2PO1A

Crystal structure of the p. abyssi exosome rnase ph ring complexed with a single stranded 10-mer poly(a) rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
236
structure length
236
Chain Sequence
KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIEGEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-mer poly(A)
publication title Insights into the mechanism of progressive RNA degradation by the archaeal exosome.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Hydrolase/hydrolase/rna
total genus 77
structure length 236
sequence length 236
ec nomenclature ec 3.1.13.-:
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 2po1A01
2BA0G 4OO1E 2PO2B 5JEAB 5C0XB 2JEAB 3KRNA 5JEAE 3H1CA 2JEBB 1R6MA 2WP8A 2NN6F 2JE6A 3GLLA 1E3PA 4IFDB 3L7ZA 4IFDE 2PNZA 2PO2A 5C0XA 1R6LA 2JEBA 2C39B 4OO1B 5C0XD 5K36F 5K36A 2PO1B 1UDOA 4BA2B 4BA1B 1E3HA 1OYSA 3CDIA 1OYRA 5K36D 3GCMA 1UDQA 3DD6A 2C37B 2WNRA 3GMEA 3CDJA 2C39A 4OO1A 2NN6C 2BA1D 5C0XF 5JEAF 5JEAA 4AIMA 2JEAA 2C38B 4OO1D 4BA2A 4BA1A 3M85D 3U1KA 5JEAD 5C0XC 2PO0B 2BA0D 3M7ND 4IFDA 5K36C 1OYPA 3HKMA 4IFDD 1UDSA 3M85G 4NBQA 4OO1F 2JE6B 2NN6B 2NN6E 3M7NG 2PO0A 4OO1C 3B4TA 4AIDA 2PO1A 3L7ZB 2BR2B 2PNZB 5JEAC 5C0XE 2C37A 4AM3A 1UDNA 2NN6A 4IFDF 5K36B 2BA1G 5K36E 2NN6D 2C38A 4IFDC 2BR2A 2WP8B 2WNRB
chains in the Genus database with same CATH superfamily
2V2VA 1KIJA 2BA0G 3PYGA 4WUCA 3J81C 4IZJD 2UUCI 4YY3E 1B62A 4KQVA 3QT6A 3T1HE 4ISAA 2VQEI 3CWVA 1Y4UA 4DR3I 1Z0GA 4DPTA 5JEAE 5GMDA 4B3ME 2UU9I 4NXNE 5L3JA 3J80C 4HY1A 1IBKI 1Z5AA 2O1TA 4JI7E 1Z5BA 2AE8A 4MU4A 4DV1E 1RREA 4DU7A 4DV2I 3ZKBA 5LMUE 1R6LA 5EL9A 5BR8I 2LJPA 1EA6A 3T1YI 2CZ9A 2JEBA 4GQUA 1ZXMA 1NZ0A 2HHHI 1UEKA 2UXBE 3P76A 5K36F 4LFAI 4URLA 1FKAE 4JV5I 2PO1B 1UDOA 3HJCA 5IT9Q 4IZKB 3OTOE 1N36I 5A2QQ 1EI1A 4KHPI 2IOQA 3K17A 1XMQI 5DNLA 3V2UC 4J3DA 3GMEA 3CDJA 4B3SE 2C39A 4OO1A 2NPFA 1I94I 4DV6I 3ZZTA 5C0XF 5JEAF 2R42A 1YH8A 4OO1D 2BV3A 1ZM9A 3M6AA 1N32E 3U1KA 3WU3A 5C0XC 1KKHA 2CVEA 1XHKA 4LF4I 4JI4E 2BA0D 3UHMA 5IT9C 3M7ND 5A2QC 1FI4A 4DUYI 2VF3A 4FWDA 1J5EE 2XEXA 2R3VA 3M85G 1IBKE 2Z5BA 1PVGA 2JE6B 2NN6B 2IOPA 4YY3I 3LTOA 4EMDA 3T1HI 2CGEA 2PO1A 2BM1A 4IZJB 4NXNI 4Z7CA 3T1YE 4RPFA 1FJGI 4JI7I 2AJ4A 2F1DA 1Z0TA 3WU4A 4AM3A 4DV1I 1UDNA 3PS1A 2V2ZA 1MG7A 2OI2A 4R1FA 4KHPE 4AQYE 4DV0E 4X62E 4DR2E 4DR1E 2UXBI 3JAMC 4JI2E 4DU8A 4OO1E 2F4VE 1ZM2A 4DR5E 4USKA 1B63A 2ZITA 2JEBB 1IBME 4LFCI 1R6MA 4X64E 4X66I 4B3SI 2JE6A 1Z0CA 4JYAE 1ELOA 4DUYE 4IFDB 1FWKA 3NZKA 4IS9A 4DV4E 2PO2A 2PNLA 1N32I 4FW4A 5EKWA 2IERA 4WUBA 2C39B 4OO1B 4JI4I 1N34E 4FW7A 3ZKDA 4DPUA 2Z5CB 2GO4A 3QT8A 1ZXNA 1J5EI 1Z5CA 1A6FA 5FLXQ 1OYRA 3GCMA 1FJGE 3Q6NA 3DD6A 1FWLA 4FWHA 4LF9E 3WU5A 1HR0E 4PRVA 2GO3A 1ZM3A 4XTJA 4DR7E 1XXEA 4QNJA 4FW3A 4AIMA 2PNMA 2Z5BB 3PYDA 1P42A 3ZZUA 4DV5E 4LF8E 4FW9A 5IWAI 2J7KA 4LF7E 3B78A 1KVKA 4IFDA 3QT5A 2HK2A 4OX9E 1RHYA 5K36C 1OYPA 3B8HA 1H7UA 4AQYI 4LFCE 4DV0I 4X62I 4DR2I 4IFDD 4JI5E 4DR1I 4NBQA 4X66E 2UXCE 4OKGA 1XNQE 4JI2I 3QT7A 5FWKA 2Q2EB 4DPWA 2NN6E 2V8PA 2F4VI 2Z5CA 2PO0A 4PU9A 3ZM7A 4X65E 4DR5I 2UUAE 2E1RA 4AIDA 3L7ZB 2EFGA 1HNWE 4MQYA 4DXLA 1IBMI 4HXZA 1XMOE 5JEAC 4X64I 4LF6I 3LNUA 4JYAI 4YHHI 4DV4I 2X36A 4FN5A 5DROA 2BR2A 2Z5EA 1RR9A 2BM0A 1YHCA 2V2QA 2WNRB 1N34I 1XNRI 2O3ZA 2PO2B 2GS8A 3KRNA 3H1CA 4LF9I 1HR0I 2NN6F 4Z7YA 5IWAE 1HNZE 2DEIA 4FW5A 3GLLA 5LL6R 4DR7I 1NHIA 3L7ZA 4IFDE 4GKKE 1Z0VA 4UT4A 1Z0WA 5C0XA 3P06A 2UUBE 4DV5I 4LF8I 4LCGA 5C0XD 4LF7I 1BKNA 4OX9I 3P3EA 4JI8E 4HACA 1H73A 1E3HA 3CDIA 3GONA 1MX0A 4LF6E 4JI5I 4PRXA 2UXCI 1XNQI 4NXME 4N3OA 5DRPA 2C37B 2WNRA 4GKJE 2HKJA 3D4JA 4JG4A 4X65I 3LPSA 4YHHE 2UUAI 3PYEA 1HNWI 2ZM6E 1XMOI 4BA2A 3J81Q 4BA1A 3PS2A 4LFBE 4DR4E 3M85D 2J65A 3Q1QA 4JI3E 4B3RI 1XNRE 2PO0B 4B3TE 3WU6A 1Z0BA 3HKMA 4MU0A 2V34A 3PRYA 4QNKA 3ZZ0A 4OO1F 4DPYA 2UXDE 5LMNE 3M7NG 1Y4SA 4OO1C 2HKEA 1Z59A 1NHJA 4DUZE 2BR2B 4LCHA 2PNZB 4LF5E 3PYFA 4DV7E 5C0XE 2DEJA 1N33I 1HNZI 1PIEA 2HFSA 2C37A 3H4LA 5FLXC 1D6TA 5K36B 2BA1G 1VISA 4GKKI 2X7IA 4JI1I 2UUBI 4WUDA 4LPFA 1OJ4A 3PS3A 2E5LE 3K85A 1IBLI 4HYMA 1Y5YA 4JI8I 5DNXA 4DV3I 2O1UA 2A2CA 5JEAB 1Y6ZA 5C0XB 2JEAB 4K0KE 3P3CA 4NXMI 4GKJI 4MU3A 4LCFA 1HNXE 1H72C 2WP8A 1MU5A 4B3RE 1H74A 4MDTA 1E3PA 4HACB 4JI0E 2ZM6I 4MYUA 4I3HA 1S16A 5ELWA 2PNZA 3J7AM 4LFBI 4DR4I 1WUUA 4OZEA 2VQFI 3B82A 4JI3I 4DR6E 1N0VC 4JI6I 1VI7A 4M1KA 4B3TI 5K36A 2UUCE 1HK7A 4BA2B 1USUA 4BA1B 1OYSA 2VQEE 4DR3E 5K36D 2WW4A 1N33E 2UU9E 1UDQA 2A2DA 1Z0EA 3J7AG 2IESA 4P7AA 4U3BA 2UXDI 1NHHA 5LMNI 2JT2A 2NN6C 3F0NA 2ZBKB 4DUZI 4DV2E 2BA1D 4LF5I 5JEAA 2JEAA 2C38B 4JI1E 3JAMQ 4U3DA 4DV7I 2GQ0A 3Q6MA 4B3MI 4IZKA 1S4EA 5BR8E 1K47A 1USVA 5JEAD 2CG9A 5GMEA 1IBLE 2HK3A 2VESA 1Y60A 2HHHE 4DV3E 1QZRA 1PKPA 4MYTA 4UTGA 4LFAE 4JV5E 1N0UA 4USMA 5LMUI 1N36E 1UDSA 1FNMA 5DRRA 2E5LI 1XMQE 1ZM4A 4P52A 4DPXA 1I94E 1H7SA 3B4TA 4DV6E 1DARA 4ZVIA 4K0KI 2O1WA 4FWGA 3OTOI 2HFUA 1HNXI 2VQFE 3K1JA 5DRQA 4LOMA 3U1YA 4JI6E 4LF4E 2NN6A 3J80Q 4IFDF 1KTVA 4JI0I 3P3GA 5K36E 4FW6A 2NN6D 2C38A 4IFDC 2O1VA 4ED4A 4MU1A 2WP8B 4IZJA 4DR6I 3HULA 3V5RA 1U2RA
chains in the Genus database with same CATH topology
2BA0G 4OO1E 2PO2B 5JEAB 5C0XB 2JEAB 3KRNA 5JEAE 3H1CA 2JEBB 1R6MA 2WP8A 2NN6F 2JE6A 3GLLA 1E3PA 4IFDB 3L7ZA 4IFDE 2PNZA 2PO2A 5C0XA 1R6LA 2JEBA 2C39B 4OO1B 5C0XD 5K36F 5K36A 2PO1B 1UDOA 4BA2B 4BA1B 1E3HA 1OYSA 3CDIA 1OYRA 5K36D 3GCMA 1UDQA 3DD6A 2C37B 2WNRA 3GMEA 3CDJA 2C39A 4OO1A 2NN6C 2BA1D 5C0XF 5JEAF 5JEAA 4AIMA 2JEAA 2C38B 4OO1D 4BA2A 4BA1A 3M85D 3U1KA 5JEAD 5C0XC 2PO0B 2BA0D 3M7ND 4IFDA 5K36C 1OYPA 3HKMA 4IFDD 1UDSA 3M85G 4NBQA 4OO1F 2JE6B 2NN6B 2NN6E 3M7NG 2PO0A 4OO1C 3B4TA 4AIDA 2PO1A 3L7ZB 2BR2B 2PNZB 5JEAC 5C0XE 2C37A 4AM3A 1UDNA 2NN6A 4IFDF 5K36B 2BA1G 5K36E 2NN6D 2C38A 4IFDC 2BR2A 2WP8B 2WNRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 G;  4OO1 E;  2PO2 B;  5JEA B;  5C0X B;  2JEA B;  3KRN A;  5JEA E;  3H1C A;  2JEB B;  1R6M A;  2WP8 A;  2NN6 F;  2JE6 A;  3GLL A;  1E3P A;  4IFD B;  3L7Z A;  4IFD E;  2PNZ A;  2PO2 A;  5C0X A;  1R6L A;  2JEB A;  2C39 B;  4OO1 B;  5C0X D;  5K36 F;  5K36 A;  2PO1 B;  1UDO A;  4BA2 B;  4BA1 B;  1E3H A;  1OYS A;  3CDI A;  1OYR A;  5K36 D;  3GCM A;  1UDQ A;  3DD6 A;  2C37 B;  2WNR A;  3GME A;  3CDJ A;  2C39 A;  4OO1 A;  2NN6 C;  2BA1 D;  5C0X F;  5JEA F;  5JEA A;  4AIM A;  2JEA A;  2C38 B;  4OO1 D;  4BA2 A;  4BA1 A;  3M85 D;  3U1K A;  5JEA D;  5C0X C;  2PO0 B;  2BA0 D;  3M7N D;  4IFD A;  5K36 C;  1OYP A;  3HKM A;  4IFD D;  1UDS A;  3M85 G;  4NBQ A;  4OO1 F;  2JE6 B;  2NN6 B;  2NN6 E;  3M7N G;  2PO0 A;  4OO1 C;  3B4T A;  4AID A;  2PO1 A;  3L7Z B;  2BR2 B;  2PNZ B;  5JEA C;  5C0X E;  2C37 A;  4AM3 A;  1UDN A;  2NN6 A;  4IFD F;  5K36 B;  2BA1 G;  5K36 E;  2NN6 D;  2C38 A;  4IFD C;  2BR2 A;  2WP8 B;  2WNR B; 
#chains in the Genus database with same CATH topology
 2V2V A;  1KIJ A;  2BA0 G;  3PYG A;  4WUC A;  3J81 C;  4IZJ D;  2UUC I;  4YY3 E;  1B62 A;  4KQV A;  3QT6 A;  3T1H E;  4ISA A;  2VQE I;  3CWV A;  1Y4U A;  4DR3 I;  1Z0G A;  4DPT A;  5JEA E;  5GMD A;  4B3M E;  2UU9 I;  4NXN E;  5L3J A;  3J80 C;  4HY1 A;  1IBK I;  1Z5A A;  2O1T A;  4JI7 E;  1Z5B A;  2AE8 A;  4MU4 A;  4DV1 E;  1RRE A;  4DU7 A;  4DV2 I;  3ZKB A;  5LMU E;  1R6L A;  5EL9 A;  5BR8 I;  2LJP A;  1EA6 A;  3T1Y I;  2CZ9 A;  2JEB A;  4GQU A;  1ZXM A;  1NZ0 A;  2HHH I;  1UEK A;  2UXB E;  3P76 A;  5K36 F;  4LFA I;  4URL A;  1FKA E;  4JV5 I;  2PO1 B;  1UDO A;  3HJC A;  5IT9 Q;  4IZK B;  3OTO E;  1N36 I;  5A2Q Q;  1EI1 A;  4KHP I;  2IOQ A;  3K17 A;  1XMQ I;  5DNL A;  3V2U C;  4J3D A;  3GME A;  3CDJ A;  4B3S E;  2C39 A;  4OO1 A;  2NPF A;  1I94 I;  4DV6 I;  3ZZT A;  5C0X F;  5JEA F;  2R42 A;  1YH8 A;  4OO1 D;  2BV3 A;  1ZM9 A;  3M6A A;  1N32 E;  3U1K A;  3WU3 A;  5C0X C;  1KKH A;  2CVE A;  1XHK A;  4LF4 I;  4JI4 E;  2BA0 D;  3UHM A;  5IT9 C;  3M7N D;  5A2Q C;  1FI4 A;  4DUY I;  2VF3 A;  4FWD A;  1J5E E;  2XEX A;  2R3V A;  3M85 G;  1IBK E;  2Z5B A;  1PVG A;  2JE6 B;  2NN6 B;  2IOP A;  4YY3 I;  3LTO A;  4EMD A;  3T1H I;  2CGE A;  2PO1 A;  2BM1 A;  4IZJ B;  4NXN I;  4Z7C A;  3T1Y E;  4RPF A;  1FJG I;  4JI7 I;  2AJ4 A;  2F1D A;  1Z0T A;  3WU4 A;  4AM3 A;  4DV1 I;  1UDN A;  3PS1 A;  2V2Z A;  1MG7 A;  2OI2 A;  4R1F A;  4KHP E;  4AQY E;  4DV0 E;  4X62 E;  4DR2 E;  4DR1 E;  2UXB I;  3JAM C;  4JI2 E;  4DU8 A;  4OO1 E;  2F4V E;  1ZM2 A;  4DR5 E;  4USK A;  1B63 A;  2ZIT A;  2JEB B;  1IBM E;  4LFC I;  1R6M A;  4X64 E;  4X66 I;  4B3S I;  2JE6 A;  1Z0C A;  4JYA E;  1ELO A;  4DUY E;  4IFD B;  1FWK A;  3NZK A;  4IS9 A;  4DV4 E;  2PO2 A;  2PNL A;  1N32 I;  4FW4 A;  5EKW A;  2IER A;  4WUB A;  2C39 B;  4OO1 B;  4JI4 I;  1N34 E;  4FW7 A;  3ZKD A;  4DPU A;  2Z5C B;  2GO4 A;  3QT8 A;  1ZXN A;  1J5E I;  1Z5C A;  1A6F A;  5FLX Q;  1OYR A;  3GCM A;  1FJG E;  3Q6N A;  3DD6 A;  1FWL A;  4FWH A;  4LF9 E;  3WU5 A;  1HR0 E;  4PRV A;  2GO3 A;  1ZM3 A;  4XTJ A;  4DR7 E;  1XXE A;  4QNJ A;  4FW3 A;  4AIM A;  2PNM A;  2Z5B B;  3PYD A;  1P42 A;  3ZZU A;  4DV5 E;  4LF8 E;  4FW9 A;  5IWA I;  2J7K A;  4LF7 E;  3B78 A;  1KVK A;  4IFD A;  3QT5 A;  2HK2 A;  4OX9 E;  1RHY A;  5K36 C;  1OYP A;  3B8H A;  1H7U A;  4AQY I;  4LFC E;  4DV0 I;  4X62 I;  4DR2 I;  4IFD D;  4JI5 E;  4DR1 I;  4NBQ A;  4X66 E;  2UXC E;  4OKG A;  1XNQ E;  4JI2 I;  3QT7 A;  5FWK A;  2Q2E B;  4DPW A;  2NN6 E;  2V8P A;  2F4V I;  2Z5C A;  2PO0 A;  4PU9 A;  3ZM7 A;  4X65 E;  4DR5 I;  2UUA E;  2E1R A;  4AID A;  3L7Z B;  2EFG A;  1HNW E;  4MQY A;  4DXL A;  1IBM I;  4HXZ A;  1XMO E;  5JEA C;  4X64 I;  4LF6 I;  3LNU A;  4JYA I;  4YHH I;  4DV4 I;  2X36 A;  4FN5 A;  5DRO A;  2BR2 A;  2Z5E A;  1RR9 A;  2BM0 A;  1YHC A;  2V2Q A;  2WNR B;  1N34 I;  1XNR I;  2O3Z A;  2PO2 B;  2GS8 A;  3KRN A;  3H1C A;  4LF9 I;  1HR0 I;  2NN6 F;  4Z7Y A;  5IWA E;  1HNZ E;  2DEI A;  4FW5 A;  3GLL A;  5LL6 R;  4DR7 I;  1NHI A;  3L7Z A;  4IFD E;  4GKK E;  1Z0V A;  4UT4 A;  1Z0W A;  5C0X A;  3P06 A;  2UUB E;  4DV5 I;  4LF8 I;  4LCG A;  5C0X D;  4LF7 I;  1BKN A;  4OX9 I;  3P3E A;  4JI8 E;  4HAC A;  1H73 A;  1E3H A;  3CDI A;  3GON A;  1MX0 A;  4LF6 E;  4JI5 I;  4PRX A;  2UXC I;  1XNQ I;  4NXM E;  4N3O A;  5DRP A;  2C37 B;  2WNR A;  4GKJ E;  2HKJ A;  3D4J A;  4JG4 A;  4X65 I;  3LPS A;  4YHH E;  2UUA I;  3PYE A;  1HNW I;  2ZM6 E;  1XMO I;  4BA2 A;  3J81 Q;  4BA1 A;  3PS2 A;  4LFB E;  4DR4 E;  3M85 D;  2J65 A;  3Q1Q A;  4JI3 E;  4B3R I;  1XNR E;  2PO0 B;  4B3T E;  3WU6 A;  1Z0B A;  3HKM A;  4MU0 A;  2V34 A;  3PRY A;  4QNK A;  3ZZ0 A;  4OO1 F;  4DPY A;  2UXD E;  5LMN E;  3M7N G;  1Y4S A;  4OO1 C;  2HKE A;  1Z59 A;  1NHJ A;  4DUZ E;  2BR2 B;  4LCH A;  2PNZ B;  4LF5 E;  3PYF A;  4DV7 E;  5C0X E;  2DEJ A;  1N33 I;  1HNZ I;  1PIE A;  2HFS A;  2C37 A;  3H4L A;  5FLX C;  1D6T A;  5K36 B;  2BA1 G;  1VIS A;  4GKK I;  2X7I A;  4JI1 I;  2UUB I;  4WUD A;  4LPF A;  1OJ4 A;  3PS3 A;  2E5L E;  3K85 A;  1IBL I;  4HYM A;  1Y5Y A;  4JI8 I;  5DNX A;  4DV3 I;  2O1U A;  2A2C A;  5JEA B;  1Y6Z A;  5C0X B;  2JEA B;  4K0K E;  3P3C A;  4NXM I;  4GKJ I;  4MU3 A;  4LCF A;  1HNX E;  1H72 C;  2WP8 A;  1MU5 A;  4B3R E;  1H74 A;  4MDT A;  1E3P A;  4HAC B;  4JI0 E;  2ZM6 I;  4MYU A;  4I3H A;  1S16 A;  5ELW A;  2PNZ A;  3J7A M;  4LFB I;  4DR4 I;  1WUU A;  4OZE A;  2VQF I;  3B82 A;  4JI3 I;  4DR6 E;  1N0V C;  4JI6 I;  1VI7 A;  4M1K A;  4B3T I;  5K36 A;  2UUC E;  1HK7 A;  4BA2 B;  1USU A;  4BA1 B;  1OYS A;  2VQE E;  4DR3 E;  5K36 D;  2WW4 A;  1N33 E;  2UU9 E;  1UDQ A;  2A2D A;  1Z0E A;  3J7A G;  2IES A;  4P7A A;  4U3B A;  2UXD I;  1NHH A;  5LMN I;  2JT2 A;  2NN6 C;  3F0N A;  2ZBK B;  4DUZ I;  4DV2 E;  2BA1 D;  4LF5 I;  5JEA A;  2JEA A;  2C38 B;  4JI1 E;  3JAM Q;  4U3D A;  4DV7 I;  2GQ0 A;  3Q6M A;  4B3M I;  4IZK A;  1S4E A;  5BR8 E;  1K47 A;  1USV A;  5JEA D;  2CG9 A;  5GME A;  1IBL E;  2HK3 A;  2VES A;  1Y60 A;  2HHH E;  4DV3 E;  1QZR A;  1PKP A;  4MYT A;  4UTG A;  4LFA E;  4JV5 E;  1N0U A;  4USM A;  5LMU I;  1N36 E;  1UDS A;  1FNM A;  5DRR A;  2E5L I;  1XMQ E;  1ZM4 A;  4P52 A;  4DPX A;  1I94 E;  1H7S A;  3B4T A;  4DV6 E;  1DAR A;  4ZVI A;  4K0K I;  2O1W A;  4FWG A;  3OTO I;  2HFU A;  1HNX I;  2VQF E;  3K1J A;  5DRQ A;  4LOM A;  3U1Y A;  4JI6 E;  4LF4 E;  2NN6 A;  3J80 Q;  4IFD F;  1KTV A;  4JI0 I;  3P3G A;  5K36 E;  4FW6 A;  2NN6 D;  2C38 A;  4IFD C;  2O1V A;  4ED4 A;  4MU1 A;  2WP8 B;  4IZJ A;  4DR6 I;  3HUL A;  3V5R A;  1U2R A; 
#chains in the Genus database with same CATH homology
 2BA0 G;  4OO1 E;  2PO2 B;  5JEA B;  5C0X B;  2JEA B;  3KRN A;  5JEA E;  3H1C A;  2JEB B;  1R6M A;  2WP8 A;  2NN6 F;  2JE6 A;  3GLL A;  1E3P A;  4IFD B;  3L7Z A;  4IFD E;  2PNZ A;  2PO2 A;  5C0X A;  1R6L A;  2JEB A;  2C39 B;  4OO1 B;  5C0X D;  5K36 F;  5K36 A;  2PO1 B;  1UDO A;  4BA2 B;  4BA1 B;  1E3H A;  1OYS A;  3CDI A;  1OYR A;  5K36 D;  3GCM A;  1UDQ A;  3DD6 A;  2C37 B;  2WNR A;  3GME A;  3CDJ A;  2C39 A;  4OO1 A;  2NN6 C;  2BA1 D;  5C0X F;  5JEA F;  5JEA A;  4AIM A;  2JEA A;  2C38 B;  4OO1 D;  4BA2 A;  4BA1 A;  3M85 D;  3U1K A;  5JEA D;  5C0X C;  2PO0 B;  2BA0 D;  3M7N D;  4IFD A;  5K36 C;  1OYP A;  3HKM A;  4IFD D;  1UDS A;  3M85 G;  4NBQ A;  4OO1 F;  2JE6 B;  2NN6 B;  2NN6 E;  3M7N G;  2PO0 A;  4OO1 C;  3B4T A;  4AID A;  2PO1 A;  3L7Z B;  2BR2 B;  2PNZ B;  5JEA C;  5C0X E;  2C37 A;  4AM3 A;  1UDN A;  2NN6 A;  4IFD F;  5K36 B;  2BA1 G;  5K36 E;  2NN6 D;  2C38 A;  4IFD C;  2BR2 A;  2WP8 B;  2WNR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...