEAE 4X66I 5BR8I 2NUEA 3PS2A 4P7DA 3ADJA 4BHCA 2O1TA 3P76A 1HNWI 2JPAA 1A1LA 3UHMA 4P52A 2EP3A 2ODRD 4LF5E 2DB2A 5A2QC 4JI2E 4KHPE 4LF9E 1YYKA 1UEKA 2EQ3A 5LL6R 5A6BD 2K4VA 4OZEA 2EPRA 2E1RA 1SR9A 2HKEA 1XNRE 2MC5A 4N3OA 4F9BB 1XHKA 4JI3I 4JI4I 4LF8I 4B3SI 2FV4B 2YRKA 4ZYEA 2UXCI 2X36A 2VQEE 4KZSA 4DR5E 4Q28A 2C39A 4USKA 3DD6A 5FWKA 1T4NA 4WUDA 2LJPA 2MKNA 3C6KA 1F2IG 5AE1A 5CFFE 4B3ME 4JI1E 3K1JA 4JG4A 4O24A 1IBLI 4NXNE 2CVEA 2EPUA 1FJGE 2EOYA 2YWQA 2EE8A 1RREA 4X64I 2EWLA 1A1FA 1B62A 4J3DA 2GS8A 2IERA 2R1FA 1GQEA 2JEBB 2RTXA 1LLMC 4WSGA 2OI2A 2EMWA 2L3CA 4FW3A 2C38B 2IHR1 4IJDA 2E72A 2EN8A 1YZ9A 2EOEA 3PYFA 2IOPA 3ZKBA 2JY9A 3P3CA 1IBMI 4JV5E 4FWHA 3C4BA 2UU9E 3C6MA 4Z7CA 3KWRA 2ZM6E 3F0NA 2HK2A 2VF3A 2YPNA 4NZVA 1L4SA 2A25A 2VQFE 4YY3I 2VRDA 1MU5A 4Q35B 2EMHA 2ADRA 5DNLA 2HHHE 2UUCE 2LE2A 2EM6A 2JEAB 2EPZA 2LVHA 1X3CA 1Y4SA 2EMZA 1Z0VA 4JI6E 3Q6NA 2V34A 4USMA 2BM0A 1H73A 2O1WA 4B3TE 4K0KI 4DV1I 3QG5C 2EPLX 2EOSA 2DGCA 4IS1C 2Q2EB 2V2VA 3PYEA 4MU4A 3IWBA 2PO1B 2DIXA 3THNA 4JI5E 2DMIA 4NXME 2C37B 1BBOA 4X65E 4JYAE 1FI4A 4DPWA 4ZYHA 2ENHA 1ZR9A 5A6AA 4LU9A 3HKMA 4LPFA 1NHIA 3EPJA 3ZKDA 2L2NA 4BCAA 3QT8A 3EPKA 4LTYA 1J5EI 2F4VE 3WU5A 2EOXA 4M2ZA
chains in the Genus database with same CATH topology
3B82A 4LF6I 3ZOQB 1ZXMA 3WU3A 3ADIA 4X62I 1KIJA 1RC7A 1B63A 1S16A 2L2MA 2NPFA 1N33E 5LMNI 2UUAE 2HK3A 3T1YI 4JI0I 3T1HI 4WUBA 4BC9A 4BS9A 2HKJA 4MYTA 2M1SA 2LTSA 4DUZI 2L6MA 5BR8E 4X66E 2B3TB 2L3JA 2A2CA 4FWGA 1HNWE 4I3HA 1UHZA 2O1UA 4J8ZA 3Q1QA 4GKKI 4M30A 4R1FA 3F6GA 4LF7I 2MC6A 4F9AB 2V8QB 4JI8E 4PRXA 3HQ1A 3IWDA 4WYQB 4JI3E 2PNMA 4JI4E 4LF8E 3QT6A 2N3HA 4XTJA 2UXCE 4P7AA 4IZJB 1XMQI 2E1MA 4YHHI 4HXZA 5IT9Q 1NHHA 1HR0I 3OMLA 1Z5CA 1ZXNA 3VYYA 4DR4I 3DF6A 4IZJD 4X64E 4DU8A 4F54A 4DV6E 2HFSA 5IT9C 3D4JA 4DXLA 4EMDA 2UXBI 1IBME 2B7VA 1IBKI 1GZ6A 3ZM7A 2J7KA 3JAMQ 4OX9I 4YY3E 1NHJA 2X7IA 1YYOA 5AASA 4KQVA 2V87A 2UXDI 1BKNA 2KONA 4OOGC 5GMDA 2L33A 2KOUA 3LLHA 4K0KE 2LTRA 4HACB 4UTGA 2L2KB 5T6JA 4DV1E 1DARA 3JAMC 1EA6A 1H72C 3GONA 4HYMA 4P78A 4RPFA 3LPSA 2FGGA 2Z5EA 4MYUA 1OJ4A 1J5EE 4HY1A 2CZ9A 3JTZA 4LF6E 4URLA 2ZBKB 5LMUI 4PU9A 4DR1I 4X62E 3B8HA 1T4LB 2JVAA 2L8TA 4WFTA 1N36I 3RMPA 3LTOA 3WU6A 3F6HA 4DV0I 4LF4I 5LMNE 1X49A 3T1YE 3T1HE 4JI0E 1RR9A 1XMOI 4DV5I 4AQYI 1N34I 1RQ0A 4DUZE 3J7AG 3DJWA 3B78A 3HXLA 4FW9A 4DR6I 2UUBI 4GKKE 1WHQA 2LBSB 2GQ0A 2NUFA 4LF7E 1FJGI 1N32I 4LFAI 1QU6A 1STUA 2V83A 4DR7E 2MDRA 3V2UC 2JOXA 3P06A 2YT4A 2Z5BB 4FWDA 1XMQE 2CPNA 4YHHE 3PRYA 2EZ6A 4ZVIA 1T4OA 3C4TA 1HR0E 1NZ0A 2V86A 5FLXQ 3QT5A 4DR4E 1U2RA 4IZJA 4BMJA 2E5LI 2UUCI 4DR3I 4L5NC 1J26A 4M1KA 2LUPB 3ADLA 1HNXI 2UXBE 1MG7A 2WZOA 4DUYI 2DSYA 2V2QA 1IBKE 5FLXC 3HULA 2N3GA 4B3SE 4DPUA 5ADZA 5DNYA 4OX9E 2ZITA 1Z0CA 4WSPA 1IBLE 2WW4A 1Z0TA 1FWKA 2V85A 2O1VA 4FN5A 2UXDE 1ZBQA 4DPXA 2HFUA 1WXRA 2LJHA 4DV3I 2B7TA 4DV2I 4WUCA 3OTOI 2Z5CB 1KTVA 3J80Q 3HPZA 2YZTA 1EKZA 4IZKB 1USUA 2NA2A 4DV4I 4B3RI 3PYDA 2JR1A 5IWAI 4DPYA 5LMUE 3MSWA 3P1XA 4DR1E 4JI7I 1VISA 2ODRC 3J80C 1FNMA 1N36E 2R42A 3J81C 3FIGA 4LFCI 4DV7I 4Z7YA 3HPSA 4DPTA 4DV0E 4LF4E 4TUGA 2B9DA 1YYWA 2DEIA 4JI8I 4GKJI 1PIEA 1I94I 1XMOE 4DV5E 3K6QA 2RS6A 4AQYE 1N34E 3QT7A 4DU7A 1XNQI 4DR2I 1HNZI 1WUUA 1N0VC 2L92A 1EI1A 5AE3A 3J7AM 1ELOA 1K47A 2G7HA 4DR6E 2UUBE 4LFBI 2KHXA 4X8WA 2JOBA 1FWLA 1N32E 2DMYA 3H4LA 4LFAE 3VYXA 4BBYA 1Z5AA 4BC7A 1O0WA 4LF5I 4JI2I 4KHPI 4LF9I 4DV6I 4DMIA 2CGEA 2DEJA 2H36X 1XNRI 3ZZUA 3JU0A 2LUQA 3AV0A 2V88A 2VQEI 4M0VA 4DR5I 3ADGA 2Z5BA 1PVGA 4F9CB 4B3MI 4JI1I 4PRVA 2E5LE 4NXNI 1H74A 4DR3E 1S4EA 3K17A 5AE2A 3PYGA 1DI2A 3Q6MA 3LMLA 1HNXE 5F3WA 1MX0A 4DUYE 1KVKA 4I8OA 3V5RA 4R8OA 1Z0GA 2JWOA 4ED4A 4JV5I 1WHNA 3HJCA 2UU9I 3CWVA 2RS7A 1FKAE 3M6AA 3IWCA 1D6TA 1H7UA 1KKHA 1Y4UA 2ZM6I 4TUIA 2NUGA 1X47A 2M7QA 2VQFI 4DV3E 3H09A 1Y6ZA 3WU4A 4DV2E 4GEQB 3OTOE 2IOQA 2EFGA 2HHHI 4WPYA 2BV3A 1A6FA 1N0UA 2XEXA 2BM1A 4JI6I 1Z59A 1ZBTA 1X48A 2M4IA 4B3TI 3ZZTA 1PKPA 2VF1A 4DKKA 4DV4E 2AJ4A 4B3RE 1Z5BA 2Z5CA 4UT4A 4JI5I 4NXMI 2V8PA 4X65I 5IWAE 4JYAI 1H7SA 4IZKA 1Z0WA 3AUZA 3J7Yp 2LMZA 4JI7E 2F8BA 2V2ZA 2F4VI 1DQ3A 4LFCE 4DV7E 3K85A 1ZM3A 3VK6A 4GKJE 2V89A 1I94E 5GMEA 2VE7C 1HK7A 1ZM9A 1USVA 4DR7I 1ZM2A 1UILA 1ZM4A 3HTXA 5A2QQ 3LNUA 3J81Q 1XNQE 3ZZ0A 2LRSA 4DR2E 5L3JA 1HNZE 2FTXB 4L8NA 1Z0EA 2A2DA 4R03A 2UUAI 1N33I 2RSMA 2CG9A 1QZRA 4HACA 2PNLA 4LFBE 2R3VA 1Z0BA 5BR8I 4X66I 2NUEA 4P7DA 3ADJA 2O1TA 1HNWI 4P52A 2ODRD 4LF5E 2DB2A 5A2QC 4JI2E 4KHPE 4LF9E 1YYKA 1UEKA 5LL6R 2K4VA 2E1RA 1SR9A 2HKEA 1XNRE 2MC5A 4N3OA 4F9BB 1XHKA 4JI3I 4JI4I 4LF8I 4B3SI 2FV4B 2UXCI 2X36A 2VQEE 4KZSA 4DR5E 4Q28A 4USKA 5FWKA 1T4NA 4WUDA 2LJPA 4B3ME 3K1JA 1IBLI 5AE1A 5CFFE 4JI1E 4JG4A 4NXNE 1FJGE 1RREA 4X64I 2EWLA 1B62A 2GS8A 1GQEA 2RTXA 2OI2A 2L3CA 2IHR1 1YZ9A 3PYFA 2IOPA 3ZKBA 2JY9A 1IBMI 4JV5E 4FWHA 3C4BA 2UU9E 4Z7CA 3KWRA 2ZM6E 3F0NA 2HK2A 2VF3A 4YY3I 2VQFE 1MU5A 2HHHE 2UUCE 2LE2A 1Y4SA 1Z0VA 4JI6E 3Q6NA 2V34A 4USMA 2BM0A 1H73A 2O1WA 4B3TE 4K0KI 4DV1I 2Q2EB 2V2VA 3PYEA 3IWBA 2DIXA 4JI5E 4NXME 4X65E 4JYAE 1FI4A 4DPWA 4LU9A 3ZKDA 1NHIA 2L2NA 4BCAA 3QT8A 4LTYA 1J5EI 2F4VE 3WU5A 4M2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B82 A;  4LF6 I;  1ZXM A;  3WU3 A;  3ADI A;  4X62 I;  1KIJ A;  1RC7 A;  1B63 A;  1S16 A;  2L2M A;  2NPF A;  1N33 E;  5LMN I;  2UUA E;  2HK3 A;  3T1Y I;  4JI0 I;  3T1H I;  4WUB A;  2HKJ A;  4MYT A;  2LTS A;  4DUZ I;  5BR8 E;  4X66 E;  2B3T B;  2L3J A;  2A2C A;  4FWG A;  1HNW E;  4I3H A;  1UHZ A;  3Q1Q A;  4GKK I;  4M30 A;  4R1F A;  4LF7 I;  4JI8 E;  4PRX A;  4WYQ B;  4JI3 E;  4JI4 E;  4LF8 E;  3QT6 A;  2N3H A;  4XTJ A;  2UXC E;  4P7A A;  1XMQ I;  4YHH I;  4HXZ A;  5IT9 Q;  1NHH A;  1HR0 I;  1Z5C A;  1ZXN A;  3VYY A;  4DR4 I;  4X64 E;  4DU8 A;  4DV6 E;  2HFS A;  5IT9 C;  3D4J A;  4DXL A;  4EMD A;  2UXB I;  1IBM E;  2B7V A;  1IBK I;  3ZM7 A;  2J7K A;  3JAM Q;  4OX9 I;  4YY3 E;  1NHJ A;  2X7I A;  1YYO A;  4KQV A;  2UXD I;  1BKN A;  4OOG C;  5GMD A;  2L33 A;  3LLH A;  4K0K E;  2LTR A;  4HAC B;  4UTG A;  2L2K B;  4DV1 E;  1DAR A;  3JAM C;  1EA6 A;  1H72 C;  3GON A;  4HYM A;  4RPF A;  3LPS A;  4MYU A;  1OJ4 A;  1J5E E;  4HY1 A;  2CZ9 A;  4LF6 E;  4URL A;  2ZBK B;  5LMU I;  4PU9 A;  4DR1 I;  4X62 E;  3B8H A;  1T4L B;  2JVA A;  4WFT A;  1N36 I;  3LTO A;  3WU6 A;  4DV0 I;  4LF4 I;  5LMN E;  1X49 A;  3T1Y E;  3T1H E;  4JI0 E;  1RR9 A;  1XMO I;  4DV5 I;  4AQY I;  1N34 I;  1RQ0 A;  4DUZ E;  3J7A G;  3B78 A;  4FW9 A;  4DR6 I;  2UUB I;  4GKK E;  1WHQ A;  2LBS B;  2NUF A;  4LF7 E;  1FJG I;  1N32 I;  4LFA I;  1QU6 A;  1STU A;  4DR7 E;  2MDR A;  3V2U C;  2YT4 A;  4FWD A;  1XMQ E;  2CPN A;  4YHH E;  2EZ6 A;  4ZVI A;  1T4O A;  3C4T A;  1HR0 E;  1NZ0 A;  5FLX Q;  3QT5 A;  4DR4 E;  1U2R A;  2E5L I;  2UUC I;  4DR3 I;  1J26 A;  4M1K A;  2LUP B;  3ADL A;  1HNX I;  2UXB E;  1MG7 A;  4DUY I;  2V2Q A;  1IBK E;  5FLX C;  3HUL A;  2N3G A;  4B3S E;  4DPU A;  4OX9 E;  2ZIT A;  1Z0C A;  1IBL E;  2WW4 A;  1Z0T A;  1FWK A;  4FN5 A;  2UXD E;  4DPX A;  2HFU A;  2LJH A;  4DV3 I;  2B7T A;  4DV2 I;  4WUC A;  3OTO I;  1KTV A;  3J80 Q;  1EKZ A;  2NA2 A;  4DV4 I;  4B3R I;  3PYD A;  5IWA I;  4DPY A;  5LMU E;  3P1X A;  4DR1 E;  4JI7 I;  1VIS A;  3J80 C;  1FNM A;  1N36 E;  2R42 A;  3J81 C;  4LFC I;  4DV7 I;  4Z7Y A;  4DPT A;  4DV0 E;  4LF4 E;  1YYW A;  2DEI A;  4JI8 I;  4GKJ I;  1PIE A;  1I94 I;  1XMO E;  4DV5 E;  2RS6 A;  4AQY E;  1N34 E;  3QT7 A;  4DU7 A;  1XNQ I;  4DR2 I;  1HNZ I;  1WUU A;  1N0V C;  1EI1 A;  3J7A M;  1ELO A;  1K47 A;  4DR6 E;  2UUB E;  4LFB I;  2KHX A;  4X8W A;  1FWL A;  1N32 E;  2DMY A;  3H4L A;  4LFA E;  3VYX A;  1Z5A A;  4LF5 I;  1O0W A;  4JI2 I;  4KHP I;  4LF9 I;  4DV6 I;  2DEJ A;  1XNR I;  3ZZU A;  2LUQ A;  2VQE I;  4DR5 I;  3ADG A;  1PVG A;  4B3M I;  4JI1 I;  4PRV A;  2E5L E;  4NXN I;  1H74 A;  4DR3 E;  1S4E A;  3K17 A;  3PYG A;  1DI2 A;  1HNX E;  1MX0 A;  4DUY E;  1KVK A;  3V5R A;  1Z0G A;  4ED4 A;  4JV5 I;  1WHN A;  2UU9 I;  3CWV A;  2RS7 A;  1FKA E;  3M6A A;  1D6T A;  1H7U A;  1KKH A;  2ZM6 I;  2NUG A;  1X47 A;  2VQF I;  4DV3 E;  3WU4 A;  4DV2 E;  3OTO E;  2EFG A;  2HHH I;  2BV3 A;  1A6F A;  1N0U A;  2XEX A;  2BM1 A;  4JI6 I;  1Z59 A;  1ZBT A;  1X48 A;  4B3T I;  3ZZT A;  1PKP A;  4DV4 E;  4DKK A;  2AJ4 A;  4B3R E;  1Z5B A;  4UT4 A;  4JI5 I;  4NXM I;  2V8P A;  4X65 I;  5IWA E;  4JYA I;  1H7S A;  1Z0W A;  3J7Y p;  4JI7 E;  2V2Z A;  2F4V I;  4LFC E;  4DV7 E;  1ZM3 A;  4GKJ E;  1I94 E;  5GME A;  1ZM9 A;  4DR7 I;  1ZM2 A;  1UIL A;  1ZM4 A;  3HTX A;  5A2Q Q;  3LNU A;  3J81 Q;  1XNQ E;  3ZZ0 A;  2LRS A;  4DR2 E;  5L3J A;  1HNZ E;  1Z0E A;  2A2D A;  1N33 I;  2UUA I;  2RSM A;  1QZR A;  4HAC A;  4LFB E;  2R3V A;  1Z0B A;  5BR8 I;  4X66 I;  2NUE A;  3ADJ A;  1HNW I;  4P52 A;  4LF5 E;  2DB2 A;  4JI2 E;  4KHP E;  1UEK A;  4LF9 E;  1YYK A;  5A2Q C;  5LL6 R;  2E1R A;  2HKE A;  1XNR E;  1XHK A;  4JI3 I;  4JI4 I;  4LF8 I;  4B3S I;  2UXC I;  2X36 A;  2VQE E;  4DR5 E;  4USK A;  1T4N A;  4WUD A;  2LJP A;  4B3M E;  3K1J A;  1IBL I;  4JI1 E;  5CFF E;  4JG4 A;  4NXN E;  1FJG E;  1RRE A;  4X64 I;  1B62 A;  2GS8 A;  1GQE A;  2RTX A;  2OI2 A;  2L3C A;  2IHR 1;  1YZ9 A;  3PYF A;  3ZKB A;  2JY9 A;  1IBM I;  4JV5 E;  4FWH A;  3C4B A;  2UU9 E;  4Z7C A;  2ZM6 E;  3F0N A;  2HK2 A;  2VF3 A;  4YY3 I;  2VQF E;  1MU5 A;  2HHH E;  2UUC E;  1Z0V A;  4JI6 E;  2V34 A;  4USM A;  2BM0 A;  1H73 A;  4B3T E;  4K0K I;  4DV1 I;  2Q2E B;  2V2V A;  3PYE A;  2DIX A;  4JI5 E;  4NXM E;  4X65 E;  4JYA E;  1FI4 A;  4DPW A;  3ZKD A;  1NHI A;  2L2N A;  3QT8 A;  1J5E I;  2F4V E;  3WU5 A;  4M2Z A; 
#chains in the Genus database with same CATH topology
 3B82 A;  4LF6 I;  3L7Z A;  3ZOQ B;  1ZXM A;  3WU3 A;  3ADI A;  4IS9 A;  4X62 I;  1KIJ A;  1RC7 A;  2I13 A;  2EM7 A;  1B63 A;  1S16 A;  4IFD B;  2L2M A;  2EMX A;  2NPF A;  2BA1 G;  1N33 E;  2YU5 A;  5LMN I;  2UUA E;  2HK3 A;  3T1Y I;  4JI0 I;  3T1H I;  2JT2 A;  4NBQ A;  4WUB A;  4BC9 A;  4BS9 A;  1ZAA C;  2HKJ A;  5C0X E;  4MYT A;  2M1S A;  2LTS A;  4DUZ I;  2L6M A;  5BR8 E;  4X66 E;  2B3T B;  2L3J A;  2A2C A;  4FWG A;  1HNW E;  4I3H A;  1UHZ A;  2O1U A;  2EN2 A;  4J8Z A;  3Q1Q A;  4F2J C;  5KL5 A;  4GKK I;  4M30 A;  4R1F A;  3F6G A;  4LF7 I;  2MC6 A;  1A1I A;  4F9A B;  5ELW A;  2V8Q B;  4JI8 E;  1UDO A;  5JEA B;  4FW6 A;  4PRX A;  3HQ1 A;  3IWD A;  2EOR A;  5K36 F;  4WYQ B;  4JI3 E;  2PNM A;  1G2F C;  4JI4 E;  4LF8 E;  3QT6 A;  1BBG A;  4LCG A;  2N3H A;  2NN6 D;  2PO2 A;  2UXC E;  4P7A A;  5A6J A;  4XTJ A;  2YTQ A;  1OYP A;  4IZJ B;  1XMQ I;  2E1M A;  4YHH I;  4HXZ A;  2NN6 E;  1NHH A;  5IT9 Q;  2JXP A;  1JK1 A;  4MU1 A;  2EN4 A;  4O5G A;  5JEA D;  2DLQ A;  1UN6 B;  1HR0 I;  3OML A;  4AID A;  1Z5C A;  2YTO A;  1ZXN A;  2PO0 A;  3VYY A;  4OO1 F;  5KL2 A;  4R2R A;  2R76 A;  4DR4 I;  1WJP A;  3DF6 A;  1UBD C;  4IZJ D;  4X64 E;  1X6F A;  4DU8 A;  4F54 A;  4DV6 E;  1JK2 A;  2EJ4 A;  4M9V C;  3P3G A;  2LO3 A;  2HFS A;  4WXD A;  5IT9 C;  3D4J A;  4DXL A;  1N33 I;  2WBU A;  4EMD A;  2UXB I;  2YRH A;  1IBM E;  2B7V A;  1IBK I;  1GZ6 A;  2VES A;  3ZM7 A;  1NEI A;  5TSE A;  2J7K A;  1OYR A;  3KRN A;  3JAM Q;  2C38 A;  4OX9 I;  1KYQ A;  4YY3 E;  4MQY A;  1NHJ A;  2X7I A;  2EPC A;  1YYO A;  1TN9 A;  5AAS A;  4KQV A;  4LOM A;  2EMI A;  2V87 A;  2UXD I;  1BKN A;  2RSI A;  4HEI A;  2KON A;  4OOG C;  4WX9 A;  2GPI A;  4R2C A;  5GMD A;  2L33 A;  2KOU A;  2YTJ A;  3LLH A;  2LTR A;  4K0K E;  3PS1 A;  4HAC B;  2L2K B;  5T6J A;  4DV1 E;  3GCM A;  4UTG A;  2PNZ B;  1DAR A;  3JAM C;  2EN7 A;  2WP8 B;  1EA6 A;  2BR2 A;  4LCF A;  1H72 C;  2JEA A;  1BB8 A;  5DRQ A;  3GON A;  4HYM A;  4U3B A;  2ELY A;  4P78 A;  2D9H A;  2DRP A;  4RPF A;  1AH5 A;  2FGG A;  3LPS A;  2YU8 A;  2Z5E A;  4MYU A;  2BA0 G;  1OJ4 A;  1J5E E;  3PS3 A;  4HY1 A;  1MEY C;  1EH8 A;  5KL4 A;  2CZ9 A;  3KZZ A;  3JTZ A;  2GO4 A;  4LF6 E;  2CTD A;  4MU0 A;  4URL A;  1KJK A;  3M85 D;  2PO1 A;  2ZBK B;  2C37 A;  5LMU I;  4PU9 A;  4DR1 I;  4X62 E;  1OYS A;  2EOQ A;  3B8H A;  1YSA C;  1T4L B;  3H1C A;  2EPN A;  2EN6 A;  2JVA A;  2L8T A;  4WFT A;  1N36 I;  2EOO A;  3RMP A;  2WNR A;  3LTO A;  2F1D A;  2C39 B;  3THO B;  2BBG A;  4O4K A;  3WU6 A;  2WBT A;  3F6H A;  4DV0 I;  4LF4 I;  5LMN E;  1X49 A;  2WBS A;  2EL4 A;  3T1Y E;  3T1H E;  2ENA A;  4JI0 E;  1RR9 A;  1XMO I;  4DV5 I;  4AQY I;  1N34 I;  1RQ0 A;  4DUZ E;  1TF6 A;  1E3H A;  3J7A G;  2Q8U A;  2EOI A;  1R6L A;  4IFD A;  5KL6 A;  3DJW A;  3B78 A;  3HXL A;  4FW9 A;  4DR6 I;  2UUB I;  4MLV A;  4GKK E;  1WHQ A;  2LBS B;  1B69 A;  2GQ0 A;  4R2D A;  4FW5 A;  5C0X B;  4AM3 A;  2NUF A;  4LF7 E;  1FJG I;  2LJU A;  2EMK A;  1N32 I;  4LFA I;  4GZN C;  1QU6 A;  5K36 A;  1PJQ A;  1STU A;  2V83 A;  4DR7 E;  2MDR A;  3V2U C;  2EN1 A;  2JOX A;  3P06 A;  2YT4 A;  2Z5B B;  1PDA A;  4FWD A;  5AC5 A;  1XMQ E;  3M7N G;  2CPN A;  4YHH E;  5C0X D;  4R2Q A;  3PRY A;  2EZ6 A;  4ZVI A;  1T4O A;  5DRR A;  4QNJ A;  5JEA A;  3C4T A;  1HR0 E;  3MHH C;  1SFE A;  1Y60 A;  4OO1 A;  1NZ0 A;  2V86 A;  5FLX Q;  3QT5 A;  4DR4 E;  3L00 A;  1U2R A;  3CDI A;  2EOH A;  4IZJ A;  2MKD A;  4BMJ A;  4IFD F;  2NN6 B;  1ZU1 A;  2EOF A;  2EPM X;  2E5L I;  4R2P A;  2LV2 A;  2UUC I;  2WCC 3;  4O43 A;  4DR3 I;  2EOM A;  4R2S A;  4L5N C;  1J26 A;  5A6B A;  1YFH A;  4M1K A;  1UDN A;  5A6K A;  2LUP B;  3ADL A;  2JE6 B;  2BB8 A;  2EM3 A;  1HNX I;  2UXB E;  1MG7 A;  2WZO A;  4DUY I;  2DSY A;  2GHF A;  2YTP A;  1IBK E;  5FLX C;  2V2Q A;  3HUL A;  2EM2 A;  2N3G A;  4B3S E;  2NN6 F;  1N3G A;  4DPU A;  3BF2 A;  5ADZ A;  5DNY A;  2NAB A;  2BA1 D;  4OX9 E;  2ZIT A;  4OKG A;  4QNK A;  4IFD C;  1Z0C A;  2YTD A;  4WSP A;  1YPN A;  1IBL E;  2WW4 A;  5JEA F;  1X5W A;  1Y5Y A;  1G2D C;  2V85 A;  1FWK A;  1Z0T A;  2O1V A;  4FN5 A;  2EML A;  5KL3 A;  2K7I A;  2UXD E;  1ZBQ A;  4DPX A;  5LLQ A;  2HFU A;  2IES A;  4FW4 A;  1WXR A;  2LJH A;  4DV3 I;  1R6M A;  2B7T A;  2EM5 A;  5K36 C;  4DV2 I;  2LT7 A;  4WUC A;  3OTO I;  2Z5C B;  1KTV A;  4B3M I;  3J80 Q;  1WRJ A;  3HPZ A;  2YZT A;  1EKZ A;  4IZK B;  1EH7 A;  5K36 E;  1USU A;  3VHT B;  2JYA A;  2N8X A;  2NA2 A;  4R2E A;  1T39 A;  5IV8 B;  4DV4 I;  5JEA C;  3BBG A;  3P3E A;  4KWY A;  2O3Z A;  4B3R I;  4OO1 C;  2JEB A;  3PYD A;  2JR1 A;  4ZYG A;  1YHC A;  2PNZ A;  5IWA I;  5DRO A;  4DPY A;  2WP8 A;  4F6N A;  2DLK A;  5LMU E;  3MSW A;  4OO1 E;  2YRM A;  1GTK A;  3P1X A;  4N4R B;  4DR1 E;  1VIS A;  4JI7 I;  2ODR C;  3J80 C;  1FNM A;  2EPK X;  1N36 E;  2PO2 B;  2R42 A;  4BA1 B;  3J81 C;  3FIG A;  4LFC I;  4DV7 I;  4Z7Y A;  3HPS A;  4WXC A;  4DPT A;  2EPA A;  4DV0 E;  4TUG A;  2B9D A;  4LF4 E;  1YYW A;  2DEI A;  4JI8 I;  1PIE A;  3U1K A;  1Z1B A;  1I94 I;  4GKJ I;  1XMO E;  2PO0 B;  4DV5 E;  3K6Q A;  2EPO A;  4BA2 B;  3TQM A;  2RS6 A;  3NZK A;  4GQU A;  2EPX A;  4AQY E;  1N34 E;  3QT7 A;  4U3D A;  2YTE A;  4DU7 A;  1XNQ I;  4MDT A;  2YTF A;  3M85 G;  1XXE A;  4DR2 I;  1HNZ I;  1WUU A;  2YSP A;  2EPP A;  1E3P A;  1N0V C;  2L92 A;  1EI1 A;  5AE3 A;  3J7A M;  1ELO A;  1K47 A;  2EMY A;  2EMG A;  2G7H A;  4DR6 E;  2UUB E;  1EH6 A;  5EKW A;  5L3J A;  4X9J A;  4LFB I;  2EMC A;  1PJT A;  2KHX A;  4HTG A;  2JOB A;  4X8W A;  4NHR A;  1FWL A;  2GLI A;  1N32 E;  2DMY A;  2YTG A;  3H4L A;  4LFA E;  3VYX A;  4BBY A;  1Z5A A;  4BC7 A;  1O0W A;  4LF5 I;  4JI2 I;  4KHP I;  4LF9 I;  4DV6 I;  1PJS A;  1RHY A;  4DMI A;  2M9A A;  2CGE A;  5EL9 A;  3KZY A;  5C0X A;  1P47 A;  2DEJ A;  2H36 X;  3MHS C;  4FW7 A;  1TF3 A;  1XNR I;  2RPC A;  3B4T A;  3GLL A;  3ZZU A;  3JU0 A;  2GO3 A;  2LUQ A;  3AV0 A;  2V88 A;  2VQE I;  3BID A;  4M0V A;  1RMD A;  2CT1 A;  1P42 A;  4DR5 I;  3ADG A;  2Z5B A;  2EMB A;  4F9C B;  1NCS A;  2EM0 A;  5IXM B;  1IMU A;  1PVG A;  4JI1 I;  4PRV A;  2E5L E;  2HC5 A;  2HGH A;  2BA0 D;  2J7J A;  4NXN I;  2BR2 B;  1H74 A;  4DR3 E;  1S4E A;  1YUJ A;  3K17 A;  1DGC A;  5AE2 A;  3PYG A;  1DI2 A;  3Q6M A;  3LML A;  1HNX E;  2HJJ A;  5F3W A;  4ISA A;  1MX0 A;  2EQ1 A;  4DUY E;  1KVK A;  2NN6 A;  2EL5 A;  4I8O A;  1AAY A;  3V5R A;  2RQL A;  4R8O A;  3EPH A;  1Z0G A;  2YTN A;  1IQO A;  2JWO A;  5C0X F;  1X6E A;  4ED4 A;  1YH8 A;  1WHN A;  3U1Y A;  4JV5 I;  3HJC A;  2JE6 A;  2EQ0 A;  2UU9 I;  3CWV A;  2WNR B;  1X6H A;  2RS7 A;  1FKA E;  3M6A A;  3IWC A;  1D6T A;  1IQS A;  1H7U A;  1KKH A;  1Y4U A;  2ZM6 I;  2CSH A;  4TUI A;  2NUG A;  1X47 A;  2M7Q A;  2VQF I;  4DV3 E;  3H09 A;  1Y6Z A;  1T38 A;  3WU4 A;  4DV2 E;  4GEQ B;  3OTO E;  2IOQ A;  2EFG A;  2HHH I;  2EM9 A;  4WPY A;  1A1G A;  2BV3 A;  1A6F A;  1N0U A;  2XEX A;  4F6M A;  2MDG A;  2BM1 A;  4JI6 I;  2EOJ A;  1Z59 A;  1ZBT A;  5C0X C;  1X48 A;  2M4I A;  5KL7 A;  4B3T I;  3ZZT A;  1PKP A;  2VF1 A;  4DKK A;  4DV4 E;  2AJ4 A;  3GME A;  2EOZ A;  2YTI A;  1UDS A;  4B3R E;  1UDQ A;  1Z5B A;  3L7Z B;  4R2A A;  2Z5C A;  4UT4 A;  4JI5 I;  4NXM I;  2V8P A;  2YSO A;  4X65 I;  3EPL A;  5IWA E;  4JYA I;  3M7N D;  1H7S A;  3UK3 C;  5K36 B;  4IZK A;  1Z0W A;  4RHB B;  3AUZ A;  2EN3 A;  2EL6 A;  3J7Y p;  1A1K A;  4IFD D;  2LMZ A;  4JI7 E;  2PRT A;  2F8B A;  2V2Z A;  2F4V I;  2EMA A;  4IFD E;  4MLQ A;  2EM8 A;  4ZYD A;  1DQ3 A;  4LFC E;  4DV7 E;  3K85 A;  5AC4 A;  4FK5 C;  2AE8 A;  4BHB A;  1ZM3 A;  2I9I A;  3CDJ A;  4AIM A;  3VK6 A;  4GKJ E;  1MGT A;  2V89 A;  1I94 E;  5GME A;  1A1H A;  2VE7 C;  4OO1 B;  1HK7 A;  5K36 D;  1ZM9 A;  1USV A;  4DR7 I;  2JP9 A;  1ZM2 A;  2NN6 C;  1UIL A;  1ZM4 A;  3HTX A;  5A2Q Q;  3LNU A;  1QNT A;  1XNQ E;  3ZZ0 A;  4BA1 A;  3J81 Q;  2LRS A;  3BGH A;  4DR2 E;  1YUI A;  4LCH A;  1HNZ E;  2FTX B;  4L8N A;  2ELZ A;  1Z0E A;  4R03 A;  2A2D A;  4MU3 A;  5DNX A;  2UUA I;  2RSM A;  2CG9 A;  3ECR A;  2EM4 A;  5A69 A;  5DRP A;  2LCE A;  1QZR A;  3EQ1 A;  2EMF A;  4LFB E;  1VI7 A;  2J65 A;  2PNL A;  1A1J A;  4HAC A;  4BA2 A;  2ENC A;  3M99 B;  4OO1 D;  4RH8 A;  1Z0B A;  2R3V A;  5JEA E;  4X66 I;  5BR8 I;  2NUE A;  3PS2 A;  4P7D A;  3ADJ A;  4BHC A;  2O1T A;  3P76 A;  1HNW I;  2JPA A;  1A1L A;  3UHM A;  4P52 A;  2EP3 A;  2ODR D;  4LF5 E;  2DB2 A;  5A2Q C;  4JI2 E;  4KHP E;  4LF9 E;  1YYK A;  1UEK A;  2EQ3 A;  5LL6 R;  5A6B D;  2K4V A;  4OZE A;  2EPR A;  2E1R A;  1SR9 A;  2HKE A;  1XNR E;  2MC5 A;  4N3O A;  4F9B B;  1XHK A;  4JI3 I;  4JI4 I;  4LF8 I;  4B3S I;  2FV4 B;  2YRK A;  4ZYE A;  2UXC I;  2X36 A;  2VQE E;  4KZS A;  4DR5 E;  4Q28 A;  2C39 A;  4USK A;  3DD6 A;  5FWK A;  1T4N A;  4WUD A;  2LJP A;  2MKN A;  3C6K A;  1F2I G;  5AE1 A;  5CFF E;  4B3M E;  4JI1 E;  3K1J A;  4JG4 A;  4O24 A;  1IBL I;  4NXN E;  2CVE A;  2EPU A;  1FJG E;  2EOY A;  2YWQ A;  2EE8 A;  1RRE A;  4X64 I;  2EWL A;  1A1F A;  1B62 A;  4J3D A;  2GS8 A;  2IER A;  2R1F A;  1GQE A;  2JEB B;  2RTX A;  1LLM C;  4WSG A;  2OI2 A;  2EMW A;  2L3C A;  4FW3 A;  2C38 B;  2IHR 1;  4IJD A;  2E72 A;  2EN8 A;  1YZ9 A;  2EOE A;  3PYF A;  2IOP A;  3ZKB A;  2JY9 A;  3P3C A;  1IBM I;  4JV5 E;  4FWH A;  3C4B A;  2UU9 E;  3C6M A;  4Z7C A;  3KWR A;  2ZM6 E;  3F0N A;  2HK2 A;  2VF3 A;  2YPN A;  4NZV A;  1L4S A;  2A25 A;  2VQF E;  4YY3 I;  2VRD A;  1MU5 A;  4Q35 B;  2EMH A;  2ADR A;  5DNL A;  2HHH E;  2UUC E;  2LE2 A;  2EM6 A;  2JEA B;  2EPZ A;  2LVH A;  1X3C A;  1Y4S A;  2EMZ A;  1Z0V A;  4JI6 E;  3Q6N A;  2V34 A;  4USM A;  2BM0 A;  1H73 A;  2O1W A;  4B3T E;  4K0K I;  4DV1 I;  3QG5 C;  2EPL X;  2EOS A;  2DGC A;  4IS1 C;  2Q2E B;  2V2V A;  3PYE A;  4MU4 A;  3IWB A;  2PO1 B;  2DIX A;  3THN A;  4JI5 E;  2DMI A;  4NXM E;  2C37 B;  1BBO A;  4X65 E;  4JYA E;  1FI4 A;  4DPW A;  4ZYH A;  2ENH A;  1ZR9 A;  5A6A A;  4LU9 A;  3HKM A;  4LPF A;  1NHI A;  3EPJ A;  3ZKD A;  2L2N A;  4BCA A;  3QT8 A;  3EPK A;  4LTY A;  1J5E I;  2F4V E;  3WU5 A;  2EOX A;  4M2Z A; 
#chains in the Genus database with same CATH homology
 3B82 A;  4LF6 I;  3ZOQ B;  1ZXM A;  3WU3 A;  3ADI A;  4X62 I;  1KIJ A;  1RC7 A;  1B63 A;  1S16 A;  2L2M A;  2NPF A;  1N33 E;  5LMN I;  2UUA E;  2HK3 A;  3T1Y I;  4JI0 I;  3T1H I;  4WUB A;  4BC9 A;  4BS9 A;  2HKJ A;  4MYT A;  2M1S A;  2LTS A;  4DUZ I;  2L6M A;  5BR8 E;  4X66 E;  2B3T B;  2L3J A;  2A2C A;  4FWG A;  1HNW E;  4I3H A;  1UHZ A;  2O1U A;  4J8Z A;  3Q1Q A;  4GKK I;  4M30 A;  4R1F A;  3F6G A;  4LF7 I;  2MC6 A;  4F9A B;  2V8Q B;  4JI8 E;  4PRX A;  3HQ1 A;  3IWD A;  4WYQ B;  4JI3 E;  2PNM A;  4JI4 E;  4LF8 E;  3QT6 A;  2N3H A;  4XTJ A;  2UXC E;  4P7A A;  4IZJ B;  1XMQ I;  2E1M A;  4YHH I;  4HXZ A;  5IT9 Q;  1NHH A;  1HR0 I;  3OML A;  1Z5C A;  1ZXN A;  3VYY A;  4DR4 I;  3DF6 A;  4IZJ D;  4X64 E;  4DU8 A;  4F54 A;  4DV6 E;  2HFS A;  5IT9 C;  3D4J A;  4DXL A;  4EMD A;  2UXB I;  1IBM E;  2B7V A;  1IBK I;  1GZ6 A;  3ZM7 A;  2J7K A;  3JAM Q;  4OX9 I;  4YY3 E;  1NHJ A;  2X7I A;  1YYO A;  5AAS A;  4KQV A;  2V87 A;  2UXD I;  1BKN A;  2KON A;  4OOG C;  5GMD A;  2L33 A;  2KOU A;  3LLH A;  4K0K E;  2LTR A;  4HAC B;  4UTG A;  2L2K B;  5T6J A;  4DV1 E;  1DAR A;  3JAM C;  1EA6 A;  1H72 C;  3GON A;  4HYM A;  4P78 A;  4RPF A;  3LPS A;  2FGG A;  2Z5E A;  4MYU A;  1OJ4 A;  1J5E E;  4HY1 A;  2CZ9 A;  3JTZ A;  4LF6 E;  4URL A;  2ZBK B;  5LMU I;  4PU9 A;  4DR1 I;  4X62 E;  3B8H A;  1T4L B;  2JVA A;  2L8T A;  4WFT A;  1N36 I;  3RMP A;  3LTO A;  3WU6 A;  3F6H A;  4DV0 I;  4LF4 I;  5LMN E;  1X49 A;  3T1Y E;  3T1H E;  4JI0 E;  1RR9 A;  1XMO I;  4DV5 I;  4AQY I;  1N34 I;  1RQ0 A;  4DUZ E;  3J7A G;  3DJW A;  3B78 A;  3HXL A;  4FW9 A;  4DR6 I;  2UUB I;  4GKK E;  1WHQ A;  2LBS B;  2GQ0 A;  2NUF A;  4LF7 E;  1FJG I;  1N32 I;  4LFA I;  1QU6 A;  1STU A;  2V83 A;  4DR7 E;  2MDR A;  3V2U C;  2JOX A;  3P06 A;  2YT4 A;  2Z5B B;  4FWD A;  1XMQ E;  2CPN A;  4YHH E;  3PRY A;  2EZ6 A;  4ZVI A;  1T4O A;  3C4T A;  1HR0 E;  1NZ0 A;  2V86 A;  5FLX Q;  3QT5 A;  4DR4 E;  1U2R A;  4IZJ A;  4BMJ A;  2E5L I;  2UUC I;  4DR3 I;  4L5N C;  1J26 A;  4M1K A;  2LUP B;  3ADL A;  1HNX I;  2UXB E;  1MG7 A;  2WZO A;  4DUY I;  2DSY A;  2V2Q A;  1IBK E;  5FLX C;  3HUL A;  2N3G A;  4B3S E;  4DPU A;  5ADZ A;  5DNY A;  4OX9 E;  2ZIT A;  1Z0C A;  4WSP A;  1IBL E;  2WW4 A;  1Z0T A;  1FWK A;  2V85 A;  2O1V A;  4FN5 A;  2UXD E;  1ZBQ A;  4DPX A;  2HFU A;  1WXR A;  2LJH A;  4DV3 I;  2B7T A;  4DV2 I;  4WUC A;  3OTO I;  2Z5C B;  1KTV A;  3J80 Q;  3HPZ A;  2YZT A;  1EKZ A;  4IZK B;  1USU A;  2NA2 A;  4DV4 I;  4B3R I;  3PYD A;  2JR1 A;  5IWA I;  4DPY A;  5LMU E;  3MSW A;  3P1X A;  4DR1 E;  4JI7 I;  1VIS A;  2ODR C;  3J80 C;  1FNM A;  1N36 E;  2R42 A;  3J81 C;  3FIG A;  4LFC I;  4DV7 I;  4Z7Y A;  3HPS A;  4DPT A;  4DV0 E;  4LF4 E;  4TUG A;  2B9D A;  1YYW A;  2DEI A;  4JI8 I;  4GKJ I;  1PIE A;  1I94 I;  1XMO E;  4DV5 E;  3K6Q A;  2RS6 A;  4AQY E;  1N34 E;  3QT7 A;  4DU7 A;  1XNQ I;  4DR2 I;  1HNZ I;  1WUU A;  1N0V C;  2L92 A;  1EI1 A;  5AE3 A;  3J7A M;  1ELO A;  1K47 A;  2G7H A;  4DR6 E;  2UUB E;  4LFB I;  2KHX A;  4X8W A;  2JOB A;  1FWL A;  1N32 E;  2DMY A;  3H4L A;  4LFA E;  3VYX A;  4BBY A;  1Z5A A;  4BC7 A;  1O0W A;  4LF5 I;  4JI2 I;  4KHP I;  4LF9 I;  4DV6 I;  4DMI A;  2CGE A;  2DEJ A;  2H36 X;  1XNR I;  3ZZU A;  3JU0 A;  2LUQ A;  3AV0 A;  2V88 A;  2VQE I;  4M0V A;  4DR5 I;  3ADG A;  2Z5B A;  1PVG A;  4F9C B;  4B3M I;  4JI1 I;  4PRV A;  2E5L E;  4NXN I;  1H74 A;  4DR3 E;  1S4E A;  3K17 A;  5AE2 A;  3PYG A;  1DI2 A;  3Q6M A;  3LML A;  1HNX E;  5F3W A;  1MX0 A;  4DUY E;  1KVK A;  4I8O A;  3V5R A;  4R8O A;  1Z0G A;  2JWO A;  4ED4 A;  4JV5 I;  1WHN A;  3HJC A;  2UU9 I;  3CWV A;  2RS7 A;  1FKA E;  3M6A A;  3IWC A;  1D6T A;  1H7U A;  1KKH A;  1Y4U A;  2ZM6 I;  4TUI A;  2NUG A;  1X47 A;  2M7Q A;  2VQF I;  4DV3 E;  3H09 A;  1Y6Z A;  3WU4 A;  4DV2 E;  4GEQ B;  3OTO E;  2IOQ A;  2EFG A;  2HHH I;  4WPY A;  2BV3 A;  1A6F A;  1N0U A;  2XEX A;  2BM1 A;  4JI6 I;  1Z59 A;  1ZBT A;  1X48 A;  2M4I A;  4B3T I;  3ZZT A;  1PKP A;  2VF1 A;  4DKK A;  4DV4 E;  2AJ4 A;  4B3R E;  1Z5B A;  2Z5C A;  4UT4 A;  4JI5 I;  4NXM I;  2V8P A;  4X65 I;  5IWA E;  4JYA I;  1H7S A;  4IZK A;  1Z0W A;  3AUZ A;  3J7Y p;  2LMZ A;  4JI7 E;  2F8B A;  2V2Z A;  2F4V I;  1DQ3 A;  4LFC E;  4DV7 E;  3K85 A;  1ZM3 A;  3VK6 A;  4GKJ E;  2V89 A;  1I94 E;  5GME A;  2VE7 C;  1HK7 A;  1ZM9 A;  1USV A;  4DR7 I;  1ZM2 A;  1UIL A;  1ZM4 A;  3HTX A;  5A2Q Q;  3LNU A;  3J81 Q;  1XNQ E;  3ZZ0 A;  2LRS A;  4DR2 E;  5L3J A;  1HNZ E;  2FTX B;  4L8N A;  1Z0E A;  2A2D A;  4R03 A;  2UUA I;  1N33 I;  2RSM A;  2CG9 A;  1QZR A;  4HAC A;  2PNL A;  4LFB E;  2R3V A;  1Z0B A;  5BR8 I;  4X66 I;  2NUE A;  4P7D A;  3ADJ A;  2O1T A;  1HNW I;  4P52 A;  2ODR D;  4LF5 E;  2DB2 A;  5A2Q C;  4JI2 E;  4KHP E;  4LF9 E;  1YYK A;  1UEK A;  5LL6 R;  2K4V A;  2E1R A;  1SR9 A;  2HKE A;  1XNR E;  2MC5 A;  4N3O A;  4F9B B;  1XHK A;  4JI3 I;  4JI4 I;  4LF8 I;  4B3S I;  2FV4 B;  2UXC I;  2X36 A;  2VQE E;  4KZS A;  4DR5 E;  4Q28 A;  4USK A;  5FWK A;  1T4N A;  4WUD A;  2LJP A;  4B3M E;  3K1J A;  1IBL I;  5AE1 A;  5CFF E;  4JI1 E;  4JG4 A;  4NXN E;  1FJG E;  1RRE A;  4X64 I;  2EWL A;  1B62 A;  2GS8 A;  1GQE A;  2RTX A;  2OI2 A;  2L3C A;  2IHR 1;  1YZ9 A;  3PYF A;  2IOP A;  3ZKB A;  2JY9 A;  1IBM I;  4JV5 E;  4FWH A;  3C4B A;  2UU9 E;  4Z7C A;  3KWR A;  2ZM6 E;  3F0N A;  2HK2 A;  2VF3 A;  4YY3 I;  2VQF E;  1MU5 A;  2HHH E;  2UUC E;  2LE2 A;  1Y4S A;  1Z0V A;  4JI6 E;  3Q6N A;  2V34 A;  4USM A;  2BM0 A;  1H73 A;  2O1W A;  4B3T E;  4K0K I;  4DV1 I;  2Q2E B;  2V2V A;  3PYE A;  3IWB A;  2DIX A;  4JI5 E;  4NXM E;  4X65 E;  4JYA E;  1FI4 A;  4DPW A;  4LU9 A;  3ZKD A;  1NHI A;  2L2N A;  4BCA A;  3QT8 A;  4LTY A;  1J5E I;  2F4V E;  3WU5 A;  4M2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...