4DV4I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4I00
4DUZE 2ZM6I 4DR1E 3J81C 1KIJA 1IBLI 1B62A 4P7AA 1N32I 4LFAE 1H72C 4DV6E 4X64I 1K47A 1EI1A 1VISA 1IBMI 3OTOE 4JI8I 1HR0I 1H7UA 5A2QC 4ZVIA 1Z0WA 3QT6A 2UXDI 1Z5BA 3WU3A 1KVKA 1N33E 4B3RI 1PVGA 4PRVA 4X64E 3CWVA 1B63A 4JI8E 4K0KI 3LTOA 3ZKBA 5IWAI 2VF3A 4DU8A 4LF7E 4DR6I 3LPSA 4Z7CA 1Z0CA 2UXCI 4MYTA 4JI3I 4K0KE 2UUBE 4PRXA 2NPFA 2HKJA 4DU7A 1N36I 1WUUA 4DR6E 2E1RA 2UXCE 4JI5I 2AJ4A 1ZXMA 4X66I 4JI3E 4LF4E 4WUBA 4AQYE 5GMDA 3ZM7A 1XHKA 2BM0A 2XEXA 4ED4A 1FWKA 4DR7I 4DV1E 4JI1I 4JI5E 4B3TE 4JI2I 4JYAI 4B3ME 1HNXI 4WUDA 4LF9I 4EMDA 3ZZTA 4DV2E 4DXLA 4YHHI 2V2VA 4JI0E 1XNRI 5LMUI 2J7KA 4JI1E 4LFBE 4DPXA 1IBKI 4GKJI 1U2RA 4DPWA 2ZBKB 4FWDA 2HHHE 4DV3E 4DV4I 4JI6E 1FWLA 3LNUA 2VQEE 1XNRE 4JI7E 5LMUE 4DR4I 3B8HA 4UTGA 3PYDA 3Q1QA 1A6FA 2A2DA 2F4VI 1IBKE 4HY1A 1Z0VA 2GS8A 5LL6R 1H73A 1I94I 4X65I 2UU9I 4DV4E 2ZM6E 4DUYI 5IT9C 2LJPA 4B3SI 1IBLE 1Z0BA 2V8PA 2F4VE 2UUCI 4RPFA 5LMNI 1I94E 4DPUA 1QZRA 4X65E 1XMOI 2UU9E 4DR2I 4PU9A 5BR8I 1N32E 1MX0A 1ZM4A 2HK2A 1S4EA 4B3SE 3ZZUA 5IT9Q 1IBME 2UUCE 1HR0E 3F0NA 3GONA 5FLXQ 2UXBI 5L3JA 2R42A 4KQVA 4DV0I 2UXDE 4B3RE 4JG4A 1ELOA 2UUAI 2DEIA 4JI4I 5IWAE 2UXBE 3ZZ0A 1S16A 4DPYA 1Z5CA 4HACA 3QT7A 4FWHA 4JV5I 2WW4A 1FKAE 2UUAE 4JI4E 3V2UC 3PYFA 4GKKI 3T1HI 1N36E 1N34I 4JV5E 1XNQI 4FWGA 4XTJA 3J7AG 4X66E 1XMQI 4X62I 4NXMI 4DR7E 4LF6I 1N34E 4USMA 4I3HA 4URLA 3PYGA 4JI2E 4Z7YA 1FNMA 1XMQE 1PIEA 4JYAE 2OI2A 4X62E 1J5EI 1HNXE 4LF9E 4NXNI 2BV3A 2HFSA 4LFCI 3T1YI 4YHHE 1BKNA 4DUZI 4FN5A 4DR1I 1NZ0A 3D4JA 1Z0TA 1H7SA 2X36A 3B78A 3J80Q 1J5EE 4GKJE 1ZM3A 1EA6A 3HULA 4HXZA 1OJ4A 4DR5I 1RREA 4LFCE 4P52A 4DR4E 2HFUA 1MG7A 4OX9I 5FLXC 4LFAI 2R3VA 1KKHA 1ZM2A 4DV6I 2ZITA 3OTOI 4DR3I 1ZXNA 4DR5E 2V2ZA 2DEJA 4DUYE 1HNZI 4DV5I 3K1JA 3J81Q 4DPTA 4OX9E 3J7AM 1PKPA 1N33I 3JAMC 2CZ9A 3PYEA 4KHPI 5LMNE 1UEKA 4DR3E 4LF5I 1XMOE 1Z0EA 1D6TA 4DR2E 3V5RA 2A2CA 1HNZE 5BR8E 4LF7I 4DV5E 3K17A 1FI4A 1FJGI 1Z0GA 4DV7I 3B82A 4LF8I 4KHPE 4LF5E 3JAMQ 2UUBI 2E5LI 4DV0E 2HKEA 4UT4A 2V2QA 5A2QQ 3QT8A 4FW9A 4WUCA 1NHJA 2EFGA 3WU6A 1FJGE 4DV7E 1N0VC 4LF8E 4LF4I 1MU5A 4AQYI 4HACB 2E5LE 1ZM9A 4M1KA 4HYMA 4R1FA 4DV1I 3ZKDA 4USKA 4B3TI 3H4LA 2HK3A 4GKKE 4B3MI 3QT5A 2BM1A 3T1HE 3M6AA 4DV2I 3J80C 1XNQE 4JI0I 5GMEA 4MYUA 2VQFI 4LFBI 1NHHA 2X7IA 4YY3I 1NHIA 1Z5AA 4NXME 1HNWI 3WU5A 2HHHI 4LF6E 4DV3I 2V34A 4JI6I 1DARA 2VQEI 4JI7I 1Z59A 1KTVA 2VQFE 3WU4A 2Q2EB 4YY3E 1RR9A 4NXNE 1HNWE 1H74A 3T1YE 1N0UA
chains in the Genus database with same CATH superfamily
4MU3A 4DUZE 1Y4UA 2ZM6I 4DR1E 1KIJA 3PS1A 4OO1F 2Z5CB 2IOQA 3M7ND 1IBLI 5JEAC 1UDQA 1B62A 1Y6ZA 4P7AA 1UDNA 4IZKA 4IZJA 2NN6F 4OKGA 1N32I 2PNMA 2PNLA 5JEAA 3GMEA 4LFAE 1H72C 5DRPA 4DV6E 4X64I 1K47A 1E3HA 1EI1A 1VISA 3NZKA 1OYPA 5DRRA 1IBMI 3OTOE 4JI8I 1HR0I 1H7UA 4IZKB 1Y5YA 5A2QC 4IZJB 4ZVIA 1Z0WA 5JEAB 3QT6A 2UXDI 1Z5BA 3WU3A 4FW7A 1E3PA 1KVKA 1N33E 2GO3A 4B3RI 1PVGA 4PRVA 4X64E 3CWVA 1B63A 4JI8E 4K0KI 2JEBA 3LTOA 4FW4A 3ZKBA 4J3DA 5IWAI 4LCGA 1OYSA 2VF3A 4DU8A 4LF7E 4DR6I 2IESA 3M85G 3GCMA 3LPSA 2IOPA 3PS3A 4Z7CA 1Z0CA 2UXCI 2JEBB 4MYTA 5FWKA 4JI3I 4K0KE 3GLLA 2UUBE 2BA0G 4N3OA 4PRXA 2NPFA 2HKJA 4MQYA 4DU7A 1WUUA 1N36I 4DR6E 2E1RA 4LCHA 3Q6MA 4GQUA 2UXCE 4JI5I 1OYRA 2AJ4A 1ZXMA 4X66I 4JI3E 4LF4E 3K85A 4WUBA 4AQYE 3M7NG 4LPFA 5GMDA 5DROA 3ZM7A 1XHKA 3HJCA 2BM0A 2XEXA 4ED4A 4AM3A 1FWKA 2PO2A 2BR2A 4DR7I 5DNLA 4DV1E 4LCFA 4JI1I 4JI5E 4IZJD 5JEAD 4B3TE 4JI2I 2WP8A 4JYAI 3P3GA 5C0XC 4IFDC 4B3ME 1HNXI 4WUDA 4LF9I 2PO2B 2BR2B 3P06A 4EMDA 3L7ZA 3ZZTA 5DRQA 4DV2E 2Z5EA 4DXLA 5JEAE 4YHHI 2V2VA 4JI0E 1XNRI 2Z5BA 5LMUI 2J7KA 1R6LA 4JI1E 2WP8B 4LFBE 5C0XA 4IFDA 4DPXA 1IBKI 3L7ZB 4GKJI 1U2RA 4DPWA 2ZBKB 4FWDA 2HHHE 2Z5BB 4DV3E 4DV4I 4JI6E 1FWLA 3LNUA 1USVA 2VQEE 1XNRE 4JI7E 4IFDB 5LMUE 4DR4I 2C39A 3KRNA 3B8HA 4UTGA 3PYDA 4MDTA 3Q1QA 5K36E 1A6FA 2A2DA 2F4VI 1IBKE 4HY1A 1Z0VA 2GS8A 5LL6R 1H73A 1I94I 4X65I 2UU9I 2CGEA 4DV4E 2C39B 2ZM6E 4DUYI 5IT9C 2LJPA 4B3SI 1IBLE 1Z0BA 2V8PA 2F4VE 2UUCI 4OO1C 4RPFA 5LMNI 1I94E 4DPUA 1QZRA 4X65E 1XMOI 2UU9E 2JT2A 4DR2I 5K36F 2WNRA 2IERA 3CDIA 4PU9A 5BR8I 1N32E 3DD6A 1MX0A 1ZM4A 2HK2A 1S4EA 4OO1A 4B3SE 3ZZUA 2NN6C 5IT9Q 1IBME 2UUCE 1HR0E 3F0NA 3GONA 5FLXQ 2WNRB 4FW3A 1UDSA 2UXBI 1USUA 5L3JA 2R42A 4KQVA 4DV0I 4OO1B 2J65A 2NN6A 2UXDE 4B3RE 4JG4A 1ELOA 5C0XD 4IFDD 2UUAI 2DEIA 4JI4I 5IWAE 2UXBE 2O3ZA 3ZZ0A 1S16A 2NN6B 4DPYA 2PO1A 4NBQA 1Z5CA 4BA1A 4HACA 3QT7A 4FWHA 4JV5I 2JE6A 2WW4A 3U1KA 1FKAE 2UUAE 4JI4E 2PO1B 3V2UC 4BA1B 2JEAA 3PYFA 4GKKI 1Y4SA 2PNZA 1VI7A 2JE6B 3T1HI 1N36E 1N34I 4JV5E 1XNQI 4FWGA 4XTJA 3J7AG 4X66E 4QNKA 4ISAA 1XMQI 2JEAB 4X62I 2PNZB 5ELWA 4NXMI 4MU4A 4FW5A 4DR7E 4LF6I 4BA2A 1N34E 4USMA 4I3HA 4URLA 1YH8A 2C37A 3PYGA 4JI2E 4Z7YA 1FNMA 4OO1D 1XMQE 1PIEA 4JYAE 2OI2A 4X62E 1J5EI 1HNXE 4LF9E 4NXNI 2BV3A 4BA2B 2HFSA 4LFCI 3T1YI 4YHHE 4OO1E 2C37B 1BKNA 5C0XB 4DUZI 3HKMA 2BA1D 4FN5A 4U3DA 2NN6D 4DR1I 1NZ0A 3D4JA 1Z0TA 3B4TA 1H7SA 5JEAF 2X36A 3B78A 3J80Q 1P42A 1J5EE 4GKJE 3UHMA 1ZM3A 1EA6A 3HULA 4HXZA 1OJ4A 4DR5I 1RREA 4LFCE 4P52A 4LOMA 4DR4E 2HFUA 1MG7A 4OX9I 2GQ0A 5FLXC 3P76A 4LFAI 2R3VA 1KKHA 1ZM2A 4DV6I 2ZITA 3OTOI 4DR3I 1ZXNA 4DR5E 2V2ZA 2DEJA 4DUYE 1HNZI 4DV5I 3K1JA 3J81Q 4DPTA 4OX9E 3J7AM 1PKPA 1N33I 3JAMC 2CZ9A 3PYEA 4KHPI 5LMNE 1UEKA 4DR3E 4LF5I 5DNXA 1XMOE 1Z0EA 1D6TA 4DR2E 3V5RA 2F1DA 2A2CA 3U1YA 1HNZE 5BR8E 4LF7I 4DV5E 5K36C 3PS2A 2GO4A 2AE8A 3K17A 3Q6NA 1YHCA 4MU0A 1FI4A 1FJGI 1Y60A 1Z0GA 4DV7I 3B82A 4LF8I 4KHPE 4LF5E 3JAMQ 3CDJA 5K36A 2UUBI 2E5LI 2O1WA 4DV0E 1RHYA 3H1CA 2HKEA 4UT4A 5C0XE 5EKWA 4U3BA 2V2QA 4IFDE 5A2QQ 1XXEA 3QT8A 4FW9A 4WUCA 1NHJA 2EFGA 3WU6A 1FJGE 2BA1G 2PO0A 4DV7E 1N0VC 4LF8E 5K36B 4OZEA 2C38A 4LF4I 1MU5A 4AQYI 4AIDA 3P3CA 4HACB 3T1YE 2E5LE 2VESA 1ZM9A 3P3EA 1HK7A 4M1KA 2PO0B 4HYMA 4R1FA 1UDOA 4DV1I 2C38B 3ZKDA 4USKA 4B3TI 5C0XF 4IFDF 3H4LA 1R6MA 2HK3A 4GKKE 4B3MI 3QT5A 2CG9A 2BM1A 3T1HE 2O1UA 3M6AA 2CVEA 4DV2I 3J80C 1XNQE 4JI0I 2O1TA 5GMEA 4QNJA 4MYUA 2VQFI 4LFBI 1NHHA 2X7IA 4YY3I 1NHIA 4AIMA 1Z5AA 4NXME 1HNWI 3WU5A 2HHHI 3M85D 4LF6E 3PRYA 4DV3I 2V34A 4JI6I 1DARA 2VQEI 4JI7I 4FW6A 1Z59A 1KTVA 2VQFE 3WU4A 2BA0D 5EL9A 2Q2EB 4MU1A 4IS9A 2O1VA 4YY3E 1RR9A 4NXNE 2Z5CA 2NN6E 1HNWE 1H74A 3J81C 1N0UA 5K36D
chains in the Genus database with same CATH topology
4DUZE 1Y4UA 2ZM6I 4DR1E 3J81C 1KIJA 2Z5CB 2IOQA 1IBLI 1B62A 1Y6ZA 4P7AA 4IZKA 4IZJA 1N32I 2PNMA 2PNLA 4LFAE 1H72C 4DV6E 4X64I 1K47A 1EI1A 1VISA 1IBMI 3OTOE 4JI8I 1HR0I 1H7UA 4IZKB 5A2QC 4IZJB 4ZVIA 1Z0WA 3QT6A 2UXDI 1Z5BA 3WU3A 1KVKA 1N33E 4B3RI 1PVGA 4PRVA 4X64E 3CWVA 1B63A 4JI8E 4K0KI 3LTOA 3ZKBA 5IWAI 2VF3A 4DU8A 4LF7E 4DR6I 3LPSA 2IOPA 4Z7CA 1Z0CA 2UXCI 4MYTA 5FWKA 4JI3I 4K0KE 2UUBE 4N3OA 4PRXA 2NPFA 2HKJA 4DU7A 1N36I 1WUUA 4DR6E 2E1RA 3Q6MA 2UXCE 4JI5I 2AJ4A 1ZXMA 4X66I 4JI3E 4LF4E 3K85A 4WUBA 4AQYE 5GMDA 3ZM7A 1XHKA 3HJCA 2BM0A 2XEXA 4ED4A 1FWKA 4DR7I 4DV1E 4JI1I 4JI5E 4IZJD 4B3TE 4JI2I 4JYAI 4B3ME 1HNXI 4WUDA 4LF9I 3P06A 4EMDA 3ZZTA 4DV2E 2Z5EA 4DXLA 4YHHI 2V2VA 4JI0E 1XNRI 2Z5BA 5LMUI 2J7KA 4JI1E 4LFBE 4DPXA 1IBKI 4GKJI 1U2RA 4DPWA 2ZBKB 4FWDA 2HHHE 2Z5BB 4DV3E 4DV4I 4JI6E 1FWLA 3LNUA 1USVA 2VQEE 1XNRE 4JI7E 5LMUE 4DR4I 3B8HA 4UTGA 3PYDA 3Q1QA 1A6FA 2A2DA 2F4VI 1IBKE 4HY1A 1Z0VA 2GS8A 5LL6R 1H73A 1I94I 4X65I 2UU9I 2CGEA 4DV4E 2ZM6E 4DUYI 5IT9C 2LJPA 4B3SI 1IBLE 1Z0BA 2V8PA 2F4VE 2UUCI 4RPFA 5LMNI 1I94E 4DPUA 1QZRA 4X65E 1XMOI 2UU9E 4DR2I 4PU9A 5BR8I 1N32E 1MX0A 1ZM4A 2HK2A 1S4EA 4B3SE 3ZZUA 5IT9Q 1IBME 2UUCE 1HR0E 3F0NA 3GONA 5FLXQ 2UXBI 1USUA 5L3JA 2R42A 4KQVA 4DV0I 2UXDE 4B3RE 4JG4A 1ELOA 2UUAI 2DEIA 4JI4I 5IWAE 2UXBE 3ZZ0A 1S16A 4DPYA 1Z5CA 4HACA 3QT7A 4FWHA 4JV5I 2WW4A 1FKAE 2UUAE 4JI4E 3V2UC 3PYFA 4GKKI 1Y4SA 3T1HI 1N36E 1N34I 4JV5E 1XNQI 4FWGA 4XTJA 3J7AG 4X66E 1XMQI 4X62I 4NXMI 4DR7E 4LF6I 1N34E 4USMA 4I3HA 4URLA 3PYGA 4JI2E 4Z7YA 1FNMA 1XMQE 1PIEA 4JYAE 2OI2A 4X62E 1J5EI 1HNXE 4LF9E 4NXNI 2BV3A 2HFSA 4LFCI 3T1YI 4YHHE 1BKNA 4DUZI 4FN5A 4DR1I 1NZ0A 3D4JA 1Z0TA 1H7SA 2X36A 3B78A 3J80Q 1J5EE 4GKJE 1ZM3A 1EA6A 3HULA 4HXZA 1OJ4A 4DR5I 1RREA 4LFCE 4P52A 4DR4E 2HFUA 1MG7A 4OX9I 2GQ0A 5FLXC 4LFAI 2R3VA 1KKHA 1ZM2A 4DV6I 2ZITA 3OTOI 4DR3I 1ZXNA 4DR5E 2V2ZA 2DEJA 4DUYE 1HNZI 4DV5I 3K1JA 3J81Q 4DPTA 4OX9E 3J7AM 1PKPA 1N33I 3JAMC 2CZ9A 3PYEA 4KHPI 5LMNE 1UEKA 4DR3E 4LF5I 1XMOE 1Z0EA 1D6TA 4DR2E 3V5RA 2A2CA 1HNZE 5BR8E 4LF7I 4DV5E 3K17A 3Q6NA 1FI4A 1FJGI 1Z0GA 4DV7I 3B82A 4LF8I 4KHPE 4LF5E 3JAMQ 2UUBI 2E5LI 2O1WA 4DV0E 2HKEA 4UT4A 2V2QA 5A2QQ 3QT8A 4FW9A 4WUCA 1NHJA 2EFGA 3WU6A 1FJGE 4DV7E 1N0VC 4LF8E 4LF4I 1MU5A 4AQYI 4HACB 2E5LE 1ZM9A 1HK7A 4M1KA 4HYMA 4R1FA 4DV1I 3ZKDA 4USKA 4B3TI 3H4LA 2HK3A 4GKKE 4B3MI 3QT5A 2CG9A 2BM1A 3T1HE 2O1UA 3M6AA 4DV2I 3J80C 1XNQE 4JI0I 2O1TA 5GMEA 4MYUA 2VQFI 4LFBI 1NHHA 2X7IA 4YY3I 1NHIA 1Z5AA 4NXME 1HNWI 3WU5A 2HHHI 4LF6E 3PRYA 4DV3I 2V34A 4JI6I 1DARA 2VQEI 4JI7I 1Z59A 1KTVA 2VQFE 3WU4A 2Q2EB 2O1VA 4YY3E 1RR9A 4NXNE 2Z5CA 1HNWE 1H74A 3T1YE 1N0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ E;  2ZM6 I;  4DR1 E;  3J81 C;  1KIJ A;  1IBL I;  1B62 A;  4P7A A;  1N32 I;  4LFA E;  1H72 C;  4DV6 E;  4X64 I;  1K47 A;  1EI1 A;  1VIS A;  1IBM I;  3OTO E;  4JI8 I;  1HR0 I;  1H7U A;  5A2Q C;  4ZVI A;  1Z0W A;  3QT6 A;  2UXD I;  1Z5B A;  3WU3 A;  1KVK A;  1N33 E;  4B3R I;  1PVG A;  4PRV A;  4X64 E;  3CWV A;  1B63 A;  4JI8 E;  4K0K I;  3LTO A;  3ZKB A;  5IWA I;  2VF3 A;  4DU8 A;  4LF7 E;  4DR6 I;  3LPS A;  4Z7C A;  1Z0C A;  2UXC I;  4MYT A;  4JI3 I;  4K0K E;  2UUB E;  4PRX A;  2NPF A;  2HKJ A;  4DU7 A;  1N36 I;  1WUU A;  4DR6 E;  2E1R A;  2UXC E;  4JI5 I;  2AJ4 A;  1ZXM A;  4X66 I;  4JI3 E;  4LF4 E;  4WUB A;  4AQY E;  5GMD A;  3ZM7 A;  1XHK A;  2BM0 A;  2XEX A;  4ED4 A;  1FWK A;  4DR7 I;  4DV1 E;  4JI1 I;  4JI5 E;  4B3T E;  4JI2 I;  4JYA I;  4B3M E;  1HNX I;  4WUD A;  4LF9 I;  4EMD A;  3ZZT A;  4DV2 E;  4DXL A;  4YHH I;  2V2V A;  4JI0 E;  1XNR I;  5LMU I;  2J7K A;  4JI1 E;  4LFB E;  4DPX A;  1IBK I;  4GKJ I;  1U2R A;  4DPW A;  2ZBK B;  4FWD A;  2HHH E;  4DV3 E;  4DV4 I;  4JI6 E;  1FWL A;  3LNU A;  2VQE E;  1XNR E;  4JI7 E;  5LMU E;  4DR4 I;  3B8H A;  4UTG A;  3PYD A;  3Q1Q A;  1A6F A;  2A2D A;  2F4V I;  1IBK E;  4HY1 A;  1Z0V A;  2GS8 A;  5LL6 R;  1H73 A;  1I94 I;  4X65 I;  2UU9 I;  4DV4 E;  2ZM6 E;  4DUY I;  5IT9 C;  2LJP A;  4B3S I;  1IBL E;  1Z0B A;  2V8P A;  2F4V E;  2UUC I;  4RPF A;  5LMN I;  1I94 E;  4DPU A;  1QZR A;  4X65 E;  1XMO I;  2UU9 E;  4DR2 I;  4PU9 A;  5BR8 I;  1N32 E;  1MX0 A;  1ZM4 A;  2HK2 A;  1S4E A;  4B3S E;  3ZZU A;  5IT9 Q;  1IBM E;  2UUC E;  1HR0 E;  3F0N A;  3GON A;  5FLX Q;  2UXB I;  5L3J A;  2R42 A;  4KQV A;  4DV0 I;  2UXD E;  4B3R E;  4JG4 A;  1ELO A;  2UUA I;  2DEI A;  4JI4 I;  5IWA E;  2UXB E;  3ZZ0 A;  1S16 A;  4DPY A;  1Z5C A;  4HAC A;  3QT7 A;  4FWH A;  4JV5 I;  2WW4 A;  1FKA E;  2UUA E;  4JI4 E;  3V2U C;  3PYF A;  4GKK I;  3T1H I;  1N36 E;  1N34 I;  4JV5 E;  1XNQ I;  4FWG A;  4XTJ A;  3J7A G;  4X66 E;  1XMQ I;  4X62 I;  4NXM I;  4DR7 E;  4LF6 I;  1N34 E;  4USM A;  4I3H A;  4URL A;  3PYG A;  4JI2 E;  4Z7Y A;  1FNM A;  1XMQ E;  1PIE A;  4JYA E;  2OI2 A;  4X62 E;  1J5E I;  1HNX E;  4LF9 E;  4NXN I;  2BV3 A;  2HFS A;  4LFC I;  3T1Y I;  4YHH E;  1BKN A;  4DUZ I;  4FN5 A;  4DR1 I;  1NZ0 A;  3D4J A;  1Z0T A;  1H7S A;  2X36 A;  3B78 A;  3J80 Q;  1J5E E;  4GKJ E;  1ZM3 A;  1EA6 A;  3HUL A;  4HXZ A;  1OJ4 A;  4DR5 I;  1RRE A;  4LFC E;  4P52 A;  4DR4 E;  2HFU A;  1MG7 A;  4OX9 I;  5FLX C;  4LFA I;  2R3V A;  1KKH A;  1ZM2 A;  4DV6 I;  2ZIT A;  3OTO I;  4DR3 I;  1ZXN A;  4DR5 E;  2V2Z A;  2DEJ A;  4DUY E;  1HNZ I;  4DV5 I;  3K1J A;  3J81 Q;  4DPT A;  4OX9 E;  3J7A M;  1PKP A;  1N33 I;  3JAM C;  2CZ9 A;  3PYE A;  4KHP I;  5LMN E;  1UEK A;  4DR3 E;  4LF5 I;  1XMO E;  1Z0E A;  1D6T A;  4DR2 E;  3V5R A;  2A2C A;  1HNZ E;  5BR8 E;  4LF7 I;  4DV5 E;  3K17 A;  1FI4 A;  1FJG I;  1Z0G A;  4DV7 I;  3B82 A;  4LF8 I;  4KHP E;  4LF5 E;  3JAM Q;  2UUB I;  2E5L I;  4DV0 E;  2HKE A;  4UT4 A;  2V2Q A;  5A2Q Q;  3QT8 A;  4FW9 A;  4WUC A;  1NHJ A;  2EFG A;  3WU6 A;  1FJG E;  4DV7 E;  1N0V C;  4LF8 E;  4LF4 I;  1MU5 A;  4AQY I;  4HAC B;  2E5L E;  1ZM9 A;  4M1K A;  4HYM A;  4R1F A;  4DV1 I;  3ZKD A;  4USK A;  4B3T I;  3H4L A;  2HK3 A;  4GKK E;  4B3M I;  3QT5 A;  2BM1 A;  3T1H E;  3M6A A;  4DV2 I;  3J80 C;  1XNQ E;  4JI0 I;  5GME A;  4MYU A;  2VQF I;  4LFB I;  1NHH A;  2X7I A;  4YY3 I;  1NHI A;  1Z5A A;  4NXM E;  1HNW I;  3WU5 A;  2HHH I;  4LF6 E;  4DV3 I;  2V34 A;  4JI6 I;  1DAR A;  2VQE I;  4JI7 I;  1Z59 A;  1KTV A;  2VQF E;  3WU4 A;  2Q2E B;  4YY3 E;  1RR9 A;  4NXN E;  1HNW E;  1H74 A;  3T1Y E;  1N0U A; 
#chains in the Genus database with same CATH topology
 4MU3 A;  4DUZ E;  1Y4U A;  2ZM6 I;  4DR1 E;  1KIJ A;  3PS1 A;  4OO1 F;  2Z5C B;  2IOQ A;  3M7N D;  1IBL I;  5JEA C;  1UDQ A;  1B62 A;  1Y6Z A;  4P7A A;  1UDN A;  4IZK A;  4IZJ A;  2NN6 F;  4OKG A;  1N32 I;  2PNM A;  2PNL A;  5JEA A;  3GME A;  4LFA E;  1H72 C;  5DRP A;  4DV6 E;  4X64 I;  1K47 A;  1E3H A;  1EI1 A;  1VIS A;  3NZK A;  1OYP A;  5DRR A;  1IBM I;  3OTO E;  4JI8 I;  1HR0 I;  1H7U A;  4IZK B;  1Y5Y A;  5A2Q C;  4IZJ B;  4ZVI A;  1Z0W A;  5JEA B;  3QT6 A;  2UXD I;  1Z5B A;  3WU3 A;  4FW7 A;  1E3P A;  1KVK A;  1N33 E;  2GO3 A;  4B3R I;  1PVG A;  4PRV A;  4X64 E;  3CWV A;  1B63 A;  4JI8 E;  4K0K I;  2JEB A;  3LTO A;  4FW4 A;  3ZKB A;  4J3D A;  5IWA I;  4LCG A;  1OYS A;  2VF3 A;  4DU8 A;  4LF7 E;  4DR6 I;  2IES A;  3M85 G;  3GCM A;  3LPS A;  2IOP A;  3PS3 A;  4Z7C A;  1Z0C A;  2UXC I;  2JEB B;  4MYT A;  5FWK A;  4JI3 I;  4K0K E;  3GLL A;  2UUB E;  2BA0 G;  4N3O A;  4PRX A;  2NPF A;  2HKJ A;  4MQY A;  4DU7 A;  1WUU A;  1N36 I;  4DR6 E;  2E1R A;  4LCH A;  3Q6M A;  4GQU A;  2UXC E;  4JI5 I;  1OYR A;  2AJ4 A;  1ZXM A;  4X66 I;  4JI3 E;  4LF4 E;  3K85 A;  4WUB A;  4AQY E;  3M7N G;  4LPF A;  5GMD A;  5DRO A;  3ZM7 A;  1XHK A;  3HJC A;  2BM0 A;  2XEX A;  4ED4 A;  4AM3 A;  1FWK A;  2PO2 A;  2BR2 A;  4DR7 I;  5DNL A;  4DV1 E;  4LCF A;  4JI1 I;  4JI5 E;  4IZJ D;  5JEA D;  4B3T E;  4JI2 I;  2WP8 A;  4JYA I;  3P3G A;  5C0X C;  4IFD C;  4B3M E;  1HNX I;  4WUD A;  4LF9 I;  2PO2 B;  2BR2 B;  3P06 A;  4EMD A;  3L7Z A;  3ZZT A;  5DRQ A;  4DV2 E;  2Z5E A;  4DXL A;  5JEA E;  4YHH I;  2V2V A;  4JI0 E;  1XNR I;  2Z5B A;  5LMU I;  2J7K A;  1R6L A;  4JI1 E;  2WP8 B;  4LFB E;  5C0X A;  4IFD A;  4DPX A;  1IBK I;  3L7Z B;  4GKJ I;  1U2R A;  4DPW A;  2ZBK B;  4FWD A;  2HHH E;  2Z5B B;  4DV3 E;  4DV4 I;  4JI6 E;  1FWL A;  3LNU A;  1USV A;  2VQE E;  1XNR E;  4JI7 E;  4IFD B;  5LMU E;  4DR4 I;  2C39 A;  3KRN A;  3B8H A;  4UTG A;  3PYD A;  4MDT A;  3Q1Q A;  5K36 E;  1A6F A;  2A2D A;  2F4V I;  1IBK E;  4HY1 A;  1Z0V A;  2GS8 A;  5LL6 R;  1H73 A;  1I94 I;  4X65 I;  2UU9 I;  2CGE A;  4DV4 E;  2C39 B;  2ZM6 E;  4DUY I;  5IT9 C;  2LJP A;  4B3S I;  1IBL E;  1Z0B A;  2V8P A;  2F4V E;  2UUC I;  4OO1 C;  4RPF A;  5LMN I;  1I94 E;  4DPU A;  1QZR A;  4X65 E;  1XMO I;  2UU9 E;  2JT2 A;  4DR2 I;  5K36 F;  2WNR A;  2IER A;  3CDI A;  4PU9 A;  5BR8 I;  1N32 E;  3DD6 A;  1MX0 A;  1ZM4 A;  2HK2 A;  1S4E A;  4OO1 A;  4B3S E;  3ZZU A;  2NN6 C;  5IT9 Q;  1IBM E;  2UUC E;  1HR0 E;  3F0N A;  3GON A;  5FLX Q;  2WNR B;  4FW3 A;  1UDS A;  2UXB I;  1USU A;  5L3J A;  2R42 A;  4KQV A;  4DV0 I;  4OO1 B;  2J65 A;  2NN6 A;  2UXD E;  4B3R E;  4JG4 A;  1ELO A;  5C0X D;  4IFD D;  2UUA I;  2DEI A;  4JI4 I;  5IWA E;  2UXB E;  2O3Z A;  3ZZ0 A;  1S16 A;  2NN6 B;  4DPY A;  2PO1 A;  4NBQ A;  1Z5C A;  4BA1 A;  4HAC A;  3QT7 A;  4FWH A;  4JV5 I;  2JE6 A;  2WW4 A;  3U1K A;  1FKA E;  2UUA E;  4JI4 E;  2PO1 B;  3V2U C;  4BA1 B;  2JEA A;  3PYF A;  4GKK I;  1Y4S A;  2PNZ A;  1VI7 A;  2JE6 B;  3T1H I;  1N36 E;  1N34 I;  4JV5 E;  1XNQ I;  4FWG A;  4XTJ A;  3J7A G;  4X66 E;  4QNK A;  4ISA A;  1XMQ I;  2JEA B;  4X62 I;  2PNZ B;  5ELW A;  4NXM I;  4MU4 A;  4FW5 A;  4DR7 E;  4LF6 I;  4BA2 A;  1N34 E;  4USM A;  4I3H A;  4URL A;  1YH8 A;  2C37 A;  3PYG A;  4JI2 E;  4Z7Y A;  1FNM A;  4OO1 D;  1XMQ E;  1PIE A;  4JYA E;  2OI2 A;  4X62 E;  1J5E I;  1HNX E;  4LF9 E;  4NXN I;  2BV3 A;  4BA2 B;  2HFS A;  4LFC I;  3T1Y I;  4YHH E;  4OO1 E;  2C37 B;  1BKN A;  5C0X B;  4DUZ I;  3HKM A;  2BA1 D;  4FN5 A;  4U3D A;  2NN6 D;  4DR1 I;  1NZ0 A;  3D4J A;  1Z0T A;  3B4T A;  1H7S A;  5JEA F;  2X36 A;  3B78 A;  3J80 Q;  1P42 A;  1J5E E;  4GKJ E;  3UHM A;  1ZM3 A;  1EA6 A;  3HUL A;  4HXZ A;  1OJ4 A;  4DR5 I;  1RRE A;  4LFC E;  4P52 A;  4LOM A;  4DR4 E;  2HFU A;  1MG7 A;  4OX9 I;  2GQ0 A;  5FLX C;  3P76 A;  4LFA I;  2R3V A;  1KKH A;  1ZM2 A;  4DV6 I;  2ZIT A;  3OTO I;  4DR3 I;  1ZXN A;  4DR5 E;  2V2Z A;  2DEJ A;  4DUY E;  1HNZ I;  4DV5 I;  3K1J A;  3J81 Q;  4DPT A;  4OX9 E;  3J7A M;  1PKP A;  1N33 I;  3JAM C;  2CZ9 A;  3PYE A;  4KHP I;  5LMN E;  1UEK A;  4DR3 E;  4LF5 I;  5DNX A;  1XMO E;  1Z0E A;  1D6T A;  4DR2 E;  3V5R A;  2F1D A;  2A2C A;  3U1Y A;  1HNZ E;  5BR8 E;  4LF7 I;  4DV5 E;  5K36 C;  3PS2 A;  2GO4 A;  2AE8 A;  3K17 A;  3Q6N A;  1YHC A;  4MU0 A;  1FI4 A;  1FJG I;  1Y60 A;  1Z0G A;  4DV7 I;  3B82 A;  4LF8 I;  4KHP E;  4LF5 E;  3JAM Q;  3CDJ A;  5K36 A;  2UUB I;  2E5L I;  2O1W A;  4DV0 E;  1RHY A;  3H1C A;  2HKE A;  4UT4 A;  5C0X E;  5EKW A;  4U3B A;  2V2Q A;  4IFD E;  5A2Q Q;  1XXE A;  3QT8 A;  4FW9 A;  4WUC A;  1NHJ A;  2EFG A;  3WU6 A;  1FJG E;  2BA1 G;  2PO0 A;  4DV7 E;  1N0V C;  4LF8 E;  5K36 B;  4OZE A;  2C38 A;  4LF4 I;  1MU5 A;  4AQY I;  4AID A;  3P3C A;  4HAC B;  3T1Y E;  2E5L E;  2VES A;  1ZM9 A;  3P3E A;  1HK7 A;  4M1K A;  2PO0 B;  4HYM A;  4R1F A;  1UDO A;  4DV1 I;  2C38 B;  3ZKD A;  4USK A;  4B3T I;  5C0X F;  4IFD F;  3H4L A;  1R6M A;  2HK3 A;  4GKK E;  4B3M I;  3QT5 A;  2CG9 A;  2BM1 A;  3T1H E;  2O1U A;  3M6A A;  2CVE A;  4DV2 I;  3J80 C;  1XNQ E;  4JI0 I;  2O1T A;  5GME A;  4QNJ A;  4MYU A;  2VQF I;  4LFB I;  1NHH A;  2X7I A;  4YY3 I;  1NHI A;  4AIM A;  1Z5A A;  4NXM E;  1HNW I;  3WU5 A;  2HHH I;  3M85 D;  4LF6 E;  3PRY A;  4DV3 I;  2V34 A;  4JI6 I;  1DAR A;  2VQE I;  4JI7 I;  4FW6 A;  1Z59 A;  1KTV A;  2VQF E;  3WU4 A;  2BA0 D;  5EL9 A;  2Q2E B;  4MU1 A;  4IS9 A;  2O1V A;  4YY3 E;  1RR9 A;  4NXN E;  2Z5C A;  2NN6 E;  1HNW E;  1H74 A;  3J81 C;  1N0U A;  5K36 D; 
#chains in the Genus database with same CATH homology
 4DUZ E;  1Y4U A;  2ZM6 I;  4DR1 E;  3J81 C;  1KIJ A;  2Z5C B;  2IOQ A;  1IBL I;  1B62 A;  1Y6Z A;  4P7A A;  4IZK A;  4IZJ A;  1N32 I;  2PNM A;  2PNL A;  4LFA E;  1H72 C;  4DV6 E;  4X64 I;  1K47 A;  1EI1 A;  1VIS A;  1IBM I;  3OTO E;  4JI8 I;  1HR0 I;  1H7U A;  4IZK B;  5A2Q C;  4IZJ B;  4ZVI A;  1Z0W A;  3QT6 A;  2UXD I;  1Z5B A;  3WU3 A;  1KVK A;  1N33 E;  4B3R I;  1PVG A;  4PRV A;  4X64 E;  3CWV A;  1B63 A;  4JI8 E;  4K0K I;  3LTO A;  3ZKB A;  5IWA I;  2VF3 A;  4DU8 A;  4LF7 E;  4DR6 I;  3LPS A;  2IOP A;  4Z7C A;  1Z0C A;  2UXC I;  4MYT A;  5FWK A;  4JI3 I;  4K0K E;  2UUB E;  4N3O A;  4PRX A;  2NPF A;  2HKJ A;  4DU7 A;  1N36 I;  1WUU A;  4DR6 E;  2E1R A;  3Q6M A;  2UXC E;  4JI5 I;  2AJ4 A;  1ZXM A;  4X66 I;  4JI3 E;  4LF4 E;  3K85 A;  4WUB A;  4AQY E;  5GMD A;  3ZM7 A;  1XHK A;  3HJC A;  2BM0 A;  2XEX A;  4ED4 A;  1FWK A;  4DR7 I;  4DV1 E;  4JI1 I;  4JI5 E;  4IZJ D;  4B3T E;  4JI2 I;  4JYA I;  4B3M E;  1HNX I;  4WUD A;  4LF9 I;  3P06 A;  4EMD A;  3ZZT A;  4DV2 E;  2Z5E A;  4DXL A;  4YHH I;  2V2V A;  4JI0 E;  1XNR I;  2Z5B A;  5LMU I;  2J7K A;  4JI1 E;  4LFB E;  4DPX A;  1IBK I;  4GKJ I;  1U2R A;  4DPW A;  2ZBK B;  4FWD A;  2HHH E;  2Z5B B;  4DV3 E;  4DV4 I;  4JI6 E;  1FWL A;  3LNU A;  1USV A;  2VQE E;  1XNR E;  4JI7 E;  5LMU E;  4DR4 I;  3B8H A;  4UTG A;  3PYD A;  3Q1Q A;  1A6F A;  2A2D A;  2F4V I;  1IBK E;  4HY1 A;  1Z0V A;  2GS8 A;  5LL6 R;  1H73 A;  1I94 I;  4X65 I;  2UU9 I;  2CGE A;  4DV4 E;  2ZM6 E;  4DUY I;  5IT9 C;  2LJP A;  4B3S I;  1IBL E;  1Z0B A;  2V8P A;  2F4V E;  2UUC I;  4RPF A;  5LMN I;  1I94 E;  4DPU A;  1QZR A;  4X65 E;  1XMO I;  2UU9 E;  4DR2 I;  4PU9 A;  5BR8 I;  1N32 E;  1MX0 A;  1ZM4 A;  2HK2 A;  1S4E A;  4B3S E;  3ZZU A;  5IT9 Q;  1IBM E;  2UUC E;  1HR0 E;  3F0N A;  3GON A;  5FLX Q;  2UXB I;  1USU A;  5L3J A;  2R42 A;  4KQV A;  4DV0 I;  2UXD E;  4B3R E;  4JG4 A;  1ELO A;  2UUA I;  2DEI A;  4JI4 I;  5IWA E;  2UXB E;  3ZZ0 A;  1S16 A;  4DPY A;  1Z5C A;  4HAC A;  3QT7 A;  4FWH A;  4JV5 I;  2WW4 A;  1FKA E;  2UUA E;  4JI4 E;  3V2U C;  3PYF A;  4GKK I;  1Y4S A;  3T1H I;  1N36 E;  1N34 I;  4JV5 E;  1XNQ I;  4FWG A;  4XTJ A;  3J7A G;  4X66 E;  1XMQ I;  4X62 I;  4NXM I;  4DR7 E;  4LF6 I;  1N34 E;  4USM A;  4I3H A;  4URL A;  3PYG A;  4JI2 E;  4Z7Y A;  1FNM A;  1XMQ E;  1PIE A;  4JYA E;  2OI2 A;  4X62 E;  1J5E I;  1HNX E;  4LF9 E;  4NXN I;  2BV3 A;  2HFS A;  4LFC I;  3T1Y I;  4YHH E;  1BKN A;  4DUZ I;  4FN5 A;  4DR1 I;  1NZ0 A;  3D4J A;  1Z0T A;  1H7S A;  2X36 A;  3B78 A;  3J80 Q;  1J5E E;  4GKJ E;  1ZM3 A;  1EA6 A;  3HUL A;  4HXZ A;  1OJ4 A;  4DR5 I;  1RRE A;  4LFC E;  4P52 A;  4DR4 E;  2HFU A;  1MG7 A;  4OX9 I;  2GQ0 A;  5FLX C;  4LFA I;  2R3V A;  1KKH A;  1ZM2 A;  4DV6 I;  2ZIT A;  3OTO I;  4DR3 I;  1ZXN A;  4DR5 E;  2V2Z A;  2DEJ A;  4DUY E;  1HNZ I;  4DV5 I;  3K1J A;  3J81 Q;  4DPT A;  4OX9 E;  3J7A M;  1PKP A;  1N33 I;  3JAM C;  2CZ9 A;  3PYE A;  4KHP I;  5LMN E;  1UEK A;  4DR3 E;  4LF5 I;  1XMO E;  1Z0E A;  1D6T A;  4DR2 E;  3V5R A;  2A2C A;  1HNZ E;  5BR8 E;  4LF7 I;  4DV5 E;  3K17 A;  3Q6N A;  1FI4 A;  1FJG I;  1Z0G A;  4DV7 I;  3B82 A;  4LF8 I;  4KHP E;  4LF5 E;  3JAM Q;  2UUB I;  2E5L I;  2O1W A;  4DV0 E;  2HKE A;  4UT4 A;  2V2Q A;  5A2Q Q;  3QT8 A;  4FW9 A;  4WUC A;  1NHJ A;  2EFG A;  3WU6 A;  1FJG E;  4DV7 E;  1N0V C;  4LF8 E;  4LF4 I;  1MU5 A;  4AQY I;  4HAC B;  2E5L E;  1ZM9 A;  1HK7 A;  4M1K A;  4HYM A;  4R1F A;  4DV1 I;  3ZKD A;  4USK A;  4B3T I;  3H4L A;  2HK3 A;  4GKK E;  4B3M I;  3QT5 A;  2CG9 A;  2BM1 A;  3T1H E;  2O1U A;  3M6A A;  4DV2 I;  3J80 C;  1XNQ E;  4JI0 I;  2O1T A;  5GME A;  4MYU A;  2VQF I;  4LFB I;  1NHH A;  2X7I A;  4YY3 I;  1NHI A;  1Z5A A;  4NXM E;  1HNW I;  3WU5 A;  2HHH I;  4LF6 E;  3PRY A;  4DV3 I;  2V34 A;  4JI6 I;  1DAR A;  2VQE I;  4JI7 I;  1Z59 A;  1KTV A;  2VQF E;  3WU4 A;  2Q2E B;  2O1V A;  4YY3 E;  1RR9 A;  4NXN E;  2Z5C A;  1HNW E;  1H74 A;  3T1Y E;  1N0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...