4DV4I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4I00
2R3VA 4X65E 4DPWA 1DARA 3OTOE 4LF5I 1Z0TA 4B3TI 1KIJA 2HK2A 4M1KA 4DV3E 4JI3E 4KHPE 4FN5A 4YHHE 5LMUI 1HR0I 2HK3A 2VQEI 4PU9A 3ZZUA 1EI1A 3QT5A 1KKHA 4B3TE 1HNWI 1HNXI 1N33E 1KVKA 4JI6I 3JAMQ 4JI4I 4X64E 2VQEE 2UUAI 4LF6I 4DV4I 3HULA 4JI7E 1H72C 5IWAE 4P52A 1IBLE 1HNWE 3PYGA 3M6AA 1HNXE 1ZM2A 1MU5A 2BM0A 1Z0CA 4JI4E 4LF7I 5A2QC 3B82A 4USKA 3ZM7A 4LF6E 2UUAE 3PYFA 4B3ME 4DU7A 5BR8I 4I3HA 4LFCI 2A2CA 2HKJA 2HKEA 3ZKDA 1XMOI 1PKPA 3QT7A 2UXBI 2UXCE 4JI0I 4YY3I 4DV5I 5LMNI 4DU8A 4UT4A 4DR3I 1XMQE 1FI4A 1U2RA 3JAMC 4HACB 1HNZI 1XMOE 3J81C 1FJGI 4FWDA 5FLXQ 4DR7I 2XEXA 2UXBE 1J5EI 4JI0E 1FKAE 4YY3E 4DV5E 4JV5E 5LMNE 2HHHI 4X65I 5IT9Q 1IBMI 2HFSA 4DR2I 1Z5AA 1PIEA 1HNZE 2E5LI 3T1HI 4GKJE 1ELOA 4DR5I 1FJGE 4P7AA 2Q2EB 4KQVA 1J5EE 2LJPA 4DV6I 4JI3I 4KHPI 3QT8A 2HHHE 1IBME 4EMDA 4YHHI 4XTJA 1N0VC 4DR2E 5LL6R 4NXMI 1H7UA 4DPUA 2J7KA 2E5LE 3T1HE 1BKNA 4DR5E 3Q1QA 2E1RA 4UTGA 1N33I 2V2VA 4ZVIA 4DV6E 1Z0WA 4HACA 2UXDE 4LF4I 4X64I 4WUDA 4JI7I 5IWAI 1IBLI 4NXME 2ZBKB 3QT6A 5FLXC 2ZITA 4JI8I 4PRVA 5IT9C 4WUBA 3WU4A 4DUZI 4LF4E 4NXNI 1UEKA 2V34A 1FWLA 1NHIA 4B3MI 4Z7YA 1B62A 4B3SE 4JI8E 1N0UA 3J7AG 1XNRE 4K0KI 4DUZE 1WUUA 2F4VE 1EA6A 4NXNE 1NZ0A 4HYMA 2UXCI 4DR4E 4ED4A 4FW9A 3ZKBA 4OX9I 1XMQI 3F0NA 1QZRA 2UU9I 1I94E 4GKKI 4K0KE 4LF8I 4B3RI 4DPXA 3K17A 4JV5I 2OI2A 1XNQI 1NHHA 4OX9E 1ZXMA 1D6TA 3LPSA 2UU9E 4DUYI 5GMEA 4GKKE 3ZZ0A 4LF8E 4FWGA 4GKJI 4DV0E 4WUCA 4B3RE 4DV1I 1IBKE 4MYTA 2UUBI 4LFAE 4JI1I 2DEJA 1XNQE 1Z5CA 1MG7A 4DUYE 3K1JA 4AQYI 2V8PA 4JG4A 1FWKA 4JYAI 1Z0VA 1K47A 4DV7I 4DV1E 1N36I 2UUBE 4DV2E 4JI1E 4FWHA 2BM1A 1VISA 3T1YI 1B63A 2UXDI 4X66E 2A2DA 2HFUA 4AQYE 2UUCI 4JYAE 3J80Q 4X62I 3V5RA 4DV7E 1N36E 4DPYA 2X36A 3WU6A 1Z5BA 3T1YE 1RREA 3CWVA 5A2QQ 4JI5I 1NHJA 4DR6I 4HXZA 2UUCE 2CZ9A 1N32I 4LF9I 4X62E 1H7SA 1Z0EA 3WU5A 2VQFI 1Z0GA 4B3SI 4DXLA 3LTOA 2WW4A 1XNRI 1N34I 2F4VI 4JI5E 4DR6E 2BV3A 5L3JA 4DR4I 1N32E 4LF9E 4LF5E 2VQFE 4JI2I 1ZM3A 1PVGA 1I94I 4RPFA 3PYDA 1N34E 1HR0E 4URLA 5LMUE 3J81Q 4DR1I 2V2ZA 3J80C 2EFGA 3LNUA 1OJ4A 4JI2E 5GMDA 1H73A 2DEIA 2R42A 4JI6E 4Z7CA 4DV0I 2VF3A 1IBKI 4DR1E 4LFAI 4DV4E 1Z0BA 1H74A 2NPFA 1Z59A 2AJ4A 2V2QA 3D4JA 4MYUA 3B78A 4LF7E 4HY1A 2ZM6I 1FNMA 1RR9A 3WU3A 1KTVA 4DV2I 3B8HA 3PYEA 1ZXNA 4X66I 4DPTA 4LFBI 5BR8E 2GS8A 4LFCE 1ZM4A 4R1FA 2ZM6E 1A6FA 1S4EA 1MX0A 3J7AM 2X7IA 3H4LA 3GONA 3ZZTA 4LFBE 4DR3E 4PRXA 1S16A 3OTOI 1ZM9A 1XHKA 3V2UC 4DR7E 4USMA 4DV3I
chains in the Genus database with same CATH superfamily
2R3VA 4X65E 1OYSA 2JEAB 4DPWA 1DARA 4ISAA 2IOPA 3OTOE 4LF5I 1Z0TA 4B3TI 2PO0A 3L7ZB 1KIJA 2HK2A 4M1KA 4DV3E 4JI3E 4KHPE 2C37A 5C0XC 2Z5BB 4IFDA 4FN5A 4OKGA 4QNKA 4LCHA 4YHHE 2HK3A 5LMUI 1HR0I 4OO1E 2VQEI 4PU9A 3ZZUA 1EI1A 3QT5A 1KKHA 4B3TE 5JEAC 1HNWI 4BA2A 1HNXI 1N33E 1R6LA 1KVKA 2Z5CB 4JI6I 3JAMQ 4JI4I 5C0XD 4X64E 2VQEE 2UUAI 4LF6I 2PNLA 4DV4I 3HULA 4JI7E 1H72C 5IWAE 2C39A 4P52A 1IBLE 2IESA 2NN6B 1XXEA 1HNWE 3PYGA 3M6AA 1HNXE 1ZM2A 2JEAA 1MU5A 2BM0A 4MQYA 1Z0CA 3PS3A 1UDNA 4JI4E 4LF7I 4IFDC 5A2QC 3B82A 4USKA 3ZM7A 3L7ZA 2UUAE 4LF6E 3P76A 4LCGA 3PYFA 4FW6A 1Y4SA 2CGEA 4B3ME 2Z5BA 2O3ZA 4U3DA 4NBQA 4DU7A 5BR8I 4I3HA 4LFCI 2A2CA 2HKJA 2HKEA 5K36B 4OO1B 3ZKDA 1XMOI 4IFDD 2BA1G 1PKPA 4LPFA 3QT7A 2Z5EA 2UXBI 2UXCE 4JI0I 4FW7A 3PS1A 4YY3I 4DV5I 2Z5CA 5LMNI 4DU8A 4IZJB 4UT4A 1OYRA 4DR3I 1XMQE 2BA0G 1FI4A 1U2RA 3JAMC 4HACB 1HNZI 4IZKB 2NN6A 1XMOE 3J81C 1FJGI 4FWDA 5FLXQ 4DR7I 2XEXA 2O1WA 2UXBE 1J5EI 4JI0E 1FKAE 4YY3E 4DV5E 4JV5E 5LMNE 2HHHI 3HJCA 4X65I 5IT9Q 1IBMI 3H1CA 3DD6A 2HFSA 4DR2I 1Z5AA 1PIEA 4IS9A 1HNZE 2E5LI 3T1HI 4GKJE 1ELOA 2NN6E 4DR5I 5DRPA 1FJGE 4P7AA 2C38B 2Q2EB 3PRYA 4KQVA 1J5EE 2LJPA 4DV6I 4JI3I 4KHPI 3QT8A 2HHHE 1IBME 4EMDA 1HK7A 4YHHI 4OO1A 4N3OA 4XTJA 1N0VC 4DR2E 3M7ND 5LL6R 4NXMI 1H7UA 1Y60A 4DPUA 2J7KA 2WP8B 3T1HE 2E5LE 1BKNA 4DR5E 3Q1QA 3CDIA 2E1RA 4IZJA 4UTGA 1N33I 2V2VA 4ZVIA 4DV6E 4GQUA 1Z0WA 5C0XE 1R6MA 4HACA 2UXDE 4LF4I 3KRNA 4IZKA 5K36E 4X64I 4WUDA 4JI7I 5IWAI 3GLLA 1USUA 1IBLI 4NXME 2ZBKB 2O1UA 3QT6A 2NN6F 5FLXC 5ELWA 2ZITA 4JI8I 3Q6NA 4PRVA 1VI7A 5IT9C 4WUBA 3WU4A 4DUZI 4LF4E 4AM3A 1YH8A 4NXNI 1UEKA 2C38A 2V34A 1FWLA 2BR2B 4LOMA 1NHIA 1UDSA 4B3MI 3M85D 5JEAD 4Z7YA 1B62A 4B3SE 4MU4A 4JI8E 1N0UA 3J7AG 1XNRE 4K0KI 4DUZE 1WUUA 2F4VE 1EA6A 2WP8A 5DNXA 5C0XF 4NXNE 4AIMA 3NZKA 5K36F 4OO1F 1NZ0A 4HYMA 1UDQA 2UXCI 4DR4E 3U1KA 1E3HA 4ED4A 3B4TA 4FW9A 3ZKBA 1USVA 3P3CA 4OX9I 1XMQI 4OZEA 3F0NA 1QZRA 2UU9I 3PS2A 4AIDA 1I94E 4GKKI 5C0XB 4K0KE 2VESA 4LF8I 2GO3A 4B3RI 4DPXA 4QNJA 3K17A 4FW3A 4JV5I 2OI2A 1XNQI 1NHHA 4OX9E 1YHCA 1ZXMA 1D6TA 3LPSA 2GQ0A 2CVEA 2UU9E 4DUYI 5GMEA 4GKKE 3ZZ0A 4LF8E 4FWGA 4GKJI 4DV0E 3CDJA 4WUCA 4B3RE 4DV1I 1IBKE 4FW5A 4MYTA 2UUBI 2F1DA 4LFAE 4JI1I 3P06A 5EKWA 2DEJA 1XNQE 2O1TA 1Z5CA 2PNZB 1MG7A 4DUYE 3K1JA 2PNMA 4AQYI 2V8PA 4JG4A 1FWKA 4JYAI 1Z0VA 2IERA 1K47A 1P42A 2JEBB 4DV7I 4DV1E 1E3PA 1N36I 2UUBE 4DV2E 4JI1E 3M7NG 4FWHA 2BM1A 2WNRB 1VISA 3T1YI 5C0XA 1B63A 2UXDI 3K85A 4X66E 5K36A 2A2DA 2HFUA 4AQYE 2O1VA 2UUCI 5DRRA 4JYAE 2PO1B 3J80Q 4X62I 2NN6C 3V5RA 4DV7E 1N36E 4DPYA 2X36A 3WU6A 1Z5BA 3T1YE 2CG9A 1RREA 2JT2A 3P3EA 3CWVA 5A2QQ 4JI5I 1NHJA 4DR6I 4HXZA 2UUCE 1UDOA 2CZ9A 1N32I 4LF9I 4X62E 1H7SA 1Z0EA 3WU5A 2VQFI 5JEAE 1Z0GA 2NN6D 4B3SI 4DXLA 2PNZA 3LTOA 4MDTA 2WW4A 1Y6ZA 1XNRI 1RHYA 1N34I 3GCMA 3M85G 2F4VI 5K36C 4OO1C 4JI5E 5DROA 2JEBA 4DR6E 2BV3A 5L3JA 4DR4I 1N32E 4LF9E 1OYPA 4LF5E 2VQFE 2WNRA 4JI2I 1ZM3A 3Q6MA 2PO2B 1PVGA 1I94I 4RPFA 3PYDA 1N34E 2PO1A 4MU0A 5DRQA 4IFDE 1HR0E 4URLA 5LMUE 3J81Q 4DR1I 5K36D 4OO1D 2V2ZA 3J80C 2EFGA 3LNUA 1OJ4A 4JI2E 5GMDA 5JEAF 1H73A 2JE6B 4IZJD 5EL9A 2IOQA 2DEIA 2R42A 4JI6E 4Z7CA 4DV0I 2VF3A 4FW4A 4MU1A 4BA1B 4DR1E 1IBKI 4LFAI 4DV4E 1Z0BA 2J65A 5JEAB 5DNLA 1H74A 2NPFA 1Z59A 4U3BA 2AJ4A 2V2QA 3D4JA 3HKMA 4MYUA 4MU3A 3B78A 2BR2A 4LF7E 4HY1A 2ZM6I 1FNMA 1RR9A 3WU3A 4IFDF 1KTVA 4DV2I 2PO2A 3GMEA 3B8HA 3PYEA 1ZXNA 2PO0B 4LCFA 4X66I 4DPTA 4LFBI 2BA1D 5BR8E 2GS8A 2C37B 4LFCE 1ZM4A 4R1FA 4IFDB 1Y4UA 2ZM6E 1A6FA 1S4EA 1MX0A 2BA0D 3J7AM 2JE6A 3U1YA 2X7IA 1Y5YA 3H4LA 4J3DA 4BA2B 3GONA 3ZZTA 4LFBE 4DR3E 4PRXA 2AE8A 2GO4A 1S16A 4BA1A 3P3GA 3OTOI 1ZM9A 5JEAA 1XHKA 3V2UC 4DR7E 2C39B 4USMA 3UHMA 5FWKA 4DV3I
chains in the Genus database with same CATH topology
2R3VA 4X65E 4DPWA 1DARA 2IOPA 3OTOE 4LF5I 1Z0TA 4B3TI 1KIJA 2HK2A 4M1KA 4DV3E 4JI3E 4KHPE 2Z5BB 4FN5A 4YHHE 5LMUI 1HR0I 2HK3A 2VQEI 4PU9A 3ZZUA 1EI1A 3QT5A 1KKHA 4B3TE 1HNWI 1HNXI 1N33E 1KVKA 2Z5CB 4JI6I 3JAMQ 4JI4I 4X64E 2VQEE 2UUAI 4LF6I 2PNLA 4DV4I 3HULA 4JI7E 1H72C 5IWAE 4P52A 1IBLE 1HNWE 3PYGA 3M6AA 1HNXE 1ZM2A 1MU5A 2BM0A 1Z0CA 4JI4E 4LF7I 5A2QC 3B82A 4USKA 3ZM7A 4LF6E 2UUAE 3PYFA 1Y4SA 2CGEA 4B3ME 2Z5BA 4DU7A 5BR8I 4I3HA 4LFCI 2A2CA 2HKJA 2HKEA 3ZKDA 1XMOI 1PKPA 3QT7A 2Z5EA 2UXBI 2UXCE 4JI0I 4YY3I 4DV5I 2Z5CA 5LMNI 4DU8A 4IZJB 4UT4A 4DR3I 1XMQE 1FI4A 1U2RA 3JAMC 4HACB 1HNZI 4IZKB 1XMOE 3J81C 1FJGI 4FWDA 5FLXQ 4DR7I 2XEXA 2O1WA 2UXBE 1J5EI 4JI0E 1FKAE 4YY3E 4DV5E 4JV5E 5LMNE 2HHHI 3HJCA 4X65I 5IT9Q 1IBMI 2HFSA 4DR2I 1Z5AA 1PIEA 1HNZE 2E5LI 3T1HI 4GKJE 1ELOA 4DR5I 1FJGE 4P7AA 2Q2EB 3PRYA 4KQVA 1J5EE 2LJPA 4DV6I 4JI3I 4KHPI 3QT8A 2HHHE 1IBME 4EMDA 1HK7A 4YHHI 4N3OA 4XTJA 1N0VC 4DR2E 5LL6R 4NXMI 1H7UA 4DPUA 2J7KA 2E5LE 3T1HE 1BKNA 4DR5E 3Q1QA 2E1RA 4IZJA 4UTGA 1N33I 2V2VA 4ZVIA 4DV6E 1Z0WA 4HACA 2UXDE 4LF4I 4IZKA 4X64I 4WUDA 4JI7I 5IWAI 1IBLI 1USUA 4NXME 2ZBKB 2O1UA 3QT6A 5FLXC 2ZITA 4JI8I 3Q6NA 4PRVA 5IT9C 4WUBA 3WU4A 4DUZI 4LF4E 4NXNI 1UEKA 2V34A 1FWLA 1NHIA 4B3MI 4Z7YA 1B62A 4B3SE 4JI8E 1N0UA 3J7AG 1XNRE 4K0KI 4DUZE 1WUUA 2F4VE 1EA6A 4NXNE 1NZ0A 4HYMA 2UXCI 4DR4E 4ED4A 4FW9A 3ZKBA 1USVA 4OX9I 1XMQI 3F0NA 1QZRA 2UU9I 1I94E 4GKKI 4K0KE 4LF8I 4B3RI 4DPXA 3K17A 4JV5I 2OI2A 1XNQI 1NHHA 4OX9E 1ZXMA 1D6TA 3LPSA 2GQ0A 2UU9E 4DUYI 5GMEA 4GKKE 3ZZ0A 4LF8E 4FWGA 4GKJI 4DV0E 4WUCA 4B3RE 4DV1I 1IBKE 4MYTA 2UUBI 4LFAE 4JI1I 3P06A 2DEJA 1XNQE 2O1TA 1Z5CA 1MG7A 4DUYE 3K1JA 2PNMA 4AQYI 2V8PA 4JG4A 1FWKA 4JYAI 1Z0VA 1K47A 4DV7I 4DV1E 1N36I 2UUBE 4DV2E 4JI1E 4FWHA 2BM1A 1VISA 3T1YI 1B63A 2UXDI 3K85A 4X66E 2A2DA 2HFUA 4AQYE 2O1VA 2UUCI 4JYAE 3J80Q 4X62I 3V5RA 4DV7E 1N36E 4DPYA 2X36A 3WU6A 1Z5BA 3T1YE 2CG9A 1RREA 3CWVA 5A2QQ 4JI5I 1NHJA 4DR6I 4HXZA 2UUCE 2CZ9A 1N32I 4LF9I 4X62E 1H7SA 1Z0EA 3WU5A 2VQFI 1Z0GA 4B3SI 4DXLA 3LTOA 2WW4A 1Y6ZA 1XNRI 1N34I 2F4VI 4JI5E 4DR6E 2BV3A 5L3JA 4DR4I 1N32E 4LF9E 4LF5E 2VQFE 4JI2I 1ZM3A 3Q6MA 1PVGA 1I94I 4RPFA 3PYDA 1N34E 1HR0E 4URLA 5LMUE 3J81Q 4DR1I 2V2ZA 3J80C 2EFGA 3LNUA 1OJ4A 4JI2E 5GMDA 1H73A 4IZJD 2IOQA 2DEIA 2R42A 4JI6E 4Z7CA 4DV0I 2VF3A 1IBKI 4DR1E 4LFAI 4DV4E 1Z0BA 1H74A 2NPFA 1Z59A 2AJ4A 2V2QA 3D4JA 4MYUA 3B78A 4LF7E 4HY1A 2ZM6I 1FNMA 1RR9A 3WU3A 1KTVA 4DV2I 3B8HA 3PYEA 1ZXNA 4X66I 4DPTA 4LFBI 5BR8E 2GS8A 4LFCE 1ZM4A 4R1FA 1Y4UA 2ZM6E 1A6FA 1S4EA 1MX0A 3J7AM 2X7IA 3H4LA 3GONA 3ZZTA 4LFBE 4DR3E 4PRXA 1S16A 3OTOI 1ZM9A 1XHKA 3V2UC 4DR7E 4USMA 5FWKA 4DV3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3V A;  4X65 E;  4DPW A;  1DAR A;  3OTO E;  4LF5 I;  1Z0T A;  4B3T I;  1KIJ A;  2HK2 A;  4M1K A;  4DV3 E;  4JI3 E;  4KHP E;  4FN5 A;  4YHH E;  5LMU I;  1HR0 I;  2HK3 A;  2VQE I;  4PU9 A;  3ZZU A;  1EI1 A;  3QT5 A;  1KKH A;  4B3T E;  1HNW I;  1HNX I;  1N33 E;  1KVK A;  4JI6 I;  3JAM Q;  4JI4 I;  4X64 E;  2VQE E;  2UUA I;  4LF6 I;  4DV4 I;  3HUL A;  4JI7 E;  1H72 C;  5IWA E;  4P52 A;  1IBL E;  1HNW E;  3PYG A;  3M6A A;  1HNX E;  1ZM2 A;  1MU5 A;  2BM0 A;  1Z0C A;  4JI4 E;  4LF7 I;  5A2Q C;  3B82 A;  4USK A;  3ZM7 A;  4LF6 E;  2UUA E;  3PYF A;  4B3M E;  4DU7 A;  5BR8 I;  4I3H A;  4LFC I;  2A2C A;  2HKJ A;  2HKE A;  3ZKD A;  1XMO I;  1PKP A;  3QT7 A;  2UXB I;  2UXC E;  4JI0 I;  4YY3 I;  4DV5 I;  5LMN I;  4DU8 A;  4UT4 A;  4DR3 I;  1XMQ E;  1FI4 A;  1U2R A;  3JAM C;  4HAC B;  1HNZ I;  1XMO E;  3J81 C;  1FJG I;  4FWD A;  5FLX Q;  4DR7 I;  2XEX A;  2UXB E;  1J5E I;  4JI0 E;  1FKA E;  4YY3 E;  4DV5 E;  4JV5 E;  5LMN E;  2HHH I;  4X65 I;  5IT9 Q;  1IBM I;  2HFS A;  4DR2 I;  1Z5A A;  1PIE A;  1HNZ E;  2E5L I;  3T1H I;  4GKJ E;  1ELO A;  4DR5 I;  1FJG E;  4P7A A;  2Q2E B;  4KQV A;  1J5E E;  2LJP A;  4DV6 I;  4JI3 I;  4KHP I;  3QT8 A;  2HHH E;  1IBM E;  4EMD A;  4YHH I;  4XTJ A;  1N0V C;  4DR2 E;  5LL6 R;  4NXM I;  1H7U A;  4DPU A;  2J7K A;  2E5L E;  3T1H E;  1BKN A;  4DR5 E;  3Q1Q A;  2E1R A;  4UTG A;  1N33 I;  2V2V A;  4ZVI A;  4DV6 E;  1Z0W A;  4HAC A;  2UXD E;  4LF4 I;  4X64 I;  4WUD A;  4JI7 I;  5IWA I;  1IBL I;  4NXM E;  2ZBK B;  3QT6 A;  5FLX C;  2ZIT A;  4JI8 I;  4PRV A;  5IT9 C;  4WUB A;  3WU4 A;  4DUZ I;  4LF4 E;  4NXN I;  1UEK A;  2V34 A;  1FWL A;  1NHI A;  4B3M I;  4Z7Y A;  1B62 A;  4B3S E;  4JI8 E;  1N0U A;  3J7A G;  1XNR E;  4K0K I;  4DUZ E;  1WUU A;  2F4V E;  1EA6 A;  4NXN E;  1NZ0 A;  4HYM A;  2UXC I;  4DR4 E;  4ED4 A;  4FW9 A;  3ZKB A;  4OX9 I;  1XMQ I;  3F0N A;  1QZR A;  2UU9 I;  1I94 E;  4GKK I;  4K0K E;  4LF8 I;  4B3R I;  4DPX A;  3K17 A;  4JV5 I;  2OI2 A;  1XNQ I;  1NHH A;  4OX9 E;  1ZXM A;  1D6T A;  3LPS A;  2UU9 E;  4DUY I;  5GME A;  4GKK E;  3ZZ0 A;  4LF8 E;  4FWG A;  4GKJ I;  4DV0 E;  4WUC A;  4B3R E;  4DV1 I;  1IBK E;  4MYT A;  2UUB I;  4LFA E;  4JI1 I;  2DEJ A;  1XNQ E;  1Z5C A;  1MG7 A;  4DUY E;  3K1J A;  4AQY I;  2V8P A;  4JG4 A;  1FWK A;  4JYA I;  1Z0V A;  1K47 A;  4DV7 I;  4DV1 E;  1N36 I;  2UUB E;  4DV2 E;  4JI1 E;  4FWH A;  2BM1 A;  1VIS A;  3T1Y I;  1B63 A;  2UXD I;  4X66 E;  2A2D A;  2HFU A;  4AQY E;  2UUC I;  4JYA E;  3J80 Q;  4X62 I;  3V5R A;  4DV7 E;  1N36 E;  4DPY A;  2X36 A;  3WU6 A;  1Z5B A;  3T1Y E;  1RRE A;  3CWV A;  5A2Q Q;  4JI5 I;  1NHJ A;  4DR6 I;  4HXZ A;  2UUC E;  2CZ9 A;  1N32 I;  4LF9 I;  4X62 E;  1H7S A;  1Z0E A;  3WU5 A;  2VQF I;  1Z0G A;  4B3S I;  4DXL A;  3LTO A;  2WW4 A;  1XNR I;  1N34 I;  2F4V I;  4JI5 E;  4DR6 E;  2BV3 A;  5L3J A;  4DR4 I;  1N32 E;  4LF9 E;  4LF5 E;  2VQF E;  4JI2 I;  1ZM3 A;  1PVG A;  1I94 I;  4RPF A;  3PYD A;  1N34 E;  1HR0 E;  4URL A;  5LMU E;  3J81 Q;  4DR1 I;  2V2Z A;  3J80 C;  2EFG A;  3LNU A;  1OJ4 A;  4JI2 E;  5GMD A;  1H73 A;  2DEI A;  2R42 A;  4JI6 E;  4Z7C A;  4DV0 I;  2VF3 A;  1IBK I;  4DR1 E;  4LFA I;  4DV4 E;  1Z0B A;  1H74 A;  2NPF A;  1Z59 A;  2AJ4 A;  2V2Q A;  3D4J A;  4MYU A;  3B78 A;  4LF7 E;  4HY1 A;  2ZM6 I;  1FNM A;  1RR9 A;  3WU3 A;  1KTV A;  4DV2 I;  3B8H A;  3PYE A;  1ZXN A;  4X66 I;  4DPT A;  4LFB I;  5BR8 E;  2GS8 A;  4LFC E;  1ZM4 A;  4R1F A;  2ZM6 E;  1A6F A;  1S4E A;  1MX0 A;  3J7A M;  2X7I A;  3H4L A;  3GON A;  3ZZT A;  4LFB E;  4DR3 E;  4PRX A;  1S16 A;  3OTO I;  1ZM9 A;  1XHK A;  3V2U C;  4DR7 E;  4USM A;  4DV3 I; 
#chains in the Genus database with same CATH topology
 2R3V A;  4X65 E;  1OYS A;  2JEA B;  4DPW A;  1DAR A;  4ISA A;  2IOP A;  3OTO E;  4LF5 I;  1Z0T A;  4B3T I;  2PO0 A;  3L7Z B;  1KIJ A;  2HK2 A;  4M1K A;  4DV3 E;  4JI3 E;  4KHP E;  2C37 A;  5C0X C;  2Z5B B;  4IFD A;  4FN5 A;  4OKG A;  4QNK A;  4LCH A;  4YHH E;  2HK3 A;  5LMU I;  1HR0 I;  4OO1 E;  2VQE I;  4PU9 A;  3ZZU A;  1EI1 A;  3QT5 A;  1KKH A;  4B3T E;  5JEA C;  1HNW I;  4BA2 A;  1HNX I;  1N33 E;  1R6L A;  1KVK A;  2Z5C B;  4JI6 I;  3JAM Q;  4JI4 I;  5C0X D;  4X64 E;  2VQE E;  2UUA I;  4LF6 I;  2PNL A;  4DV4 I;  3HUL A;  4JI7 E;  1H72 C;  5IWA E;  2C39 A;  4P52 A;  1IBL E;  2IES A;  2NN6 B;  1XXE A;  1HNW E;  3PYG A;  3M6A A;  1HNX E;  1ZM2 A;  2JEA A;  1MU5 A;  2BM0 A;  4MQY A;  1Z0C A;  3PS3 A;  1UDN A;  4JI4 E;  4LF7 I;  4IFD C;  5A2Q C;  3B82 A;  4USK A;  3ZM7 A;  3L7Z A;  2UUA E;  4LF6 E;  3P76 A;  4LCG A;  3PYF A;  4FW6 A;  1Y4S A;  2CGE A;  4B3M E;  2Z5B A;  2O3Z A;  4U3D A;  4NBQ A;  4DU7 A;  5BR8 I;  4I3H A;  4LFC I;  2A2C A;  2HKJ A;  2HKE A;  5K36 B;  4OO1 B;  3ZKD A;  1XMO I;  4IFD D;  2BA1 G;  1PKP A;  4LPF A;  3QT7 A;  2Z5E A;  2UXB I;  2UXC E;  4JI0 I;  4FW7 A;  3PS1 A;  4YY3 I;  4DV5 I;  2Z5C A;  5LMN I;  4DU8 A;  4IZJ B;  4UT4 A;  1OYR A;  4DR3 I;  1XMQ E;  2BA0 G;  1FI4 A;  1U2R A;  3JAM C;  4HAC B;  1HNZ I;  4IZK B;  2NN6 A;  1XMO E;  3J81 C;  1FJG I;  4FWD A;  5FLX Q;  4DR7 I;  2XEX A;  2O1W A;  2UXB E;  1J5E I;  4JI0 E;  1FKA E;  4YY3 E;  4DV5 E;  4JV5 E;  5LMN E;  2HHH I;  3HJC A;  4X65 I;  5IT9 Q;  1IBM I;  3H1C A;  3DD6 A;  2HFS A;  4DR2 I;  1Z5A A;  1PIE A;  4IS9 A;  1HNZ E;  2E5L I;  3T1H I;  4GKJ E;  1ELO A;  2NN6 E;  4DR5 I;  5DRP A;  1FJG E;  4P7A A;  2C38 B;  2Q2E B;  3PRY A;  4KQV A;  1J5E E;  2LJP A;  4DV6 I;  4JI3 I;  4KHP I;  3QT8 A;  2HHH E;  1IBM E;  4EMD A;  1HK7 A;  4YHH I;  4OO1 A;  4N3O A;  4XTJ A;  1N0V C;  4DR2 E;  3M7N D;  5LL6 R;  4NXM I;  1H7U A;  1Y60 A;  4DPU A;  2J7K A;  2WP8 B;  3T1H E;  2E5L E;  1BKN A;  4DR5 E;  3Q1Q A;  3CDI A;  2E1R A;  4IZJ A;  4UTG A;  1N33 I;  2V2V A;  4ZVI A;  4DV6 E;  4GQU A;  1Z0W A;  5C0X E;  1R6M A;  4HAC A;  2UXD E;  4LF4 I;  3KRN A;  4IZK A;  5K36 E;  4X64 I;  4WUD A;  4JI7 I;  5IWA I;  3GLL A;  1USU A;  1IBL I;  4NXM E;  2ZBK B;  2O1U A;  3QT6 A;  2NN6 F;  5FLX C;  5ELW A;  2ZIT A;  4JI8 I;  3Q6N A;  4PRV A;  1VI7 A;  5IT9 C;  4WUB A;  3WU4 A;  4DUZ I;  4LF4 E;  4AM3 A;  1YH8 A;  4NXN I;  1UEK A;  2C38 A;  2V34 A;  1FWL A;  2BR2 B;  4LOM A;  1NHI A;  1UDS A;  4B3M I;  3M85 D;  5JEA D;  4Z7Y A;  1B62 A;  4B3S E;  4MU4 A;  4JI8 E;  1N0U A;  3J7A G;  1XNR E;  4K0K I;  4DUZ E;  1WUU A;  2F4V E;  1EA6 A;  2WP8 A;  5DNX A;  5C0X F;  4NXN E;  4AIM A;  3NZK A;  5K36 F;  4OO1 F;  1NZ0 A;  4HYM A;  1UDQ A;  2UXC I;  4DR4 E;  3U1K A;  1E3H A;  4ED4 A;  3B4T A;  4FW9 A;  3ZKB A;  1USV A;  3P3C A;  4OX9 I;  1XMQ I;  4OZE A;  3F0N A;  1QZR A;  2UU9 I;  3PS2 A;  4AID A;  1I94 E;  4GKK I;  5C0X B;  4K0K E;  2VES A;  4LF8 I;  2GO3 A;  4B3R I;  4DPX A;  4QNJ A;  3K17 A;  4FW3 A;  4JV5 I;  2OI2 A;  1XNQ I;  1NHH A;  4OX9 E;  1YHC A;  1ZXM A;  1D6T A;  3LPS A;  2GQ0 A;  2CVE A;  2UU9 E;  4DUY I;  5GME A;  4GKK E;  3ZZ0 A;  4LF8 E;  4FWG A;  4GKJ I;  4DV0 E;  3CDJ A;  4WUC A;  4B3R E;  4DV1 I;  1IBK E;  4FW5 A;  4MYT A;  2UUB I;  2F1D A;  4LFA E;  4JI1 I;  3P06 A;  5EKW A;  2DEJ A;  1XNQ E;  2O1T A;  1Z5C A;  2PNZ B;  1MG7 A;  4DUY E;  3K1J A;  2PNM A;  4AQY I;  2V8P A;  4JG4 A;  1FWK A;  4JYA I;  1Z0V A;  2IER A;  1K47 A;  1P42 A;  2JEB B;  4DV7 I;  4DV1 E;  1E3P A;  1N36 I;  2UUB E;  4DV2 E;  4JI1 E;  3M7N G;  4FWH A;  2BM1 A;  2WNR B;  1VIS A;  3T1Y I;  5C0X A;  1B63 A;  2UXD I;  3K85 A;  4X66 E;  5K36 A;  2A2D A;  2HFU A;  4AQY E;  2O1V A;  2UUC I;  5DRR A;  4JYA E;  2PO1 B;  3J80 Q;  4X62 I;  2NN6 C;  3V5R A;  4DV7 E;  1N36 E;  4DPY A;  2X36 A;  3WU6 A;  1Z5B A;  3T1Y E;  2CG9 A;  1RRE A;  2JT2 A;  3P3E A;  3CWV A;  5A2Q Q;  4JI5 I;  1NHJ A;  4DR6 I;  4HXZ A;  2UUC E;  1UDO A;  2CZ9 A;  1N32 I;  4LF9 I;  4X62 E;  1H7S A;  1Z0E A;  3WU5 A;  2VQF I;  5JEA E;  1Z0G A;  2NN6 D;  4B3S I;  4DXL A;  2PNZ A;  3LTO A;  4MDT A;  2WW4 A;  1Y6Z A;  1XNR I;  1RHY A;  1N34 I;  3GCM A;  3M85 G;  2F4V I;  5K36 C;  4OO1 C;  4JI5 E;  5DRO A;  2JEB A;  4DR6 E;  2BV3 A;  5L3J A;  4DR4 I;  1N32 E;  4LF9 E;  1OYP A;  4LF5 E;  2VQF E;  2WNR A;  4JI2 I;  1ZM3 A;  3Q6M A;  2PO2 B;  1PVG A;  1I94 I;  4RPF A;  3PYD A;  1N34 E;  2PO1 A;  4MU0 A;  5DRQ A;  4IFD E;  1HR0 E;  4URL A;  5LMU E;  3J81 Q;  4DR1 I;  5K36 D;  4OO1 D;  2V2Z A;  3J80 C;  2EFG A;  3LNU A;  1OJ4 A;  4JI2 E;  5GMD A;  5JEA F;  1H73 A;  2JE6 B;  4IZJ D;  5EL9 A;  2IOQ A;  2DEI A;  2R42 A;  4JI6 E;  4Z7C A;  4DV0 I;  2VF3 A;  4FW4 A;  4MU1 A;  4BA1 B;  4DR1 E;  1IBK I;  4LFA I;  4DV4 E;  1Z0B A;  2J65 A;  5JEA B;  5DNL A;  1H74 A;  2NPF A;  1Z59 A;  4U3B A;  2AJ4 A;  2V2Q A;  3D4J A;  3HKM A;  4MYU A;  4MU3 A;  3B78 A;  2BR2 A;  4LF7 E;  4HY1 A;  2ZM6 I;  1FNM A;  1RR9 A;  3WU3 A;  4IFD F;  1KTV A;  4DV2 I;  2PO2 A;  3GME A;  3B8H A;  3PYE A;  1ZXN A;  2PO0 B;  4LCF A;  4X66 I;  4DPT A;  4LFB I;  2BA1 D;  5BR8 E;  2GS8 A;  2C37 B;  4LFC E;  1ZM4 A;  4R1F A;  4IFD B;  1Y4U A;  2ZM6 E;  1A6F A;  1S4E A;  1MX0 A;  2BA0 D;  3J7A M;  2JE6 A;  3U1Y A;  2X7I A;  1Y5Y A;  3H4L A;  4J3D A;  4BA2 B;  3GON A;  3ZZT A;  4LFB E;  4DR3 E;  4PRX A;  2AE8 A;  2GO4 A;  1S16 A;  4BA1 A;  3P3G A;  3OTO I;  1ZM9 A;  5JEA A;  1XHK A;  3V2U C;  4DR7 E;  2C39 B;  4USM A;  3UHM A;  5FWK A;  4DV3 I; 
#chains in the Genus database with same CATH homology
 2R3V A;  4X65 E;  4DPW A;  1DAR A;  2IOP A;  3OTO E;  4LF5 I;  1Z0T A;  4B3T I;  1KIJ A;  2HK2 A;  4M1K A;  4DV3 E;  4JI3 E;  4KHP E;  2Z5B B;  4FN5 A;  4YHH E;  5LMU I;  1HR0 I;  2HK3 A;  2VQE I;  4PU9 A;  3ZZU A;  1EI1 A;  3QT5 A;  1KKH A;  4B3T E;  1HNW I;  1HNX I;  1N33 E;  1KVK A;  2Z5C B;  4JI6 I;  3JAM Q;  4JI4 I;  4X64 E;  2VQE E;  2UUA I;  4LF6 I;  2PNL A;  4DV4 I;  3HUL A;  4JI7 E;  1H72 C;  5IWA E;  4P52 A;  1IBL E;  1HNW E;  3PYG A;  3M6A A;  1HNX E;  1ZM2 A;  1MU5 A;  2BM0 A;  1Z0C A;  4JI4 E;  4LF7 I;  5A2Q C;  3B82 A;  4USK A;  3ZM7 A;  4LF6 E;  2UUA E;  3PYF A;  1Y4S A;  2CGE A;  4B3M E;  2Z5B A;  4DU7 A;  5BR8 I;  4I3H A;  4LFC I;  2A2C A;  2HKJ A;  2HKE A;  3ZKD A;  1XMO I;  1PKP A;  3QT7 A;  2Z5E A;  2UXB I;  2UXC E;  4JI0 I;  4YY3 I;  4DV5 I;  2Z5C A;  5LMN I;  4DU8 A;  4IZJ B;  4UT4 A;  4DR3 I;  1XMQ E;  1FI4 A;  1U2R A;  3JAM C;  4HAC B;  1HNZ I;  4IZK B;  1XMO E;  3J81 C;  1FJG I;  4FWD A;  5FLX Q;  4DR7 I;  2XEX A;  2O1W A;  2UXB E;  1J5E I;  4JI0 E;  1FKA E;  4YY3 E;  4DV5 E;  4JV5 E;  5LMN E;  2HHH I;  3HJC A;  4X65 I;  5IT9 Q;  1IBM I;  2HFS A;  4DR2 I;  1Z5A A;  1PIE A;  1HNZ E;  2E5L I;  3T1H I;  4GKJ E;  1ELO A;  4DR5 I;  1FJG E;  4P7A A;  2Q2E B;  3PRY A;  4KQV A;  1J5E E;  2LJP A;  4DV6 I;  4JI3 I;  4KHP I;  3QT8 A;  2HHH E;  1IBM E;  4EMD A;  1HK7 A;  4YHH I;  4N3O A;  4XTJ A;  1N0V C;  4DR2 E;  5LL6 R;  4NXM I;  1H7U A;  4DPU A;  2J7K A;  2E5L E;  3T1H E;  1BKN A;  4DR5 E;  3Q1Q A;  2E1R A;  4IZJ A;  4UTG A;  1N33 I;  2V2V A;  4ZVI A;  4DV6 E;  1Z0W A;  4HAC A;  2UXD E;  4LF4 I;  4IZK A;  4X64 I;  4WUD A;  4JI7 I;  5IWA I;  1IBL I;  1USU A;  4NXM E;  2ZBK B;  2O1U A;  3QT6 A;  5FLX C;  2ZIT A;  4JI8 I;  3Q6N A;  4PRV A;  5IT9 C;  4WUB A;  3WU4 A;  4DUZ I;  4LF4 E;  4NXN I;  1UEK A;  2V34 A;  1FWL A;  1NHI A;  4B3M I;  4Z7Y A;  1B62 A;  4B3S E;  4JI8 E;  1N0U A;  3J7A G;  1XNR E;  4K0K I;  4DUZ E;  1WUU A;  2F4V E;  1EA6 A;  4NXN E;  1NZ0 A;  4HYM A;  2UXC I;  4DR4 E;  4ED4 A;  4FW9 A;  3ZKB A;  1USV A;  4OX9 I;  1XMQ I;  3F0N A;  1QZR A;  2UU9 I;  1I94 E;  4GKK I;  4K0K E;  4LF8 I;  4B3R I;  4DPX A;  3K17 A;  4JV5 I;  2OI2 A;  1XNQ I;  1NHH A;  4OX9 E;  1ZXM A;  1D6T A;  3LPS A;  2GQ0 A;  2UU9 E;  4DUY I;  5GME A;  4GKK E;  3ZZ0 A;  4LF8 E;  4FWG A;  4GKJ I;  4DV0 E;  4WUC A;  4B3R E;  4DV1 I;  1IBK E;  4MYT A;  2UUB I;  4LFA E;  4JI1 I;  3P06 A;  2DEJ A;  1XNQ E;  2O1T A;  1Z5C A;  1MG7 A;  4DUY E;  3K1J A;  2PNM A;  4AQY I;  2V8P A;  4JG4 A;  1FWK A;  4JYA I;  1Z0V A;  1K47 A;  4DV7 I;  4DV1 E;  1N36 I;  2UUB E;  4DV2 E;  4JI1 E;  4FWH A;  2BM1 A;  1VIS A;  3T1Y I;  1B63 A;  2UXD I;  3K85 A;  4X66 E;  2A2D A;  2HFU A;  4AQY E;  2O1V A;  2UUC I;  4JYA E;  3J80 Q;  4X62 I;  3V5R A;  4DV7 E;  1N36 E;  4DPY A;  2X36 A;  3WU6 A;  1Z5B A;  3T1Y E;  2CG9 A;  1RRE A;  3CWV A;  5A2Q Q;  4JI5 I;  1NHJ A;  4DR6 I;  4HXZ A;  2UUC E;  2CZ9 A;  1N32 I;  4LF9 I;  4X62 E;  1H7S A;  1Z0E A;  3WU5 A;  2VQF I;  1Z0G A;  4B3S I;  4DXL A;  3LTO A;  2WW4 A;  1Y6Z A;  1XNR I;  1N34 I;  2F4V I;  4JI5 E;  4DR6 E;  2BV3 A;  5L3J A;  4DR4 I;  1N32 E;  4LF9 E;  4LF5 E;  2VQF E;  4JI2 I;  1ZM3 A;  3Q6M A;  1PVG A;  1I94 I;  4RPF A;  3PYD A;  1N34 E;  1HR0 E;  4URL A;  5LMU E;  3J81 Q;  4DR1 I;  2V2Z A;  3J80 C;  2EFG A;  3LNU A;  1OJ4 A;  4JI2 E;  5GMD A;  1H73 A;  4IZJ D;  2IOQ A;  2DEI A;  2R42 A;  4JI6 E;  4Z7C A;  4DV0 I;  2VF3 A;  1IBK I;  4DR1 E;  4LFA I;  4DV4 E;  1Z0B A;  1H74 A;  2NPF A;  1Z59 A;  2AJ4 A;  2V2Q A;  3D4J A;  4MYU A;  3B78 A;  4LF7 E;  4HY1 A;  2ZM6 I;  1FNM A;  1RR9 A;  3WU3 A;  1KTV A;  4DV2 I;  3B8H A;  3PYE A;  1ZXN A;  4X66 I;  4DPT A;  4LFB I;  5BR8 E;  2GS8 A;  4LFC E;  1ZM4 A;  4R1F A;  1Y4U A;  2ZM6 E;  1A6F A;  1S4E A;  1MX0 A;  3J7A M;  2X7I A;  3H4L A;  3GON A;  3ZZT A;  4LFB E;  4DR3 E;  4PRX A;  1S16 A;  3OTO I;  1ZM9 A;  1XHK A;  3V2U C;  4DR7 E;  4USM A;  5FWK A;  4DV3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...