4JI2E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4ji2E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4ji2E02
1NHHA 2VQFE 2LUPB 1DI2A 4FW9A 4DR3E 4B3RE 1XNRI 4NXNI 1IBKI 4FN5A 4NXME 1DARA 4DR6E 1KTVA 3B8HA 1GQEA 2HHHE 4JI3E 2UXCE 4FWDA 4JG4A 4M1KA 4DR5E 2V2VA 3WU3A 4LF4I 2L3JA 4DV2E 4DU8A 2NA2A 2UXBI 4R1FA 4KHPI 3J7AM 4WUCA 2CPNA 2F4VE 3QT6A 1RR9A 3ZKBA 3WU5A 4XTJA 5LMUE 2HK3A 1T4OA 3K1JA 4DUZE 4DR2I 4DR1E 1FNMA 4DPXA 4B3MI 2YT4A 4JI2E 4LFAE 4YY3I 4M2ZA 4LF8E 3ZKDA 3J7AG 2LJPA 3M6AA 4HACB 4DV6I 1I94E 3WU6A 4LFBE 1YZ9A 5IT9C 1H7UA 2GS8A 2LBSB 1ZBTA 4AQYI 2VQEE 1ZM2A 1Z0WA 4K0KE 2B7TA 2Q2EB 4JI5I 2UXDE 3D4JA 1FJGI 1Z0TA 3T1YE 4OX9I 3VYYA 4X64E 1BKNA 4DV7E 4EMDA 1Z5CA 4X65E 4JI1E 4DV4E 4DR7I 4DR3I 2IHR1 1HNWI 1ELOA 1YYOA 3OTOI 2EZ6A 1N36E 1XMQI 4WFTA 4PU9A 2UUAE 2UUBE 4LF6E 4DV3E 2L2MA 1H74A 4DV1I 1ZXNA 5LMNE 4JV5I 1RC7A 2X7IA 1PVGA 4DPUA 1H72C 4HYMA 3J81Q 5BR8I 1VISA 4DU7A 3VYXA 4USKA 4P7AA 1KVKA 2HFUA 1Z5BA 4B3TE 5CFFE 2X36A 3ADJA 1B62A 4LFCI 2LJHA 2UU9E 1Z0CA 1MG7A 4WYQB 4JI8E 2L2NA 1Z59A 2ZM6I 1S16A 4MYTA 2LTSA 3V2UC 2UUCE 2R42A 2E1RA 3WU4A 4JI7E 4LF7E 3P1XA 2E5LE 2EFGA 1HR0E 2NPFA 4DV5E 2OI2A 4JYAI 4RPFA 1U2RA 4DPTA 4B3SI 2VQEI 1N32I 1PIEA 1HNZI 1IBMI 1QZRA 1NHJA 4YHHI 1EI1A 4DUYE 4GKKE 3ADLA 2A2CA 5FLXQ 1RREA 4HACA 3GONA 4JI0I 1N34E 5FLXC 3C4BA 4HY1A 4I3HA 3H4LA 5IWAE 2DMYA 4GKJE 4WUBA 4DPYA 1UEKA 2UUBI 2NUGA 1Z5AA 3ADGA 4DV0I 1X48A 4OOGC 3HTXA 1HNXI 2KHXA 2J7KA 3PYEA 4JI4E 4LF5I 2RSMA 1MU5A 4WUDA 1J5EE 1IBLE 1XNQI 4X62E 4X8WA 5IT9Q 3T1HE 4LF9I 1N33E 4DXLA 4DR4E 3JAMQ 2ZITA 4MYUA 1D6TA 1EA6A 4DKKA 3JAMC 2LRSA 2HFSA 1XMOI 2NUEA 1XNRE 4NXNE 1IBKE 2B7VA 1T4NA 2VQFI 4M30A 4KQVA 4P52A 4B3RI 1N0VC 3K17A 3ZZ0A 1S4EA 3F0NA 4NXMI 4UTGA 4DR6I 2HHHI 4JI3I 3PYFA 2UXCI 1QU6A 1H73A 3ADIA 2A2DA 2UXBE 4KHPE 4DR5I 2JY9A 3QT7A 1K47A 4DV2I 1B63A 2RTXA 2BM1A 5GMDA 2L33A 1ZM3A 2F4VI 4DR2E 2LTRA 2XEXA 4B3ME 5LMUI 3ZZUA 3CWVA 4DUZI 4YY3E 1PKPA 4JI6E 4DR1I 4ED4A 3V5RA 3LPSA 3HULA 1WHNA 4JI2I 1UILA 4LFAI 3J7Yp 3LTOA 4LF8I 2V8PA 2CZ9A 2V2ZA 4FWGA 1I94I 3J80Q 3LNUA 1YYWA 4LFBI 4AQYE 1Z0BA 3J80C 1FI4A 4UT4A 4JI5E 1FJGE 1Z0GA 4OX9E 5A2QQ 5LL6R 2JVAA 2L3CA 4DR7E 4K0KI 5A2QC 2UXDI 1HNWE 3T1YI 1ZM9A 3LLHA 3OTOE 4X64I 4DV7I 1MX0A 1XMQE 4JI1I 4X65I 4DV4I 2N3HA 1Z0EA 1ZXMA 3B78A 1FWLA 2HKJA 1KIJA 2DIXA 1NZ0A 1N36I 2WW4A 4X66E 1X49A 2UUAI 4DV1E 4LF6I 2ZBKB 2VF3A 5GMEA 4JV5E 4DV3I 1UHZA 2B3TB 1FKAE 2DEJA 1ZM4A 3B82A 2BM0A 5BR8E 5LMNI 2BV3A 1XHKA 2RS6A 4LFCE 1YYKA 4PRVA 2L2KB 1A6FA 4B3TI 1FWKA 2LUQA 1NHIA 2ZM6E 2UU9I 1J26A 2V2QA 4JI6I 4USMA 4JI8I 1Z0VA 2R3VA 1N0UA 1WUUA 5L3JA 4JYAE 2UUCI 3ZZTA 4JI7I 1T4LB 4LF7I 2E5LI 4LF4E 4B3SE 1HR0I 1WHQA 3C4TA 1N32E 3PYGA 1HNZE 1X47A 1IBME 3QT5A 4DV5I 1KKHA 2N3GA 4YHHE 1O0WA 2NUFA 3QT8A 4URLA 4HXZA 4DUYI 1OJ4A 4GKKI 4JI0E 4X66I 4Z7CA 4DV0E 4DPWA 1N34I 3Q1QA 5IWAI 4GKJI 1HNXE 4LF5E 2DEIA 4Z7YA 1RQ0A 1XNQE 1STUA 2RS7A 2DB2A 4ZVIA 2HK2A 4DV6E 1EKZA 4JI4I 4PRXA 2HKEA 1J5EI 1IBLI 4LF9E 3ZM7A 3J81C 2AJ4A 4X62I 1H7SA 3T1HI 4FWHA 2MDRA 3PYDA 1N33I 2V34A 1XMOE 4DR4I
chains in the Genus database with same CATH superfamily
4RH8A 1NHHA 2VQFE 4TUGA 2LUPB 1DI2A 4FW9A 1JK1A 4DR3E 3PS3A 2L6MA 2YRKA 2YTQA 4B3RE 3K6QA 1TF6A 2F1DA 4NXNI 1IBKI 1XNRI 2BA1D 1A1GA 4FN5A 4NXME 1T39A 4ZYDA 2K4VA 4DR6E 1DARA 1KTVA 3B8HA 4MQYA 1GQEA 4LU9A 1DGCA 5DRPA 2HHHE 4JI3E 5C0XC 2UXCE 4LCFA 1HK7A 4FWDA 4JG4A 4M1KA 2EM2A 2RSIA 4IFDB 2PO0B 4DR5E 2V2VA 1GZ6A 3WU3A 4LF4I 4NZVA 2L3JA 4DV2E 4DU8A 4HTGA 2EPKX 2H36X 1NEIA 2NA2A 4BHBA 2V8QB 2KOUA 3HQ1A 2UXBI 2EOIA 4R1FA 4KHPI 3J7AM 2GQ0A 3F6HA 4IZKB 4WUCA 2YU5A 1X6FA 2CPNA 2MKDA 2YRHA 2EMYA 1QNTA 3JU0A 2F4VE 2EOOA 3L00A 2M4IA 1R6MA 3QT6A 2EM3A 2WBSA 2EN6A 1RR9A 3ZKBA 2RQLA 3KWRA 3WU5A 4XTJA 5LMUE 2HK3A 2R1FA 1T4OA 2I9IA 3HXLA 4R8OA 3K1JA 4DUZE 4BC9A 4DR2I 4GEQB 2KONA 4DR1E 1FNMA 2EJ4A 4U3BA 2EPAA 4P78A 1X5WA 2B9DA 2YSOA 2K7IA 1B69A 4DPXA 2YT4A 1UDNA 4B3MI 4JI2E 2PO1B 2EQ0A 3P3EA 4LFAE 5F3WA 2WP8A 3TQMA 1TF3A 4YY3I 4M2ZA 4LF8E 1VI7A 3ZKDA 2GLIA 5A69A 3J7AG 5DNXA 3BGHA 2LJUA 5A6KA 2ENAA 2JT2A 4F6MA 2LJPA 2D9HA 2EOZA 3M6AA 4HACB 2VRDA 5JEAE 5K36E 3BF2A 2EMHA 4WXCA 4X9JA 1P42A 4DV6I 4WSPA 1I94E 2Z5BB 4BBYA 4R2SA 3WU6A 4LFBE 1YZ9A 5IT9C 4NBQA 1H7UA 4LOMA 2WZOA 2EQ1A 4P7DA 2NN6E 4EMDA 2GS8A 4DR4I 4Q35B 2FGGA 2LBSB 1ZBTA 2C37A 1P47A 4FW7A 4AQYI 2VQEE 4FW5A 1ZM2A 1Z0WA 2EOHA 4O43A 4K0KE 4F9CB 2B7TA 2Q2EB 4JI5I 3AV0A 2UXDE 3D4JA 4FW6A 1FJGI 4LTYA 2BB8A 3T1YE 1Z0TA 1RMDA 4OX9I 2O1VA 1SR9A 2M7QA 3F6GA 3VYYA 2DMIA 4X64E 1BKNA 2V85A 4DV7E 4X65E 1YUIA 4JI1E 4DV4E 1USUA 1Z5CA 1JK2A 1GTKA 3LMLA 4DR7I 4BHCA 4DR3I 2IHR1 1Y4SA 2EPNA 1HNWI 1ELOA 1AH5A 2LVHA 1YYOA 4IFDE 3OTOI 2IOQA 2EZ6A 1N36E 1Y6ZA 1XMQI 4WFTA 2JPAA 2R42A 4KWYA 4PU9A 2UUAE 5JEAC 2WBUA 2UUBE 4LF6E 2EOFA 5IV8B 4MDTA 3DD6A 5JEAA 2JR1A 5K36A 2L2MA 4DV3E 5A6AA 2EWLA 4IJDA 2PNZA 2LT7A 3EPKA 1H74A 1IQSA 2Z5EA 2YWQA 4DV1I 2JEAA 2EOEA 2YTGA 1ZXNA 4OKGA 5A6JA 2EN4A 5LMNE 1MGTA 4ZYHA 3KRNA 2NN6A 1RC7A 2X7IA 5KL3A 2MDGA 1PVGA 4JV5I 4DPUA 4ISAA 2VF1A 1H72C 4OO1C 4HYMA 2V83A 2GHFA 4F6NA 1IQOA 3J81Q 4I8OA 5BR8I 2CGEA 2E1MA 1A1LA 2EMZA 1RHYA 1VISA 3VYXA 4USKA 4DU7A 4P7AA 1KVKA 2HFUA 1Z5BA 2JE6B 1MEYC 5CFFE 4B3TE 2F8BA 2EMLA 1NCSA 1AAYA 4BMJA 4R2CA 2X36A 3ADJA 1B62A 4LFCI 2LJHA 2UU9E 2C39B 1Z0CA 1MG7A 4WYQB 2EM7A 1USVA 4IFDC 2EORA 2VESA 5K36F 2Z5CB 3HKMA 4JI8E 4HEIA 2YSPA 2L2NA 1Z59A 4IFDA 2PO0A 5DROA 2ZM6I 3KZYA 2EMGA 1OYRA 1S16A 1IMUA 1YH8A 4OO1B 2N8XA 5K36D 2NN6F 4MYTA 1G2DC 2V88A 2LTSA 1LLMC 5KL2A 3V2UC 2YTDA 2IOPA 4IZKA 2UUCE 2YTOA 2EOSA 2EPXA 2Q8UA 2E1RA 4JI7E 2NN6D 2JEBB 4F2JC 3WU4A 4LF7E 3P1XA 2E5LE 2EFGA 1HR0E 2EPOA 2NPFA 1WRJA 4DV5E 2OI2A 3PS1A 4JYAI 2CSHA 2EMFA 2WNRB 2J7JA 4RPFA 5C0XA 1U2RA 4DPTA 4J8ZA 5T6JA 2YTIA 4B3SI 2VQEI 1N32I 1PIEA 1HNZI 2EM6A 1IBMI 1QZRA 1NHJA 1X3CA 3RMPA 3MHHC 3EPJA 1YPNA 4IZJB 4YHHI 1EI1A 2PO1A 4DUYE 1N3GA 1EH8A 4GKKE 4IFDD 4WPYA 2MKNA 4WSGA 2GPIA 4BC7A 2EPPA 4GQUA 5AC4A 3ADLA 2LV2A 4AM3A 2A2CA 5FLXQ 1X6HA 1RREA 4HACA 5EKWA 2O1TA 2WCC3 3GONA 3U1YA 4JI0I 2YPNA 5FLXC 2EMIA 3C4BA 1N34E 2O1WA 1PJTA 2Z5BA 4HY1A 2YU8A 3H4LA 4I3HA 5IWAE 2DMYA 4GKJE 4OZEA 4WUBA 5C0XF 2ENCA 4J3DA 3KZZA 1UEKA 4DPYA 2UUBI 2ELYA 2V89A 2NUGA 1Z5AA 2LCEA 3ADGA 4DV0I 1X48A 2YZTA 4OOGC 4F54A 5C0XD 3HTXA 3HJCA 4N3OA 2KHXA 2J7KA 1HNXI 3PYEA 4JI4E 4LF5I 4BA2B 2RSMA 2IERA 1MU5A 4WUDA 1J5EE 1IBLE 3MSWA 1XNQI 2BBGA 2EM9A 2ODRC 4X62E 4X8WA 4MU4A 5IT9Q 3T1HE 4LF9I 5AE3A 1N33E 4DXLA 4WXDA 4DR4E 3JAMQ 2ZITA 4MYUA 3K85A 1PDAA 1D6TA 1G2FC 1EA6A 4DKKA 3JAMC 2DRPA 4OO1E 4LCHA 2LRSA 2HFSA 2EPRA 2A25A 4KZSA 2NUEA 1XMOI 3M85D 4ZYEA 2YTPA 3MHSC 4NXNE 1IBKE 1XNRE 2B7VA 1T4NA 3ECRA 2VQFI 2FV4B 4M30A 3THOB 3VHTB 3GLLA 5AE1A 4KQVA 2EM0A 2JXPA 4P52A 4B3RI 5DRQA 2L92A 4N4RB 3DF6A 3PS2A 1N0VC 3K17A 3ZZ0A 1S4EA 3F0NA 4NXMI 4UTGA 1ZAAC 4DR6I 3P06A 4AIMA 2HHHI 4JI3I 3PYFA 2UXCI 1QU6A 4GZNC 1H73A 3ADIA 2ODRD 2A2DA 2JE6A 3OMLA 2DGCA 2WBTA 2UXBE 2DSYA 4KHPE 4DR5I 2JY9A 3QT7A 1K47A 2EN3A 2JYAA 2EP3A 1B63A 5KL7A 1XXEA 2C39A 4DV2I 3B4TA 2RTXA 3CDIA 5KL4A 3C6MA 2C38B 2EN1A 2EE8A 2LO3A 2R76A 4WX9A 2Z5CA 2LMZA 2BM1A 3Q6MA 2JWOA 5GMDA 2L33A 1L4SA 4OO1A 1ZM3A 2F4VI 4DR2E 2LTRA 2EOJA 4LCGA 1ZR9A 2XEXA 3IWCA 3DJWA 3IWDA 4B3ME 3P3CA 2MC6A 3CWVA 3ZZUA 5LMUI 3UHMA 2V86A 1SFEA 2JEBA 4NHRA 4DUZI 4YY3E 2AE8A 2L8TA 1PKPA 2EQ3A 2EPMX 4JI6E 2BA1G 3BIDA 3V5RA 4ED4A 4DR1I 3LPSA 1ZU1A 2DLQA 4R2DA 2BA0D 5DNLA 2WNRA 5JEAF 3JTZA 3HULA 1WHNA 2EM8A 4JI2I 1A1KA 1TN9A 1UILA 2M9AA 4LFAI 1UDQA 1A1IA 3J7Yp 3LTOA 2ADRA 2CTDA 5JEAD 3IWBA 3VK6A 1Y4UA 3ZOQB 2V8PA 4LF8I 2CZ9A 4M9VC 2V2ZA 4FWGA 4F9AB 4IZJA 4OO1F 4R2QA 5EL9A 2EM4A 2PRTA 1E3HA 2GO4A 1I94I 3J80Q 2DLKA 3UK3C 3LNUA 5ELWA 1YYWA 1YUJA 4LFBI 4AQYE 2EMCA 3CDJA 5AC5A 1Z0BA 3J80C 1FI4A 2PO2B 3GCMA 4UT4A 4OO1D 4JI5E 2V87A 1FJGE 1Z0GA 3L7ZB 4OX9E 1KYQA 3M7ND 4MU1A 5A2QQ 2MC5A 5LL6R 2JVAA 2L3CA 2EOYA 4BA1A 4DR7E 2EPUA 5AASA 4FW3A 1UBDC 4MLVA 5A2QC 4IFDF 4K0KI 2UXDI 1UN6B 1HNWE 3T1YI 3LLHA 3HPSA 2EOXA 1ZM9A 2YTJA 3OTOE 5DNYA 1EH6A 4X64I 4DMIA 4DV7I 5KL5A 1XMQE 1MX0A 4JI1I 5A6BA 1F2IG 2N3HA 4X65I 1Z0EA 1Y5YA 4DV4I 1ZXMA 2BR2B 1FWLA 4O24A 3B78A 2HKJA 1UDOA 3GMEA 4BA2A 4R2EA 3EPLA 1KIJA 2DIXA 1NZ0A 1N36I 2WW4A 5IXMB 4X66E 4IZJD 4L5NC 1X49A 1BB8A 2UUAI 4DV1E 4LF6I 5KL6A 2ZBKB 2VF3A 5GMEA 4JV5E 2YTEA 2JP9A 4DV3I 1DQ3A 1UHZA 4MU0A 2B3TB 1FKAE 2EL6A 2DEJA 2ELZA 2RPCA 1BBOA 1ZM4A 3B82A 2BM0A 2NABA 3P3GA 5BR8E 2CG9A 2EMXA 1OYSA 5LMNI 2EL4A 1A1FA 2BV3A 5C0XB 2JOBA 2ENHA 4ZYGA 2EPLX 1XHKA 2RS6A 1PJSA 4LFCE 1YYKA 3M85G 3H1CA 4PRVA 4BCAA 2L2KB 3EPHA 5TSEA 5A6BD 2EMBA 4FW4A 4IS1C 1A6FA 4B3TI 1FWKA 2LUQA 4R2PA 1YSAC 2LE2A 1NHIA 2PNMA 2ZM6E 2UU9I 1EH7A 1WXRA 1J26A 2V2QA 2FTXB 4JI6I 2EPZA 4BA1B 1WJPA 2YRMA 2EOMA 1X6EA 4IS9A 4USMA 4JI8I 3QG5C 2YTNA 4M0VA 4RHBB 1Z0VA 1A1HA 1E3PA 2GO3A 2O1UA 2CT1A 2R3VA 3FIGA 1N0UA 1A1JA 1WUUA 5AE2A 5L3JA 1R6LA 2C38A 1YFHA 4JYAE 2HC5A 2J65A 1UDSA 3THNA 2UUCI 3ZZTA 1YHCA 4JI7I 4R2AA 2G7HA 1T4LB 2JOXA 2CVEA 4LF7I 2WP8B 4O4KA 2M1SA 4LF4E 4B3SE 1HR0I 2E5LI 1WHQA 3C4TA 1N32E 3PYGA 1HNZE 1X47A 1IBME 2E72A 3QT5A 1KKHA 4DV5I 2N3GA 5LLQA 4Q28A 4YHHE 3PRYA 1Z1BA 1O0WA 2EN7A 4R2RA 2O3ZA 4R03A 3EQ1A 2NUFA 3QT8A 1PJQA 3U1KA 4URLA 3Q6NA 1T38A 1BBGA 4HXZA 4L8NA 4DUYI 1OJ4A 2PNLA 3H09A 2EMWA 3M99B 4GKKI 2VE7C 4JI0E 2BA0G 2C37B 4F9BB 4TUIA 4BS9A 4MLQA 4O5GA 2EMAA 4FK5C 5K36C 2I13A 4X66I 4Z7CA 4DV0E 1KJKA 4DPWA 1N34I 3C6KA 3Q1QA 5IWAI 2IESA 4GKJI 1ZBQA 1HNXE 1OYPA 2EL5A 4LF5E 2NN6C 2EPCA 2HGHA 2PO2A 4LPFA 2DEIA 4Z7YA 5C0XE 3L7ZA 1RQ0A 1STUA 1XNQE 4U3DA 2RS7A 2DB2A 4ZVIA 4MU3A 5DRRA 2HK2A 4DV6E 2EOQA 1EKZA 4JI4I 3NZKA 4PRXA 2HKEA 2HJJA 1J5EI 1IBLI 3BBGA 4LF9E 4QNJA 3M7NG 3ZM7A 3J81C 5ADZA 2YTFA 2AJ4A 4AIDA 4X62I 3AUZA 5JEAB 5K36B 2PNZB 2EMKA 2EN8A 1H7SA 2EM5A 2BR2A 3T1HI 3HPZA 4FWHA 2MDRA 3PYDA 4QNKA 5FWKA 2JEAB 1N33I 1Y60A 2V34A 2EN2A 1XMOE 2NN6B 3P76A
chains in the Genus database with same CATH topology
1NHHA 2VQFE 4TUGA 2LUPB 1DI2A 4FW9A 4DR3E 2L6MA 4B3RE 3K6QA 1XNRI 4NXNI 1IBKI 4FN5A 4NXME 2K4VA 4DR6E 1DARA 1KTVA 3B8HA 1GQEA 4LU9A 2HHHE 4JI3E 2UXCE 1HK7A 4FWDA 4JG4A 4M1KA 4DR5E 2V2VA 1GZ6A 3WU3A 4LF4I 2L3JA 4DV2E 4DU8A 2H36X 2NA2A 2V8QB 2KOUA 3HQ1A 2UXBI 4R1FA 4KHPI 3J7AM 2GQ0A 3F6HA 4IZKB 4WUCA 2CPNA 2F4VE 3JU0A 2M4IA 3QT6A 1RR9A 3ZKBA 3KWRA 3WU5A 4XTJA 5LMUE 2HK3A 1T4OA 3HXLA 4R8OA 3K1JA 4DUZE 4BC9A 4DR2I 4GEQB 2KONA 4DR1E 1FNMA 4P78A 4DPXA 2B9DA 4B3MI 2YT4A 4JI2E 4LFAE 5F3WA 4YY3I 4M2ZA 4LF8E 3ZKDA 3J7AG 2LJPA 3M6AA 4HACB 4DV6I 4WSPA 1I94E 2Z5BB 4BBYA 3WU6A 4LFBE 1YZ9A 5IT9C 1H7UA 2WZOA 4P7DA 2GS8A 2FGGA 2LBSB 1ZBTA 4AQYI 2VQEE 1ZM2A 1Z0WA 4K0KE 4F9CB 2B7TA 2Q2EB 4JI5I 2UXDE 3AV0A 3D4JA 1FJGI 4LTYA 1Z0TA 3T1YE 4OX9I 2O1VA 1SR9A 2M7QA 3F6GA 3VYYA 4X64E 1BKNA 2V85A 4DV7E 4JI1E 4X65E 1USUA 4DV4E 1Z5CA 4EMDA 4DR7I 3LMLA 4DR3I 2IHR1 1Y4SA 1HNWI 1ELOA 1YYOA 3OTOI 2IOQA 2EZ6A 1N36E 1Y6ZA 1XMQI 4WFTA 4PU9A 2UUAE 2UUBE 4LF6E 2JR1A 4DV3E 2L2MA 2EWLA 1H74A 2Z5EA 4DV1I 1ZXNA 5LMNE 4JV5I 1RC7A 2X7IA 1PVGA 4DPUA 2VF1A 1H72C 4HYMA 2V83A 3J81Q 4I8OA 5BR8I 2CGEA 2E1MA 1VISA 4DU7A 3VYXA 4USKA 4P7AA 1KVKA 2HFUA 1Z5BA 4B3TE 5CFFE 2F8BA 4BMJA 2X36A 3ADJA 1B62A 4LFCI 2LJHA 2UU9E 1Z0CA 1MG7A 4WYQB 1USVA 2Z5CB 4JI8E 2L2NA 1Z59A 2ZM6I 1S16A 4MYTA 2V88A 2LTSA 3V2UC 2IOPA 4IZKA 2UUCE 2R42A 2E1RA 3WU4A 4JI7E 4LF7E 3P1XA 2E5LE 2EFGA 1HR0E 2NPFA 4DV5E 2OI2A 4JYAI 4RPFA 1U2RA 4DPTA 4J8ZA 5T6JA 4B3SI 2VQEI 1N32I 1PIEA 1HNZI 1IBMI 1QZRA 1NHJA 3RMPA 4IZJB 4YHHI 1EI1A 4DUYE 4GKKE 4WPYA 4BC7A 3ADLA 2A2CA 5FLXQ 1RREA 4HACA 2O1TA 3GONA 4JI0I 5FLXC 1N34E 3C4BA 2O1WA 4HY1A 2Z5BA 4I3HA 3H4LA 5IWAE 2DMYA 4GKJE 4WUBA 4DPYA 1UEKA 2UUBI 2V89A 2NUGA 1Z5AA 3ADGA 4DV0I 1X48A 2YZTA 4OOGC 4F54A 3HTXA 3HJCA 4N3OA 2KHXA 2J7KA 1HNXI 3PYEA 4JI4E 4LF5I 2RSMA 1MU5A 4WUDA 1J5EE 1IBLE 3MSWA 1XNQI 2ODRC 4X62E 4X8WA 5IT9Q 3T1HE 4LF9I 5AE3A 1N33E 4DXLA 4DR4E 3JAMQ 2ZITA 4MYUA 3K85A 1D6TA 1EA6A 4DKKA 3JAMC 2LRSA 2HFSA 4KZSA 2NUEA 1XMOI 1XNRE 4NXNE 1IBKE 2B7VA 1T4NA 2VQFI 2FV4B 4M30A 5AE1A 4KQVA 4P52A 4B3RI 2L92A 3DF6A 1N0VC 3K17A 3ZZ0A 1S4EA 3F0NA 4NXMI 4UTGA 4DR6I 3P06A 2HHHI 4JI3I 3PYFA 2UXCI 1QU6A 1H73A 3ADIA 2ODRD 2A2DA 3OMLA 2UXBE 2DSYA 4KHPE 4DR5I 2JY9A 3QT7A 1K47A 4DV2I 1B63A 2RTXA 2Z5CA 2LMZA 2BM1A 3Q6MA 2JWOA 5GMDA 2L33A 1ZM3A 2F4VI 4DR2E 2LTRA 2XEXA 3IWCA 3DJWA 3IWDA 4B3ME 3ZZUA 2MC6A 3CWVA 5LMUI 2V86A 4DUZI 4YY3E 2L8TA 1PKPA 4JI6E 4DR1I 4ED4A 3V5RA 3LPSA 3JTZA 3HULA 1WHNA 4JI2I 1UILA 4LFAI 3J7Yp 3LTOA 4LF8I 3IWBA 3VK6A 1Y4UA 3ZOQB 2V8PA 2CZ9A 2V2ZA 4FWGA 4F9AB 4IZJA 1I94I 3J80Q 3LNUA 1YYWA 4LFBI 4AQYE 1Z0BA 3J80C 1FI4A 4UT4A 4JI5E 2V87A 1FJGE 1Z0GA 4OX9E 5A2QQ 2MC5A 5LL6R 2JVAA 2L3CA 4DR7E 5AASA 4K0KI 5A2QC 2UXDI 1HNWE 3T1YI 3LLHA 3HPSA 1ZM9A 3OTOE 5DNYA 4X64I 4DMIA 4DV7I 1MX0A 1XMQE 4JI1I 4X65I 4DV4I 2N3HA 1Z0EA 1ZXMA 3B78A 1FWLA 2HKJA 1KIJA 2DIXA 1NZ0A 1N36I 2WW4A 4X66E 4IZJD 4L5NC 1X49A 2UUAI 4DV1E 4LF6I 2ZBKB 2VF3A 5GMEA 4JV5E 4DV3I 1DQ3A 1UHZA 2B3TB 1FKAE 2DEJA 1ZM4A 3B82A 2BM0A 5BR8E 2CG9A 5LMNI 2BV3A 2JOBA 1XHKA 2RS6A 4LFCE 1YYKA 4PRVA 4BCAA 2L2KB 1A6FA 4B3TI 1FWKA 2LUQA 2LE2A 1NHIA 2PNMA 2ZM6E 2UU9I 1WXRA 1J26A 2V2QA 2FTXB 4JI6I 4USMA 4JI8I 4M0VA 1Z0VA 2O1UA 2R3VA 3FIGA 1N0UA 1WUUA 5AE2A 5L3JA 4JYAE 2UUCI 3ZZTA 4JI7I 1T4LB 2G7HA 2JOXA 4LF7I 2E5LI 2M1SA 4LF4E 4B3SE 1HR0I 1WHQA 3C4TA 1N32E 3PYGA 1HNZE 1X47A 1IBME 3QT5A 4DV5I 1KKHA 2N3GA 4Q28A 4YHHE 3PRYA 1O0WA 4R03A 2NUFA 3QT8A 4URLA 3Q6NA 4HXZA 4L8NA 4DUYI 1OJ4A 2PNLA 3H09A 4GKKI 2VE7C 4JI0E 4F9BB 4TUIA 4BS9A 4X66I 4Z7CA 4DV0E 4DPWA 1N34I 3Q1QA 5IWAI 4GKJI 1ZBQA 1HNXE 4LF5E 2DEIA 4Z7YA 1RQ0A 1XNQE 1STUA 2RS7A 2DB2A 4ZVIA 2HK2A 4DV6E 1EKZA 4JI4I 4PRXA 2HKEA 1J5EI 1IBLI 4LF9E 3ZM7A 3J81C 5ADZA 2AJ4A 4X62I 3AUZA 1H7SA 3T1HI 3HPZA 4FWHA 2MDRA 3PYDA 5FWKA 1N33I 2V34A 1XMOE 4DR4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHH A;  2VQF E;  2LUP B;  1DI2 A;  4FW9 A;  4DR3 E;  4B3R E;  1XNR I;  4NXN I;  1IBK I;  4FN5 A;  4NXM E;  1DAR A;  4DR6 E;  1KTV A;  3B8H A;  1GQE A;  2HHH E;  4JI3 E;  2UXC E;  4FWD A;  4JG4 A;  4M1K A;  4DR5 E;  2V2V A;  3WU3 A;  4LF4 I;  2L3J A;  4DV2 E;  4DU8 A;  2NA2 A;  2UXB I;  4R1F A;  4KHP I;  3J7A M;  4WUC A;  2CPN A;  2F4V E;  3QT6 A;  1RR9 A;  3ZKB A;  3WU5 A;  4XTJ A;  5LMU E;  2HK3 A;  1T4O A;  3K1J A;  4DUZ E;  4DR2 I;  4DR1 E;  1FNM A;  4DPX A;  4B3M I;  2YT4 A;  4JI2 E;  4LFA E;  4YY3 I;  4M2Z A;  4LF8 E;  3ZKD A;  3J7A G;  2LJP A;  3M6A A;  4HAC B;  4DV6 I;  1I94 E;  3WU6 A;  4LFB E;  1YZ9 A;  5IT9 C;  1H7U A;  2GS8 A;  2LBS B;  1ZBT A;  4AQY I;  2VQE E;  1ZM2 A;  1Z0W A;  4K0K E;  2B7T A;  2Q2E B;  4JI5 I;  2UXD E;  3D4J A;  1FJG I;  1Z0T A;  3T1Y E;  4OX9 I;  3VYY A;  4X64 E;  1BKN A;  4DV7 E;  4EMD A;  1Z5C A;  4X65 E;  4JI1 E;  4DV4 E;  4DR7 I;  4DR3 I;  2IHR 1;  1HNW I;  1ELO A;  1YYO A;  3OTO I;  2EZ6 A;  1N36 E;  1XMQ I;  4WFT A;  4PU9 A;  2UUA E;  2UUB E;  4LF6 E;  4DV3 E;  2L2M A;  1H74 A;  4DV1 I;  1ZXN A;  5LMN E;  4JV5 I;  1RC7 A;  2X7I A;  1PVG A;  4DPU A;  1H72 C;  4HYM A;  3J81 Q;  5BR8 I;  1VIS A;  4DU7 A;  3VYX A;  4USK A;  4P7A A;  1KVK A;  2HFU A;  1Z5B A;  4B3T E;  5CFF E;  2X36 A;  3ADJ A;  1B62 A;  4LFC I;  2LJH A;  2UU9 E;  1Z0C A;  1MG7 A;  4WYQ B;  4JI8 E;  2L2N A;  1Z59 A;  2ZM6 I;  1S16 A;  4MYT A;  2LTS A;  3V2U C;  2UUC E;  2R42 A;  2E1R A;  3WU4 A;  4JI7 E;  4LF7 E;  3P1X A;  2E5L E;  2EFG A;  1HR0 E;  2NPF A;  4DV5 E;  2OI2 A;  4JYA I;  4RPF A;  1U2R A;  4DPT A;  4B3S I;  2VQE I;  1N32 I;  1PIE A;  1HNZ I;  1IBM I;  1QZR A;  1NHJ A;  4YHH I;  1EI1 A;  4DUY E;  4GKK E;  3ADL A;  2A2C A;  5FLX Q;  1RRE A;  4HAC A;  3GON A;  4JI0 I;  1N34 E;  5FLX C;  3C4B A;  4HY1 A;  4I3H A;  3H4L A;  5IWA E;  2DMY A;  4GKJ E;  4WUB A;  4DPY A;  1UEK A;  2UUB I;  2NUG A;  1Z5A A;  3ADG A;  4DV0 I;  1X48 A;  4OOG C;  3HTX A;  1HNX I;  2KHX A;  2J7K A;  3PYE A;  4JI4 E;  4LF5 I;  2RSM A;  1MU5 A;  4WUD A;  1J5E E;  1IBL E;  1XNQ I;  4X62 E;  4X8W A;  5IT9 Q;  3T1H E;  4LF9 I;  1N33 E;  4DXL A;  4DR4 E;  3JAM Q;  2ZIT A;  4MYU A;  1D6T A;  1EA6 A;  4DKK A;  3JAM C;  2LRS A;  2HFS A;  1XMO I;  2NUE A;  1XNR E;  4NXN E;  1IBK E;  2B7V A;  1T4N A;  2VQF I;  4M30 A;  4KQV A;  4P52 A;  4B3R I;  1N0V C;  3K17 A;  3ZZ0 A;  1S4E A;  3F0N A;  4NXM I;  4UTG A;  4DR6 I;  2HHH I;  4JI3 I;  3PYF A;  2UXC I;  1QU6 A;  1H73 A;  3ADI A;  2A2D A;  2UXB E;  4KHP E;  4DR5 I;  2JY9 A;  3QT7 A;  1K47 A;  4DV2 I;  1B63 A;  2RTX A;  2BM1 A;  5GMD A;  2L33 A;  1ZM3 A;  2F4V I;  4DR2 E;  2LTR A;  2XEX A;  4B3M E;  5LMU I;  3ZZU A;  3CWV A;  4DUZ I;  4YY3 E;  1PKP A;  4JI6 E;  4DR1 I;  4ED4 A;  3V5R A;  3LPS A;  3HUL A;  1WHN A;  4JI2 I;  1UIL A;  4LFA I;  3J7Y p;  3LTO A;  4LF8 I;  2V8P A;  2CZ9 A;  2V2Z A;  4FWG A;  1I94 I;  3J80 Q;  3LNU A;  1YYW A;  4LFB I;  4AQY E;  1Z0B A;  3J80 C;  1FI4 A;  4UT4 A;  4JI5 E;  1FJG E;  1Z0G A;  4OX9 E;  5A2Q Q;  5LL6 R;  2JVA A;  2L3C A;  4DR7 E;  4K0K I;  5A2Q C;  2UXD I;  1HNW E;  3T1Y I;  1ZM9 A;  3LLH A;  3OTO E;  4X64 I;  4DV7 I;  1MX0 A;  1XMQ E;  4JI1 I;  4X65 I;  4DV4 I;  2N3H A;  1Z0E A;  1ZXM A;  3B78 A;  1FWL A;  2HKJ A;  1KIJ A;  2DIX A;  1NZ0 A;  1N36 I;  2WW4 A;  4X66 E;  1X49 A;  2UUA I;  4DV1 E;  4LF6 I;  2ZBK B;  2VF3 A;  5GME A;  4JV5 E;  4DV3 I;  1UHZ A;  2B3T B;  1FKA E;  2DEJ A;  1ZM4 A;  3B82 A;  2BM0 A;  5BR8 E;  5LMN I;  2BV3 A;  1XHK A;  2RS6 A;  4LFC E;  1YYK A;  4PRV A;  2L2K B;  1A6F A;  4B3T I;  1FWK A;  2LUQ A;  1NHI A;  2ZM6 E;  2UU9 I;  1J26 A;  2V2Q A;  4JI6 I;  4USM A;  4JI8 I;  1Z0V A;  2R3V A;  1N0U A;  1WUU A;  5L3J A;  4JYA E;  2UUC I;  3ZZT A;  4JI7 I;  1T4L B;  4LF7 I;  2E5L I;  4LF4 E;  4B3S E;  1HR0 I;  1WHQ A;  3C4T A;  1N32 E;  3PYG A;  1HNZ E;  1X47 A;  1IBM E;  3QT5 A;  4DV5 I;  1KKH A;  2N3G A;  4YHH E;  1O0W A;  2NUF A;  3QT8 A;  4URL A;  4HXZ A;  4DUY I;  1OJ4 A;  4GKK I;  4JI0 E;  4X66 I;  4Z7C A;  4DV0 E;  4DPW A;  1N34 I;  3Q1Q A;  5IWA I;  4GKJ I;  1HNX E;  4LF5 E;  2DEI A;  4Z7Y A;  1RQ0 A;  1XNQ E;  1STU A;  2RS7 A;  2DB2 A;  4ZVI A;  2HK2 A;  4DV6 E;  1EKZ A;  4JI4 I;  4PRX A;  2HKE A;  1J5E I;  1IBL I;  4LF9 E;  3ZM7 A;  3J81 C;  2AJ4 A;  4X62 I;  1H7S A;  3T1H I;  4FWH A;  2MDR A;  3PYD A;  1N33 I;  2V34 A;  1XMO E;  4DR4 I; 
#chains in the Genus database with same CATH topology
 4RH8 A;  1NHH A;  2VQF E;  4TUG A;  2LUP B;  1DI2 A;  4FW9 A;  1JK1 A;  4DR3 E;  3PS3 A;  2L6M A;  2YRK A;  2YTQ A;  4B3R E;  3K6Q A;  1TF6 A;  2F1D A;  4NXN I;  1IBK I;  1XNR I;  2BA1 D;  1A1G A;  4FN5 A;  4NXM E;  1T39 A;  4ZYD A;  2K4V A;  4DR6 E;  1DAR A;  1KTV A;  3B8H A;  4MQY A;  1GQE A;  4LU9 A;  1DGC A;  5DRP A;  2HHH E;  4JI3 E;  5C0X C;  2UXC E;  4LCF A;  1HK7 A;  4FWD A;  4JG4 A;  4M1K A;  2EM2 A;  2RSI A;  4IFD B;  2PO0 B;  4DR5 E;  2V2V A;  1GZ6 A;  3WU3 A;  4LF4 I;  4NZV A;  2L3J A;  4DV2 E;  4DU8 A;  4HTG A;  2EPK X;  2H36 X;  1NEI A;  2NA2 A;  4BHB A;  2V8Q B;  2KOU A;  3HQ1 A;  2UXB I;  2EOI A;  4R1F A;  4KHP I;  3J7A M;  2GQ0 A;  3F6H A;  4IZK B;  4WUC A;  2YU5 A;  1X6F A;  2CPN A;  2MKD A;  2YRH A;  2EMY A;  1QNT A;  3JU0 A;  2F4V E;  2EOO A;  3L00 A;  2M4I A;  1R6M A;  3QT6 A;  2EM3 A;  2WBS A;  2EN6 A;  1RR9 A;  3ZKB A;  2RQL A;  3KWR A;  3WU5 A;  4XTJ A;  5LMU E;  2HK3 A;  2R1F A;  1T4O A;  2I9I A;  3HXL A;  4R8O A;  3K1J A;  4DUZ E;  4BC9 A;  4DR2 I;  4GEQ B;  2KON A;  4DR1 E;  1FNM A;  2EJ4 A;  4U3B A;  2EPA A;  4P78 A;  1X5W A;  2B9D A;  2YSO A;  2K7I A;  1B69 A;  4DPX A;  2YT4 A;  1UDN A;  4B3M I;  4JI2 E;  2PO1 B;  2EQ0 A;  3P3E A;  4LFA E;  5F3W A;  2WP8 A;  3TQM A;  1TF3 A;  4YY3 I;  4M2Z A;  4LF8 E;  1VI7 A;  3ZKD A;  2GLI A;  5A69 A;  3J7A G;  5DNX A;  3BGH A;  2LJU A;  5A6K A;  2ENA A;  2JT2 A;  4F6M A;  2LJP A;  2D9H A;  2EOZ A;  3M6A A;  4HAC B;  2VRD A;  5JEA E;  5K36 E;  3BF2 A;  2EMH A;  4WXC A;  4X9J A;  1P42 A;  4DV6 I;  4WSP A;  1I94 E;  2Z5B B;  4BBY A;  4R2S A;  3WU6 A;  4LFB E;  1YZ9 A;  5IT9 C;  4NBQ A;  1H7U A;  4LOM A;  2WZO A;  2EQ1 A;  4P7D A;  2NN6 E;  4EMD A;  2GS8 A;  4DR4 I;  4Q35 B;  2FGG A;  2LBS B;  1ZBT A;  2C37 A;  1P47 A;  4FW7 A;  4AQY I;  2VQE E;  4FW5 A;  1ZM2 A;  1Z0W A;  2EOH A;  4O43 A;  4K0K E;  4F9C B;  2B7T A;  2Q2E B;  4JI5 I;  3AV0 A;  2UXD E;  3D4J A;  4FW6 A;  1FJG I;  4LTY A;  2BB8 A;  3T1Y E;  1Z0T A;  1RMD A;  4OX9 I;  2O1V A;  1SR9 A;  2M7Q A;  3F6G A;  3VYY A;  2DMI A;  4X64 E;  1BKN A;  2V85 A;  4DV7 E;  4X65 E;  1YUI A;  4JI1 E;  4DV4 E;  1USU A;  1Z5C A;  1JK2 A;  1GTK A;  3LML A;  4DR7 I;  4BHC A;  4DR3 I;  2IHR 1;  1Y4S A;  2EPN A;  1HNW I;  1ELO A;  1AH5 A;  2LVH A;  1YYO A;  4IFD E;  3OTO I;  2IOQ A;  2EZ6 A;  1N36 E;  1Y6Z A;  1XMQ I;  4WFT A;  2JPA A;  2R42 A;  4KWY A;  4PU9 A;  2UUA E;  5JEA C;  2WBU A;  2UUB E;  4LF6 E;  2EOF A;  5IV8 B;  4MDT A;  3DD6 A;  5JEA A;  2JR1 A;  5K36 A;  2L2M A;  4DV3 E;  5A6A A;  2EWL A;  4IJD A;  2PNZ A;  2LT7 A;  3EPK A;  1H74 A;  1IQS A;  2Z5E A;  2YWQ A;  4DV1 I;  2JEA A;  2EOE A;  2YTG A;  1ZXN A;  4OKG A;  5A6J A;  2EN4 A;  5LMN E;  1MGT A;  4ZYH A;  3KRN A;  2NN6 A;  1RC7 A;  2X7I A;  5KL3 A;  2MDG A;  1PVG A;  4JV5 I;  4DPU A;  4ISA A;  2VF1 A;  1H72 C;  4OO1 C;  4HYM A;  2V83 A;  2GHF A;  4F6N A;  1IQO A;  3J81 Q;  4I8O A;  5BR8 I;  2CGE A;  2E1M A;  1A1L A;  2EMZ A;  1RHY A;  1VIS A;  3VYX A;  4USK A;  4DU7 A;  4P7A A;  1KVK A;  2HFU A;  1Z5B A;  2JE6 B;  1MEY C;  5CFF E;  4B3T E;  2F8B A;  2EML A;  1NCS A;  1AAY A;  4BMJ A;  4R2C A;  2X36 A;  3ADJ A;  1B62 A;  4LFC I;  2LJH A;  2UU9 E;  2C39 B;  1Z0C A;  1MG7 A;  4WYQ B;  2EM7 A;  1USV A;  4IFD C;  2EOR A;  2VES A;  5K36 F;  2Z5C B;  3HKM A;  4JI8 E;  4HEI A;  2YSP A;  2L2N A;  1Z59 A;  4IFD A;  2PO0 A;  5DRO A;  2ZM6 I;  3KZY A;  2EMG A;  1OYR A;  1S16 A;  1IMU A;  1YH8 A;  4OO1 B;  2N8X A;  5K36 D;  2NN6 F;  4MYT A;  1G2D C;  2V88 A;  2LTS A;  1LLM C;  5KL2 A;  3V2U C;  2YTD A;  2IOP A;  4IZK A;  2UUC E;  2YTO A;  2EOS A;  2EPX A;  2Q8U A;  2E1R A;  4JI7 E;  2NN6 D;  2JEB B;  4F2J C;  3WU4 A;  4LF7 E;  3P1X A;  2E5L E;  2EFG A;  1HR0 E;  2EPO A;  2NPF A;  1WRJ A;  4DV5 E;  2OI2 A;  3PS1 A;  4JYA I;  2CSH A;  2EMF A;  2WNR B;  2J7J A;  4RPF A;  5C0X A;  1U2R A;  4DPT A;  4J8Z A;  5T6J A;  2YTI A;  4B3S I;  2VQE I;  1N32 I;  1PIE A;  1HNZ I;  2EM6 A;  1IBM I;  1QZR A;  1NHJ A;  1X3C A;  3RMP A;  3MHH C;  3EPJ A;  1YPN A;  4IZJ B;  4YHH I;  1EI1 A;  2PO1 A;  4DUY E;  1N3G A;  1EH8 A;  4GKK E;  4IFD D;  4WPY A;  2MKN A;  4WSG A;  2GPI A;  4BC7 A;  2EPP A;  4GQU A;  5AC4 A;  3ADL A;  2LV2 A;  4AM3 A;  2A2C A;  5FLX Q;  1X6H A;  1RRE A;  4HAC A;  5EKW A;  2O1T A;  2WCC 3;  3GON A;  3U1Y A;  4JI0 I;  2YPN A;  5FLX C;  2EMI A;  3C4B A;  1N34 E;  2O1W A;  1PJT A;  2Z5B A;  4HY1 A;  2YU8 A;  3H4L A;  4I3H A;  5IWA E;  2DMY A;  4GKJ E;  4OZE A;  4WUB A;  5C0X F;  2ENC A;  4J3D A;  3KZZ A;  1UEK A;  4DPY A;  2UUB I;  2ELY A;  2V89 A;  2NUG A;  1Z5A A;  2LCE A;  3ADG A;  4DV0 I;  1X48 A;  2YZT A;  4OOG C;  4F54 A;  5C0X D;  3HTX A;  3HJC A;  4N3O A;  2KHX A;  2J7K A;  1HNX I;  3PYE A;  4JI4 E;  4LF5 I;  4BA2 B;  2RSM A;  2IER A;  1MU5 A;  4WUD A;  1J5E E;  1IBL E;  3MSW A;  1XNQ I;  2BBG A;  2EM9 A;  2ODR C;  4X62 E;  4X8W A;  4MU4 A;  5IT9 Q;  3T1H E;  4LF9 I;  5AE3 A;  1N33 E;  4DXL A;  4WXD A;  4DR4 E;  3JAM Q;  2ZIT A;  4MYU A;  3K85 A;  1PDA A;  1D6T A;  1G2F C;  1EA6 A;  4DKK A;  3JAM C;  2DRP A;  4OO1 E;  4LCH A;  2LRS A;  2HFS A;  2EPR A;  2A25 A;  4KZS A;  2NUE A;  1XMO I;  3M85 D;  4ZYE A;  2YTP A;  3MHS C;  4NXN E;  1IBK E;  1XNR E;  2B7V A;  1T4N A;  3ECR A;  2VQF I;  2FV4 B;  4M30 A;  3THO B;  3VHT B;  3GLL A;  5AE1 A;  4KQV A;  2EM0 A;  2JXP A;  4P52 A;  4B3R I;  5DRQ A;  2L92 A;  4N4R B;  3DF6 A;  3PS2 A;  1N0V C;  3K17 A;  3ZZ0 A;  1S4E A;  3F0N A;  4NXM I;  4UTG A;  1ZAA C;  4DR6 I;  3P06 A;  4AIM A;  2HHH I;  4JI3 I;  3PYF A;  2UXC I;  1QU6 A;  4GZN C;  1H73 A;  3ADI A;  2ODR D;  2A2D A;  2JE6 A;  3OML A;  2DGC A;  2WBT A;  2UXB E;  2DSY A;  4KHP E;  4DR5 I;  2JY9 A;  3QT7 A;  1K47 A;  2EN3 A;  2JYA A;  2EP3 A;  1B63 A;  5KL7 A;  1XXE A;  2C39 A;  4DV2 I;  3B4T A;  2RTX A;  3CDI A;  5KL4 A;  3C6M A;  2C38 B;  2EN1 A;  2EE8 A;  2LO3 A;  2R76 A;  4WX9 A;  2Z5C A;  2LMZ A;  2BM1 A;  3Q6M A;  2JWO A;  5GMD A;  2L33 A;  1L4S A;  4OO1 A;  1ZM3 A;  2F4V I;  4DR2 E;  2LTR A;  2EOJ A;  4LCG A;  1ZR9 A;  2XEX A;  3IWC A;  3DJW A;  3IWD A;  4B3M E;  3P3C A;  2MC6 A;  3CWV A;  3ZZU A;  5LMU I;  3UHM A;  2V86 A;  1SFE A;  2JEB A;  4NHR A;  4DUZ I;  4YY3 E;  2AE8 A;  2L8T A;  1PKP A;  2EQ3 A;  2EPM X;  4JI6 E;  2BA1 G;  3BID A;  3V5R A;  4ED4 A;  4DR1 I;  3LPS A;  1ZU1 A;  2DLQ A;  4R2D A;  2BA0 D;  5DNL A;  2WNR A;  5JEA F;  3JTZ A;  3HUL A;  1WHN A;  2EM8 A;  4JI2 I;  1A1K A;  1TN9 A;  1UIL A;  2M9A A;  4LFA I;  1UDQ A;  1A1I A;  3J7Y p;  3LTO A;  2ADR A;  2CTD A;  5JEA D;  3IWB A;  3VK6 A;  1Y4U A;  3ZOQ B;  2V8P A;  4LF8 I;  2CZ9 A;  4M9V C;  2V2Z A;  4FWG A;  4F9A B;  4IZJ A;  4OO1 F;  4R2Q A;  5EL9 A;  2EM4 A;  2PRT A;  1E3H A;  2GO4 A;  1I94 I;  3J80 Q;  2DLK A;  3UK3 C;  3LNU A;  5ELW A;  1YYW A;  1YUJ A;  4LFB I;  4AQY E;  2EMC A;  3CDJ A;  5AC5 A;  1Z0B A;  3J80 C;  1FI4 A;  2PO2 B;  3GCM A;  4UT4 A;  4OO1 D;  4JI5 E;  2V87 A;  1FJG E;  1Z0G A;  3L7Z B;  4OX9 E;  1KYQ A;  3M7N D;  4MU1 A;  5A2Q Q;  2MC5 A;  5LL6 R;  2JVA A;  2L3C A;  2EOY A;  4BA1 A;  4DR7 E;  2EPU A;  5AAS A;  4FW3 A;  1UBD C;  4MLV A;  5A2Q C;  4IFD F;  4K0K I;  2UXD I;  1UN6 B;  1HNW E;  3T1Y I;  3LLH A;  3HPS A;  2EOX A;  1ZM9 A;  2YTJ A;  3OTO E;  5DNY A;  1EH6 A;  4X64 I;  4DMI A;  4DV7 I;  5KL5 A;  1XMQ E;  1MX0 A;  4JI1 I;  5A6B A;  1F2I G;  2N3H A;  4X65 I;  1Z0E A;  1Y5Y A;  4DV4 I;  1ZXM A;  2BR2 B;  1FWL A;  4O24 A;  3B78 A;  2HKJ A;  1UDO A;  3GME A;  4BA2 A;  4R2E A;  3EPL A;  1KIJ A;  2DIX A;  1NZ0 A;  1N36 I;  2WW4 A;  5IXM B;  4X66 E;  4IZJ D;  4L5N C;  1X49 A;  1BB8 A;  2UUA I;  4DV1 E;  4LF6 I;  5KL6 A;  2ZBK B;  2VF3 A;  5GME A;  4JV5 E;  2YTE A;  2JP9 A;  4DV3 I;  1DQ3 A;  1UHZ A;  4MU0 A;  2B3T B;  1FKA E;  2EL6 A;  2DEJ A;  2ELZ A;  2RPC A;  1BBO A;  1ZM4 A;  3B82 A;  2BM0 A;  2NAB A;  3P3G A;  5BR8 E;  2CG9 A;  2EMX A;  1OYS A;  5LMN I;  2EL4 A;  1A1F A;  2BV3 A;  5C0X B;  2JOB A;  2ENH A;  4ZYG A;  2EPL X;  1XHK A;  2RS6 A;  1PJS A;  4LFC E;  1YYK A;  3M85 G;  3H1C A;  4PRV A;  4BCA A;  2L2K B;  3EPH A;  5TSE A;  5A6B D;  2EMB A;  4FW4 A;  4IS1 C;  1A6F A;  4B3T I;  1FWK A;  2LUQ A;  4R2P A;  1YSA C;  2LE2 A;  1NHI A;  2PNM A;  2ZM6 E;  2UU9 I;  1EH7 A;  1WXR A;  1J26 A;  2V2Q A;  2FTX B;  4JI6 I;  2EPZ A;  4BA1 B;  1WJP A;  2YRM A;  2EOM A;  1X6E A;  4IS9 A;  4USM A;  4JI8 I;  3QG5 C;  2YTN A;  4M0V A;  4RHB B;  1Z0V A;  1A1H A;  1E3P A;  2GO3 A;  2O1U A;  2CT1 A;  2R3V A;  3FIG A;  1N0U A;  1A1J A;  1WUU A;  5AE2 A;  5L3J A;  1R6L A;  2C38 A;  1YFH A;  4JYA E;  2HC5 A;  2J65 A;  1UDS A;  3THN A;  2UUC I;  3ZZT A;  1YHC A;  4JI7 I;  4R2A A;  2G7H A;  1T4L B;  2JOX A;  2CVE A;  4LF7 I;  2WP8 B;  4O4K A;  2M1S A;  4LF4 E;  4B3S E;  1HR0 I;  2E5L I;  1WHQ A;  3C4T A;  1N32 E;  3PYG A;  1HNZ E;  1X47 A;  1IBM E;  2E72 A;  3QT5 A;  1KKH A;  4DV5 I;  2N3G A;  5LLQ A;  4Q28 A;  4YHH E;  3PRY A;  1Z1B A;  1O0W A;  2EN7 A;  4R2R A;  2O3Z A;  4R03 A;  3EQ1 A;  2NUF A;  3QT8 A;  1PJQ A;  3U1K A;  4URL A;  3Q6N A;  1T38 A;  1BBG A;  4HXZ A;  4L8N A;  4DUY I;  1OJ4 A;  2PNL A;  3H09 A;  2EMW A;  3M99 B;  4GKK I;  2VE7 C;  4JI0 E;  2BA0 G;  2C37 B;  4F9B B;  4TUI A;  4BS9 A;  4MLQ A;  4O5G A;  2EMA A;  4FK5 C;  5K36 C;  2I13 A;  4X66 I;  4Z7C A;  4DV0 E;  1KJK A;  4DPW A;  1N34 I;  3C6K A;  3Q1Q A;  5IWA I;  2IES A;  4GKJ I;  1ZBQ A;  1HNX E;  1OYP A;  2EL5 A;  4LF5 E;  2NN6 C;  2EPC A;  2HGH A;  2PO2 A;  4LPF A;  2DEI A;  4Z7Y A;  5C0X E;  3L7Z A;  1RQ0 A;  1STU A;  1XNQ E;  4U3D A;  2RS7 A;  2DB2 A;  4ZVI A;  4MU3 A;  5DRR A;  2HK2 A;  4DV6 E;  2EOQ A;  1EKZ A;  4JI4 I;  3NZK A;  4PRX A;  2HKE A;  2HJJ A;  1J5E I;  1IBL I;  3BBG A;  4LF9 E;  4QNJ A;  3M7N G;  3ZM7 A;  3J81 C;  5ADZ A;  2YTF A;  2AJ4 A;  4AID A;  4X62 I;  3AUZ A;  5JEA B;  5K36 B;  2PNZ B;  2EMK A;  2EN8 A;  1H7S A;  2EM5 A;  2BR2 A;  3T1H I;  3HPZ A;  4FWH A;  2MDR A;  3PYD A;  4QNK A;  5FWK A;  2JEA B;  1N33 I;  1Y60 A;  2V34 A;  2EN2 A;  1XMO E;  2NN6 B;  3P76 A; 
#chains in the Genus database with same CATH homology
 1NHH A;  2VQF E;  4TUG A;  2LUP B;  1DI2 A;  4FW9 A;  4DR3 E;  2L6M A;  4B3R E;  3K6Q A;  1XNR I;  4NXN I;  1IBK I;  4FN5 A;  4NXM E;  2K4V A;  4DR6 E;  1DAR A;  1KTV A;  3B8H A;  1GQE A;  4LU9 A;  2HHH E;  4JI3 E;  2UXC E;  1HK7 A;  4FWD A;  4JG4 A;  4M1K A;  4DR5 E;  2V2V A;  1GZ6 A;  3WU3 A;  4LF4 I;  2L3J A;  4DV2 E;  4DU8 A;  2H36 X;  2NA2 A;  2V8Q B;  2KOU A;  3HQ1 A;  2UXB I;  4R1F A;  4KHP I;  3J7A M;  2GQ0 A;  3F6H A;  4IZK B;  4WUC A;  2CPN A;  2F4V E;  3JU0 A;  2M4I A;  3QT6 A;  1RR9 A;  3ZKB A;  3KWR A;  3WU5 A;  4XTJ A;  5LMU E;  2HK3 A;  1T4O A;  3HXL A;  4R8O A;  3K1J A;  4DUZ E;  4BC9 A;  4DR2 I;  4GEQ B;  2KON A;  4DR1 E;  1FNM A;  4P78 A;  4DPX A;  2B9D A;  4B3M I;  2YT4 A;  4JI2 E;  4LFA E;  5F3W A;  4YY3 I;  4M2Z A;  4LF8 E;  3ZKD A;  3J7A G;  2LJP A;  3M6A A;  4HAC B;  4DV6 I;  4WSP A;  1I94 E;  2Z5B B;  4BBY A;  3WU6 A;  4LFB E;  1YZ9 A;  5IT9 C;  1H7U A;  2WZO A;  4P7D A;  2GS8 A;  2FGG A;  2LBS B;  1ZBT A;  4AQY I;  2VQE E;  1ZM2 A;  1Z0W A;  4K0K E;  4F9C B;  2B7T A;  2Q2E B;  4JI5 I;  2UXD E;  3AV0 A;  3D4J A;  1FJG I;  4LTY A;  1Z0T A;  3T1Y E;  4OX9 I;  2O1V A;  1SR9 A;  2M7Q A;  3F6G A;  3VYY A;  4X64 E;  1BKN A;  2V85 A;  4DV7 E;  4JI1 E;  4X65 E;  1USU A;  4DV4 E;  1Z5C A;  4EMD A;  4DR7 I;  3LML A;  4DR3 I;  2IHR 1;  1Y4S A;  1HNW I;  1ELO A;  1YYO A;  3OTO I;  2IOQ A;  2EZ6 A;  1N36 E;  1Y6Z A;  1XMQ I;  4WFT A;  4PU9 A;  2UUA E;  2UUB E;  4LF6 E;  2JR1 A;  4DV3 E;  2L2M A;  2EWL A;  1H74 A;  2Z5E A;  4DV1 I;  1ZXN A;  5LMN E;  4JV5 I;  1RC7 A;  2X7I A;  1PVG A;  4DPU A;  2VF1 A;  1H72 C;  4HYM A;  2V83 A;  3J81 Q;  4I8O A;  5BR8 I;  2CGE A;  2E1M A;  1VIS A;  4DU7 A;  3VYX A;  4USK A;  4P7A A;  1KVK A;  2HFU A;  1Z5B A;  4B3T E;  5CFF E;  2F8B A;  4BMJ A;  2X36 A;  3ADJ A;  1B62 A;  4LFC I;  2LJH A;  2UU9 E;  1Z0C A;  1MG7 A;  4WYQ B;  1USV A;  2Z5C B;  4JI8 E;  2L2N A;  1Z59 A;  2ZM6 I;  1S16 A;  4MYT A;  2V88 A;  2LTS A;  3V2U C;  2IOP A;  4IZK A;  2UUC E;  2R42 A;  2E1R A;  3WU4 A;  4JI7 E;  4LF7 E;  3P1X A;  2E5L E;  2EFG A;  1HR0 E;  2NPF A;  4DV5 E;  2OI2 A;  4JYA I;  4RPF A;  1U2R A;  4DPT A;  4J8Z A;  5T6J A;  4B3S I;  2VQE I;  1N32 I;  1PIE A;  1HNZ I;  1IBM I;  1QZR A;  1NHJ A;  3RMP A;  4IZJ B;  4YHH I;  1EI1 A;  4DUY E;  4GKK E;  4WPY A;  4BC7 A;  3ADL A;  2A2C A;  5FLX Q;  1RRE A;  4HAC A;  2O1T A;  3GON A;  4JI0 I;  5FLX C;  1N34 E;  3C4B A;  2O1W A;  4HY1 A;  2Z5B A;  4I3H A;  3H4L A;  5IWA E;  2DMY A;  4GKJ E;  4WUB A;  4DPY A;  1UEK A;  2UUB I;  2V89 A;  2NUG A;  1Z5A A;  3ADG A;  4DV0 I;  1X48 A;  2YZT A;  4OOG C;  4F54 A;  3HTX A;  3HJC A;  4N3O A;  2KHX A;  2J7K A;  1HNX I;  3PYE A;  4JI4 E;  4LF5 I;  2RSM A;  1MU5 A;  4WUD A;  1J5E E;  1IBL E;  3MSW A;  1XNQ I;  2ODR C;  4X62 E;  4X8W A;  5IT9 Q;  3T1H E;  4LF9 I;  5AE3 A;  1N33 E;  4DXL A;  4DR4 E;  3JAM Q;  2ZIT A;  4MYU A;  3K85 A;  1D6T A;  1EA6 A;  4DKK A;  3JAM C;  2LRS A;  2HFS A;  4KZS A;  2NUE A;  1XMO I;  1XNR E;  4NXN E;  1IBK E;  2B7V A;  1T4N A;  2VQF I;  2FV4 B;  4M30 A;  5AE1 A;  4KQV A;  4P52 A;  4B3R I;  2L92 A;  3DF6 A;  1N0V C;  3K17 A;  3ZZ0 A;  1S4E A;  3F0N A;  4NXM I;  4UTG A;  4DR6 I;  3P06 A;  2HHH I;  4JI3 I;  3PYF A;  2UXC I;  1QU6 A;  1H73 A;  3ADI A;  2ODR D;  2A2D A;  3OML A;  2UXB E;  2DSY A;  4KHP E;  4DR5 I;  2JY9 A;  3QT7 A;  1K47 A;  4DV2 I;  1B63 A;  2RTX A;  2Z5C A;  2LMZ A;  2BM1 A;  3Q6M A;  2JWO A;  5GMD A;  2L33 A;  1ZM3 A;  2F4V I;  4DR2 E;  2LTR A;  2XEX A;  3IWC A;  3DJW A;  3IWD A;  4B3M E;  3ZZU A;  2MC6 A;  3CWV A;  5LMU I;  2V86 A;  4DUZ I;  4YY3 E;  2L8T A;  1PKP A;  4JI6 E;  4DR1 I;  4ED4 A;  3V5R A;  3LPS A;  3JTZ A;  3HUL A;  1WHN A;  4JI2 I;  1UIL A;  4LFA I;  3J7Y p;  3LTO A;  4LF8 I;  3IWB A;  3VK6 A;  1Y4U A;  3ZOQ B;  2V8P A;  2CZ9 A;  2V2Z A;  4FWG A;  4F9A B;  4IZJ A;  1I94 I;  3J80 Q;  3LNU A;  1YYW A;  4LFB I;  4AQY E;  1Z0B A;  3J80 C;  1FI4 A;  4UT4 A;  4JI5 E;  2V87 A;  1FJG E;  1Z0G A;  4OX9 E;  5A2Q Q;  2MC5 A;  5LL6 R;  2JVA A;  2L3C A;  4DR7 E;  5AAS A;  4K0K I;  5A2Q C;  2UXD I;  1HNW E;  3T1Y I;  3LLH A;  3HPS A;  1ZM9 A;  3OTO E;  5DNY A;  4X64 I;  4DMI A;  4DV7 I;  1MX0 A;  1XMQ E;  4JI1 I;  4X65 I;  4DV4 I;  2N3H A;  1Z0E A;  1ZXM A;  3B78 A;  1FWL A;  2HKJ A;  1KIJ A;  2DIX A;  1NZ0 A;  1N36 I;  2WW4 A;  4X66 E;  4IZJ D;  4L5N C;  1X49 A;  2UUA I;  4DV1 E;  4LF6 I;  2ZBK B;  2VF3 A;  5GME A;  4JV5 E;  4DV3 I;  1DQ3 A;  1UHZ A;  2B3T B;  1FKA E;  2DEJ A;  1ZM4 A;  3B82 A;  2BM0 A;  5BR8 E;  2CG9 A;  5LMN I;  2BV3 A;  2JOB A;  1XHK A;  2RS6 A;  4LFC E;  1YYK A;  4PRV A;  4BCA A;  2L2K B;  1A6F A;  4B3T I;  1FWK A;  2LUQ A;  2LE2 A;  1NHI A;  2PNM A;  2ZM6 E;  2UU9 I;  1WXR A;  1J26 A;  2V2Q A;  2FTX B;  4JI6 I;  4USM A;  4JI8 I;  4M0V A;  1Z0V A;  2O1U A;  2R3V A;  3FIG A;  1N0U A;  1WUU A;  5AE2 A;  5L3J A;  4JYA E;  2UUC I;  3ZZT A;  4JI7 I;  1T4L B;  2G7H A;  2JOX A;  4LF7 I;  2E5L I;  2M1S A;  4LF4 E;  4B3S E;  1HR0 I;  1WHQ A;  3C4T A;  1N32 E;  3PYG A;  1HNZ E;  1X47 A;  1IBM E;  3QT5 A;  4DV5 I;  1KKH A;  2N3G A;  4Q28 A;  4YHH E;  3PRY A;  1O0W A;  4R03 A;  2NUF A;  3QT8 A;  4URL A;  3Q6N A;  4HXZ A;  4L8N A;  4DUY I;  1OJ4 A;  2PNL A;  3H09 A;  4GKK I;  2VE7 C;  4JI0 E;  4F9B B;  4TUI A;  4BS9 A;  4X66 I;  4Z7C A;  4DV0 E;  4DPW A;  1N34 I;  3Q1Q A;  5IWA I;  4GKJ I;  1ZBQ A;  1HNX E;  4LF5 E;  2DEI A;  4Z7Y A;  1RQ0 A;  1XNQ E;  1STU A;  2RS7 A;  2DB2 A;  4ZVI A;  2HK2 A;  4DV6 E;  1EKZ A;  4JI4 I;  4PRX A;  2HKE A;  1J5E I;  1IBL I;  4LF9 E;  3ZM7 A;  3J81 C;  5ADZ A;  2AJ4 A;  4X62 I;  3AUZ A;  1H7S A;  3T1H I;  3HPZ A;  4FWH A;  2MDR A;  3PYD A;  5FWK A;  1N33 I;  2V34 A;  1XMO E;  4DR4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...