4DV4I

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4dv4I00
4UT4A 1OJ4A 4YY3I 4AQYE 4FWHA 2UUBE 4GKKI 1FWLA 1FNMA 4DV2E 4NXNI 4OX9E 5BR8E 3ZZ0A 2NPFA 4JI8I 3OTOI 1Z0CA 5GMDA 4UTGA 1ZM9A 1HNWE 4B3ME 4LF9I 4DPYA 5LMNI 2X7IA 4B3RI 2WW4A 3J81Q 2VQEI 4LF4I 3H4LA 1H73A 2UU9E 4YHHE 4DV5E 4DV0I 4X64I 3T1YE 4JG4A 4LFCI 3QT6A 1D6TA 1ZM4A 4DR4I 3F0NA 2HKJA 4FWGA 2A2CA 4WUBA 1XNRI 1H74A 3V2UC 1VISA 4KHPE 4PU9A 3Q1QA 2UUCE 1N32E 1DARA 1XMOI 4DR7I 4X66E 4LF6E 1ZM2A 4WUDA 4JI1I 1ZM3A 1XNQE 5IWAI 4DR6E 2E5LI 1IBME 4K0KI 2UXDI 1XHKA 3QT5A 4JI0I 4DPWA 4DR2E 4RPFA 4R1FA 3PYEA 3WU3A 1N33E 5L3JA 3ZM7A 1IBLE 4X62E 1HR0E 1Z5BA 1HNZI 4NXMI 4DV4I 4Z7CA 4X65E 4JV5I 5IT9Q 1N0VC 4HY1A 1B63A 1N36E 2XEXA 3JAMQ 1I94E 4JI7E 5A2QC 4URLA 1NHHA 2UXCE 4AQYI 1EI1A 3LTOA 2UUBI 1PIEA 5FLXC 5A2QQ 4DV2I 2VF3A 3V5RA 3M6AA 4OX9I 5BR8I 5FLXQ 4Z7YA 1XMQE 4FWDA 1FI4A 1HNWI 4JI5E 4B3MI 2CZ9A 1S16A 5LL6R 2UU9I 4YHHI 3B82A 4DV5I 1BKNA 1B62A 3J81C 3T1YI 1IBKE 4B3SE 2ZBKB 1FKAE 4JI2E 3WU4A 4ZVIA 4LFAE 2ZM6E 2VQFE 2HK3A 1H72C 4LFBE 5GMEA 4KHPI 2UUCI 1N32I 4X66I 4LF6I 2R3VA 1XNQI 1MG7A 1QZRA 2HK2A 4DR6I 3HULA 1IBMI 4HXZA 4DPXA 4JI8E 3B8HA 4DU8A 4LF7E 3B78A 1FJGE 1K47A 4DR2I 4DV3E 4LF5E 2UXBE 4LF9E 4GKJE 4DPTA 4DR5E 4JI6E 1N33I 1H7SA 2V2VA 2V34A 4X62I 1HR0I 1IBLI 1KVKA 4WUCA 4DUYE 4DR3E 1NZ0A 4P52A 4X65I 2DEJA 4B3TE 2V2ZA 1MX0A 1Z0EA 3QT8A 3QT7A 2HHHE 4DR1I 1N36I 1HNXE 1I94I 5IT9C 4P7AA 4JI7I 4EMDA 1ELOA 2UXCI 4DXLA 3JAMC 1Z0VA 4DV1E 2BM0A 4LF8E 3T1HE 1RR9A 3D4JA 4JYAE 4KQVA 4DUZE 1XMQI 4DV7E 4DV6E 1RREA 4JI3E 4MYUA 4JI5I 1N0UA 2BM1A 1Z5AA 2V2QA 1PVGA 2R42A 5LMUE 3LPSA 4JI4E 1ZXNA 1Z0WA 3J7AM 2UUAE 4M1KA 2LJPA 4HYMA 1IBKI 3J7AG 1J5EE 1PKPA 4B3SI 4JI2I 1N34E 3PYDA 4LFAI 2ZM6I 2VQFI 2F4VE 4LFBI 4DPUA 2A2DA 3ZKBA 1KIJA 1Z5CA 1KKHA 2HFSA 2X36A 2HKEA 1ZXMA 3PYFA 4YY3E 4LF7I 2EFGA 1FJGI 4DV3I 2ZITA 4LF5I 1MU5A 4GKKE 2UXBI 2V8PA 4GKJI 1Z0GA 4NXNE 4DR5I 3GONA 4JI6I 4ED4A 4PRVA 1U2RA 1H7UA 3OTOE 1WUUA 1NHJA 3J80C 3K17A 4DUYI 2AJ4A 4DR3I 1NHIA 5LMNE 4B3RE 3J80Q 4B3TI 2VQEE 2HHHI 4LF4E 3CWVA 4XTJA 1HNXI 4DV0E 4X64E 4HACA 4LFCE 4I3HA 4USMA 2DEIA 4DV1I 4USKA 4DR4E 4LF8I 4FW9A 1EA6A 3WU6A 1Z0BA 3T1HI 2BV3A 1XNRE 1Z59A 3ZZTA 4JYAI 1XMOE 4DR7E 1FWKA 3WU5A 4DUZI 3ZKDA 3PYGA 4DV7I 4DV6I 4JI1E 2GS8A 4JI3I 5IWAE 4PRXA 2E5LE 4K0KE 2UXDE 1S4EA 4JI0E 5LMUI 4JI4I 3K1JA 4MYTA 2HFUA 3ZZUA 3LNUA 2UUAI 4FN5A 4DR1E 1J5EI 1N34I 1KTVA 1Z0TA 1A6FA 2E1RA 1HNZE 4NXME 2OI2A 2F4VI 2J7KA 4DV4E 4JV5E 4DU7A 1UEKA 4HACB 2Q2EB
chains in the Genus database with same CATH superfamily
4UT4A 1OJ4A 2C39B 2C38B 5JEAD 2JEAA 4YY3I 4AQYE 4FWHA 2UUBE 4GKKI 1FWLA 4IS9A 4BA2B 1FNMA 4DV2E 4NXNI 4OX9E 2NN6D 5BR8E 3ZZ0A 2PO1A 4OO1B 4FW4A 2NPFA 2AE8A 4JI8I 3OTOI 1Z0CA 3PS3A 5GMDA 4MQYA 2BR2B 4UTGA 1ZM9A 1HNWE 5DROA 4B3ME 4LF9I 4DPYA 5LMNI 2X7IA 4B3RI 2C37A 2NN6B 2PO0B 2WW4A 2PO2A 3H1CA 3J81Q 3PS1A 4IZKA 2VQEI 4LF4I 3H4LA 1H73A 2UU9E 4YHHE 4DV5E 3GLLA 4MU1A 4DV0I 4X64I 2Z5BA 4AIMA 3T1YE 4JG4A 4LFCI 3QT6A 1D6TA 1ZM4A 2PNZB 4DR4I 3F0NA 4N3OA 2HKJA 4FWGA 2A2CA 4WUBA 1XNRI 1H74A 3V2UC 1VISA 4KHPE 4PU9A 3Q1QA 2UUCE 1N32E 1DARA 1XMOI 4DR7I 4X66E 4LF6E 2C39A 2BA0G 2C38A 1ZM2A 3HKMA 4WUDA 5DRRA 4JI1I 1ZM3A 1XNQE 5IWAI 4DR6E 2E5LI 2Z5EA 3P3GA 1IBME 4K0KI 2UXDI 1XHKA 4FW6A 3QT5A 4JI0I 4DPWA 4DR2E 4RPFA 3P3EA 4R1FA 4OO1A 3PYEA 3WU3A 2PO1B 1RHYA 2JE6B 1N33E 2BR2A 2O1TA 5L3JA 3ZM7A 4NBQA 1IBLE 4X62E 1HR0E 1Z5BA 3HJCA 2NN6A 1HNZI 2PO0A 4OO1C 3KRNA 4NXMI 3P3CA 4DV4I 4Z7CA 4X65E 2CG9A 2BA0D 4IZKB 4JV5I 5IT9Q 1N0VC 4HY1A 1B63A 1Y5YA 1N36E 2XEXA 2NN6C 5K36D 2Z5BB 1USUA 3JAMQ 1I94E 4JI7E 2PNZA 5A2QC 4URLA 5DNLA 1NHHA 4MU3A 2UXCE 4AQYI 1EI1A 3LTOA 2UUBI 1PIEA 5FLXC 5A2QQ 4DV2I 1Y6ZA 2VF3A 3V5RA 3M6AA 4OX9I 1VI7A 5BR8I 4OKGA 5FLXQ 4Z7YA 4IFDD 1XMQE 4FWDA 4QNKA 4OO1E 1FI4A 1HNWI 4JI5E 4B3MI 3GCMA 2CZ9A 3P76A 1S16A 5LL6R 2BA1G 4BA1A 1UDOA 4LOMA 2PNLA 5JEAB 4LCFA 2NN6E 4OZEA 2IESA 2JE6A 2UU9I 1YHCA 4YHHI 3B82A 4DV5I 4U3DA 1BKNA 1B62A 3J81C 3T1YI 5C0XD 1XXEA 1IBKE 4B3SE 2ZBKB 1FKAE 4JI2E 3WU4A 4ZVIA 4QNJA 4LFAE 2ZM6E 2VQFE 2HK3A 1H72C 4LFBE 5GMEA 4IZJD 4KHPI 2UUCI 1N32I 3DD6A 2O3ZA 1E3PA 4X66I 4LF6I 2R3VA 3PS2A 1XNQI 2BA1D 1MG7A 1QZRA 2HK2A 4DR6I 3HULA 1IBMI 4IZJB 5K36A 4HXZA 4DPXA 4JI8E 3B8HA 4DU8A 4LF7E 3B78A 1FJGE 1K47A 4DR2I 4DV3E 2O1UA 4LF5E 2UXBE 4LF9E 4GKJE 4ISAA 4DPTA 3GMEA 4DR5E 4JI6E 1N33I 5K36C 1H7SA 2V2VA 1Y4UA 2V34A 4X62I 1HR0I 1IBLI 2GO3A 1KVKA 4WUCA 4DUYE 1P42A 4DR3E 2JT2A 5JEAA 4U3BA 1NZ0A 4BA1B 4P52A 4IFDA 4X65I 3Q6MA 2DEJA 4B3TE 2V2ZA 4OO1F 1MX0A 1Z0EA 3QT8A 3QT7A 2HHHE 4DR1I 1N36I 1OYSA 1HNXE 1I94I 5IT9C 5JEAC 1R6LA 4IFDC 4P7AA 4JI7I 3U1YA 2NN6F 4EMDA 1ELOA 2UXCI 4FW3A 4DXLA 1Z0VA 3P06A 3JAMC 4DV1E 5C0XA 2BM0A 4LF8E 3T1HE 1RR9A 1UDQA 3D4JA 3B4TA 1USVA 4JYAE 4KQVA 4DUZE 1Y60A 1XMQI 4DV7E 4IZJA 3M85G 4DV6E 5C0XC 1RREA 4JI3E 5DRPA 5K36B 4MYUA 2JEBB 4JI5I 1N0UA 5DRQA 2BM1A 1Z5AA 2V2QA 1PVGA 2R42A 5LMUE 5JEAE 3LPSA 4IFDE 4JI4E 1ZXNA 5FWKA 1Z0WA 3J7AM 2UUAE 3NZKA 4M1KA 2LJPA 4HYMA 1IBKI 3J7AG 1YH8A 1PKPA 1J5EE 4B3SI 4JI2I 1N34E 3PYDA 4LFAI 4IFDB 2ZM6I 2VQFI 2F4VE 2GO4A 4LFBI 4J3DA 4OO1D 4DPUA 2A2DA 3M85D 3ZKBA 3L7ZB 1KIJA 1Z5CA 5C0XE 1KKHA 2HFSA 3PRYA 5ELWA 2X36A 2HKEA 2IERA 2Z5CA 1ZXMA 2WNRA 1Y4SA 3PYFA 4YY3E 4LF7I 2EFGA 5C0XB 1FJGI 4DV3I 2ZITA 4LF5I 1MU5A 2CVEA 4GKKE 2UXBI 2V8PA 4GKJI 1Z0GA 4NXNE 4DR5I 3GONA 4JI6I 4ED4A 4PRVA 1U2RA 1H7UA 2JEBA 3OTOE 1WUUA 1NHJA 2CGEA 3J80C 3K17A 5K36F 4DUYI 2AJ4A 4DR3I 4MU4A 4HACB 1NHIA 4FW5A 5LMNE 4B3RE 3CDJA 3J80Q 2WP8B 4B3TI 3Q6NA 4MDTA 2VQEE 2HHHI 4LF4E 3CWVA 4LCGA 4XTJA 5EL9A 1HNXI 4DV0E 3U1KA 4X64E 4HACA 4AM3A 4LFCE 4I3HA 4USMA 1OYPA 2DEIA 5JEAF 4IFDF 4DV1I 4USKA 3L7ZA 4DR4E 4LF8I 2JEAB 4FW9A 1EA6A 3WU6A 1Z0BA 3T1HI 2BV3A 1XNRE 4BA2A 1Z59A 3ZZTA 4JYAI 1XMOE 4DR7E 1FWKA 3WU5A 4DUZI 4GQUA 3ZKDA 3PYGA 4DV7I 4DV6I 3M7NG 4JI1E 2GS8A 2Z5CB 3UHMA 1HK7A 2WNRB 5IWAE 4JI3I 4PRXA 2E5LE 4K0KE 2F1DA 2UXDE 5K36E 5C0XF 1S4EA 2PNMA 4JI0E 4MU0A 1OYRA 1E3HA 1UDNA 2C37B 4FW7A 2IOQA 5LMUI 2PO2B 2GQ0A 4JI4I 3K1JA 4MYTA 2HFUA 4LCHA 3ZZUA 1UDSA 2O1WA 2VESA 3LNUA 2UUAI 1R6MA 4FN5A 4DR1E 1J5EI 2IOPA 1N34I 1KTVA 1Z0TA 1A6FA 2E1RA 3CDIA 1HNZE 2WP8A 2O1VA 4NXME 2OI2A 4AIDA 2F4VI 2J7KA 4DV4E 5DNXA 4LPFA 3K85A 3M7ND 4JV5E 4DU7A 1UEKA 2J65A 5EKWA 2Q2EB
chains in the Genus database with same CATH topology
4UT4A 1OJ4A 4YY3I 4AQYE 4FWHA 2UUBE 4GKKI 1FWLA 1FNMA 4DV2E 4NXNI 4OX9E 5BR8E 3ZZ0A 2NPFA 4JI8I 3OTOI 1Z0CA 5GMDA 4UTGA 1ZM9A 1HNWE 4B3ME 4LF9I 4DPYA 5LMNI 2X7IA 4B3RI 2WW4A 3J81Q 4IZKA 2VQEI 4LF4I 3H4LA 1H73A 2UU9E 4YHHE 4DV5E 4DV0I 4X64I 2Z5BA 3T1YE 4JG4A 4LFCI 3QT6A 1D6TA 1ZM4A 4DR4I 3F0NA 4N3OA 2HKJA 4FWGA 2A2CA 4WUBA 1XNRI 1H74A 3V2UC 1VISA 4KHPE 4PU9A 3Q1QA 2UUCE 1N32E 1DARA 1XMOI 4DR7I 4X66E 4LF6E 1ZM2A 4WUDA 4JI1I 1ZM3A 1XNQE 5IWAI 4DR6E 2E5LI 2Z5EA 1IBME 4K0KI 2UXDI 1XHKA 3QT5A 4JI0I 4DPWA 4DR2E 4RPFA 4R1FA 3PYEA 3WU3A 1N33E 5L3JA 2O1TA 3ZM7A 1IBLE 4X62E 1HR0E 1Z5BA 3HJCA 1HNZI 4NXMI 4DV4I 4Z7CA 4X65E 2CG9A 4IZKB 4JV5I 5IT9Q 1N0VC 4HY1A 1B63A 1N36E 2XEXA 2Z5BB 1USUA 3JAMQ 1I94E 4JI7E 5A2QC 4URLA 1NHHA 2UXCE 4AQYI 1EI1A 3LTOA 2UUBI 1PIEA 5FLXC 5A2QQ 4DV2I 1Y6ZA 2VF3A 3V5RA 3M6AA 4OX9I 5BR8I 5FLXQ 4Z7YA 1XMQE 4FWDA 1FI4A 1HNWI 4JI5E 4B3MI 2CZ9A 1S16A 5LL6R 2PNLA 2UU9I 4YHHI 3B82A 4DV5I 1BKNA 1B62A 3J81C 3T1YI 1IBKE 4B3SE 2ZBKB 1FKAE 4JI2E 3WU4A 4ZVIA 4LFAE 2ZM6E 2VQFE 2HK3A 1H72C 4LFBE 5GMEA 4IZJD 4KHPI 2UUCI 1N32I 4X66I 4LF6I 2R3VA 1XNQI 1MG7A 1QZRA 2HK2A 4DR6I 3HULA 1IBMI 4IZJB 4HXZA 4DPXA 4JI8E 3B8HA 4DU8A 4LF7E 3B78A 1FJGE 1K47A 4DR2I 4DV3E 2O1UA 4LF5E 2UXBE 4LF9E 4GKJE 4DPTA 4DR5E 4JI6E 1N33I 1H7SA 2V2VA 1Y4UA 2V34A 4X62I 1HR0I 1IBLI 1KVKA 4WUCA 4DUYE 4DR3E 1NZ0A 4P52A 4X65I 3Q6MA 2DEJA 4B3TE 2V2ZA 1MX0A 1Z0EA 3QT8A 3QT7A 2HHHE 4DR1I 1N36I 1HNXE 1I94I 5IT9C 4P7AA 4JI7I 4EMDA 1ELOA 2UXCI 4DXLA 3JAMC 1Z0VA 3P06A 4DV1E 2BM0A 4LF8E 3T1HE 1RR9A 3D4JA 1USVA 4JYAE 4KQVA 4DUZE 1XMQI 4DV7E 4IZJA 4DV6E 1RREA 4JI3E 4MYUA 4JI5I 1N0UA 2BM1A 1Z5AA 2V2QA 1PVGA 2R42A 5LMUE 3LPSA 4JI4E 1ZXNA 5FWKA 1Z0WA 3J7AM 2UUAE 4M1KA 2LJPA 4HYMA 1IBKI 3J7AG 1J5EE 1PKPA 4B3SI 4JI2I 1N34E 3PYDA 4LFAI 2ZM6I 2VQFI 2F4VE 4LFBI 4DPUA 2A2DA 3ZKBA 1KIJA 1Z5CA 1KKHA 2HFSA 3PRYA 2X36A 2HKEA 2Z5CA 1ZXMA 1Y4SA 3PYFA 4YY3E 4LF7I 2EFGA 1FJGI 4DV3I 2ZITA 4LF5I 1MU5A 4GKKE 2UXBI 2V8PA 4GKJI 1Z0GA 4NXNE 4DR5I 3GONA 4JI6I 4ED4A 4PRVA 1U2RA 1H7UA 3OTOE 1WUUA 1NHJA 2CGEA 3J80C 3K17A 4DUYI 2AJ4A 4DR3I 1NHIA 5LMNE 4B3RE 3J80Q 4B3TI 3Q6NA 2VQEE 2HHHI 4LF4E 3CWVA 4XTJA 1HNXI 4DV0E 4X64E 4HACA 4LFCE 4I3HA 4USMA 2DEIA 4DV1I 4USKA 4DR4E 4LF8I 4FW9A 1EA6A 3WU6A 1Z0BA 3T1HI 2BV3A 1XNRE 1Z59A 3ZZTA 4JYAI 1XMOE 4DR7E 1FWKA 3WU5A 4DUZI 3ZKDA 3PYGA 4DV7I 4DV6I 4JI1E 2GS8A 2Z5CB 1HK7A 4JI3I 5IWAE 4PRXA 2E5LE 4K0KE 2UXDE 1S4EA 2PNMA 4JI0E 2IOQA 5LMUI 2GQ0A 4JI4I 3K1JA 4MYTA 2HFUA 3ZZUA 2O1WA 3LNUA 2UUAI 4FN5A 4DR1E 1J5EI 2IOPA 1N34I 1KTVA 1Z0TA 1A6FA 2E1RA 1HNZE 2O1VA 4NXME 2OI2A 2F4VI 2J7KA 4DV4E 3K85A 4JV5E 4DU7A 1UEKA 4HACB 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT4 A;  1OJ4 A;  4YY3 I;  4AQY E;  4FWH A;  2UUB E;  4GKK I;  1FWL A;  1FNM A;  4DV2 E;  4NXN I;  4OX9 E;  5BR8 E;  3ZZ0 A;  2NPF A;  4JI8 I;  3OTO I;  1Z0C A;  5GMD A;  4UTG A;  1ZM9 A;  1HNW E;  4B3M E;  4LF9 I;  4DPY A;  5LMN I;  2X7I A;  4B3R I;  2WW4 A;  3J81 Q;  2VQE I;  4LF4 I;  3H4L A;  1H73 A;  2UU9 E;  4YHH E;  4DV5 E;  4DV0 I;  4X64 I;  3T1Y E;  4JG4 A;  4LFC I;  3QT6 A;  1D6T A;  1ZM4 A;  4DR4 I;  3F0N A;  2HKJ A;  4FWG A;  2A2C A;  4WUB A;  1XNR I;  1H74 A;  3V2U C;  1VIS A;  4KHP E;  4PU9 A;  3Q1Q A;  2UUC E;  1N32 E;  1DAR A;  1XMO I;  4DR7 I;  4X66 E;  4LF6 E;  1ZM2 A;  4WUD A;  4JI1 I;  1ZM3 A;  1XNQ E;  5IWA I;  4DR6 E;  2E5L I;  1IBM E;  4K0K I;  2UXD I;  1XHK A;  3QT5 A;  4JI0 I;  4DPW A;  4DR2 E;  4RPF A;  4R1F A;  3PYE A;  3WU3 A;  1N33 E;  5L3J A;  3ZM7 A;  1IBL E;  4X62 E;  1HR0 E;  1Z5B A;  1HNZ I;  4NXM I;  4DV4 I;  4Z7C A;  4X65 E;  4JV5 I;  5IT9 Q;  1N0V C;  4HY1 A;  1B63 A;  1N36 E;  2XEX A;  3JAM Q;  1I94 E;  4JI7 E;  5A2Q C;  4URL A;  1NHH A;  2UXC E;  4AQY I;  1EI1 A;  3LTO A;  2UUB I;  1PIE A;  5FLX C;  5A2Q Q;  4DV2 I;  2VF3 A;  3V5R A;  3M6A A;  4OX9 I;  5BR8 I;  5FLX Q;  4Z7Y A;  1XMQ E;  4FWD A;  1FI4 A;  1HNW I;  4JI5 E;  4B3M I;  2CZ9 A;  1S16 A;  5LL6 R;  2UU9 I;  4YHH I;  3B82 A;  4DV5 I;  1BKN A;  1B62 A;  3J81 C;  3T1Y I;  1IBK E;  4B3S E;  2ZBK B;  1FKA E;  4JI2 E;  3WU4 A;  4ZVI A;  4LFA E;  2ZM6 E;  2VQF E;  2HK3 A;  1H72 C;  4LFB E;  5GME A;  4KHP I;  2UUC I;  1N32 I;  4X66 I;  4LF6 I;  2R3V A;  1XNQ I;  1MG7 A;  1QZR A;  2HK2 A;  4DR6 I;  3HUL A;  1IBM I;  4HXZ A;  4DPX A;  4JI8 E;  3B8H A;  4DU8 A;  4LF7 E;  3B78 A;  1FJG E;  1K47 A;  4DR2 I;  4DV3 E;  4LF5 E;  2UXB E;  4LF9 E;  4GKJ E;  4DPT A;  4DR5 E;  4JI6 E;  1N33 I;  1H7S A;  2V2V A;  2V34 A;  4X62 I;  1HR0 I;  1IBL I;  1KVK A;  4WUC A;  4DUY E;  4DR3 E;  1NZ0 A;  4P52 A;  4X65 I;  2DEJ A;  4B3T E;  2V2Z A;  1MX0 A;  1Z0E A;  3QT8 A;  3QT7 A;  2HHH E;  4DR1 I;  1N36 I;  1HNX E;  1I94 I;  5IT9 C;  4P7A A;  4JI7 I;  4EMD A;  1ELO A;  2UXC I;  4DXL A;  3JAM C;  1Z0V A;  4DV1 E;  2BM0 A;  4LF8 E;  3T1H E;  1RR9 A;  3D4J A;  4JYA E;  4KQV A;  4DUZ E;  1XMQ I;  4DV7 E;  4DV6 E;  1RRE A;  4JI3 E;  4MYU A;  4JI5 I;  1N0U A;  2BM1 A;  1Z5A A;  2V2Q A;  1PVG A;  2R42 A;  5LMU E;  3LPS A;  4JI4 E;  1ZXN A;  1Z0W A;  3J7A M;  2UUA E;  4M1K A;  2LJP A;  4HYM A;  1IBK I;  3J7A G;  1J5E E;  1PKP A;  4B3S I;  4JI2 I;  1N34 E;  3PYD A;  4LFA I;  2ZM6 I;  2VQF I;  2F4V E;  4LFB I;  4DPU A;  2A2D A;  3ZKB A;  1KIJ A;  1Z5C A;  1KKH A;  2HFS A;  2X36 A;  2HKE A;  1ZXM A;  3PYF A;  4YY3 E;  4LF7 I;  2EFG A;  1FJG I;  4DV3 I;  2ZIT A;  4LF5 I;  1MU5 A;  4GKK E;  2UXB I;  2V8P A;  4GKJ I;  1Z0G A;  4NXN E;  4DR5 I;  3GON A;  4JI6 I;  4ED4 A;  4PRV A;  1U2R A;  1H7U A;  3OTO E;  1WUU A;  1NHJ A;  3J80 C;  3K17 A;  4DUY I;  2AJ4 A;  4DR3 I;  1NHI A;  5LMN E;  4B3R E;  3J80 Q;  4B3T I;  2VQE E;  2HHH I;  4LF4 E;  3CWV A;  4XTJ A;  1HNX I;  4DV0 E;  4X64 E;  4HAC A;  4LFC E;  4I3H A;  4USM A;  2DEI A;  4DV1 I;  4USK A;  4DR4 E;  4LF8 I;  4FW9 A;  1EA6 A;  3WU6 A;  1Z0B A;  3T1H I;  2BV3 A;  1XNR E;  1Z59 A;  3ZZT A;  4JYA I;  1XMO E;  4DR7 E;  1FWK A;  3WU5 A;  4DUZ I;  3ZKD A;  3PYG A;  4DV7 I;  4DV6 I;  4JI1 E;  2GS8 A;  4JI3 I;  5IWA E;  4PRX A;  2E5L E;  4K0K E;  2UXD E;  1S4E A;  4JI0 E;  5LMU I;  4JI4 I;  3K1J A;  4MYT A;  2HFU A;  3ZZU A;  3LNU A;  2UUA I;  4FN5 A;  4DR1 E;  1J5E I;  1N34 I;  1KTV A;  1Z0T A;  1A6F A;  2E1R A;  1HNZ E;  4NXM E;  2OI2 A;  2F4V I;  2J7K A;  4DV4 E;  4JV5 E;  4DU7 A;  1UEK A;  4HAC B;  2Q2E B; 
#chains in the Genus database with same CATH topology
 4UT4 A;  1OJ4 A;  2C39 B;  2C38 B;  5JEA D;  2JEA A;  4YY3 I;  4AQY E;  4FWH A;  2UUB E;  4GKK I;  1FWL A;  4IS9 A;  4BA2 B;  1FNM A;  4DV2 E;  4NXN I;  4OX9 E;  2NN6 D;  5BR8 E;  3ZZ0 A;  2PO1 A;  4OO1 B;  4FW4 A;  2NPF A;  2AE8 A;  4JI8 I;  3OTO I;  1Z0C A;  3PS3 A;  5GMD A;  4MQY A;  2BR2 B;  4UTG A;  1ZM9 A;  1HNW E;  5DRO A;  4B3M E;  4LF9 I;  4DPY A;  5LMN I;  2X7I A;  4B3R I;  2C37 A;  2NN6 B;  2PO0 B;  2WW4 A;  2PO2 A;  3H1C A;  3J81 Q;  3PS1 A;  4IZK A;  2VQE I;  4LF4 I;  3H4L A;  1H73 A;  2UU9 E;  4YHH E;  4DV5 E;  3GLL A;  4MU1 A;  4DV0 I;  4X64 I;  2Z5B A;  4AIM A;  3T1Y E;  4JG4 A;  4LFC I;  3QT6 A;  1D6T A;  1ZM4 A;  2PNZ B;  4DR4 I;  3F0N A;  4N3O A;  2HKJ A;  4FWG A;  2A2C A;  4WUB A;  1XNR I;  1H74 A;  3V2U C;  1VIS A;  4KHP E;  4PU9 A;  3Q1Q A;  2UUC E;  1N32 E;  1DAR A;  1XMO I;  4DR7 I;  4X66 E;  4LF6 E;  2C39 A;  2BA0 G;  2C38 A;  1ZM2 A;  3HKM A;  4WUD A;  5DRR A;  4JI1 I;  1ZM3 A;  1XNQ E;  5IWA I;  4DR6 E;  2E5L I;  2Z5E A;  3P3G A;  1IBM E;  4K0K I;  2UXD I;  1XHK A;  4FW6 A;  3QT5 A;  4JI0 I;  4DPW A;  4DR2 E;  4RPF A;  3P3E A;  4R1F A;  4OO1 A;  3PYE A;  3WU3 A;  2PO1 B;  1RHY A;  2JE6 B;  1N33 E;  2BR2 A;  2O1T A;  5L3J A;  3ZM7 A;  4NBQ A;  1IBL E;  4X62 E;  1HR0 E;  1Z5B A;  3HJC A;  2NN6 A;  1HNZ I;  2PO0 A;  4OO1 C;  3KRN A;  4NXM I;  3P3C A;  4DV4 I;  4Z7C A;  4X65 E;  2CG9 A;  2BA0 D;  4IZK B;  4JV5 I;  5IT9 Q;  1N0V C;  4HY1 A;  1B63 A;  1Y5Y A;  1N36 E;  2XEX A;  2NN6 C;  5K36 D;  2Z5B B;  1USU A;  3JAM Q;  1I94 E;  4JI7 E;  2PNZ A;  5A2Q C;  4URL A;  5DNL A;  1NHH A;  4MU3 A;  2UXC E;  4AQY I;  1EI1 A;  3LTO A;  2UUB I;  1PIE A;  5FLX C;  5A2Q Q;  4DV2 I;  1Y6Z A;  2VF3 A;  3V5R A;  3M6A A;  4OX9 I;  1VI7 A;  5BR8 I;  4OKG A;  5FLX Q;  4Z7Y A;  4IFD D;  1XMQ E;  4FWD A;  4QNK A;  4OO1 E;  1FI4 A;  1HNW I;  4JI5 E;  4B3M I;  3GCM A;  2CZ9 A;  3P76 A;  1S16 A;  5LL6 R;  2BA1 G;  4BA1 A;  1UDO A;  4LOM A;  2PNL A;  5JEA B;  4LCF A;  2NN6 E;  4OZE A;  2IES A;  2JE6 A;  2UU9 I;  1YHC A;  4YHH I;  3B82 A;  4DV5 I;  4U3D A;  1BKN A;  1B62 A;  3J81 C;  3T1Y I;  5C0X D;  1XXE A;  1IBK E;  4B3S E;  2ZBK B;  1FKA E;  4JI2 E;  3WU4 A;  4ZVI A;  4QNJ A;  4LFA E;  2ZM6 E;  2VQF E;  2HK3 A;  1H72 C;  4LFB E;  5GME A;  4IZJ D;  4KHP I;  2UUC I;  1N32 I;  3DD6 A;  2O3Z A;  1E3P A;  4X66 I;  4LF6 I;  2R3V A;  3PS2 A;  1XNQ I;  2BA1 D;  1MG7 A;  1QZR A;  2HK2 A;  4DR6 I;  3HUL A;  1IBM I;  4IZJ B;  5K36 A;  4HXZ A;  4DPX A;  4JI8 E;  3B8H A;  4DU8 A;  4LF7 E;  3B78 A;  1FJG E;  1K47 A;  4DR2 I;  4DV3 E;  2O1U A;  4LF5 E;  2UXB E;  4LF9 E;  4GKJ E;  4ISA A;  4DPT A;  3GME A;  4DR5 E;  4JI6 E;  1N33 I;  5K36 C;  1H7S A;  2V2V A;  1Y4U A;  2V34 A;  4X62 I;  1HR0 I;  1IBL I;  2GO3 A;  1KVK A;  4WUC A;  4DUY E;  1P42 A;  4DR3 E;  2JT2 A;  5JEA A;  4U3B A;  1NZ0 A;  4BA1 B;  4P52 A;  4IFD A;  4X65 I;  3Q6M A;  2DEJ A;  4B3T E;  2V2Z A;  4OO1 F;  1MX0 A;  1Z0E A;  3QT8 A;  3QT7 A;  2HHH E;  4DR1 I;  1N36 I;  1OYS A;  1HNX E;  1I94 I;  5IT9 C;  5JEA C;  1R6L A;  4IFD C;  4P7A A;  4JI7 I;  3U1Y A;  2NN6 F;  4EMD A;  1ELO A;  2UXC I;  4FW3 A;  4DXL A;  1Z0V A;  3P06 A;  3JAM C;  4DV1 E;  5C0X A;  2BM0 A;  4LF8 E;  3T1H E;  1RR9 A;  1UDQ A;  3D4J A;  3B4T A;  1USV A;  4JYA E;  4KQV A;  4DUZ E;  1Y60 A;  1XMQ I;  4DV7 E;  4IZJ A;  3M85 G;  4DV6 E;  5C0X C;  1RRE A;  4JI3 E;  5DRP A;  5K36 B;  4MYU A;  2JEB B;  4JI5 I;  1N0U A;  5DRQ A;  2BM1 A;  1Z5A A;  2V2Q A;  1PVG A;  2R42 A;  5LMU E;  5JEA E;  3LPS A;  4IFD E;  4JI4 E;  1ZXN A;  5FWK A;  1Z0W A;  3J7A M;  2UUA E;  3NZK A;  4M1K A;  2LJP A;  4HYM A;  1IBK I;  3J7A G;  1YH8 A;  1PKP A;  1J5E E;  4B3S I;  4JI2 I;  1N34 E;  3PYD A;  4LFA I;  4IFD B;  2ZM6 I;  2VQF I;  2F4V E;  2GO4 A;  4LFB I;  4J3D A;  4OO1 D;  4DPU A;  2A2D A;  3M85 D;  3ZKB A;  3L7Z B;  1KIJ A;  1Z5C A;  5C0X E;  1KKH A;  2HFS A;  3PRY A;  5ELW A;  2X36 A;  2HKE A;  2IER A;  2Z5C A;  1ZXM A;  2WNR A;  1Y4S A;  3PYF A;  4YY3 E;  4LF7 I;  2EFG A;  5C0X B;  1FJG I;  4DV3 I;  2ZIT A;  4LF5 I;  1MU5 A;  2CVE A;  4GKK E;  2UXB I;  2V8P A;  4GKJ I;  1Z0G A;  4NXN E;  4DR5 I;  3GON A;  4JI6 I;  4ED4 A;  4PRV A;  1U2R A;  1H7U A;  2JEB A;  3OTO E;  1WUU A;  1NHJ A;  2CGE A;  3J80 C;  3K17 A;  5K36 F;  4DUY I;  2AJ4 A;  4DR3 I;  4MU4 A;  4HAC B;  1NHI A;  4FW5 A;  5LMN E;  4B3R E;  3CDJ A;  3J80 Q;  2WP8 B;  4B3T I;  3Q6N A;  4MDT A;  2VQE E;  2HHH I;  4LF4 E;  3CWV A;  4LCG A;  4XTJ A;  5EL9 A;  1HNX I;  4DV0 E;  3U1K A;  4X64 E;  4HAC A;  4AM3 A;  4LFC E;  4I3H A;  4USM A;  1OYP A;  2DEI A;  5JEA F;  4IFD F;  4DV1 I;  4USK A;  3L7Z A;  4DR4 E;  4LF8 I;  2JEA B;  4FW9 A;  1EA6 A;  3WU6 A;  1Z0B A;  3T1H I;  2BV3 A;  1XNR E;  4BA2 A;  1Z59 A;  3ZZT A;  4JYA I;  1XMO E;  4DR7 E;  1FWK A;  3WU5 A;  4DUZ I;  4GQU A;  3ZKD A;  3PYG A;  4DV7 I;  4DV6 I;  3M7N G;  4JI1 E;  2GS8 A;  2Z5C B;  3UHM A;  1HK7 A;  2WNR B;  5IWA E;  4JI3 I;  4PRX A;  2E5L E;  4K0K E;  2F1D A;  2UXD E;  5K36 E;  5C0X F;  1S4E A;  2PNM A;  4JI0 E;  4MU0 A;  1OYR A;  1E3H A;  1UDN A;  2C37 B;  4FW7 A;  2IOQ A;  5LMU I;  2PO2 B;  2GQ0 A;  4JI4 I;  3K1J A;  4MYT A;  2HFU A;  4LCH A;  3ZZU A;  1UDS A;  2O1W A;  2VES A;  3LNU A;  2UUA I;  1R6M A;  4FN5 A;  4DR1 E;  1J5E I;  2IOP A;  1N34 I;  1KTV A;  1Z0T A;  1A6F A;  2E1R A;  3CDI A;  1HNZ E;  2WP8 A;  2O1V A;  4NXM E;  2OI2 A;  4AID A;  2F4V I;  2J7K A;  4DV4 E;  5DNX A;  4LPF A;  3K85 A;  3M7N D;  4JV5 E;  4DU7 A;  1UEK A;  2J65 A;  5EKW A;  2Q2E B; 
#chains in the Genus database with same CATH homology
 4UT4 A;  1OJ4 A;  4YY3 I;  4AQY E;  4FWH A;  2UUB E;  4GKK I;  1FWL A;  1FNM A;  4DV2 E;  4NXN I;  4OX9 E;  5BR8 E;  3ZZ0 A;  2NPF A;  4JI8 I;  3OTO I;  1Z0C A;  5GMD A;  4UTG A;  1ZM9 A;  1HNW E;  4B3M E;  4LF9 I;  4DPY A;  5LMN I;  2X7I A;  4B3R I;  2WW4 A;  3J81 Q;  4IZK A;  2VQE I;  4LF4 I;  3H4L A;  1H73 A;  2UU9 E;  4YHH E;  4DV5 E;  4DV0 I;  4X64 I;  2Z5B A;  3T1Y E;  4JG4 A;  4LFC I;  3QT6 A;  1D6T A;  1ZM4 A;  4DR4 I;  3F0N A;  4N3O A;  2HKJ A;  4FWG A;  2A2C A;  4WUB A;  1XNR I;  1H74 A;  3V2U C;  1VIS A;  4KHP E;  4PU9 A;  3Q1Q A;  2UUC E;  1N32 E;  1DAR A;  1XMO I;  4DR7 I;  4X66 E;  4LF6 E;  1ZM2 A;  4WUD A;  4JI1 I;  1ZM3 A;  1XNQ E;  5IWA I;  4DR6 E;  2E5L I;  2Z5E A;  1IBM E;  4K0K I;  2UXD I;  1XHK A;  3QT5 A;  4JI0 I;  4DPW A;  4DR2 E;  4RPF A;  4R1F A;  3PYE A;  3WU3 A;  1N33 E;  5L3J A;  2O1T A;  3ZM7 A;  1IBL E;  4X62 E;  1HR0 E;  1Z5B A;  3HJC A;  1HNZ I;  4NXM I;  4DV4 I;  4Z7C A;  4X65 E;  2CG9 A;  4IZK B;  4JV5 I;  5IT9 Q;  1N0V C;  4HY1 A;  1B63 A;  1N36 E;  2XEX A;  2Z5B B;  1USU A;  3JAM Q;  1I94 E;  4JI7 E;  5A2Q C;  4URL A;  1NHH A;  2UXC E;  4AQY I;  1EI1 A;  3LTO A;  2UUB I;  1PIE A;  5FLX C;  5A2Q Q;  4DV2 I;  1Y6Z A;  2VF3 A;  3V5R A;  3M6A A;  4OX9 I;  5BR8 I;  5FLX Q;  4Z7Y A;  1XMQ E;  4FWD A;  1FI4 A;  1HNW I;  4JI5 E;  4B3M I;  2CZ9 A;  1S16 A;  5LL6 R;  2PNL A;  2UU9 I;  4YHH I;  3B82 A;  4DV5 I;  1BKN A;  1B62 A;  3J81 C;  3T1Y I;  1IBK E;  4B3S E;  2ZBK B;  1FKA E;  4JI2 E;  3WU4 A;  4ZVI A;  4LFA E;  2ZM6 E;  2VQF E;  2HK3 A;  1H72 C;  4LFB E;  5GME A;  4IZJ D;  4KHP I;  2UUC I;  1N32 I;  4X66 I;  4LF6 I;  2R3V A;  1XNQ I;  1MG7 A;  1QZR A;  2HK2 A;  4DR6 I;  3HUL A;  1IBM I;  4IZJ B;  4HXZ A;  4DPX A;  4JI8 E;  3B8H A;  4DU8 A;  4LF7 E;  3B78 A;  1FJG E;  1K47 A;  4DR2 I;  4DV3 E;  2O1U A;  4LF5 E;  2UXB E;  4LF9 E;  4GKJ E;  4DPT A;  4DR5 E;  4JI6 E;  1N33 I;  1H7S A;  2V2V A;  1Y4U A;  2V34 A;  4X62 I;  1HR0 I;  1IBL I;  1KVK A;  4WUC A;  4DUY E;  4DR3 E;  1NZ0 A;  4P52 A;  4X65 I;  3Q6M A;  2DEJ A;  4B3T E;  2V2Z A;  1MX0 A;  1Z0E A;  3QT8 A;  3QT7 A;  2HHH E;  4DR1 I;  1N36 I;  1HNX E;  1I94 I;  5IT9 C;  4P7A A;  4JI7 I;  4EMD A;  1ELO A;  2UXC I;  4DXL A;  3JAM C;  1Z0V A;  3P06 A;  4DV1 E;  2BM0 A;  4LF8 E;  3T1H E;  1RR9 A;  3D4J A;  1USV A;  4JYA E;  4KQV A;  4DUZ E;  1XMQ I;  4DV7 E;  4IZJ A;  4DV6 E;  1RRE A;  4JI3 E;  4MYU A;  4JI5 I;  1N0U A;  2BM1 A;  1Z5A A;  2V2Q A;  1PVG A;  2R42 A;  5LMU E;  3LPS A;  4JI4 E;  1ZXN A;  5FWK A;  1Z0W A;  3J7A M;  2UUA E;  4M1K A;  2LJP A;  4HYM A;  1IBK I;  3J7A G;  1J5E E;  1PKP A;  4B3S I;  4JI2 I;  1N34 E;  3PYD A;  4LFA I;  2ZM6 I;  2VQF I;  2F4V E;  4LFB I;  4DPU A;  2A2D A;  3ZKB A;  1KIJ A;  1Z5C A;  1KKH A;  2HFS A;  3PRY A;  2X36 A;  2HKE A;  2Z5C A;  1ZXM A;  1Y4S A;  3PYF A;  4YY3 E;  4LF7 I;  2EFG A;  1FJG I;  4DV3 I;  2ZIT A;  4LF5 I;  1MU5 A;  4GKK E;  2UXB I;  2V8P A;  4GKJ I;  1Z0G A;  4NXN E;  4DR5 I;  3GON A;  4JI6 I;  4ED4 A;  4PRV A;  1U2R A;  1H7U A;  3OTO E;  1WUU A;  1NHJ A;  2CGE A;  3J80 C;  3K17 A;  4DUY I;  2AJ4 A;  4DR3 I;  1NHI A;  5LMN E;  4B3R E;  3J80 Q;  4B3T I;  3Q6N A;  2VQE E;  2HHH I;  4LF4 E;  3CWV A;  4XTJ A;  1HNX I;  4DV0 E;  4X64 E;  4HAC A;  4LFC E;  4I3H A;  4USM A;  2DEI A;  4DV1 I;  4USK A;  4DR4 E;  4LF8 I;  4FW9 A;  1EA6 A;  3WU6 A;  1Z0B A;  3T1H I;  2BV3 A;  1XNR E;  1Z59 A;  3ZZT A;  4JYA I;  1XMO E;  4DR7 E;  1FWK A;  3WU5 A;  4DUZ I;  3ZKD A;  3PYG A;  4DV7 I;  4DV6 I;  4JI1 E;  2GS8 A;  2Z5C B;  1HK7 A;  4JI3 I;  5IWA E;  4PRX A;  2E5L E;  4K0K E;  2UXD E;  1S4E A;  2PNM A;  4JI0 E;  2IOQ A;  5LMU I;  2GQ0 A;  4JI4 I;  3K1J A;  4MYT A;  2HFU A;  3ZZU A;  2O1W A;  3LNU A;  2UUA I;  4FN5 A;  4DR1 E;  1J5E I;  2IOP A;  1N34 I;  1KTV A;  1Z0T A;  1A6F A;  2E1R A;  1HNZ E;  2O1V A;  4NXM E;  2OI2 A;  2F4V I;  2J7K A;  4DV4 E;  3K85 A;  4JV5 E;  4DU7 A;  1UEK A;  4HAC B;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...