4DV4I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4I00
1H72C 4JG4A 4DPYA 4JI3I 4JV5E 3J7AM 1N36E 3LTOA 2UXBE 4JI2I 2E5LE 2NPFA 3B8HA 3GONA 5LMUE 1HNZI 4RPFA 4DR2I 1XMQE 4KQVA 1XNRE 4NXNI 1S4EA 4DR4I 2LJPA 2R3VA 4P52A 4FW9A 1H7SA 1HNWE 2ZITA 4LFAI 2GS8A 4JI3E 1NHHA 3K17A 4B3ME 2UXDI 4JI8E 2HHHI 3J80C 3J80Q 1I94I 4M1KA 4DV7I 4B3RE 4B3TE 5BR8E 4URLA 4DR1I 1NHIA 4JI5I 1Z0WA 5GMEA 4LF7E 4P7AA 1XHKA 1MX0A 1Z0CA 4FWDA 4DPWA 4JYAI 4X62I 1H73A 2HKJA 4DV3E 2BV3A 4JI4I 2UXDE 4DV0I 2WW4A 4I3HA 1IBLI 2CZ9A 4GKJE 4JV5I 1H74A 2HFSA 3D4JA 4PRVA 1N36I 2UXBI 2DEIA 1HR0E 2UUAE 4HACB 2ZM6E 3ZZTA 3JAMC 4FN5A 3JAMQ 5LMUI 1Z5CA 4X66E 2VF3A 1UEKA 1Z0BA 1XMQI 4X62E 1Z5BA 4B3SI 1XNRI 1ELOA 1RR9A 5IWAE 4PRXA 4JI4E 1HNWI 2Q2EB 1N0UA 4DV0E 2UU9E 5IT9Q 1IBLE 4JI6E 4B3MI 4DPTA 4PU9A 4DV1E 3H4LA 1N0VC 4JI8I 4FWHA 1KTVA 4B3RI 4B3TI 2V8PA 1PKPA 5BR8I 1ZM4A 1H7UA 4KHPE 2UUCI 3WU6A 4LFBI 4LF7I 4JI1E 4WUDA 4B3SE 4DV5I 2UXCE 3WU5A 1IBKI 4LF9E 1B62A 4FWGA 4DV3I 4USKA 4AQYE 4UTGA 1NZ0A 3CWVA 1FI4A 4DV4E 1A6FA 4GKJI 1KVKA 4YHHI 1HR0I 2UUAI 2UUCE 2ZM6I 3ZZUA 4LFBE 5LMNI 1FNMA 4HACA 4X66I 1HNXE 2HFUA 4DV5E 4LF8I 4NXME 3M6AA 1IBKE 4YY3E 4X65I 4DU7A 4DR6E 1DARA 3PYDA 4DV6E 1ZM9A 3V5RA 2DEJA 2UUBE 5IWAI 2EFGA 1ZXNA 1S16A 4X64I 5A2QC 2UU9I 4JI6I 2HK2A 4DV1I 4UT4A 4YHHE 1Z5AA 1PIEA 2X36A 1N32E 5LMNE 2AJ4A 4KHPI 1K47A 4GKKE 4R1FA 4Z7YA 4LF8E 4JI1I 1BKNA 4X65E 4ZVIA 3T1HE 3T1YE 2UXCI 1XMOE 1PVGA 1ZM3A 2V2VA 4LF9I 3WU3A 1WUUA 4Z7CA 2X7IA 4X64E 4DXLA 2E1RA 1Z0VA 1XNQE 4AQYI 4LF6I 4JI7I 3QT8A 4HY1A 2XEXA 2J7KA 4ED4A 4DV4I 1Z0TA 4LF5E 4LF4E 1EA6A 2VQFE 2V2ZA 4DUZE 2F4VI 3QT7A 1ZM2A 1J5EI 3ZZ0A 3OTOE 1FJGE 1MG7A 3F0NA 3J7AG 4DR3E 3ZM7A 4DUYE 4OX9I 4K0KI 3B78A 1N34E 3K1JA 1HNXI 2R42A 4WUBA 1N33E 2OI2A 4NXMI 4YY3I 4DR6I 5FLXC 1Z0EA 5FLXQ 2VQEE 4DV6I 3J81C 3J81Q 1Z59A 2UUBI 1RREA 4DV2I 1D6TA 4LF6E 1NHJA 3LPSA 4JI7E 1FWLA 1U2RA 1IBME 1Z0GA 2V2QA 2F4VE 3QT6A 4DR5E 1J5EE 4LFCE 3Q1QA 4JI0I 4OX9E 1N32I 4K0KE 1FWKA 1MU5A 4GKKI 4DPXA 4USMA 3ZKBA 1KIJA 4JI2E 1QZRA 1FKAE 3T1HI 3T1YI 3LNUA 1XMOI 4DR7I 3ZKDA 1HNZE 4DR2E 4DV2E 5A2QQ 5L3JA 1XNQI 4NXNE 2A2DA 4DR4E 3WU4A 5GMDA 1KKHA 1VISA 4LF5I 3HULA 4LF4I 2VQFI 3V2UC 4DUZI 2ZBKB 4HXZA 4EMDA 2HKEA 4JI0E 1ZXMA 4LFAE 2BM0A 3OTOI 1FJGI 2HHHE 4DR3I 2BM1A 1I94E 1OJ4A 2V34A 4HYMA 4DUYI 4DV7E 1N34I 3PYFA 4WUCA 4DU8A 4DR1E 4MYUA 4DR7E 1N33I 4DPUA 2E5LI 2A2CA 4JI5E 2VQEI 3QT5A 3PYGA 2HK3A 1EI1A 4JYAE 5LL6R 1IBMI 1B63A 4MYTA 4XTJA 4DR5I 3PYEA 4LFCI 3B82A 5IT9C
chains in the Genus database with same CATH superfamily
1H72C 4JG4A 4DPYA 5K36A 4JI3I 5C0XF 4JV5E 2PO1A 4OO1E 4MU1A 4LCFA 3J7AM 1N36E 4MU3A 3LTOA 2UXBE 4JI2I 2E5LE 2NN6E 2NPFA 3B8HA 3GONA 5LMUE 1HNZI 4IFDA 5K36D 5JEAE 4RPFA 4DR2I 2O1VA 5DRPA 1XMQE 4KQVA 1XNRE 4NXNI 2C38B 3M85D 1S4EA 3U1KA 4DR4I 2LJPA 2BA0G 2R3VA 4P52A 4FW9A 1H7SA 1HNWE 2GQ0A 4OO1D 2ZITA 4LFAI 2GS8A 4JI3E 1NHHA 3K17A 4B3ME 2UXDI 4LPFA 2NN6D 4JI8E 3J80C 2HHHI 4OZEA 3J80Q 1I94I 4M1KA 4MU4A 1R6MA 4DV7I 4B3RE 4B3TE 5BR8E 5FWKA 4URLA 4DR1I 1NHIA 4NBQA 4JI5I 1Z0WA 5GMEA 5C0XC 5DRRA 4LF7E 4IS9A 4P7AA 1XHKA 3DD6A 1MX0A 4MQYA 1Z0CA 2JEAA 1USUA 4FWDA 2C39B 4DPWA 4JYAI 2WNRB 4X62I 1H73A 1OYPA 4N3OA 5DNLA 3UHMA 2HKJA 4DV3E 2BV3A 2O1TA 5EKWA 4JI4I 3GMEA 2UXDE 1P42A 4DV0I 4BA2A 2WW4A 4I3HA 2PO0B 1IBLI 2BA1D 2CZ9A 4ISAA 5JEAB 5DROA 2BR2B 4GKJE 4JV5I 1H74A 2IERA 4U3DA 2HFSA 1Y4UA 2JE6A 3D4JA 4PRVA 1N36I 2GO4A 2O1WA 2UXBI 2AE8A 2DEIA 1HR0E 2UUAE 4HACB 2ZM6E 3ZZTA 3JAMC 4FN5A 3JAMQ 5LMUI 3CDIA 1Z5CA 4IZKB 2GO3A 4X66E 3KRNA 2VF3A 1UEKA 1RHYA 1Z0BA 1XMQI 5K36E 4X62E 2F1DA 1Z5BA 4B3SI 1XNRI 3M7ND 1ELOA 1RR9A 5IWAE 2Z5CB 2CG9A 4PRXA 4JI4E 1HNWI 2Q2EB 1N0UA 4DV0E 2UU9E 5IT9Q 1IBLE 3H1CA 3L7ZB 4JI6E 4IFDE 4B3MI 4DPTA 4PU9A 2NN6F 4DV1E 3H4LA 1N0VC 4JI8I 4FWHA 4FW4A 4FW5A 2WP8B 5JEAF 3NZKA 1KTVA 4B3RI 3PS1A 4B3TI 2V8PA 1PKPA 5BR8I 1ZM4A 1H7UA 2IOPA 4KHPE 2UUCI 1UDSA 3WU6A 2Z5BB 4LFBI 4LF7I 4JI1E 4WUDA 4B3SE 4DV5I 2O3ZA 3WU5A 2UXCE 1E3PA 1IBKI 3B4TA 4LF9E 4IFDD 2C39A 1B62A 2WNRA 4FWGA 4DV3I 4USKA 4AQYE 3M85G 4UTGA 1NZ0A 3CWVA 1FI4A 4DV4E 1A6FA 5C0XA 4GKJI 1Y4SA 4OKGA 2PO0A 3Q6MA 2BR2A 4OO1C 1KVKA 4YHHI 5K36B 1HR0I 2UUAI 1VI7A 2UUCE 1YHCA 2ZM6I 3ZZUA 4LFBE 2NN6C 4MDTA 5C0XD 5LMNI 1OYSA 3P06A 1FNMA 4HACA 4X66I 1HNXE 5JEAC 2HFUA 4GQUA 1HK7A 4DV5E 4LCHA 4LF8I 4IZKA 4NXME 3M6AA 4YY3E 1IBKE 4X65I 4DU7A 4DR6E 1DARA 3PYDA 4IZJA 4OO1B 4DV6E 1ZM9A 4FW3A 2DEJA 3V5RA 4MU0A 2UUBE 5IWAI 2EFGA 1ZXNA 1S16A 2C37B 4X64I 5A2QC 2NN6B 3HKMA 2UU9I 2Z5CA 2IESA 4JI6I 2HK2A 4DV1I 4UT4A 3Q6NA 4IZJD 3L7ZA 4YHHE 1Z5AA 2BA1G 2JEBB 1PIEA 2WP8A 5ELWA 2PO2B 2X36A 5K36F 1N32E 3PS3A 4QNKA 5LMNE 2AJ4A 4KHPI 1K47A 4GKKE 4R1FA 4Z7YA 4LF8E 4JI1I 1BKNA 4LCGA 4X65E 4ZVIA 3T1HE 3T1YE 2Z5BA 1YH8A 4BA1B 2UXCI 1XMOE 1PVGA 1ZM3A 4IFDF 2V2VA 4LF9I 3WU3A 1WUUA 2C38A 4Z7CA 4OO1F 2JEAB 2X7IA 4X64E 4DXLA 2IOQA 1UDOA 2E1RA 2VESA 1Z0VA 1XNQE 4AQYI 1Y5YA 4LF6I 4J3DA 4JI7I 3QT8A 4HY1A 2XEXA 2J7KA 4ED4A 4DV4I 1Z0TA 4LF5E 4LF4E 1EA6A 2VQFE 2V2ZA 4FW6A 2PNZB 4DUZE 1Y6ZA 2F4VI 3QT7A 1ZM2A 1J5EI 3ZZ0A 2J65A 3OTOE 4AM3A 1FJGE 1MG7A 3F0NA 3J7AG 4DR3E 3ZM7A 2JE6B 4DUYE 4OX9I 4K0KI 3B78A 1N34E 3GLLA 3K1JA 2Z5EA 1HNXI 2R42A 4WUBA 1N33E 2OI2A 4NXMI 4YY3I 3P3GA 4DR6I 2CVEA 5FLXC 5C0XE 1Z0EA 5FLXQ 2VQEE 3K85A 5K36C 4DV6I 3J81C 5EL9A 3J81Q 1Z59A 2UUBI 1RREA 2BA0D 4DV2I 1D6TA 4OO1A 4LF6E 1NHJA 3LPSA 4JI7E 1FWLA 1U2RA 1UDQA 5DRQA 1IBME 2C37A 2NN6A 1Z0GA 2V2QA 4IFDC 2F4VE 4LOMA 5JEAA 3QT6A 4DR5E 1J5EE 4LFCE 3PRYA 3Q1QA 2PO1B 4JI0I 2PNLA 4OX9E 1N32I 1R6LA 4K0KE 2JEBA 1FWKA 5DNXA 2PO2A 1E3HA 1MU5A 3P76A 4GKKI 4DPXA 4USMA 3ZKBA 5JEAD 1KIJA 4JI2E 4IFDB 1QZRA 1FKAE 3T1HI 3T1YI 2JT2A 3LNUA 1XMOI 4DR7I 3ZKDA 1HNZE 4DR2E 2CGEA 4DV2E 4BA1A 5A2QQ 5L3JA 3P3EA 1XNQI 4NXNE 2A2DA 4DR4E 3WU4A 5GMDA 1KKHA 1VISA 4LF5I 3HULA 4QNJA 4LF4I 2VQFI 1OYRA 3V2UC 4DUZI 2ZBKB 4HXZA 4EMDA 2HKEA 3PS2A 1ZXMA 4JI0E 4LFAE 2BM0A 3OTOI 1USVA 5C0XB 1FJGI 2PNZA 2HHHE 4DR3I 2BM1A 1I94E 1OJ4A 2V34A 4HYMA 4DUYI 4DV7E 1N34I 1Y60A 4AIDA 3PYFA 4FW7A 4WUCA 4DU8A 4DR1E 4MYUA 4DR7E 1N33I 1XXEA 4DPUA 2E5LI 2A2CA 4JI5E 2VQEI 3QT5A 3HJCA 3PYGA 2HK3A 3M7NG 3CDJA 4IZJB 1EI1A 3GCMA 3P3CA 4JYAE 4U3BA 5LL6R 4AIMA 1IBMI 1B63A 2O1UA 1UDNA 4MYTA 3U1YA 4XTJA 4BA2B 4DR5I 3PYEA 4LFCI 3B82A 2PNMA 5IT9C
chains in the Genus database with same CATH topology
1H72C 4JG4A 4DPYA 4JI3I 4JV5E 3J7AM 1N36E 3LTOA 2UXBE 4JI2I 2E5LE 2NPFA 3B8HA 3GONA 5LMUE 1HNZI 4RPFA 4DR2I 2O1VA 1XMQE 4KQVA 1XNRE 4NXNI 1S4EA 4DR4I 2LJPA 2R3VA 4P52A 4FW9A 1H7SA 1HNWE 2GQ0A 2ZITA 4LFAI 2GS8A 4JI3E 1NHHA 3K17A 4B3ME 2UXDI 4JI8E 2HHHI 3J80C 3J80Q 1I94I 4M1KA 4DV7I 4B3RE 4B3TE 5BR8E 5FWKA 4URLA 4DR1I 1NHIA 4JI5I 1Z0WA 5GMEA 4LF7E 4P7AA 1XHKA 1MX0A 1Z0CA 1USUA 4FWDA 4DPWA 4JYAI 4X62I 1H73A 4N3OA 2HKJA 4DV3E 2BV3A 2O1TA 4JI4I 2UXDE 4DV0I 2WW4A 4I3HA 1IBLI 2CZ9A 4GKJE 4JV5I 1H74A 2HFSA 1Y4UA 3D4JA 4PRVA 1N36I 2UXBI 2O1WA 2DEIA 1HR0E 2UUAE 4HACB 2ZM6E 3ZZTA 3JAMC 4FN5A 3JAMQ 5LMUI 1Z5CA 4IZKB 4X66E 2VF3A 1UEKA 1Z0BA 1XMQI 4X62E 1Z5BA 4B3SI 1XNRI 1ELOA 1RR9A 5IWAE 2Z5CB 2CG9A 4PRXA 4JI4E 1HNWI 2Q2EB 1N0UA 4DV0E 2UU9E 5IT9Q 1IBLE 4JI6E 4B3MI 4DPTA 4PU9A 4DV1E 3H4LA 1N0VC 4JI8I 4FWHA 1KTVA 4B3RI 4B3TI 2V8PA 1PKPA 5BR8I 1ZM4A 1H7UA 2IOPA 4KHPE 2UUCI 3WU6A 2Z5BB 4LFBI 4LF7I 4JI1E 4WUDA 4B3SE 4DV5I 2UXCE 3WU5A 1IBKI 4LF9E 1B62A 4FWGA 4DV3I 4USKA 4AQYE 4UTGA 1NZ0A 3CWVA 1FI4A 4DV4E 1A6FA 4GKJI 1Y4SA 3Q6MA 1KVKA 4YHHI 1HR0I 2UUAI 2UUCE 2ZM6I 3ZZUA 4LFBE 5LMNI 3P06A 1FNMA 4HACA 4X66I 1HNXE 2HFUA 4DV5E 1HK7A 4LF8I 4IZKA 4NXME 3M6AA 4YY3E 1IBKE 4X65I 4DU7A 4DR6E 1DARA 3PYDA 4IZJA 4DV6E 1ZM9A 3V5RA 2DEJA 2UUBE 5IWAI 2EFGA 1ZXNA 1S16A 4X64I 5A2QC 2UU9I 2Z5CA 4JI6I 2HK2A 4DV1I 4UT4A 3Q6NA 4IZJD 4YHHE 1Z5AA 1PIEA 2X36A 1N32E 5LMNE 2AJ4A 4KHPI 1K47A 4GKKE 4R1FA 4Z7YA 4LF8E 4JI1I 1BKNA 4X65E 4ZVIA 3T1HE 3T1YE 2Z5BA 2UXCI 1XMOE 1PVGA 1ZM3A 2V2VA 4LF9I 3WU3A 1WUUA 4Z7CA 2X7IA 4X64E 4DXLA 2IOQA 2E1RA 1Z0VA 1XNQE 4AQYI 4LF6I 4JI7I 3QT8A 4HY1A 2XEXA 2J7KA 4ED4A 4DV4I 1Z0TA 4LF5E 4LF4E 1EA6A 2VQFE 2V2ZA 4DUZE 2F4VI 1Y6ZA 3QT7A 1ZM2A 1J5EI 3ZZ0A 3OTOE 1FJGE 1MG7A 3F0NA 3J7AG 4DR3E 3ZM7A 4DUYE 4OX9I 4K0KI 3B78A 1N34E 3K1JA 2Z5EA 1HNXI 2R42A 4WUBA 1N33E 2OI2A 4NXMI 4YY3I 4DR6I 5FLXC 1Z0EA 5FLXQ 2VQEE 3K85A 4DV6I 3J81C 3J81Q 1Z59A 2UUBI 1RREA 4DV2I 1D6TA 4LF6E 1NHJA 3LPSA 4JI7E 1FWLA 1U2RA 1IBME 1Z0GA 2V2QA 2F4VE 3QT6A 4DR5E 1J5EE 4LFCE 3PRYA 3Q1QA 4JI0I 2PNLA 4OX9E 1N32I 4K0KE 1FWKA 1MU5A 4GKKI 4DPXA 4USMA 3ZKBA 1KIJA 4JI2E 1QZRA 1FKAE 3T1HI 3T1YI 3LNUA 1XMOI 4DR7I 3ZKDA 1HNZE 4DR2E 2CGEA 4DV2E 5A2QQ 5L3JA 1XNQI 4NXNE 2A2DA 4DR4E 3WU4A 5GMDA 1KKHA 1VISA 4LF5I 3HULA 4LF4I 2VQFI 3V2UC 4DUZI 2ZBKB 4HXZA 4EMDA 2HKEA 4JI0E 1ZXMA 4LFAE 2BM0A 3OTOI 1USVA 1FJGI 2HHHE 4DR3I 2BM1A 1I94E 1OJ4A 2V34A 4HYMA 4DUYI 4DV7E 1N34I 3PYFA 4WUCA 4DU8A 4DR1E 4MYUA 4DR7E 1N33I 4DPUA 2E5LI 2A2CA 4JI5E 2VQEI 3QT5A 3HJCA 3PYGA 2HK3A 4IZJB 1EI1A 4JYAE 5LL6R 1IBMI 1B63A 2O1UA 4MYTA 4XTJA 4DR5I 3PYEA 4LFCI 3B82A 2PNMA 5IT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H72 C;  4JG4 A;  4DPY A;  4JI3 I;  4JV5 E;  3J7A M;  1N36 E;  3LTO A;  2UXB E;  4JI2 I;  2E5L E;  2NPF A;  3B8H A;  3GON A;  5LMU E;  1HNZ I;  4RPF A;  4DR2 I;  1XMQ E;  4KQV A;  1XNR E;  4NXN I;  1S4E A;  4DR4 I;  2LJP A;  2R3V A;  4P52 A;  4FW9 A;  1H7S A;  1HNW E;  2ZIT A;  4LFA I;  2GS8 A;  4JI3 E;  1NHH A;  3K17 A;  4B3M E;  2UXD I;  4JI8 E;  2HHH I;  3J80 C;  3J80 Q;  1I94 I;  4M1K A;  4DV7 I;  4B3R E;  4B3T E;  5BR8 E;  4URL A;  4DR1 I;  1NHI A;  4JI5 I;  1Z0W A;  5GME A;  4LF7 E;  4P7A A;  1XHK A;  1MX0 A;  1Z0C A;  4FWD A;  4DPW A;  4JYA I;  4X62 I;  1H73 A;  2HKJ A;  4DV3 E;  2BV3 A;  4JI4 I;  2UXD E;  4DV0 I;  2WW4 A;  4I3H A;  1IBL I;  2CZ9 A;  4GKJ E;  4JV5 I;  1H74 A;  2HFS A;  3D4J A;  4PRV A;  1N36 I;  2UXB I;  2DEI A;  1HR0 E;  2UUA E;  4HAC B;  2ZM6 E;  3ZZT A;  3JAM C;  4FN5 A;  3JAM Q;  5LMU I;  1Z5C A;  4X66 E;  2VF3 A;  1UEK A;  1Z0B A;  1XMQ I;  4X62 E;  1Z5B A;  4B3S I;  1XNR I;  1ELO A;  1RR9 A;  5IWA E;  4PRX A;  4JI4 E;  1HNW I;  2Q2E B;  1N0U A;  4DV0 E;  2UU9 E;  5IT9 Q;  1IBL E;  4JI6 E;  4B3M I;  4DPT A;  4PU9 A;  4DV1 E;  3H4L A;  1N0V C;  4JI8 I;  4FWH A;  1KTV A;  4B3R I;  4B3T I;  2V8P A;  1PKP A;  5BR8 I;  1ZM4 A;  1H7U A;  4KHP E;  2UUC I;  3WU6 A;  4LFB I;  4LF7 I;  4JI1 E;  4WUD A;  4B3S E;  4DV5 I;  2UXC E;  3WU5 A;  1IBK I;  4LF9 E;  1B62 A;  4FWG A;  4DV3 I;  4USK A;  4AQY E;  4UTG A;  1NZ0 A;  3CWV A;  1FI4 A;  4DV4 E;  1A6F A;  4GKJ I;  1KVK A;  4YHH I;  1HR0 I;  2UUA I;  2UUC E;  2ZM6 I;  3ZZU A;  4LFB E;  5LMN I;  1FNM A;  4HAC A;  4X66 I;  1HNX E;  2HFU A;  4DV5 E;  4LF8 I;  4NXM E;  3M6A A;  1IBK E;  4YY3 E;  4X65 I;  4DU7 A;  4DR6 E;  1DAR A;  3PYD A;  4DV6 E;  1ZM9 A;  3V5R A;  2DEJ A;  2UUB E;  5IWA I;  2EFG A;  1ZXN A;  1S16 A;  4X64 I;  5A2Q C;  2UU9 I;  4JI6 I;  2HK2 A;  4DV1 I;  4UT4 A;  4YHH E;  1Z5A A;  1PIE A;  2X36 A;  1N32 E;  5LMN E;  2AJ4 A;  4KHP I;  1K47 A;  4GKK E;  4R1F A;  4Z7Y A;  4LF8 E;  4JI1 I;  1BKN A;  4X65 E;  4ZVI A;  3T1H E;  3T1Y E;  2UXC I;  1XMO E;  1PVG A;  1ZM3 A;  2V2V A;  4LF9 I;  3WU3 A;  1WUU A;  4Z7C A;  2X7I A;  4X64 E;  4DXL A;  2E1R A;  1Z0V A;  1XNQ E;  4AQY I;  4LF6 I;  4JI7 I;  3QT8 A;  4HY1 A;  2XEX A;  2J7K A;  4ED4 A;  4DV4 I;  1Z0T A;  4LF5 E;  4LF4 E;  1EA6 A;  2VQF E;  2V2Z A;  4DUZ E;  2F4V I;  3QT7 A;  1ZM2 A;  1J5E I;  3ZZ0 A;  3OTO E;  1FJG E;  1MG7 A;  3F0N A;  3J7A G;  4DR3 E;  3ZM7 A;  4DUY E;  4OX9 I;  4K0K I;  3B78 A;  1N34 E;  3K1J A;  1HNX I;  2R42 A;  4WUB A;  1N33 E;  2OI2 A;  4NXM I;  4YY3 I;  4DR6 I;  5FLX C;  1Z0E A;  5FLX Q;  2VQE E;  4DV6 I;  3J81 C;  3J81 Q;  1Z59 A;  2UUB I;  1RRE A;  4DV2 I;  1D6T A;  4LF6 E;  1NHJ A;  3LPS A;  4JI7 E;  1FWL A;  1U2R A;  1IBM E;  1Z0G A;  2V2Q A;  2F4V E;  3QT6 A;  4DR5 E;  1J5E E;  4LFC E;  3Q1Q A;  4JI0 I;  4OX9 E;  1N32 I;  4K0K E;  1FWK A;  1MU5 A;  4GKK I;  4DPX A;  4USM A;  3ZKB A;  1KIJ A;  4JI2 E;  1QZR A;  1FKA E;  3T1H I;  3T1Y I;  3LNU A;  1XMO I;  4DR7 I;  3ZKD A;  1HNZ E;  4DR2 E;  4DV2 E;  5A2Q Q;  5L3J A;  1XNQ I;  4NXN E;  2A2D A;  4DR4 E;  3WU4 A;  5GMD A;  1KKH A;  1VIS A;  4LF5 I;  3HUL A;  4LF4 I;  2VQF I;  3V2U C;  4DUZ I;  2ZBK B;  4HXZ A;  4EMD A;  2HKE A;  4JI0 E;  1ZXM A;  4LFA E;  2BM0 A;  3OTO I;  1FJG I;  2HHH E;  4DR3 I;  2BM1 A;  1I94 E;  1OJ4 A;  2V34 A;  4HYM A;  4DUY I;  4DV7 E;  1N34 I;  3PYF A;  4WUC A;  4DU8 A;  4DR1 E;  4MYU A;  4DR7 E;  1N33 I;  4DPU A;  2E5L I;  2A2C A;  4JI5 E;  2VQE I;  3QT5 A;  3PYG A;  2HK3 A;  1EI1 A;  4JYA E;  5LL6 R;  1IBM I;  1B63 A;  4MYT A;  4XTJ A;  4DR5 I;  3PYE A;  4LFC I;  3B82 A;  5IT9 C; 
#chains in the Genus database with same CATH topology
 1H72 C;  4JG4 A;  4DPY A;  5K36 A;  4JI3 I;  5C0X F;  4JV5 E;  2PO1 A;  4OO1 E;  4MU1 A;  4LCF A;  3J7A M;  1N36 E;  4MU3 A;  3LTO A;  2UXB E;  4JI2 I;  2E5L E;  2NN6 E;  2NPF A;  3B8H A;  3GON A;  5LMU E;  1HNZ I;  4IFD A;  5K36 D;  5JEA E;  4RPF A;  4DR2 I;  2O1V A;  5DRP A;  1XMQ E;  4KQV A;  1XNR E;  4NXN I;  2C38 B;  3M85 D;  1S4E A;  3U1K A;  4DR4 I;  2LJP A;  2BA0 G;  2R3V A;  4P52 A;  4FW9 A;  1H7S A;  1HNW E;  2GQ0 A;  4OO1 D;  2ZIT A;  4LFA I;  2GS8 A;  4JI3 E;  1NHH A;  3K17 A;  4B3M E;  2UXD I;  4LPF A;  2NN6 D;  4JI8 E;  3J80 C;  2HHH I;  4OZE A;  3J80 Q;  1I94 I;  4M1K A;  4MU4 A;  1R6M A;  4DV7 I;  4B3R E;  4B3T E;  5BR8 E;  5FWK A;  4URL A;  4DR1 I;  1NHI A;  4NBQ A;  4JI5 I;  1Z0W A;  5GME A;  5C0X C;  5DRR A;  4LF7 E;  4IS9 A;  4P7A A;  1XHK A;  3DD6 A;  1MX0 A;  4MQY A;  1Z0C A;  2JEA A;  1USU A;  4FWD A;  2C39 B;  4DPW A;  4JYA I;  2WNR B;  4X62 I;  1H73 A;  1OYP A;  4N3O A;  5DNL A;  3UHM A;  2HKJ A;  4DV3 E;  2BV3 A;  2O1T A;  5EKW A;  4JI4 I;  3GME A;  2UXD E;  1P42 A;  4DV0 I;  4BA2 A;  2WW4 A;  4I3H A;  2PO0 B;  1IBL I;  2BA1 D;  2CZ9 A;  4ISA A;  5JEA B;  5DRO A;  2BR2 B;  4GKJ E;  4JV5 I;  1H74 A;  2IER A;  4U3D A;  2HFS A;  1Y4U A;  2JE6 A;  3D4J A;  4PRV A;  1N36 I;  2GO4 A;  2O1W A;  2UXB I;  2AE8 A;  2DEI A;  1HR0 E;  2UUA E;  4HAC B;  2ZM6 E;  3ZZT A;  3JAM C;  4FN5 A;  3JAM Q;  5LMU I;  3CDI A;  1Z5C A;  4IZK B;  2GO3 A;  4X66 E;  3KRN A;  2VF3 A;  1UEK A;  1RHY A;  1Z0B A;  1XMQ I;  5K36 E;  4X62 E;  2F1D A;  1Z5B A;  4B3S I;  1XNR I;  3M7N D;  1ELO A;  1RR9 A;  5IWA E;  2Z5C B;  2CG9 A;  4PRX A;  4JI4 E;  1HNW I;  2Q2E B;  1N0U A;  4DV0 E;  2UU9 E;  5IT9 Q;  1IBL E;  3H1C A;  3L7Z B;  4JI6 E;  4IFD E;  4B3M I;  4DPT A;  4PU9 A;  2NN6 F;  4DV1 E;  3H4L A;  1N0V C;  4JI8 I;  4FWH A;  4FW4 A;  4FW5 A;  2WP8 B;  5JEA F;  3NZK A;  1KTV A;  4B3R I;  3PS1 A;  4B3T I;  2V8P A;  1PKP A;  5BR8 I;  1ZM4 A;  1H7U A;  2IOP A;  4KHP E;  2UUC I;  1UDS A;  3WU6 A;  2Z5B B;  4LFB I;  4LF7 I;  4JI1 E;  4WUD A;  4B3S E;  4DV5 I;  2O3Z A;  3WU5 A;  2UXC E;  1E3P A;  1IBK I;  3B4T A;  4LF9 E;  4IFD D;  2C39 A;  1B62 A;  2WNR A;  4FWG A;  4DV3 I;  4USK A;  4AQY E;  3M85 G;  4UTG A;  1NZ0 A;  3CWV A;  1FI4 A;  4DV4 E;  1A6F A;  5C0X A;  4GKJ I;  1Y4S A;  4OKG A;  2PO0 A;  3Q6M A;  2BR2 A;  4OO1 C;  1KVK A;  4YHH I;  5K36 B;  1HR0 I;  2UUA I;  1VI7 A;  2UUC E;  1YHC A;  2ZM6 I;  3ZZU A;  4LFB E;  2NN6 C;  4MDT A;  5C0X D;  5LMN I;  1OYS A;  3P06 A;  1FNM A;  4HAC A;  4X66 I;  1HNX E;  5JEA C;  2HFU A;  4GQU A;  1HK7 A;  4DV5 E;  4LCH A;  4LF8 I;  4IZK A;  4NXM E;  3M6A A;  4YY3 E;  1IBK E;  4X65 I;  4DU7 A;  4DR6 E;  1DAR A;  3PYD A;  4IZJ A;  4OO1 B;  4DV6 E;  1ZM9 A;  4FW3 A;  2DEJ A;  3V5R A;  4MU0 A;  2UUB E;  5IWA I;  2EFG A;  1ZXN A;  1S16 A;  2C37 B;  4X64 I;  5A2Q C;  2NN6 B;  3HKM A;  2UU9 I;  2Z5C A;  2IES A;  4JI6 I;  2HK2 A;  4DV1 I;  4UT4 A;  3Q6N A;  4IZJ D;  3L7Z A;  4YHH E;  1Z5A A;  2BA1 G;  2JEB B;  1PIE A;  2WP8 A;  5ELW A;  2PO2 B;  2X36 A;  5K36 F;  1N32 E;  3PS3 A;  4QNK A;  5LMN E;  2AJ4 A;  4KHP I;  1K47 A;  4GKK E;  4R1F A;  4Z7Y A;  4LF8 E;  4JI1 I;  1BKN A;  4LCG A;  4X65 E;  4ZVI A;  3T1H E;  3T1Y E;  2Z5B A;  1YH8 A;  4BA1 B;  2UXC I;  1XMO E;  1PVG A;  1ZM3 A;  4IFD F;  2V2V A;  4LF9 I;  3WU3 A;  1WUU A;  2C38 A;  4Z7C A;  4OO1 F;  2JEA B;  2X7I A;  4X64 E;  4DXL A;  2IOQ A;  1UDO A;  2E1R A;  2VES A;  1Z0V A;  1XNQ E;  4AQY I;  1Y5Y A;  4LF6 I;  4J3D A;  4JI7 I;  3QT8 A;  4HY1 A;  2XEX A;  2J7K A;  4ED4 A;  4DV4 I;  1Z0T A;  4LF5 E;  4LF4 E;  1EA6 A;  2VQF E;  2V2Z A;  4FW6 A;  2PNZ B;  4DUZ E;  1Y6Z A;  2F4V I;  3QT7 A;  1ZM2 A;  1J5E I;  3ZZ0 A;  2J65 A;  3OTO E;  4AM3 A;  1FJG E;  1MG7 A;  3F0N A;  3J7A G;  4DR3 E;  3ZM7 A;  2JE6 B;  4DUY E;  4OX9 I;  4K0K I;  3B78 A;  1N34 E;  3GLL A;  3K1J A;  2Z5E A;  1HNX I;  2R42 A;  4WUB A;  1N33 E;  2OI2 A;  4NXM I;  4YY3 I;  3P3G A;  4DR6 I;  2CVE A;  5FLX C;  5C0X E;  1Z0E A;  5FLX Q;  2VQE E;  3K85 A;  5K36 C;  4DV6 I;  3J81 C;  5EL9 A;  3J81 Q;  1Z59 A;  2UUB I;  1RRE A;  2BA0 D;  4DV2 I;  1D6T A;  4OO1 A;  4LF6 E;  1NHJ A;  3LPS A;  4JI7 E;  1FWL A;  1U2R A;  1UDQ A;  5DRQ A;  1IBM E;  2C37 A;  2NN6 A;  1Z0G A;  2V2Q A;  4IFD C;  2F4V E;  4LOM A;  5JEA A;  3QT6 A;  4DR5 E;  1J5E E;  4LFC E;  3PRY A;  3Q1Q A;  2PO1 B;  4JI0 I;  2PNL A;  4OX9 E;  1N32 I;  1R6L A;  4K0K E;  2JEB A;  1FWK A;  5DNX A;  2PO2 A;  1E3H A;  1MU5 A;  3P76 A;  4GKK I;  4DPX A;  4USM A;  3ZKB A;  5JEA D;  1KIJ A;  4JI2 E;  4IFD B;  1QZR A;  1FKA E;  3T1H I;  3T1Y I;  2JT2 A;  3LNU A;  1XMO I;  4DR7 I;  3ZKD A;  1HNZ E;  4DR2 E;  2CGE A;  4DV2 E;  4BA1 A;  5A2Q Q;  5L3J A;  3P3E A;  1XNQ I;  4NXN E;  2A2D A;  4DR4 E;  3WU4 A;  5GMD A;  1KKH A;  1VIS A;  4LF5 I;  3HUL A;  4QNJ A;  4LF4 I;  2VQF I;  1OYR A;  3V2U C;  4DUZ I;  2ZBK B;  4HXZ A;  4EMD A;  2HKE A;  3PS2 A;  1ZXM A;  4JI0 E;  4LFA E;  2BM0 A;  3OTO I;  1USV A;  5C0X B;  1FJG I;  2PNZ A;  2HHH E;  4DR3 I;  2BM1 A;  1I94 E;  1OJ4 A;  2V34 A;  4HYM A;  4DUY I;  4DV7 E;  1N34 I;  1Y60 A;  4AID A;  3PYF A;  4FW7 A;  4WUC A;  4DU8 A;  4DR1 E;  4MYU A;  4DR7 E;  1N33 I;  1XXE A;  4DPU A;  2E5L I;  2A2C A;  4JI5 E;  2VQE I;  3QT5 A;  3HJC A;  3PYG A;  2HK3 A;  3M7N G;  3CDJ A;  4IZJ B;  1EI1 A;  3GCM A;  3P3C A;  4JYA E;  4U3B A;  5LL6 R;  4AIM A;  1IBM I;  1B63 A;  2O1U A;  1UDN A;  4MYT A;  3U1Y A;  4XTJ A;  4BA2 B;  4DR5 I;  3PYE A;  4LFC I;  3B82 A;  2PNM A;  5IT9 C; 
#chains in the Genus database with same CATH homology
 1H72 C;  4JG4 A;  4DPY A;  4JI3 I;  4JV5 E;  3J7A M;  1N36 E;  3LTO A;  2UXB E;  4JI2 I;  2E5L E;  2NPF A;  3B8H A;  3GON A;  5LMU E;  1HNZ I;  4RPF A;  4DR2 I;  2O1V A;  1XMQ E;  4KQV A;  1XNR E;  4NXN I;  1S4E A;  4DR4 I;  2LJP A;  2R3V A;  4P52 A;  4FW9 A;  1H7S A;  1HNW E;  2GQ0 A;  2ZIT A;  4LFA I;  2GS8 A;  4JI3 E;  1NHH A;  3K17 A;  4B3M E;  2UXD I;  4JI8 E;  2HHH I;  3J80 C;  3J80 Q;  1I94 I;  4M1K A;  4DV7 I;  4B3R E;  4B3T E;  5BR8 E;  5FWK A;  4URL A;  4DR1 I;  1NHI A;  4JI5 I;  1Z0W A;  5GME A;  4LF7 E;  4P7A A;  1XHK A;  1MX0 A;  1Z0C A;  1USU A;  4FWD A;  4DPW A;  4JYA I;  4X62 I;  1H73 A;  4N3O A;  2HKJ A;  4DV3 E;  2BV3 A;  2O1T A;  4JI4 I;  2UXD E;  4DV0 I;  2WW4 A;  4I3H A;  1IBL I;  2CZ9 A;  4GKJ E;  4JV5 I;  1H74 A;  2HFS A;  1Y4U A;  3D4J A;  4PRV A;  1N36 I;  2UXB I;  2O1W A;  2DEI A;  1HR0 E;  2UUA E;  4HAC B;  2ZM6 E;  3ZZT A;  3JAM C;  4FN5 A;  3JAM Q;  5LMU I;  1Z5C A;  4IZK B;  4X66 E;  2VF3 A;  1UEK A;  1Z0B A;  1XMQ I;  4X62 E;  1Z5B A;  4B3S I;  1XNR I;  1ELO A;  1RR9 A;  5IWA E;  2Z5C B;  2CG9 A;  4PRX A;  4JI4 E;  1HNW I;  2Q2E B;  1N0U A;  4DV0 E;  2UU9 E;  5IT9 Q;  1IBL E;  4JI6 E;  4B3M I;  4DPT A;  4PU9 A;  4DV1 E;  3H4L A;  1N0V C;  4JI8 I;  4FWH A;  1KTV A;  4B3R I;  4B3T I;  2V8P A;  1PKP A;  5BR8 I;  1ZM4 A;  1H7U A;  2IOP A;  4KHP E;  2UUC I;  3WU6 A;  2Z5B B;  4LFB I;  4LF7 I;  4JI1 E;  4WUD A;  4B3S E;  4DV5 I;  2UXC E;  3WU5 A;  1IBK I;  4LF9 E;  1B62 A;  4FWG A;  4DV3 I;  4USK A;  4AQY E;  4UTG A;  1NZ0 A;  3CWV A;  1FI4 A;  4DV4 E;  1A6F A;  4GKJ I;  1Y4S A;  3Q6M A;  1KVK A;  4YHH I;  1HR0 I;  2UUA I;  2UUC E;  2ZM6 I;  3ZZU A;  4LFB E;  5LMN I;  3P06 A;  1FNM A;  4HAC A;  4X66 I;  1HNX E;  2HFU A;  4DV5 E;  1HK7 A;  4LF8 I;  4IZK A;  4NXM E;  3M6A A;  4YY3 E;  1IBK E;  4X65 I;  4DU7 A;  4DR6 E;  1DAR A;  3PYD A;  4IZJ A;  4DV6 E;  1ZM9 A;  3V5R A;  2DEJ A;  2UUB E;  5IWA I;  2EFG A;  1ZXN A;  1S16 A;  4X64 I;  5A2Q C;  2UU9 I;  2Z5C A;  4JI6 I;  2HK2 A;  4DV1 I;  4UT4 A;  3Q6N A;  4IZJ D;  4YHH E;  1Z5A A;  1PIE A;  2X36 A;  1N32 E;  5LMN E;  2AJ4 A;  4KHP I;  1K47 A;  4GKK E;  4R1F A;  4Z7Y A;  4LF8 E;  4JI1 I;  1BKN A;  4X65 E;  4ZVI A;  3T1H E;  3T1Y E;  2Z5B A;  2UXC I;  1XMO E;  1PVG A;  1ZM3 A;  2V2V A;  4LF9 I;  3WU3 A;  1WUU A;  4Z7C A;  2X7I A;  4X64 E;  4DXL A;  2IOQ A;  2E1R A;  1Z0V A;  1XNQ E;  4AQY I;  4LF6 I;  4JI7 I;  3QT8 A;  4HY1 A;  2XEX A;  2J7K A;  4ED4 A;  4DV4 I;  1Z0T A;  4LF5 E;  4LF4 E;  1EA6 A;  2VQF E;  2V2Z A;  4DUZ E;  2F4V I;  1Y6Z A;  3QT7 A;  1ZM2 A;  1J5E I;  3ZZ0 A;  3OTO E;  1FJG E;  1MG7 A;  3F0N A;  3J7A G;  4DR3 E;  3ZM7 A;  4DUY E;  4OX9 I;  4K0K I;  3B78 A;  1N34 E;  3K1J A;  2Z5E A;  1HNX I;  2R42 A;  4WUB A;  1N33 E;  2OI2 A;  4NXM I;  4YY3 I;  4DR6 I;  5FLX C;  1Z0E A;  5FLX Q;  2VQE E;  3K85 A;  4DV6 I;  3J81 C;  3J81 Q;  1Z59 A;  2UUB I;  1RRE A;  4DV2 I;  1D6T A;  4LF6 E;  1NHJ A;  3LPS A;  4JI7 E;  1FWL A;  1U2R A;  1IBM E;  1Z0G A;  2V2Q A;  2F4V E;  3QT6 A;  4DR5 E;  1J5E E;  4LFC E;  3PRY A;  3Q1Q A;  4JI0 I;  2PNL A;  4OX9 E;  1N32 I;  4K0K E;  1FWK A;  1MU5 A;  4GKK I;  4DPX A;  4USM A;  3ZKB A;  1KIJ A;  4JI2 E;  1QZR A;  1FKA E;  3T1H I;  3T1Y I;  3LNU A;  1XMO I;  4DR7 I;  3ZKD A;  1HNZ E;  4DR2 E;  2CGE A;  4DV2 E;  5A2Q Q;  5L3J A;  1XNQ I;  4NXN E;  2A2D A;  4DR4 E;  3WU4 A;  5GMD A;  1KKH A;  1VIS A;  4LF5 I;  3HUL A;  4LF4 I;  2VQF I;  3V2U C;  4DUZ I;  2ZBK B;  4HXZ A;  4EMD A;  2HKE A;  4JI0 E;  1ZXM A;  4LFA E;  2BM0 A;  3OTO I;  1USV A;  1FJG I;  2HHH E;  4DR3 I;  2BM1 A;  1I94 E;  1OJ4 A;  2V34 A;  4HYM A;  4DUY I;  4DV7 E;  1N34 I;  3PYF A;  4WUC A;  4DU8 A;  4DR1 E;  4MYU A;  4DR7 E;  1N33 I;  4DPU A;  2E5L I;  2A2C A;  4JI5 E;  2VQE I;  3QT5 A;  3HJC A;  3PYG A;  2HK3 A;  4IZJ B;  1EI1 A;  4JYA E;  5LL6 R;  1IBM I;  1B63 A;  2O1U A;  4MYT A;  4XTJ A;  4DR5 I;  3PYE A;  4LFC I;  3B82 A;  2PNM A;  5IT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...