4DV4I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4I00
4JYAE 1I94I 1N33I 4DUYI 5IT9C 2UXBE 1ZM2A 1PIEA 5FLXC 4PU9A 4DV0I 3PYEA 3ZKDA 1HNXE 1Z59A 1ELOA 4LF7I 3QT7A 2E1RA 4I3HA 4DR2I 1BKNA 1HNZI 5FLXQ 2UUCI 3K1JA 4JI4E 4JI0I 1J5EE 3WU5A 3QT5A 2ZITA 1MU5A 4HACA 4PRXA 3QT8A 4LF9I 1N36I 4LF4I 5IWAE 2VQEE 3QT6A 4LF4E 2HHHI 2NPFA 4JYAI 1MG7A 1Z5BA 1Z0VA 3LPSA 1IBLI 4FWGA 1J5EI 1KIJA 1UEKA 4DR5E 1FI4A 2UXCE 4KHPE 1Z5CA 4LF8E 1XNRI 2V2QA 4LFAE 2VQFE 1N0VC 4DV3E 1I94E 4B3RE 5BR8I 3ZKBA 1DARA 1FWKA 4ED4A 4NXME 1IBME 4DR4E 2UXDE 4DV6E 2E5LE 4B3SI 4X64E 2R42A 1N32E 1ZXNA 4AQYE 1ZM3A 2HFUA 4LFCI 4WUCA 5LL6R 1Z0CA 3V5RA 1K47A 2HKEA 2ZBKB 3K17A 3JAMQ 4DXLA 4XTJA 4DPUA 2UXBI 1ZM4A 4LF6I 3T1YE 3ZZUA 1FKAE 4DR1I 4DV4I 4JI2E 2WW4A 1H7UA 2V2VA 1PVGA 1FJGI 3B78A 2AJ4A 1IBKI 3PYGA 4JV5I 4WUDA 1B62A 1NHJA 2CZ9A 5LMNE 1A6FA 4URLA 3WU6A 4NXMI 1NHIA 4K0KI 2UXDI 3GONA 2X7IA 2ZM6I 4LF5E 4LF5I 4DUYE 4DR3I 4DPTA 2UUAE 4DUZI 4MYTA 4X65E 1XNRE 1U2RA 3J7AG 2V2ZA 4X62E 1Z0BA 2UU9I 4WUBA 3CWVA 4JI8E 4KHPI 4B3TI 4LF7E 1NHHA 4ZVIA 1MX0A 4OX9E 2UUBE 4GKJI 4JG4A 2OI2A 2HK2A 4LF9E 2A2CA 4USKA 3OTOI 4Z7YA 1RR9A 4YHHE 2DEIA 4JI0E 1D6TA 4DV7E 1N0UA 4DV5E 1VISA 1FWLA 3J81C 4JI8I 1EI1A 4B3MI 1FJGE 4DU8A 1HR0I 4X62I 2R3VA 2J7KA 2HFSA 1N36E 2Q2EB 4Z7CA 4DV2I 3B8HA 4GKJE 5A2QC 1HNWI 4FWHA 1FNMA 1N34I 4JI1E 3WU4A 1XNQE 3B82A 4DV7I 1QZRA 1HNXI 1N34E 5GMDA 1XMQE 2HKJA 4DR3E 3ZZTA 4DUZE 3T1YI 2BM1A 2V8PA 1RREA 1XMQI 4DR6I 4B3ME 4JI6E 1PKPA 4DR2E 1XHKA 2X36A 4GKKE 2BV3A 3J7AM 5A2QQ 1WUUA 1H73A 4MYUA 4X65I 4KQVA 3LNUA 1IBMI 4LFBI 5IWAI 2VQEI 4LFBE 1N33E 4B3RI 4DV1E 1Z5AA 4OX9I 4DU7A 1HR0E 2F4VE 1XMOE 2LJPA 1HNZE 1NZ0A 4DPWA 1Z0EA 2GS8A 1XNQI 1Z0TA 4DPXA 3ZZ0A 4USMA 3ZM7A 3PYDA 4DR5I 1XMOI 4DV0E 4B3SE 2E5LI 4JI2I 4YY3E 4YHHI 5BR8E 4R1FA 3T1HE 3T1HI 4LFAI 4K0KE 4JI3I 2VQFI 2UUCE 4HXZA 4DV5I 1Z0WA 4DPYA 4JV5E 3Q1QA 1H72C 4FWDA 1KVKA 1ZM9A 2HK3A 4RPFA 2VF3A 4FN5A 4HYMA 4YY3I 4DV3I 4P7AA 4EMDA 3LTOA 1KTVA 4DR7I 4B3TE 4P52A 4LF8I 5LMNI 2F4VI 4DR7E 4JI5E 4NXNE 1S4EA 4JI3E 4DV6I 2UU9E 3HULA 2V34A 5L3JA 2HHHE 2DEJA 4HACB 4FW9A 4DV2E 4DV1I 2UUAI 2UUBI 4LF6E 4X66I 1B63A 1S16A 2A2DA 2ZM6E 3H4LA 4UTGA 1KKHA 4PRVA 5LMUE 1H7SA 3V2UC 2XEXA 3M6AA 4JI7I 3J81Q 4LFCE 1IBKE 4GKKI 3WU3A 2UXCI 3F0NA 3J80C 5IT9Q 4X64I 3D4JA 5LMUI 4DR6E 1EA6A 1IBLE 1H74A 1Z0GA 4DR1E 4UT4A 4M1KA 3J80Q 4JI4I 1OJ4A 4NXNI 4JI5I 3PYFA 3JAMC 4HY1A 5GMEA 1N32I 4JI6I 4AQYI 2BM0A 2EFGA 4JI7E 1HNWE 4DR4I 4X66E 4JI1I 4DV4E 3OTOE 1ZXMA
chains in the Genus database with same CATH superfamily
4JYAE 4OO1C 1I94I 1N33I 5K36B 4OKGA 4DUYI 5IT9C 2UXBE 1USVA 1ZM2A 4IFDA 1PIEA 5FLXC 2O1TA 4PU9A 4DV0I 3PYEA 3ZKDA 1HNXE 1Z59A 1ELOA 4LF7I 2JT2A 3CDJA 3QT7A 2E1RA 1R6LA 4I3HA 4DR2I 4AIDA 1BKNA 1HNZI 5C0XC 3HKMA 5FLXQ 2UUCI 3K1JA 4MU3A 4JI4E 4JI0I 2WNRA 1J5EE 3NZKA 3WU5A 3QT5A 4LCGA 2JEBB 2ZITA 1MU5A 3P06A 4PRXA 4HACA 3QT8A 4LF9I 1N36I 1HK7A 2CGEA 4LF4I 5IWAE 2VQEE 3QT6A 4LF4E 2HHHI 2NPFA 4JYAI 1MG7A 1OYSA 1Z5BA 1Z0VA 3LPSA 1IBLI 2GO3A 4FWGA 1J5EI 1KIJA 2C37A 1UEKA 3H1CA 4U3BA 4AIMA 4DR5E 1FI4A 4AM3A 2UXCE 4KHPE 1Z5CA 2VESA 4LF8E 2AE8A 3L7ZB 2NN6C 1XNRI 2V2QA 1E3HA 5EKWA 2J65A 4LFAE 2VQFE 1N0VC 4DV3E 1I94E 4B3RE 5BR8I 3UHMA 4IZJD 3ZKBA 1OYRA 1DARA 1FWKA 4ED4A 4NXME 2IESA 1OYPA 1IBME 4DR4E 4OZEA 5JEAB 2UXDE 4DV6E 4BA1A 3Q6MA 2E5LE 4B3SI 4X64E 5K36C 2R42A 1N32E 1ZXNA 2JE6B 4IFDE 4AQYE 1ZM3A 2HFUA 5DRPA 4LFCI 4WUCA 5LL6R 1Z0CA 3V5RA 1K47A 2HKEA 2ZBKB 3K17A 4OO1A 3JAMQ 4DXLA 1RHYA 2C38A 4XTJA 4DPUA 2UXBI 1XXEA 1ZM4A 3PS2A 4LF6I 3T1YE 4MU1A 3ZZUA 1FKAE 4DR1I 4DV4I 4ISAA 4JI2E 2WW4A 3GCMA 1H7UA 2V2VA 1PVGA 1FJGI 3B78A 2AJ4A 5DRRA 2BA1D 1IBKI 3PYGA 4JV5I 2WP8A 4J3DA 4WUDA 4IZKA 1B62A 2Z5BA 1NHJA 2CZ9A 5LMNE 1A6FA 5DROA 4URLA 3WU6A 2IOPA 3DD6A 3GLLA 4NXMI 4OO1D 2JEAB 1NHIA 4K0KI 2UXDI 3GONA 2X7IA 2ZM6I 4BA2B 4MU0A 2BR2B 5C0XB 2C38B 2IOQA 4LF5E 4LF5I 3HJCA 1E3PA 5ELWA 4DUYE 4DR3I 4DPTA 2UUAE 4DUZI 4MYTA 2NN6F 4X65E 3PS1A 1U2RA 1XNRE 3J7AG 2V2ZA 4X62E 4IFDC 1Z0BA 2UU9I 2PO2B 4WUBA 3CWVA 4JI8E 2Z5EA 3CDIA 4KHPI 4B3TI 4LF7E 1NHHA 4ZVIA 1MX0A 4OX9E 3K85A 2UUBE 4GKJI 4JG4A 4LCFA 2OI2A 2HK2A 4LF9E 2A2CA 4USKA 3OTOI 3L7ZA 4Z7YA 1RR9A 4YHHE 2BA1G 2DEIA 5K36A 3B4TA 4JI0E 1D6TA 4DV7E 1N0UA 4DV5E 4N3OA 1VISA 4IZJA 5JEAE 1FWLA 3J81C 4JI8I 1EI1A 4B3MI 2GO4A 1FJGE 4DU8A 1HR0I 4X62I 2R3VA 2J7KA 2O1WA 2HFSA 1N36E 1UDOA 2Q2EB 4Z7CA 2C39A 4DV2I 3B8HA 4GKJE 2CG9A 5A2QC 1HNWI 4FWHA 2F1DA 5K36D 1FNMA 1N34I 4JI1E 4FW4A 3WU4A 1XNQE 2Z5CA 3B82A 4FW5A 4DV7I 1QZRA 4QNKA 5C0XD 1HNXI 1N34E 2NN6B 2O1VA 5GMDA 1XMQE 2PNLA 2Z5CB 2HKJA 4IS9A 4DR3E 3U1KA 4OO1E 5DNXA 3ZZTA 4DUZE 3T1YI 2BM1A 2V8PA 1RREA 1XMQI 5JEAC 4DR6I 4B3ME 4JI6E 2PO2A 1PKPA 5JEAD 1XHKA 4DR2E 1YH8A 2X36A 4GKKE 2BV3A 2PNZB 3J7AM 1Y5YA 2O3ZA 5A2QQ 2CVEA 1WUUA 1H73A 1VI7A 2PO1B 4MYUA 5C0XA 3Q6NA 4X65I 4KQVA 3LNUA 4U3DA 2BR2A 1IBMI 2O1UA 5IWAI 2VQEI 2NN6D 4LFBE 4LFBI 2JEAA 1N33E 4B3RI 4DV1E 2Z5BB 1UDQA 1Z5AA 4OX9I 4DU7A 3GMEA 3KRNA 3M85D 2WP8B 1HR0E 2F4VE 1XMOE 4IZKB 2LJPA 1HNZE 1NZ0A 4DPWA 4IFDF 1Z0EA 2GS8A 1XNQI 1Z0TA 4DPXA 3ZZ0A 5K36F 4USMA 3ZM7A 5C0XE 3PYDA 4DR5I 1XMOI 3PRYA 4DV0E 4B3SE 2E5LI 4JI2I 4YY3E 3M7NG 4YHHI 5BR8E 4R1FA 1UDSA 3T1HE 3T1HI 4LOMA 1R6MA 4LFAI 4K0KE 2PNZA 5FWKA 4JI3I 2VQFI 2UUCE 5EL9A 2PNMA 2JE6A 5K36E 4BA2A 4HXZA 4DV5I 2BA0G 1YHCA 1Z0WA 4BA1B 4DPYA 3Q1QA 4JV5E 1H72C 1Y4SA 4FWDA 1KVKA 4FW3A 4NBQA 1Y4UA 1ZM9A 2HK3A 4RPFA 2VF3A 4FN5A 4HYMA 4YY3I 4DV3I 4P7AA 4IFDB 2BA0D 4LCHA 4EMDA 2IERA 3LTOA 1KTVA 4DR7I 4IFDD 4B3TE 5JEAF 4P52A 4LF8I 5LMNI 4OO1B 5C0XF 1UDNA 4MQYA 2C39B 2F4VI 4LPFA 4DR7E 2NN6E 4JI5E 4NXNE 1S4EA 2JEBA 4JI3E 4DV6I 2UU9E 3HULA 1Y60A 2V34A 5L3JA 2HHHE 2DEJA 4HACB 4FW7A 4FW9A 4DV2E 2PO0B 4OO1F 4DV1I 2WNRB 2UUAI 2UUBI 3P3EA 4LF6E 5JEAA 4X66I 1B63A 1S16A 2A2DA 2ZM6E 3H4LA 4UTGA 1KKHA 4IZJB 2GQ0A 4MDTA 4PRVA 5LMUE 1H7SA 3P3CA 3V2UC 2XEXA 3U1YA 3M85G 3M6AA 4JI7I 3P3GA 3J81Q 4LFCE 1IBKE 1P42A 4GKKI 3WU3A 2NN6A 2UXCI 3F0NA 3J80C 5IT9Q 4X64I 4GQUA 3D4JA 5LMUI 4QNJA 1USUA 4DR6E 1EA6A 3PS3A 1IBLE 1H74A 1Z0GA 2C37B 4DR1E 4UT4A 2PO1A 4M1KA 3J80Q 4JI4I 1OJ4A 2PO0A 4NXNI 4JI5I 5DRQA 1Y6ZA 3PYFA 3JAMC 4HY1A 5GMEA 1N32I 4MU4A 4JI6I 4AQYI 5DNLA 2BM0A 2EFGA 4JI7E 1HNWE 4FW6A 3M7ND 4DR4I 4X66E 4JI1I 4DV4E 3P76A 3OTOE 1ZXMA
chains in the Genus database with same CATH topology
4JYAE 1I94I 1N33I 4DUYI 5IT9C 2UXBE 1USVA 1ZM2A 1PIEA 5FLXC 2O1TA 4PU9A 4DV0I 3PYEA 3ZKDA 1HNXE 1Z59A 1ELOA 4LF7I 3QT7A 2E1RA 4I3HA 4DR2I 1BKNA 1HNZI 5FLXQ 2UUCI 3K1JA 4JI4E 4JI0I 1J5EE 3WU5A 3QT5A 2ZITA 1MU5A 3P06A 4HACA 4PRXA 3QT8A 4LF9I 1N36I 1HK7A 2CGEA 4LF4I 5IWAE 2VQEE 3QT6A 4LF4E 2HHHI 2NPFA 4JYAI 1MG7A 1Z5BA 1Z0VA 3LPSA 1IBLI 4FWGA 1J5EI 1KIJA 1UEKA 4DR5E 1FI4A 2UXCE 4KHPE 1Z5CA 4LF8E 1XNRI 2V2QA 4LFAE 2VQFE 1N0VC 4DV3E 1I94E 4B3RE 5BR8I 4IZJD 3ZKBA 1DARA 1FWKA 4ED4A 4NXME 1IBME 4DR4E 2UXDE 4DV6E 3Q6MA 2E5LE 4B3SI 4X64E 2R42A 1N32E 1ZXNA 4AQYE 1ZM3A 2HFUA 4LFCI 4WUCA 5LL6R 1Z0CA 3V5RA 1K47A 2HKEA 2ZBKB 3K17A 3JAMQ 4DXLA 4XTJA 4DPUA 2UXBI 1ZM4A 4LF6I 3T1YE 3ZZUA 1FKAE 4DR1I 4DV4I 4JI2E 2WW4A 1H7UA 2V2VA 1PVGA 1FJGI 3B78A 2AJ4A 1IBKI 3PYGA 4JV5I 4WUDA 4IZKA 1B62A 2Z5BA 1NHJA 2CZ9A 5LMNE 1A6FA 4URLA 3WU6A 2IOPA 4NXMI 1NHIA 4K0KI 2UXDI 3GONA 2X7IA 2ZM6I 2IOQA 4LF5E 4LF5I 3HJCA 4DUYE 4DR3I 4DPTA 2UUAE 4DUZI 4MYTA 4X65E 1XNRE 1U2RA 3J7AG 2V2ZA 4X62E 1Z0BA 2UU9I 4WUBA 3CWVA 4JI8E 2Z5EA 4KHPI 4B3TI 4LF7E 1NHHA 4ZVIA 1MX0A 4OX9E 3K85A 2UUBE 4GKJI 4JG4A 2OI2A 2HK2A 4LF9E 2A2CA 4USKA 3OTOI 4Z7YA 1RR9A 4YHHE 2DEIA 4JI0E 1D6TA 4DV7E 1N0UA 4DV5E 4N3OA 1VISA 4IZJA 1FWLA 3J81C 4JI8I 1EI1A 4B3MI 1FJGE 4DU8A 1HR0I 4X62I 2R3VA 2J7KA 2O1WA 2HFSA 1N36E 2Q2EB 4Z7CA 4DV2I 3B8HA 4GKJE 2CG9A 5A2QC 1HNWI 4FWHA 1FNMA 1N34I 4JI1E 3WU4A 1XNQE 2Z5CA 3B82A 4DV7I 1QZRA 1HNXI 1N34E 2O1VA 5GMDA 1XMQE 2PNLA 2Z5CB 2HKJA 4DR3E 3ZZTA 4DUZE 3T1YI 2BM1A 2V8PA 1RREA 1XMQI 4DR6I 4B3ME 4JI6E 1PKPA 4DR2E 1XHKA 2X36A 4GKKE 2BV3A 3J7AM 5A2QQ 1WUUA 1H73A 4MYUA 3Q6NA 4X65I 4KQVA 3LNUA 1IBMI 2O1UA 5IWAI 2VQEI 4LFBE 4LFBI 1N33E 4B3RI 4DV1E 2Z5BB 1Z5AA 4OX9I 4DU7A 1HR0E 2F4VE 1XMOE 4IZKB 2LJPA 1HNZE 1NZ0A 4DPWA 1Z0EA 2GS8A 1XNQI 1Z0TA 4DPXA 3ZZ0A 4USMA 3ZM7A 3PYDA 4DR5I 1XMOI 3PRYA 4DV0E 4B3SE 2E5LI 4JI2I 4YY3E 4YHHI 5BR8E 4R1FA 3T1HE 3T1HI 4LFAI 4K0KE 5FWKA 4JI3I 2VQFI 2UUCE 2PNMA 4HXZA 4DV5I 1Z0WA 4DPYA 4JV5E 3Q1QA 1H72C 1Y4SA 4FWDA 1KVKA 1Y4UA 1ZM9A 2HK3A 4RPFA 2VF3A 4FN5A 4HYMA 4YY3I 4DV3I 4P7AA 4EMDA 3LTOA 1KTVA 4DR7I 4B3TE 4P52A 4LF8I 5LMNI 2F4VI 4DR7E 4JI5E 4NXNE 1S4EA 4JI3E 4DV6I 2UU9E 3HULA 2V34A 5L3JA 2HHHE 2DEJA 4HACB 4FW9A 4DV2E 4DV1I 2UUAI 2UUBI 4LF6E 4X66I 1B63A 1S16A 2ZM6E 2A2DA 3H4LA 4UTGA 1KKHA 4IZJB 2GQ0A 4PRVA 5LMUE 1H7SA 3V2UC 2XEXA 3M6AA 4JI7I 3J81Q 4LFCE 1IBKE 4GKKI 3WU3A 2UXCI 3F0NA 3J80C 5IT9Q 4X64I 3D4JA 5LMUI 1USUA 4DR6E 1EA6A 1IBLE 1H74A 1Z0GA 4DR1E 4UT4A 4M1KA 3J80Q 4JI4I 1OJ4A 4NXNI 4JI5I 1Y6ZA 3PYFA 3JAMC 4HY1A 5GMEA 1N32I 4JI6I 4AQYI 2BM0A 2EFGA 4JI7E 1HNWE 4DR4I 4X66E 4JI1I 4DV4E 3OTOE 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  1I94 I;  1N33 I;  4DUY I;  5IT9 C;  2UXB E;  1ZM2 A;  1PIE A;  5FLX C;  4PU9 A;  4DV0 I;  3PYE A;  3ZKD A;  1HNX E;  1Z59 A;  1ELO A;  4LF7 I;  3QT7 A;  2E1R A;  4I3H A;  4DR2 I;  1BKN A;  1HNZ I;  5FLX Q;  2UUC I;  3K1J A;  4JI4 E;  4JI0 I;  1J5E E;  3WU5 A;  3QT5 A;  2ZIT A;  1MU5 A;  4HAC A;  4PRX A;  3QT8 A;  4LF9 I;  1N36 I;  4LF4 I;  5IWA E;  2VQE E;  3QT6 A;  4LF4 E;  2HHH I;  2NPF A;  4JYA I;  1MG7 A;  1Z5B A;  1Z0V A;  3LPS A;  1IBL I;  4FWG A;  1J5E I;  1KIJ A;  1UEK A;  4DR5 E;  1FI4 A;  2UXC E;  4KHP E;  1Z5C A;  4LF8 E;  1XNR I;  2V2Q A;  4LFA E;  2VQF E;  1N0V C;  4DV3 E;  1I94 E;  4B3R E;  5BR8 I;  3ZKB A;  1DAR A;  1FWK A;  4ED4 A;  4NXM E;  1IBM E;  4DR4 E;  2UXD E;  4DV6 E;  2E5L E;  4B3S I;  4X64 E;  2R42 A;  1N32 E;  1ZXN A;  4AQY E;  1ZM3 A;  2HFU A;  4LFC I;  4WUC A;  5LL6 R;  1Z0C A;  3V5R A;  1K47 A;  2HKE A;  2ZBK B;  3K17 A;  3JAM Q;  4DXL A;  4XTJ A;  4DPU A;  2UXB I;  1ZM4 A;  4LF6 I;  3T1Y E;  3ZZU A;  1FKA E;  4DR1 I;  4DV4 I;  4JI2 E;  2WW4 A;  1H7U A;  2V2V A;  1PVG A;  1FJG I;  3B78 A;  2AJ4 A;  1IBK I;  3PYG A;  4JV5 I;  4WUD A;  1B62 A;  1NHJ A;  2CZ9 A;  5LMN E;  1A6F A;  4URL A;  3WU6 A;  4NXM I;  1NHI A;  4K0K I;  2UXD I;  3GON A;  2X7I A;  2ZM6 I;  4LF5 E;  4LF5 I;  4DUY E;  4DR3 I;  4DPT A;  2UUA E;  4DUZ I;  4MYT A;  4X65 E;  1XNR E;  1U2R A;  3J7A G;  2V2Z A;  4X62 E;  1Z0B A;  2UU9 I;  4WUB A;  3CWV A;  4JI8 E;  4KHP I;  4B3T I;  4LF7 E;  1NHH A;  4ZVI A;  1MX0 A;  4OX9 E;  2UUB E;  4GKJ I;  4JG4 A;  2OI2 A;  2HK2 A;  4LF9 E;  2A2C A;  4USK A;  3OTO I;  4Z7Y A;  1RR9 A;  4YHH E;  2DEI A;  4JI0 E;  1D6T A;  4DV7 E;  1N0U A;  4DV5 E;  1VIS A;  1FWL A;  3J81 C;  4JI8 I;  1EI1 A;  4B3M I;  1FJG E;  4DU8 A;  1HR0 I;  4X62 I;  2R3V A;  2J7K A;  2HFS A;  1N36 E;  2Q2E B;  4Z7C A;  4DV2 I;  3B8H A;  4GKJ E;  5A2Q C;  1HNW I;  4FWH A;  1FNM A;  1N34 I;  4JI1 E;  3WU4 A;  1XNQ E;  3B82 A;  4DV7 I;  1QZR A;  1HNX I;  1N34 E;  5GMD A;  1XMQ E;  2HKJ A;  4DR3 E;  3ZZT A;  4DUZ E;  3T1Y I;  2BM1 A;  2V8P A;  1RRE A;  1XMQ I;  4DR6 I;  4B3M E;  4JI6 E;  1PKP A;  4DR2 E;  1XHK A;  2X36 A;  4GKK E;  2BV3 A;  3J7A M;  5A2Q Q;  1WUU A;  1H73 A;  4MYU A;  4X65 I;  4KQV A;  3LNU A;  1IBM I;  4LFB I;  5IWA I;  2VQE I;  4LFB E;  1N33 E;  4B3R I;  4DV1 E;  1Z5A A;  4OX9 I;  4DU7 A;  1HR0 E;  2F4V E;  1XMO E;  2LJP A;  1HNZ E;  1NZ0 A;  4DPW A;  1Z0E A;  2GS8 A;  1XNQ I;  1Z0T A;  4DPX A;  3ZZ0 A;  4USM A;  3ZM7 A;  3PYD A;  4DR5 I;  1XMO I;  4DV0 E;  4B3S E;  2E5L I;  4JI2 I;  4YY3 E;  4YHH I;  5BR8 E;  4R1F A;  3T1H E;  3T1H I;  4LFA I;  4K0K E;  4JI3 I;  2VQF I;  2UUC E;  4HXZ A;  4DV5 I;  1Z0W A;  4DPY A;  4JV5 E;  3Q1Q A;  1H72 C;  4FWD A;  1KVK A;  1ZM9 A;  2HK3 A;  4RPF A;  2VF3 A;  4FN5 A;  4HYM A;  4YY3 I;  4DV3 I;  4P7A A;  4EMD A;  3LTO A;  1KTV A;  4DR7 I;  4B3T E;  4P52 A;  4LF8 I;  5LMN I;  2F4V I;  4DR7 E;  4JI5 E;  4NXN E;  1S4E A;  4JI3 E;  4DV6 I;  2UU9 E;  3HUL A;  2V34 A;  5L3J A;  2HHH E;  2DEJ A;  4HAC B;  4FW9 A;  4DV2 E;  4DV1 I;  2UUA I;  2UUB I;  4LF6 E;  4X66 I;  1B63 A;  1S16 A;  2A2D A;  2ZM6 E;  3H4L A;  4UTG A;  1KKH A;  4PRV A;  5LMU E;  1H7S A;  3V2U C;  2XEX A;  3M6A A;  4JI7 I;  3J81 Q;  4LFC E;  1IBK E;  4GKK I;  3WU3 A;  2UXC I;  3F0N A;  3J80 C;  5IT9 Q;  4X64 I;  3D4J A;  5LMU I;  4DR6 E;  1EA6 A;  1IBL E;  1H74 A;  1Z0G A;  4DR1 E;  4UT4 A;  4M1K A;  3J80 Q;  4JI4 I;  1OJ4 A;  4NXN I;  4JI5 I;  3PYF A;  3JAM C;  4HY1 A;  5GME A;  1N32 I;  4JI6 I;  4AQY I;  2BM0 A;  2EFG A;  4JI7 E;  1HNW E;  4DR4 I;  4X66 E;  4JI1 I;  4DV4 E;  3OTO E;  1ZXM A; 
#chains in the Genus database with same CATH topology
 4JYA E;  4OO1 C;  1I94 I;  1N33 I;  5K36 B;  4OKG A;  4DUY I;  5IT9 C;  2UXB E;  1USV A;  1ZM2 A;  4IFD A;  1PIE A;  5FLX C;  2O1T A;  4PU9 A;  4DV0 I;  3PYE A;  3ZKD A;  1HNX E;  1Z59 A;  1ELO A;  4LF7 I;  2JT2 A;  3CDJ A;  3QT7 A;  2E1R A;  1R6L A;  4I3H A;  4DR2 I;  4AID A;  1BKN A;  1HNZ I;  5C0X C;  3HKM A;  5FLX Q;  2UUC I;  3K1J A;  4MU3 A;  4JI4 E;  4JI0 I;  2WNR A;  1J5E E;  3NZK A;  3WU5 A;  3QT5 A;  4LCG A;  2JEB B;  2ZIT A;  1MU5 A;  3P06 A;  4PRX A;  4HAC A;  3QT8 A;  4LF9 I;  1N36 I;  1HK7 A;  2CGE A;  4LF4 I;  5IWA E;  2VQE E;  3QT6 A;  4LF4 E;  2HHH I;  2NPF A;  4JYA I;  1MG7 A;  1OYS A;  1Z5B A;  1Z0V A;  3LPS A;  1IBL I;  2GO3 A;  4FWG A;  1J5E I;  1KIJ A;  2C37 A;  1UEK A;  3H1C A;  4U3B A;  4AIM A;  4DR5 E;  1FI4 A;  4AM3 A;  2UXC E;  4KHP E;  1Z5C A;  2VES A;  4LF8 E;  2AE8 A;  3L7Z B;  2NN6 C;  1XNR I;  2V2Q A;  1E3H A;  5EKW A;  2J65 A;  4LFA E;  2VQF E;  1N0V C;  4DV3 E;  1I94 E;  4B3R E;  5BR8 I;  3UHM A;  4IZJ D;  3ZKB A;  1OYR A;  1DAR A;  1FWK A;  4ED4 A;  4NXM E;  2IES A;  1OYP A;  1IBM E;  4DR4 E;  4OZE A;  5JEA B;  2UXD E;  4DV6 E;  4BA1 A;  3Q6M A;  2E5L E;  4B3S I;  4X64 E;  5K36 C;  2R42 A;  1N32 E;  1ZXN A;  2JE6 B;  4IFD E;  4AQY E;  1ZM3 A;  2HFU A;  5DRP A;  4LFC I;  4WUC A;  5LL6 R;  1Z0C A;  3V5R A;  1K47 A;  2HKE A;  2ZBK B;  3K17 A;  4OO1 A;  3JAM Q;  4DXL A;  1RHY A;  2C38 A;  4XTJ A;  4DPU A;  2UXB I;  1XXE A;  1ZM4 A;  3PS2 A;  4LF6 I;  3T1Y E;  4MU1 A;  3ZZU A;  1FKA E;  4DR1 I;  4DV4 I;  4ISA A;  4JI2 E;  2WW4 A;  3GCM A;  1H7U A;  2V2V A;  1PVG A;  1FJG I;  3B78 A;  2AJ4 A;  5DRR A;  2BA1 D;  1IBK I;  3PYG A;  4JV5 I;  2WP8 A;  4J3D A;  4WUD A;  4IZK A;  1B62 A;  2Z5B A;  1NHJ A;  2CZ9 A;  5LMN E;  1A6F A;  5DRO A;  4URL A;  3WU6 A;  2IOP A;  3DD6 A;  3GLL A;  4NXM I;  4OO1 D;  2JEA B;  1NHI A;  4K0K I;  2UXD I;  3GON A;  2X7I A;  2ZM6 I;  4BA2 B;  4MU0 A;  2BR2 B;  5C0X B;  2C38 B;  2IOQ A;  4LF5 E;  4LF5 I;  3HJC A;  1E3P A;  5ELW A;  4DUY E;  4DR3 I;  4DPT A;  2UUA E;  4DUZ I;  4MYT A;  2NN6 F;  4X65 E;  3PS1 A;  1U2R A;  1XNR E;  3J7A G;  2V2Z A;  4X62 E;  4IFD C;  1Z0B A;  2UU9 I;  2PO2 B;  4WUB A;  3CWV A;  4JI8 E;  2Z5E A;  3CDI A;  4KHP I;  4B3T I;  4LF7 E;  1NHH A;  4ZVI A;  1MX0 A;  4OX9 E;  3K85 A;  2UUB E;  4GKJ I;  4JG4 A;  4LCF A;  2OI2 A;  2HK2 A;  4LF9 E;  2A2C A;  4USK A;  3OTO I;  3L7Z A;  4Z7Y A;  1RR9 A;  4YHH E;  2BA1 G;  2DEI A;  5K36 A;  3B4T A;  4JI0 E;  1D6T A;  4DV7 E;  1N0U A;  4DV5 E;  4N3O A;  1VIS A;  4IZJ A;  5JEA E;  1FWL A;  3J81 C;  4JI8 I;  1EI1 A;  4B3M I;  2GO4 A;  1FJG E;  4DU8 A;  1HR0 I;  4X62 I;  2R3V A;  2J7K A;  2O1W A;  2HFS A;  1N36 E;  1UDO A;  2Q2E B;  4Z7C A;  2C39 A;  4DV2 I;  3B8H A;  4GKJ E;  2CG9 A;  5A2Q C;  1HNW I;  4FWH A;  2F1D A;  5K36 D;  1FNM A;  1N34 I;  4JI1 E;  4FW4 A;  3WU4 A;  1XNQ E;  2Z5C A;  3B82 A;  4FW5 A;  4DV7 I;  1QZR A;  4QNK A;  5C0X D;  1HNX I;  1N34 E;  2NN6 B;  2O1V A;  5GMD A;  1XMQ E;  2PNL A;  2Z5C B;  2HKJ A;  4IS9 A;  4DR3 E;  3U1K A;  4OO1 E;  5DNX A;  3ZZT A;  4DUZ E;  3T1Y I;  2BM1 A;  2V8P A;  1RRE A;  1XMQ I;  5JEA C;  4DR6 I;  4B3M E;  4JI6 E;  2PO2 A;  1PKP A;  5JEA D;  1XHK A;  4DR2 E;  1YH8 A;  2X36 A;  4GKK E;  2BV3 A;  2PNZ B;  3J7A M;  1Y5Y A;  2O3Z A;  5A2Q Q;  2CVE A;  1WUU A;  1H73 A;  1VI7 A;  2PO1 B;  4MYU A;  5C0X A;  3Q6N A;  4X65 I;  4KQV A;  3LNU A;  4U3D A;  2BR2 A;  1IBM I;  2O1U A;  5IWA I;  2VQE I;  2NN6 D;  4LFB E;  4LFB I;  2JEA A;  1N33 E;  4B3R I;  4DV1 E;  2Z5B B;  1UDQ A;  1Z5A A;  4OX9 I;  4DU7 A;  3GME A;  3KRN A;  3M85 D;  2WP8 B;  1HR0 E;  2F4V E;  1XMO E;  4IZK B;  2LJP A;  1HNZ E;  1NZ0 A;  4DPW A;  4IFD F;  1Z0E A;  2GS8 A;  1XNQ I;  1Z0T A;  4DPX A;  3ZZ0 A;  5K36 F;  4USM A;  3ZM7 A;  5C0X E;  3PYD A;  4DR5 I;  1XMO I;  3PRY A;  4DV0 E;  4B3S E;  2E5L I;  4JI2 I;  4YY3 E;  3M7N G;  4YHH I;  5BR8 E;  4R1F A;  1UDS A;  3T1H E;  3T1H I;  4LOM A;  1R6M A;  4LFA I;  4K0K E;  2PNZ A;  5FWK A;  4JI3 I;  2VQF I;  2UUC E;  5EL9 A;  2PNM A;  2JE6 A;  5K36 E;  4BA2 A;  4HXZ A;  4DV5 I;  2BA0 G;  1YHC A;  1Z0W A;  4BA1 B;  4DPY A;  3Q1Q A;  4JV5 E;  1H72 C;  1Y4S A;  4FWD A;  1KVK A;  4FW3 A;  4NBQ A;  1Y4U A;  1ZM9 A;  2HK3 A;  4RPF A;  2VF3 A;  4FN5 A;  4HYM A;  4YY3 I;  4DV3 I;  4P7A A;  4IFD B;  2BA0 D;  4LCH A;  4EMD A;  2IER A;  3LTO A;  1KTV A;  4DR7 I;  4IFD D;  4B3T E;  5JEA F;  4P52 A;  4LF8 I;  5LMN I;  4OO1 B;  5C0X F;  1UDN A;  4MQY A;  2C39 B;  2F4V I;  4LPF A;  4DR7 E;  2NN6 E;  4JI5 E;  4NXN E;  1S4E A;  2JEB A;  4JI3 E;  4DV6 I;  2UU9 E;  3HUL A;  1Y60 A;  2V34 A;  5L3J A;  2HHH E;  2DEJ A;  4HAC B;  4FW7 A;  4FW9 A;  4DV2 E;  2PO0 B;  4OO1 F;  4DV1 I;  2WNR B;  2UUA I;  2UUB I;  3P3E A;  4LF6 E;  5JEA A;  4X66 I;  1B63 A;  1S16 A;  2A2D A;  2ZM6 E;  3H4L A;  4UTG A;  1KKH A;  4IZJ B;  2GQ0 A;  4MDT A;  4PRV A;  5LMU E;  1H7S A;  3P3C A;  3V2U C;  2XEX A;  3U1Y A;  3M85 G;  3M6A A;  4JI7 I;  3P3G A;  3J81 Q;  4LFC E;  1IBK E;  1P42 A;  4GKK I;  3WU3 A;  2NN6 A;  2UXC I;  3F0N A;  3J80 C;  5IT9 Q;  4X64 I;  4GQU A;  3D4J A;  5LMU I;  4QNJ A;  1USU A;  4DR6 E;  1EA6 A;  3PS3 A;  1IBL E;  1H74 A;  1Z0G A;  2C37 B;  4DR1 E;  4UT4 A;  2PO1 A;  4M1K A;  3J80 Q;  4JI4 I;  1OJ4 A;  2PO0 A;  4NXN I;  4JI5 I;  5DRQ A;  1Y6Z A;  3PYF A;  3JAM C;  4HY1 A;  5GME A;  1N32 I;  4MU4 A;  4JI6 I;  4AQY I;  5DNL A;  2BM0 A;  2EFG A;  4JI7 E;  1HNW E;  4FW6 A;  3M7N D;  4DR4 I;  4X66 E;  4JI1 I;  4DV4 E;  3P76 A;  3OTO E;  1ZXM A; 
#chains in the Genus database with same CATH homology
 4JYA E;  1I94 I;  1N33 I;  4DUY I;  5IT9 C;  2UXB E;  1USV A;  1ZM2 A;  1PIE A;  5FLX C;  2O1T A;  4PU9 A;  4DV0 I;  3PYE A;  3ZKD A;  1HNX E;  1Z59 A;  1ELO A;  4LF7 I;  3QT7 A;  2E1R A;  4I3H A;  4DR2 I;  1BKN A;  1HNZ I;  5FLX Q;  2UUC I;  3K1J A;  4JI4 E;  4JI0 I;  1J5E E;  3WU5 A;  3QT5 A;  2ZIT A;  1MU5 A;  3P06 A;  4HAC A;  4PRX A;  3QT8 A;  4LF9 I;  1N36 I;  1HK7 A;  2CGE A;  4LF4 I;  5IWA E;  2VQE E;  3QT6 A;  4LF4 E;  2HHH I;  2NPF A;  4JYA I;  1MG7 A;  1Z5B A;  1Z0V A;  3LPS A;  1IBL I;  4FWG A;  1J5E I;  1KIJ A;  1UEK A;  4DR5 E;  1FI4 A;  2UXC E;  4KHP E;  1Z5C A;  4LF8 E;  1XNR I;  2V2Q A;  4LFA E;  2VQF E;  1N0V C;  4DV3 E;  1I94 E;  4B3R E;  5BR8 I;  4IZJ D;  3ZKB A;  1DAR A;  1FWK A;  4ED4 A;  4NXM E;  1IBM E;  4DR4 E;  2UXD E;  4DV6 E;  3Q6M A;  2E5L E;  4B3S I;  4X64 E;  2R42 A;  1N32 E;  1ZXN A;  4AQY E;  1ZM3 A;  2HFU A;  4LFC I;  4WUC A;  5LL6 R;  1Z0C A;  3V5R A;  1K47 A;  2HKE A;  2ZBK B;  3K17 A;  3JAM Q;  4DXL A;  4XTJ A;  4DPU A;  2UXB I;  1ZM4 A;  4LF6 I;  3T1Y E;  3ZZU A;  1FKA E;  4DR1 I;  4DV4 I;  4JI2 E;  2WW4 A;  1H7U A;  2V2V A;  1PVG A;  1FJG I;  3B78 A;  2AJ4 A;  1IBK I;  3PYG A;  4JV5 I;  4WUD A;  4IZK A;  1B62 A;  2Z5B A;  1NHJ A;  2CZ9 A;  5LMN E;  1A6F A;  4URL A;  3WU6 A;  2IOP A;  4NXM I;  1NHI A;  4K0K I;  2UXD I;  3GON A;  2X7I A;  2ZM6 I;  2IOQ A;  4LF5 E;  4LF5 I;  3HJC A;  4DUY E;  4DR3 I;  4DPT A;  2UUA E;  4DUZ I;  4MYT A;  4X65 E;  1XNR E;  1U2R A;  3J7A G;  2V2Z A;  4X62 E;  1Z0B A;  2UU9 I;  4WUB A;  3CWV A;  4JI8 E;  2Z5E A;  4KHP I;  4B3T I;  4LF7 E;  1NHH A;  4ZVI A;  1MX0 A;  4OX9 E;  3K85 A;  2UUB E;  4GKJ I;  4JG4 A;  2OI2 A;  2HK2 A;  4LF9 E;  2A2C A;  4USK A;  3OTO I;  4Z7Y A;  1RR9 A;  4YHH E;  2DEI A;  4JI0 E;  1D6T A;  4DV7 E;  1N0U A;  4DV5 E;  4N3O A;  1VIS A;  4IZJ A;  1FWL A;  3J81 C;  4JI8 I;  1EI1 A;  4B3M I;  1FJG E;  4DU8 A;  1HR0 I;  4X62 I;  2R3V A;  2J7K A;  2O1W A;  2HFS A;  1N36 E;  2Q2E B;  4Z7C A;  4DV2 I;  3B8H A;  4GKJ E;  2CG9 A;  5A2Q C;  1HNW I;  4FWH A;  1FNM A;  1N34 I;  4JI1 E;  3WU4 A;  1XNQ E;  2Z5C A;  3B82 A;  4DV7 I;  1QZR A;  1HNX I;  1N34 E;  2O1V A;  5GMD A;  1XMQ E;  2PNL A;  2Z5C B;  2HKJ A;  4DR3 E;  3ZZT A;  4DUZ E;  3T1Y I;  2BM1 A;  2V8P A;  1RRE A;  1XMQ I;  4DR6 I;  4B3M E;  4JI6 E;  1PKP A;  4DR2 E;  1XHK A;  2X36 A;  4GKK E;  2BV3 A;  3J7A M;  5A2Q Q;  1WUU A;  1H73 A;  4MYU A;  3Q6N A;  4X65 I;  4KQV A;  3LNU A;  1IBM I;  2O1U A;  5IWA I;  2VQE I;  4LFB E;  4LFB I;  1N33 E;  4B3R I;  4DV1 E;  2Z5B B;  1Z5A A;  4OX9 I;  4DU7 A;  1HR0 E;  2F4V E;  1XMO E;  4IZK B;  2LJP A;  1HNZ E;  1NZ0 A;  4DPW A;  1Z0E A;  2GS8 A;  1XNQ I;  1Z0T A;  4DPX A;  3ZZ0 A;  4USM A;  3ZM7 A;  3PYD A;  4DR5 I;  1XMO I;  3PRY A;  4DV0 E;  4B3S E;  2E5L I;  4JI2 I;  4YY3 E;  4YHH I;  5BR8 E;  4R1F A;  3T1H E;  3T1H I;  4LFA I;  4K0K E;  5FWK A;  4JI3 I;  2VQF I;  2UUC E;  2PNM A;  4HXZ A;  4DV5 I;  1Z0W A;  4DPY A;  4JV5 E;  3Q1Q A;  1H72 C;  1Y4S A;  4FWD A;  1KVK A;  1Y4U A;  1ZM9 A;  2HK3 A;  4RPF A;  2VF3 A;  4FN5 A;  4HYM A;  4YY3 I;  4DV3 I;  4P7A A;  4EMD A;  3LTO A;  1KTV A;  4DR7 I;  4B3T E;  4P52 A;  4LF8 I;  5LMN I;  2F4V I;  4DR7 E;  4JI5 E;  4NXN E;  1S4E A;  4JI3 E;  4DV6 I;  2UU9 E;  3HUL A;  2V34 A;  5L3J A;  2HHH E;  2DEJ A;  4HAC B;  4FW9 A;  4DV2 E;  4DV1 I;  2UUA I;  2UUB I;  4LF6 E;  4X66 I;  1B63 A;  1S16 A;  2ZM6 E;  2A2D A;  3H4L A;  4UTG A;  1KKH A;  4IZJ B;  2GQ0 A;  4PRV A;  5LMU E;  1H7S A;  3V2U C;  2XEX A;  3M6A A;  4JI7 I;  3J81 Q;  4LFC E;  1IBK E;  4GKK I;  3WU3 A;  2UXC I;  3F0N A;  3J80 C;  5IT9 Q;  4X64 I;  3D4J A;  5LMU I;  1USU A;  4DR6 E;  1EA6 A;  1IBL E;  1H74 A;  1Z0G A;  4DR1 E;  4UT4 A;  4M1K A;  3J80 Q;  4JI4 I;  1OJ4 A;  4NXN I;  4JI5 I;  1Y6Z A;  3PYF A;  3JAM C;  4HY1 A;  5GME A;  1N32 I;  4JI6 I;  4AQY I;  2BM0 A;  2EFG A;  4JI7 E;  1HNW E;  4DR4 I;  4X66 E;  4JI1 I;  4DV4 E;  3OTO E;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...