2PO1A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with a single stranded 10-mer poly(a) rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase/rna
molecule keywords 10-mer poly(A)
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 77
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po1A01
5JEAC 1E3HA 5C0XB 3GCMA 5JEAA 2BA1D 4IFDA 2BR2A 3B4TA 4OO1B 4BA2A 2PO0A 2BA0D 3M7ND 2NN6D 1OYSA 3L7ZB 5K36B 3DD6A 2BA1G 2BA0G 3M7NG 2JE6B 5C0XC 3KRNA 5JEAE 2NN6B 4IFDE 5C0XA 4OO1A 2JEBB 1UDOA 2JEAA 5K36C 4IFDC 3L7ZA 5K36A 1R6LA 1UDQA 2WNRB 2JE6A 2NN6C 5C0XE 2PO1B 2NN6A 4OO1E 2C38B 2JEBA 5K36E 2PO2B 4OO1C 1R6MA 2WP8B 1OYPA 1OYRA 4AM3A 3GMEA 2NN6E 3U1KA 5JEAF 4IFDF 4BA2B 3GLLA 2PO0B 5C0XD 2PO2A 2C37B 3CDJA 5K36D 4BA1B 5JEAD 4IFDD 3CDIA 5C0XF 2C39B 4OO1F 4NBQA 2PNZB 1E3PA 2JEAB 2WNRA 5K36F 5JEAB 2PO1A 4IFDB 2BR2B 2C37A 3M85D 1UDSA 4BA1A 2C38A 4OO1D 2NN6F 3H1CA 1UDNA 3HKMA 2C39A 3M85G 2WP8A 4AIMA 4AIDA 2PNZA
chains in the Genus database with same CATH superfamily
1Z5BA 2HK2A 5JEAC 4ISAA 4PRXA 4B3ME 2V2VA 2BR2A 3P06A 4PU9A 4OO1B 2BA0D 1IBLI 4B3SE 4DPUA 4JI4E 1FKAE 4LCGA 4AQYI 1DARA 4UTGA 1YH8A 4DR4E 4LF8E 2E5LE 1RREA 5C0XA 1HNXE 2O1UA 2UUAI 2UXCI 4LF5E 3Q1QA 2DEJA 3P3CA 2JEBB 1D6TA 3H4LA 1H7UA 2PNLA 3L7ZA 4QNKA 4IFDC 3PYFA 4DV4E 4DV6E 1H74A 1USUA 4MU1A 5A2QC 5C0XE 4HACB 2PO1B 5BR8E 5LMNE 1S4EA 2Z5EA 5IT9Q 4P7AA 3F0NA 1FWLA 4DV2E 3LNUA 4LCFA 4USKA 4YHHI 2VQEE 4JYAE 4QNJA 2V34A 2VQFI 4NXME 1OYRA 4AM3A 3GMEA 4LF6E 2BV3A 4DV5I 2UUBI 5JEAF 1RR9A 1J5EI 4DV1I 4X62E 4LFCI 1Y4UA 1N32E 4LF9E 2A2DA 2IESA 2PO2A 4JG4A 3B8HA 4HY1A 4DR5I 2VESA 3ZZTA 4OX9E 4LCHA 4LFBI 4IFDD 3LTOA 1EA6A 4IZJA 1H72C 2C39B 5DNXA 4LOMA 4OZEA 3B82A 1H7SA 2PNZB 1E3PA 4LF7E 4B3RI 3M6AA 1ZM2A 3J80C 1XNQE 2XEXA 1FJGE 2PNMA 3K17A 4IFDB 4JI5I 3ZZ0A 3ZKBA 2A2CA 4BA1A 4DXLA 4M1KA 1Y60A 1XNRE 1RHYA 2GQ0A 1MX0A 5DRPA 5LL6R 1IBLE 3QT7A 3B78A 2UXDE 4BA2A 4MYTA 1EI1A 4FWDA 2NN6D 4DV3E 2X36A 5K36B 3DD6A 2GO4A 3WU3A 4AQYE 1ELOA 2BA1G 1Z0WA 4USMA 3J81Q 4N3OA 1HNZI 1XMQE 3M7NG 4DR6I 5C0XC 4DR2I 2UUAE 4R1FA 2NN6B 1ZXMA 4IZKB 5EL9A 2BM1A 3HULA 3QT6A 4OO1A 3JAMC 2JEAA 2V2QA 4X64I 4Z7YA 2WW4A 3QT5A 4DPTA 2ZM6I 3K1JA 4OO1E 2Z5CA 2JEBA 2F4VI 4YHHE 4K0KE 1YHCA 3PS1A 2DEIA 2VQFE 1B62A 1OYPA 2HFSA 4DV5E 2UUBE 2OI2A 3J7AG 5IWAE 4DV1E 4LFAI 2HKJA 4GKKI 4LFCE 3U1YA 4URLA 5C0XD 4DR5E 1VI7A 2CZ9A 2C37B 2GO3A 4DU8A 5JEAD 1Z59A 4KHPI 4JV5I 4JI8E 3CDIA 5L3JA 4JI0I 5C0XF 1Y4SA 4MYUA 4B3RE 2CVEA 4DR1I 4FWHA 3V2UC 1USVA 1P42A 2WNRA 4XTJA 4LF4E 3UHMA 4DR7I 5JEAB 4NXNI 2J7KA 1QZRA 4U3DA 5LMUE 4B3SI 3P76A 4P52A 4JI6I 4DV0I 2C38A 2AE8A 4B3TI 1NZ0A 3H1CA 3K85A 3HKMA 3ZKDA 2C39A 4LF8I 3M85G 2WP8A 3WU6A 3J80Q 1N33I 2PNZA 2F1DA 4JI7E 5IT9C 3PS2A 4X66I 5FLXQ 1E3HA 2BA1D 2Z5BB 4IFDA 1Z0GA 3WU5A 2PO0A 1HK7A 2HFUA 2VF3A 3M7ND 4DV4I 3J7AM 1HNWI 2Q2EB 5DRQA 2UUCI 5LMNI 1N36I 4DR2E 1Z0TA 2JE6B 4EMDA 1XMOI 1Z0VA 3KRNA 1Z0BA 4DUZI 4IFDE 3D4JA 2O3ZA 4HYMA 1IBMI 4X65I 4X64E 1VISA 3PRYA 4JI1I 2ZITA 5K36A 2ZM6E 4YY3I 4GKJI 1IBKI 4DR3I 2LJPA 3ZZUA 3P3GA 2IOPA 2HK3A 4DUYI 1MG7A 2NN6A 3JAMQ 3T1YI 4DU7A 4DV7I 3LPSA 2F4VE 1U2RA 1ZM9A 4OX9I 5K36E 2UXCE 4PRVA 1OJ4A 2O1TA 3QT8A 4FW6A 2GS8A 1FWKA 1N0VC 1WUUA 1I94I 1KVKA 4LFAE 3PYGA 3PYDA 2NN6E 2HHHI 4JI3I 1NHHA 4BA2B 3GLLA 3T1HI 1Z0CA 3CWVA 4JI2I 2IERA 2UXBI 1ZM3A 1KIJA 1ZM4A 1PIEA 1Y6ZA 3CDJA 4HXZA 4KHPE 4JI0E 4FW7A 1BKNA 4DR1E 3Q6NA 2R42A 4NBQA 4OO1F 5DROA 5A2QQ 5GMEA 2UXDI 2JEAB 1HR0I 1J5EE 4DR7E 2R3VA 4NXNE 3OTOI 4HACA 4DV3I 2PO1A 2BR2B 1H73A 2C37A 3M85D 4JI6E 4DV0E 1UDSA 4DPWA 1S16A 4B3TE 1N34I 1NHIA 4WUCA 1XMQI 2X7IA 1UEKA 2UU9I 1UDNA 4LPFA 5DRRA 4LFBE 1N33E 2Z5CB 2V8PA 4X66E 4FN5A 5EKWA 4FW5A 5C0XB 4WUDA 2NPFA 2IOQA 3GCMA 5JEAA 3B4TA 1ZXNA 4FW3A 4B3MI 1OYSA 4MDTA 3L7ZB 4FW4A 4FWGA 4JI5E 4I3HA 1HNWE 2JT2A 1Z0EA 2UUCE 3NZKA 1N36E 1FI4A 2O1WA 5ELWA 1XXEA 4Z7CA 4JI4I 2BA0G 1XMOE 4DUZE 1PVGA 4RPFA 5JEAE 4MU3A 4DR4I 4K0KI 1IBME 4X65E 2E5LI 2Z5BA 1HNXI 3Q6MA 4JI1E 3PS3A 4LF5I 1UDOA 2E1RA 5K36C 3PYEA 4YY3E 4GKJE 4GQUA 1R6LA 1A6FA 4DR3E 1IBKE 3P3EA 5IWAI 1B63A 1UDQA 4DV6I 4MQYA 3ZM7A 2WNRB 2JE6A 2NN6C 4DUYE 3T1YE 4DV7E 4IZJD 1HNZE 4FW9A 5BR8I 4DR6E 2C38B 2AJ4A 2PO2B 4DV2I 1FNMA 4OO1C 4OKGA 4JI8I 1R6MA 4ED4A 2VQEI 1I94E 4U3BA 2EFGA 2WP8B 4JYAI 2BM0A 1KTVA 2J65A 4IZJB 2ZBKB 2HHHE 4JI3E 4NXMI 4LF6I 1KKHA 3U1KA 4IFDF 4LF4I 5FLXC 3T1HE 4JI2E 2CG9A 2PO0B 4X62I 5GMDA 2UXBE 5LMUI 1Y5YA 1Z5AA 5DNLA 1N32I 4LF9I 3HJCA 4IZKA 5K36D 4BA1B 4DPYA 4ZVIA 2CGEA 1K47A 4JI7I 4DPXA 4WUBA 1XHKA 3GONA 4UT4A 1HR0E 4J3DA 3OTOE 4LF7I 4GKKE 4MU4A 5K36F 1PKPA 1XNQI 2V2ZA 3V5RA 2O1VA 1MU5A 4KQVA 1FJGI 5FWKA 1N34E 1Z5CA 1N0UA 4OO1D 2UU9E 2NN6F 4IS9A 1XNRI 3WU4A 2HKEA 4JV5E 1NHJA 4AIMA 4MU0A 4AIDA 3J81C
chains in the Genus database with same CATH topology
5JEAC 1E3HA 5C0XB 3GCMA 5JEAA 2BA1D 4IFDA 2BR2A 3B4TA 4OO1B 4BA2A 2PO0A 2BA0D 3M7ND 2NN6D 1OYSA 3L7ZB 5K36B 3DD6A 2BA1G 2BA0G 3M7NG 2JE6B 5C0XC 3KRNA 5JEAE 2NN6B 4IFDE 5C0XA 4OO1A 2JEBB 1UDOA 2JEAA 5K36C 4IFDC 3L7ZA 5K36A 1R6LA 1UDQA 2WNRB 2JE6A 2NN6C 5C0XE 2PO1B 2NN6A 4OO1E 2C38B 2JEBA 5K36E 2PO2B 4OO1C 1R6MA 2WP8B 1OYPA 1OYRA 4AM3A 3GMEA 2NN6E 3U1KA 5JEAF 4IFDF 4BA2B 3GLLA 2PO0B 5C0XD 2PO2A 2C37B 3CDJA 5K36D 4BA1B 5JEAD 4IFDD 3CDIA 5C0XF 2C39B 4OO1F 4NBQA 2PNZB 1E3PA 2JEAB 2WNRA 5K36F 5JEAB 2PO1A 4IFDB 2BR2B 2C37A 3M85D 1UDSA 4BA1A 2C38A 4OO1D 2NN6F 3H1CA 1UDNA 3HKMA 2C39A 3M85G 2WP8A 4AIMA 4AIDA 2PNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA C;  1E3H A;  5C0X B;  3GCM A;  5JEA A;  2BA1 D;  4IFD A;  2BR2 A;  3B4T A;  4OO1 B;  4BA2 A;  2PO0 A;  2BA0 D;  3M7N D;  2NN6 D;  1OYS A;  3L7Z B;  5K36 B;  3DD6 A;  2BA1 G;  2BA0 G;  3M7N G;  2JE6 B;  5C0X C;  3KRN A;  5JEA E;  2NN6 B;  4IFD E;  5C0X A;  4OO1 A;  2JEB B;  1UDO A;  2JEA A;  5K36 C;  4IFD C;  3L7Z A;  5K36 A;  1R6L A;  1UDQ A;  2WNR B;  2JE6 A;  2NN6 C;  5C0X E;  2PO1 B;  2NN6 A;  4OO1 E;  2C38 B;  2JEB A;  5K36 E;  2PO2 B;  4OO1 C;  1R6M A;  2WP8 B;  1OYP A;  1OYR A;  4AM3 A;  3GME A;  2NN6 E;  3U1K A;  5JEA F;  4IFD F;  4BA2 B;  3GLL A;  2PO0 B;  5C0X D;  2PO2 A;  2C37 B;  3CDJ A;  5K36 D;  4BA1 B;  5JEA D;  4IFD D;  3CDI A;  5C0X F;  2C39 B;  4OO1 F;  4NBQ A;  2PNZ B;  1E3P A;  2JEA B;  2WNR A;  5K36 F;  5JEA B;  2PO1 A;  4IFD B;  2BR2 B;  2C37 A;  3M85 D;  1UDS A;  4BA1 A;  2C38 A;  4OO1 D;  2NN6 F;  3H1C A;  1UDN A;  3HKM A;  2C39 A;  3M85 G;  2WP8 A;  4AIM A;  4AID A;  2PNZ A; 
#chains in the Genus database with same CATH topology
 1Z5B A;  2HK2 A;  5JEA C;  4ISA A;  4PRX A;  4B3M E;  2V2V A;  2BR2 A;  3P06 A;  4PU9 A;  4OO1 B;  2BA0 D;  1IBL I;  4B3S E;  4DPU A;  4JI4 E;  1FKA E;  4LCG A;  4AQY I;  1DAR A;  4UTG A;  1YH8 A;  4DR4 E;  4LF8 E;  2E5L E;  1RRE A;  5C0X A;  1HNX E;  2O1U A;  2UUA I;  2UXC I;  4LF5 E;  3Q1Q A;  2DEJ A;  3P3C A;  2JEB B;  1D6T A;  3H4L A;  1H7U A;  2PNL A;  3L7Z A;  4QNK A;  4IFD C;  3PYF A;  4DV4 E;  4DV6 E;  1H74 A;  1USU A;  4MU1 A;  5A2Q C;  5C0X E;  4HAC B;  2PO1 B;  5BR8 E;  5LMN E;  1S4E A;  2Z5E A;  5IT9 Q;  4P7A A;  3F0N A;  1FWL A;  4DV2 E;  3LNU A;  4LCF A;  4USK A;  4YHH I;  2VQE E;  4JYA E;  4QNJ A;  2V34 A;  2VQF I;  4NXM E;  1OYR A;  4AM3 A;  3GME A;  4LF6 E;  2BV3 A;  4DV5 I;  2UUB I;  5JEA F;  1RR9 A;  1J5E I;  4DV1 I;  4X62 E;  4LFC I;  1Y4U A;  1N32 E;  4LF9 E;  2A2D A;  2IES A;  2PO2 A;  4JG4 A;  3B8H A;  4HY1 A;  4DR5 I;  2VES A;  3ZZT A;  4OX9 E;  4LCH A;  4LFB I;  4IFD D;  3LTO A;  1EA6 A;  4IZJ A;  1H72 C;  2C39 B;  5DNX A;  4LOM A;  4OZE A;  3B82 A;  1H7S A;  2PNZ B;  1E3P A;  4LF7 E;  4B3R I;  3M6A A;  1ZM2 A;  3J80 C;  1XNQ E;  2XEX A;  1FJG E;  2PNM A;  3K17 A;  4IFD B;  4JI5 I;  3ZZ0 A;  3ZKB A;  2A2C A;  4BA1 A;  4DXL A;  4M1K A;  1Y60 A;  1XNR E;  1RHY A;  2GQ0 A;  1MX0 A;  5DRP A;  5LL6 R;  1IBL E;  3QT7 A;  3B78 A;  2UXD E;  4BA2 A;  4MYT A;  1EI1 A;  4FWD A;  2NN6 D;  4DV3 E;  2X36 A;  5K36 B;  3DD6 A;  2GO4 A;  3WU3 A;  4AQY E;  1ELO A;  2BA1 G;  1Z0W A;  4USM A;  3J81 Q;  4N3O A;  1HNZ I;  1XMQ E;  3M7N G;  4DR6 I;  5C0X C;  4DR2 I;  2UUA E;  4R1F A;  2NN6 B;  1ZXM A;  4IZK B;  5EL9 A;  2BM1 A;  3HUL A;  3QT6 A;  4OO1 A;  3JAM C;  2JEA A;  2V2Q A;  4X64 I;  4Z7Y A;  2WW4 A;  3QT5 A;  4DPT A;  2ZM6 I;  3K1J A;  4OO1 E;  2Z5C A;  2JEB A;  2F4V I;  4YHH E;  4K0K E;  1YHC A;  3PS1 A;  2DEI A;  2VQF E;  1B62 A;  1OYP A;  2HFS A;  4DV5 E;  2UUB E;  2OI2 A;  3J7A G;  5IWA E;  4DV1 E;  4LFA I;  2HKJ A;  4GKK I;  4LFC E;  3U1Y A;  4URL A;  5C0X D;  4DR5 E;  1VI7 A;  2CZ9 A;  2C37 B;  2GO3 A;  4DU8 A;  5JEA D;  1Z59 A;  4KHP I;  4JV5 I;  4JI8 E;  3CDI A;  5L3J A;  4JI0 I;  5C0X F;  1Y4S A;  4MYU A;  4B3R E;  2CVE A;  4DR1 I;  4FWH A;  3V2U C;  1USV A;  1P42 A;  2WNR A;  4XTJ A;  4LF4 E;  3UHM A;  4DR7 I;  5JEA B;  4NXN I;  2J7K A;  1QZR A;  4U3D A;  5LMU E;  4B3S I;  3P76 A;  4P52 A;  4JI6 I;  4DV0 I;  2C38 A;  2AE8 A;  4B3T I;  1NZ0 A;  3H1C A;  3K85 A;  3HKM A;  3ZKD A;  2C39 A;  4LF8 I;  3M85 G;  2WP8 A;  3WU6 A;  3J80 Q;  1N33 I;  2PNZ A;  2F1D A;  4JI7 E;  5IT9 C;  3PS2 A;  4X66 I;  5FLX Q;  1E3H A;  2BA1 D;  2Z5B B;  4IFD A;  1Z0G A;  3WU5 A;  2PO0 A;  1HK7 A;  2HFU A;  2VF3 A;  3M7N D;  4DV4 I;  3J7A M;  1HNW I;  2Q2E B;  5DRQ A;  2UUC I;  5LMN I;  1N36 I;  4DR2 E;  1Z0T A;  2JE6 B;  4EMD A;  1XMO I;  1Z0V A;  3KRN A;  1Z0B A;  4DUZ I;  4IFD E;  3D4J A;  2O3Z A;  4HYM A;  1IBM I;  4X65 I;  4X64 E;  1VIS A;  3PRY A;  4JI1 I;  2ZIT A;  5K36 A;  2ZM6 E;  4YY3 I;  4GKJ I;  1IBK I;  4DR3 I;  2LJP A;  3ZZU A;  3P3G A;  2IOP A;  2HK3 A;  4DUY I;  1MG7 A;  2NN6 A;  3JAM Q;  3T1Y I;  4DU7 A;  4DV7 I;  3LPS A;  2F4V E;  1U2R A;  1ZM9 A;  4OX9 I;  5K36 E;  2UXC E;  4PRV A;  1OJ4 A;  2O1T A;  3QT8 A;  4FW6 A;  2GS8 A;  1FWK A;  1N0V C;  1WUU A;  1I94 I;  1KVK A;  4LFA E;  3PYG A;  3PYD A;  2NN6 E;  2HHH I;  4JI3 I;  1NHH A;  4BA2 B;  3GLL A;  3T1H I;  1Z0C A;  3CWV A;  4JI2 I;  2IER A;  2UXB I;  1ZM3 A;  1KIJ A;  1ZM4 A;  1PIE A;  1Y6Z A;  3CDJ A;  4HXZ A;  4KHP E;  4JI0 E;  4FW7 A;  1BKN A;  4DR1 E;  3Q6N A;  2R42 A;  4NBQ A;  4OO1 F;  5DRO A;  5A2Q Q;  5GME A;  2UXD I;  2JEA B;  1HR0 I;  1J5E E;  4DR7 E;  2R3V A;  4NXN E;  3OTO I;  4HAC A;  4DV3 I;  2PO1 A;  2BR2 B;  1H73 A;  2C37 A;  3M85 D;  4JI6 E;  4DV0 E;  1UDS A;  4DPW A;  1S16 A;  4B3T E;  1N34 I;  1NHI A;  4WUC A;  1XMQ I;  2X7I A;  1UEK A;  2UU9 I;  1UDN A;  4LPF A;  5DRR A;  4LFB E;  1N33 E;  2Z5C B;  2V8P A;  4X66 E;  4FN5 A;  5EKW A;  4FW5 A;  5C0X B;  4WUD A;  2NPF A;  2IOQ A;  3GCM A;  5JEA A;  3B4T A;  1ZXN A;  4FW3 A;  4B3M I;  1OYS A;  4MDT A;  3L7Z B;  4FW4 A;  4FWG A;  4JI5 E;  4I3H A;  1HNW E;  2JT2 A;  1Z0E A;  2UUC E;  3NZK A;  1N36 E;  1FI4 A;  2O1W A;  5ELW A;  1XXE A;  4Z7C A;  4JI4 I;  2BA0 G;  1XMO E;  4DUZ E;  1PVG A;  4RPF A;  5JEA E;  4MU3 A;  4DR4 I;  4K0K I;  1IBM E;  4X65 E;  2E5L I;  2Z5B A;  1HNX I;  3Q6M A;  4JI1 E;  3PS3 A;  4LF5 I;  1UDO A;  2E1R A;  5K36 C;  3PYE A;  4YY3 E;  4GKJ E;  4GQU A;  1R6L A;  1A6F A;  4DR3 E;  1IBK E;  3P3E A;  5IWA I;  1B63 A;  1UDQ A;  4DV6 I;  4MQY A;  3ZM7 A;  2WNR B;  2JE6 A;  2NN6 C;  4DUY E;  3T1Y E;  4DV7 E;  4IZJ D;  1HNZ E;  4FW9 A;  5BR8 I;  4DR6 E;  2C38 B;  2AJ4 A;  2PO2 B;  4DV2 I;  1FNM A;  4OO1 C;  4OKG A;  4JI8 I;  1R6M A;  4ED4 A;  2VQE I;  1I94 E;  4U3B A;  2EFG A;  2WP8 B;  4JYA I;  2BM0 A;  1KTV A;  2J65 A;  4IZJ B;  2ZBK B;  2HHH E;  4JI3 E;  4NXM I;  4LF6 I;  1KKH A;  3U1K A;  4IFD F;  4LF4 I;  5FLX C;  3T1H E;  4JI2 E;  2CG9 A;  2PO0 B;  4X62 I;  5GMD A;  2UXB E;  5LMU I;  1Y5Y A;  1Z5A A;  5DNL A;  1N32 I;  4LF9 I;  3HJC A;  4IZK A;  5K36 D;  4BA1 B;  4DPY A;  4ZVI A;  2CGE A;  1K47 A;  4JI7 I;  4DPX A;  4WUB A;  1XHK A;  3GON A;  4UT4 A;  1HR0 E;  4J3D A;  3OTO E;  4LF7 I;  4GKK E;  4MU4 A;  5K36 F;  1PKP A;  1XNQ I;  2V2Z A;  3V5R A;  2O1V A;  1MU5 A;  4KQV A;  1FJG I;  5FWK A;  1N34 E;  1Z5C A;  1N0U A;  4OO1 D;  2UU9 E;  2NN6 F;  4IS9 A;  1XNR I;  3WU4 A;  2HKE A;  4JV5 E;  1NHJ A;  4AIM A;  4MU0 A;  4AID A;  3J81 C; 
#chains in the Genus database with same CATH homology
 5JEA C;  1E3H A;  5C0X B;  3GCM A;  5JEA A;  2BA1 D;  4IFD A;  2BR2 A;  3B4T A;  4OO1 B;  4BA2 A;  2PO0 A;  2BA0 D;  3M7N D;  2NN6 D;  1OYS A;  3L7Z B;  5K36 B;  3DD6 A;  2BA1 G;  2BA0 G;  3M7N G;  2JE6 B;  5C0X C;  3KRN A;  5JEA E;  2NN6 B;  4IFD E;  5C0X A;  4OO1 A;  2JEB B;  1UDO A;  2JEA A;  5K36 C;  4IFD C;  3L7Z A;  5K36 A;  1R6L A;  1UDQ A;  2WNR B;  2JE6 A;  2NN6 C;  5C0X E;  2PO1 B;  2NN6 A;  4OO1 E;  2C38 B;  2JEB A;  5K36 E;  2PO2 B;  4OO1 C;  1R6M A;  2WP8 B;  1OYP A;  1OYR A;  4AM3 A;  3GME A;  2NN6 E;  3U1K A;  5JEA F;  4IFD F;  4BA2 B;  3GLL A;  2PO0 B;  5C0X D;  2PO2 A;  2C37 B;  3CDJ A;  5K36 D;  4BA1 B;  5JEA D;  4IFD D;  3CDI A;  5C0X F;  2C39 B;  4OO1 F;  4NBQ A;  2PNZ B;  1E3P A;  2JEA B;  2WNR A;  5K36 F;  5JEA B;  2PO1 A;  4IFD B;  2BR2 B;  2C37 A;  3M85 D;  1UDS A;  4BA1 A;  2C38 A;  4OO1 D;  2NN6 F;  3H1C A;  1UDN A;  3HKM A;  2C39 A;  3M85 G;  2WP8 A;  4AIM A;  4AID A;  2PNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...