1Z0WA

Crystal structure of a. fulgidus lon proteolytic domain at 1.2a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 64
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0wA00
4DR7E 3V2UC 4DV7E 2UXBI 4MYTA 4WUDA 4GKKE 1Z0GA 5FLXQ 2UUBE 4DPTA 4I3HA 3K1JA 1FNMA 1N0VC 4JI4I 1IBLI 1Z5CA 1Z5BA 5IT9C 3J7AG 4USMA 4LFCE 4UT4A 4FWGA 3J81C 4LF4E 4JI7E 4XTJA 4DPWA 3M6AA 5LL6R 3JAMC 4X64E 4DV5E 4FWHA 1MX0A 3ZM7A 1Z0BA 3GONA 4JI0E 3PYFA 1EI1A 2Q2EB 4X62E 5LMNI 5IT9Q 2R3VA 2EFGA 4DR5I 4JV5E 4LF6E 4Z7CA 5A2QQ 4LF8E 1HR0I 4LFAI 1BKNA 1MU5A 4JYAE 3ZZUA 3H4LA 1S16A 1N0UA 2VQFE 3CWVA 2F4VI 4DPUA 1FWLA 5GMEA 4B3RE 1ELOA 1NZ0A 4GKJI 3OTOE 1HNWI 1KIJA 2E5LI 1J5EE 4DV0I 1U2RA 2HHHI 5BR8E 2ZBKB 4K0KE 4DV6E 1XNQE 1Z0TA 4WUCA 1H72C 1VISA 2V8PA 4ED4A 4DR1E 1NHHA 2J7KA 4FWDA 4OX9I 2ZM6I 4DR2I 1PKPA 3PYDA 4PU9A 4NXMI 4HXZA 4LFBE 4JI1I 4B3TE 4USKA 4WUBA 1FKAE 1HNZI 3T1HI 4DUZI 3ZKBA 2E1RA 4Z7YA 1N34I 2HK3A 3QT5A 4AQYI 1IBKI 2CZ9A 4JI8E 4ZVIA 1I94E 2UUAE 3Q1QA 3PYEA 4YHHE 4DUYE 2AJ4A 1ZM3A 3LTOA 2VQEE 1FJGE 4X66I 4DPXA 2V2QA 2DEIA 1Z0WA 1N33I 3QT6A 4NXNI 1Z59A 1XHKA 1A6FA 4JI4E 4JI6I 1IBLE 3J80Q 4DV3I 1KVKA 1XNRI 3WU4A 4JI3I 2X7IA 1MG7A 5A2QC 2UUCI 2HFUA 2UUBI 4B3MI 3WU3A 3T1YE 2GS8A 2HKEA 1H73A 4UTGA 5LMNE 4B3SI 1IBMI 2UXDI 4HACA 1ZM2A 4DR6I 1HNXI 1H74A 2BM0A 4JI5E 1WUUA 4R1FA 4LFAE 3WU5A 2BM1A 4DU7A 1XMOE 4HACB 1EA6A 3HULA 2F4VE 1PIEA 4YY3I 5LMUI 4X62I 2X36A 4GKJE 1HNWE 2UXCI 4PRXA 2E5LE 4M1KA 4DV0E 4DR3I 4JI2I 2HHHE 4LF9I 1XMQI 1ZXMA 1OJ4A 3V5RA 4OX9E 2ZM6E 2HFSA 2UU9I 5GMDA 4DV4E 4JI1E 2WW4A 1FWKA 1Z0EA 1H7UA 4DV6I 3T1HE 4DUZE 4DV2E 1N36I 4PRVA 4DR4E 1N32I 1Z0VA 5IWAI 2XEXA 4AQYE 1IBKE 3B82A 4HYMA 1ZM9A 1RR9A 4LF7I 4X66E 4DPYA 3J80C 4DV1E 1B62A 4P52A 2UXBE 2HKJA 1N33E 4LF5I 3WU6A 4JI8I 4NXNE 4KHPI 2LJPA 4MYUA 2NPFA 4X65I 5L3JA 2HK2A 4JI6E 3QT8A 3B78A 1XNRE 1FJGI 4DR7I 4JI3E 4DV7I 4DU8A 2UUCE 4GKKI 4B3ME 1NHJA 3J7AM 4B3SE 1Z0CA 1IBME 2UXDE 2DEJA 4JG4A 4DR5E 4DR6E 4HY1A 1HNXE 3K17A 4LFCI 1H7SA 4EMDA 1HR0E 1KKHA 3F0NA 4LF4I 3B8HA 4JI7I 4KQVA 4X64I 3T1YI 2OI2A 4DV5I 3ZKDA 4JI0I 4YY3E 5LMUE 2V2ZA 2UXCE 3ZZ0A 2VF3A 4DR3E 1QZRA 4JI2E 3J81Q 4JV5I 4LF6I 4JI5I 4LF8I 4LF9E 2V2VA 3JAMQ 1XMOI 1XMQE 2A2CA 4P7AA 4JYAI 2VQFI 4B3RI 1UEKA 3OTOI 1ZM4A 4DR2E 4FW9A 1J5EI 2UU9E 4NXME 2R42A 1RREA 1KTVA 5BR8I 4K0KI 1XNQI 3D4JA 4FN5A 1N36E 1HNZE 1B63A 3ZZTA 1N32E 4DR1I 1FI4A 1S4EA 1N34E 5IWAE 1DARA 1K47A 4DXLA 4DV4I 4LFBI 3LNUA 1ZXNA 4LF7E 4B3TI 4DV2I 4DR4I 1D6TA 2V34A 2ZITA 4LF5E 2A2DA 3PYGA 1Z5AA 5FLXC 4KHPE 4X65E 3LPSA 1PVGA 1I94I 2UUAI 1NHIA 4YHHI 4DUYI 4RPFA 4DV3E 2BV3A 4URLA 3QT7A 2VQEI 4DV1I
chains in the Genus database with same CATH superfamily
4DR7E 3V2UC 4DV7E 1YH8A 2UXBI 3GLLA 4MYTA 4WUDA 4GKKE 2VESA 1Z0GA 5FLXQ 2UUBE 5JEAF 4DPTA 4I3HA 3PS2A 4OO1E 3K1JA 1FNMA 1N0VC 1UDOA 4JI4I 1IBLI 2Z5BB 1Z5CA 4OO1C 1Z5BA 5IT9C 3J7AG 4IFDD 4USMA 4LFCE 4UT4A 4FWGA 3J81C 4LF4E 4JI7E 4XTJA 4DPWA 1Y6ZA 3M6AA 5LL6R 3JAMC 4X64E 3KRNA 4IFDF 4DV5E 4FWHA 1MX0A 3ZM7A 1Z0BA 3GONA 2JEBA 4JI0E 3PYFA 4AIDA 1EI1A 3M85G 2Q2EB 3M7ND 4X62E 5LMNI 5IT9Q 2R3VA 2PO1B 2EFGA 4URLA 5ELWA 4DR5I 5C0XF 4JV5E 4LF6E 2JEBB 4Z7CA 5A2QQ 4LF8E 1HR0I 3P06A 4LFAI 1BKNA 5K36D 1MU5A 4JYAE 3ZZUA 3H4LA 4FW3A 1S16A 1N0UA 4OKGA 2VQFE 3CWVA 2F4VI 3CDJA 4DPUA 1FWLA 5GMEA 4B3RE 2BR2A 2JEAA 2BA1G 1ELOA 1NZ0A 4GKJI 3OTOE 1HNWI 1KIJA 2E5LI 1J5EE 4DV0I 2GO3A 2NN6E 1U2RA 2BR2B 4OO1F 1USUA 2HHHI 2C38B 5BR8E 2ZBKB 2GO4A 2NN6C 4K0KE 4DV6E 1XNQE 1Z0TA 5JEAE 4WUCA 4IZJA 1YHCA 1H72C 1VISA 2GQ0A 4FW6A 2V8PA 4ED4A 4DR1E 1NHHA 2J7KA 4FWDA 5DNLA 5JEAC 4OX9I 2BA1D 2ZM6I 4DR2I 1PKPA 2WNRA 3PYDA 4IZJB 4PU9A 4NXMI 4HXZA 4LFBE 4JI1I 3L7ZA 5C0XB 2JT2A 4B3TE 1R6LA 4IFDE 2WNRB 4USKA 4WUBA 1FKAE 2PNZB 1HNZI 3T1HI 4DUZI 3ZKBA 1E3HA 4MQYA 4IFDC 2E1RA 3GCMA 3L7ZB 4Z7YA 1N34I 2HK3A 1OYPA 3QT5A 4AQYI 5C0XE 1IBKI 4OO1A 2CZ9A 4JI8E 3P76A 4GQUA 1E3PA 3P3GA 4ZVIA 2O1TA 4LOMA 3UHMA 1I94E 2UUAE 3Q1QA 3PYEA 4YHHE 4DUYE 2AJ4A 1ZM3A 4OO1B 4AIMA 3LTOA 2VQEE 1FJGE 4X66I 4DPXA 2V2QA 2DEIA 4BA2A 4LCFA 4FW5A 1Z0WA 2C37B 1N33I 2Z5BA 3P3CA 3QT6A 4NXNI 1Z59A 1XHKA 1A6FA 3H1CA 4BA2B 4JI4E 4JI6I 5FWKA 1IBLE 3J80Q 3B4TA 1UDNA 4ISAA 4DV3I 1KVKA 1XNRI 3DD6A 3WU4A 4JI3I 4MU4A 2PO2A 2X7IA 2AE8A 1MG7A 5A2QC 1RHYA 2HFUA 2UUCI 2UUBI 4B3MI 2PO1A 4BA1A 3NZKA 3WU3A 3T1YE 2GS8A 2HKEA 1H73A 4UTGA 5LMNE 2IOPA 2PO2B 4B3SI 3GMEA 4LPFA 1IBMI 2O1WA 1VI7A 2UXDI 1Y60A 4HACA 1ZM2A 2Z5EA 2NN6A 4BA1B 4DR6I 1HNXI 2PNMA 1H74A 2BM0A 4JI5E 1WUUA 4R1FA 4LFAE 3WU5A 2BM1A 4DU7A 1XMOE 4HACB 5DRPA 5JEAA 2NN6B 1EA6A 3HULA 2F4VE 4N3OA 4J3DA 1PIEA 2JE6A 4YY3I 5LMUI 4X62I 2X36A 5K36F 4GKJE 2C38A 1HNWE 2UXCI 5DRQA 5JEAB 3M85D 4PRXA 2E5LE 4M1KA 4DV0E 4DR3I 4JI2I 2JE6B 2HHHE 4LF9I 5DROA 1XMQI 4IFDA 1ZXMA 1OJ4A 2O1VA 3V5RA 4IS9A 2F1DA 4IFDB 4OX9E 5C0XA 2ZM6E 1OYSA 2HFSA 2IERA 2UU9I 2PNZA 5GMDA 4DV4E 4JI1E 2WW4A 1FWKA 1Z0EA 1UDQA 1H7UA 4DV6I 3T1HE 4DUZE 4FW4A 4DV2E 1N36I 4PRVA 4DR4E 1N32I 1Z0VA 5IWAI 2XEXA 4AQYE 1IBKE 3B82A 4OZEA 4IZKA 4HYMA 5K36B 1ZM9A 1USVA 5EKWA 1RR9A 4AM3A 1Y4SA 2C39A 2C37A 4LF7I 4IZKB 4X66E 4DPYA 3J80C 4DV1E 3U1YA 4MDTA 1B62A 4P52A 5K36E 2UXBE 2IOQA 2HKJA 2C39B 1N33E 4LF5I 3WU6A 4JI8I 5K36C 4NXNE 3Q6MA 4KHPI 2LJPA 4MYUA 2NPFA 4X65I 5L3JA 2HK2A 4JI6E 4QNJA 2J65A 1UDSA 5DRRA 4QNKA 1R6MA 3B78A 3K85A 3QT8A 1XNRE 1FJGI 4DR7I 4JI3E 4MU1A 4NBQA 4DV7I 4DU8A 2WP8A 2UUCE 4GKKI 4B3ME 1NHJA 5EL9A 3M7NG 3J7AM 3P3EA 4B3SE 2WP8B 1Z0CA 3PRYA 4U3DA 1IBME 2UXDE 2DEJA 2CG9A 4JG4A 4DR5E 4DR6E 4HY1A 1HNXE 3K17A 4LFCI 2CVEA 1H7SA 4EMDA 1KKHA 4IZJD 1HR0E 3F0NA 4LF4I 3B8HA 4JI7I 4KQVA 4X64I 3T1YI 2OI2A 4DV5I 5C0XD 3ZKDA 4JI0I 4YY3E 5LMUE 2V2ZA 2UXCE 5DNXA 3ZZ0A 2VF3A 4DR3E 4MU3A 1QZRA 4JI2E 2Z5CA 3J81Q 4LF6I 4JV5I 4LCHA 1OYRA 4JI5I 4LF8I 3Q6NA 2V2VA 3JAMQ 1XMOI 4LF9E 1XMQE 2A2CA 4P7AA 4JYAI 2VQFI 2Z5CB 3HJCA 4B3RI 1UEKA 4OO1D 1HK7A 3OTOI 1ZM4A 4DR2E 4FW9A 1J5EI 3HKMA 2UU9E 4NXME 2R42A 3PS3A 1RREA 1KTVA 2JEAB 1P42A 5BR8I 4K0KI 1Y5YA 1XNQI 3D4JA 4FN5A 1N36E 1HNZE 1B63A 2PNLA 3ZZTA 5K36A 3PS1A 1N32E 4DR1I 2PO0A 4FW7A 1FI4A 1S4EA 1N34E 2BA0G 5IWAE 1DARA 1K47A 4DXLA 4DV4I 4LFBI 2PO0B 1Y4UA 3LNUA 1ZXNA 4LF7E 4B3TI 4DV2I 4DR4I 4LCGA 1D6TA 3CDIA 2V34A 4U3BA 2IESA 2O1UA 2O3ZA 2ZITA 4LF5E 2A2DA 3PYGA 1Z5AA 2BA0D 5FLXC 4KHPE 2NN6D 4X65E 3U1KA 1XXEA 2CGEA 1PVGA 3LPSA 5C0XC 1I94I 4MU0A 2UUAI 1NHIA 4YHHI 4DUYI 4RPFA 4DV3E 2BV3A 2NN6F 3QT7A 5JEAD 2VQEI 4DV1I
chains in the Genus database with same CATH topology
4DR7E 3V2UC 4DV7E 2UXBI 4MYTA 4WUDA 4GKKE 1Z0GA 5FLXQ 2UUBE 4DPTA 4I3HA 3K1JA 1FNMA 1N0VC 4JI4I 1IBLI 2Z5BB 1Z5CA 1Z5BA 5IT9C 3J7AG 4USMA 4LFCE 4UT4A 4FWGA 3J81C 4LF4E 4JI7E 4XTJA 4DPWA 1Y6ZA 3M6AA 5LL6R 3JAMC 4X64E 4DV5E 4FWHA 1MX0A 3ZM7A 1Z0BA 3GONA 4JI0E 3PYFA 1EI1A 2Q2EB 4X62E 5LMNI 5IT9Q 2R3VA 2EFGA 4DR5I 4JV5E 4LF6E 4Z7CA 5A2QQ 4LF8E 1HR0I 3P06A 4LFAI 1BKNA 1MU5A 4JYAE 3ZZUA 3H4LA 1S16A 1N0UA 2VQFE 3CWVA 2F4VI 4DPUA 1FWLA 5GMEA 4B3RE 1ELOA 1NZ0A 4GKJI 3OTOE 1HNWI 1KIJA 2E5LI 1J5EE 4DV0I 1U2RA 1USUA 2HHHI 5BR8E 2ZBKB 4K0KE 4DV6E 1XNQE 1Z0TA 4WUCA 4IZJA 1H72C 1VISA 2GQ0A 2V8PA 4ED4A 4DR1E 1NHHA 2J7KA 4FWDA 4OX9I 2ZM6I 4DR2I 1PKPA 3PYDA 4IZJB 4PU9A 4NXMI 4HXZA 4LFBE 4JI1I 4B3TE 4USKA 4WUBA 1FKAE 1HNZI 3T1HI 4DUZI 3ZKBA 2E1RA 4Z7YA 1N34I 2HK3A 3QT5A 4AQYI 1IBKI 2CZ9A 4JI8E 4ZVIA 2O1TA 1I94E 2UUAE 3Q1QA 3PYEA 4YHHE 4DUYE 2AJ4A 1ZM3A 3LTOA 2VQEE 1FJGE 4X66I 4DPXA 2V2QA 2DEIA 1Z0WA 1N33I 2Z5BA 3QT6A 4NXNI 1Z59A 1XHKA 1A6FA 4JI4E 4JI6I 5FWKA 1IBLE 3J80Q 4DV3I 1KVKA 1XNRI 3WU4A 4JI3I 2X7IA 1MG7A 5A2QC 2UUCI 2HFUA 2UUBI 4B3MI 3WU3A 3T1YE 2GS8A 2HKEA 1H73A 4UTGA 5LMNE 2IOPA 4B3SI 1IBMI 2O1WA 2UXDI 4HACA 1ZM2A 2Z5EA 4DR6I 1HNXI 2PNMA 1H74A 2BM0A 4JI5E 1WUUA 4R1FA 4LFAE 3WU5A 2BM1A 4DU7A 1XMOE 4HACB 1EA6A 3HULA 2F4VE 4N3OA 1PIEA 4YY3I 5LMUI 4X62I 2X36A 4GKJE 1HNWE 2UXCI 4PRXA 2E5LE 4M1KA 4DV0E 4DR3I 4JI2I 2HHHE 4LF9I 1XMQI 1ZXMA 1OJ4A 2O1VA 3V5RA 4OX9E 2ZM6E 2HFSA 2UU9I 5GMDA 4DV4E 4JI1E 2WW4A 1FWKA 1Z0EA 1H7UA 4DV6I 3T1HE 4DUZE 4DV2E 1N36I 4PRVA 4DR4E 1N32I 1Z0VA 5IWAI 2XEXA 4AQYE 1IBKE 3B82A 4IZKA 4HYMA 1ZM9A 1USVA 1RR9A 1Y4SA 4LF7I 4IZKB 4X66E 4DPYA 3J80C 4DV1E 1B62A 4P52A 2UXBE 2IOQA 2HKJA 1N33E 4LF5I 3WU6A 4JI8I 4NXNE 3Q6MA 4KHPI 2LJPA 4MYUA 2NPFA 4X65I 5L3JA 2HK2A 4JI6E 3QT8A 3B78A 3K85A 1XNRE 1FJGI 4DR7I 4JI3E 4DV7I 4DU8A 2UUCE 4GKKI 4B3ME 1NHJA 3J7AM 4B3SE 3PRYA 1Z0CA 1IBME 2UXDE 2DEJA 2CG9A 4JG4A 4DR5E 4DR6E 4HY1A 1HNXE 3K17A 4LFCI 1H7SA 4EMDA 1KKHA 4IZJD 1HR0E 3F0NA 4LF4I 3B8HA 4JI7I 4KQVA 4X64I 3T1YI 2OI2A 4DV5I 3ZKDA 4JI0I 4YY3E 5LMUE 2V2ZA 2UXCE 3ZZ0A 2VF3A 4DR3E 1QZRA 4JI2E 2Z5CA 3J81Q 4LF6I 4JV5I 4JI5I 4LF8I 3Q6NA 2V2VA 3JAMQ 1XMOI 4LF9E 1XMQE 2A2CA 4P7AA 4JYAI 2VQFI 2Z5CB 3HJCA 4B3RI 1UEKA 1HK7A 3OTOI 1ZM4A 4DR2E 4FW9A 1J5EI 2UU9E 4NXME 2R42A 1RREA 1KTVA 5BR8I 4K0KI 1XNQI 3D4JA 4FN5A 1N36E 1HNZE 1B63A 2PNLA 3ZZTA 1N32E 4DR1I 1FI4A 1S4EA 1N34E 5IWAE 1DARA 1K47A 4DXLA 4DV4I 4LFBI 1Y4UA 3LNUA 1ZXNA 4LF7E 4B3TI 4DV2I 4DR4I 1D6TA 2V34A 2O1UA 2ZITA 4LF5E 2A2DA 3PYGA 1Z5AA 5FLXC 4KHPE 4X65E 2CGEA 1PVGA 3LPSA 1I94I 2UUAI 1NHIA 4YHHI 4DUYI 4RPFA 4DV3E 2BV3A 4URLA 3QT7A 2VQEI 4DV1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 E;  3V2U C;  4DV7 E;  2UXB I;  4MYT A;  4WUD A;  4GKK E;  1Z0G A;  5FLX Q;  2UUB E;  4DPT A;  4I3H A;  3K1J A;  1FNM A;  1N0V C;  4JI4 I;  1IBL I;  1Z5C A;  1Z5B A;  5IT9 C;  3J7A G;  4USM A;  4LFC E;  4UT4 A;  4FWG A;  3J81 C;  4LF4 E;  4JI7 E;  4XTJ A;  4DPW A;  3M6A A;  5LL6 R;  3JAM C;  4X64 E;  4DV5 E;  4FWH A;  1MX0 A;  3ZM7 A;  1Z0B A;  3GON A;  4JI0 E;  3PYF A;  1EI1 A;  2Q2E B;  4X62 E;  5LMN I;  5IT9 Q;  2R3V A;  2EFG A;  4DR5 I;  4JV5 E;  4LF6 E;  4Z7C A;  5A2Q Q;  4LF8 E;  1HR0 I;  4LFA I;  1BKN A;  1MU5 A;  4JYA E;  3ZZU A;  3H4L A;  1S16 A;  1N0U A;  2VQF E;  3CWV A;  2F4V I;  4DPU A;  1FWL A;  5GME A;  4B3R E;  1ELO A;  1NZ0 A;  4GKJ I;  3OTO E;  1HNW I;  1KIJ A;  2E5L I;  1J5E E;  4DV0 I;  1U2R A;  2HHH I;  5BR8 E;  2ZBK B;  4K0K E;  4DV6 E;  1XNQ E;  1Z0T A;  4WUC A;  1H72 C;  1VIS A;  2V8P A;  4ED4 A;  4DR1 E;  1NHH A;  2J7K A;  4FWD A;  4OX9 I;  2ZM6 I;  4DR2 I;  1PKP A;  3PYD A;  4PU9 A;  4NXM I;  4HXZ A;  4LFB E;  4JI1 I;  4B3T E;  4USK A;  4WUB A;  1FKA E;  1HNZ I;  3T1H I;  4DUZ I;  3ZKB A;  2E1R A;  4Z7Y A;  1N34 I;  2HK3 A;  3QT5 A;  4AQY I;  1IBK I;  2CZ9 A;  4JI8 E;  4ZVI A;  1I94 E;  2UUA E;  3Q1Q A;  3PYE A;  4YHH E;  4DUY E;  2AJ4 A;  1ZM3 A;  3LTO A;  2VQE E;  1FJG E;  4X66 I;  4DPX A;  2V2Q A;  2DEI A;  1Z0W A;  1N33 I;  3QT6 A;  4NXN I;  1Z59 A;  1XHK A;  1A6F A;  4JI4 E;  4JI6 I;  1IBL E;  3J80 Q;  4DV3 I;  1KVK A;  1XNR I;  3WU4 A;  4JI3 I;  2X7I A;  1MG7 A;  5A2Q C;  2UUC I;  2HFU A;  2UUB I;  4B3M I;  3WU3 A;  3T1Y E;  2GS8 A;  2HKE A;  1H73 A;  4UTG A;  5LMN E;  4B3S I;  1IBM I;  2UXD I;  4HAC A;  1ZM2 A;  4DR6 I;  1HNX I;  1H74 A;  2BM0 A;  4JI5 E;  1WUU A;  4R1F A;  4LFA E;  3WU5 A;  2BM1 A;  4DU7 A;  1XMO E;  4HAC B;  1EA6 A;  3HUL A;  2F4V E;  1PIE A;  4YY3 I;  5LMU I;  4X62 I;  2X36 A;  4GKJ E;  1HNW E;  2UXC I;  4PRX A;  2E5L E;  4M1K A;  4DV0 E;  4DR3 I;  4JI2 I;  2HHH E;  4LF9 I;  1XMQ I;  1ZXM A;  1OJ4 A;  3V5R A;  4OX9 E;  2ZM6 E;  2HFS A;  2UU9 I;  5GMD A;  4DV4 E;  4JI1 E;  2WW4 A;  1FWK A;  1Z0E A;  1H7U A;  4DV6 I;  3T1H E;  4DUZ E;  4DV2 E;  1N36 I;  4PRV A;  4DR4 E;  1N32 I;  1Z0V A;  5IWA I;  2XEX A;  4AQY E;  1IBK E;  3B82 A;  4HYM A;  1ZM9 A;  1RR9 A;  4LF7 I;  4X66 E;  4DPY A;  3J80 C;  4DV1 E;  1B62 A;  4P52 A;  2UXB E;  2HKJ A;  1N33 E;  4LF5 I;  3WU6 A;  4JI8 I;  4NXN E;  4KHP I;  2LJP A;  4MYU A;  2NPF A;  4X65 I;  5L3J A;  2HK2 A;  4JI6 E;  3QT8 A;  3B78 A;  1XNR E;  1FJG I;  4DR7 I;  4JI3 E;  4DV7 I;  4DU8 A;  2UUC E;  4GKK I;  4B3M E;  1NHJ A;  3J7A M;  4B3S E;  1Z0C A;  1IBM E;  2UXD E;  2DEJ A;  4JG4 A;  4DR5 E;  4DR6 E;  4HY1 A;  1HNX E;  3K17 A;  4LFC I;  1H7S A;  4EMD A;  1HR0 E;  1KKH A;  3F0N A;  4LF4 I;  3B8H A;  4JI7 I;  4KQV A;  4X64 I;  3T1Y I;  2OI2 A;  4DV5 I;  3ZKD A;  4JI0 I;  4YY3 E;  5LMU E;  2V2Z A;  2UXC E;  3ZZ0 A;  2VF3 A;  4DR3 E;  1QZR A;  4JI2 E;  3J81 Q;  4JV5 I;  4LF6 I;  4JI5 I;  4LF8 I;  4LF9 E;  2V2V A;  3JAM Q;  1XMO I;  1XMQ E;  2A2C A;  4P7A A;  4JYA I;  2VQF I;  4B3R I;  1UEK A;  3OTO I;  1ZM4 A;  4DR2 E;  4FW9 A;  1J5E I;  2UU9 E;  4NXM E;  2R42 A;  1RRE A;  1KTV A;  5BR8 I;  4K0K I;  1XNQ I;  3D4J A;  4FN5 A;  1N36 E;  1HNZ E;  1B63 A;  3ZZT A;  1N32 E;  4DR1 I;  1FI4 A;  1S4E A;  1N34 E;  5IWA E;  1DAR A;  1K47 A;  4DXL A;  4DV4 I;  4LFB I;  3LNU A;  1ZXN A;  4LF7 E;  4B3T I;  4DV2 I;  4DR4 I;  1D6T A;  2V34 A;  2ZIT A;  4LF5 E;  2A2D A;  3PYG A;  1Z5A A;  5FLX C;  4KHP E;  4X65 E;  3LPS A;  1PVG A;  1I94 I;  2UUA I;  1NHI A;  4YHH I;  4DUY I;  4RPF A;  4DV3 E;  2BV3 A;  4URL A;  3QT7 A;  2VQE I;  4DV1 I; 
#chains in the Genus database with same CATH topology
 4DR7 E;  3V2U C;  4DV7 E;  1YH8 A;  2UXB I;  3GLL A;  4MYT A;  4WUD A;  4GKK E;  2VES A;  1Z0G A;  5FLX Q;  2UUB E;  5JEA F;  4DPT A;  4I3H A;  3PS2 A;  4OO1 E;  3K1J A;  1FNM A;  1N0V C;  1UDO A;  4JI4 I;  1IBL I;  2Z5B B;  1Z5C A;  4OO1 C;  1Z5B A;  5IT9 C;  3J7A G;  4IFD D;  4USM A;  4LFC E;  4UT4 A;  4FWG A;  3J81 C;  4LF4 E;  4JI7 E;  4XTJ A;  4DPW A;  1Y6Z A;  3M6A A;  5LL6 R;  3JAM C;  4X64 E;  3KRN A;  4IFD F;  4DV5 E;  4FWH A;  1MX0 A;  3ZM7 A;  1Z0B A;  3GON A;  2JEB A;  4JI0 E;  3PYF A;  4AID A;  1EI1 A;  3M85 G;  2Q2E B;  3M7N D;  4X62 E;  5LMN I;  5IT9 Q;  2R3V A;  2PO1 B;  2EFG A;  4URL A;  5ELW A;  4DR5 I;  5C0X F;  4JV5 E;  4LF6 E;  2JEB B;  4Z7C A;  5A2Q Q;  4LF8 E;  1HR0 I;  3P06 A;  4LFA I;  1BKN A;  5K36 D;  1MU5 A;  4JYA E;  3ZZU A;  3H4L A;  4FW3 A;  1S16 A;  1N0U A;  4OKG A;  2VQF E;  3CWV A;  2F4V I;  3CDJ A;  4DPU A;  1FWL A;  5GME A;  4B3R E;  2BR2 A;  2JEA A;  2BA1 G;  1ELO A;  1NZ0 A;  4GKJ I;  3OTO E;  1HNW I;  1KIJ A;  2E5L I;  1J5E E;  4DV0 I;  2GO3 A;  2NN6 E;  1U2R A;  2BR2 B;  4OO1 F;  1USU A;  2HHH I;  2C38 B;  5BR8 E;  2ZBK B;  2GO4 A;  2NN6 C;  4K0K E;  4DV6 E;  1XNQ E;  1Z0T A;  5JEA E;  4WUC A;  4IZJ A;  1YHC A;  1H72 C;  1VIS A;  2GQ0 A;  4FW6 A;  2V8P A;  4ED4 A;  4DR1 E;  1NHH A;  2J7K A;  4FWD A;  5DNL A;  5JEA C;  4OX9 I;  2BA1 D;  2ZM6 I;  4DR2 I;  1PKP A;  2WNR A;  3PYD A;  4IZJ B;  4PU9 A;  4NXM I;  4HXZ A;  4LFB E;  4JI1 I;  3L7Z A;  5C0X B;  2JT2 A;  4B3T E;  1R6L A;  4IFD E;  2WNR B;  4USK A;  4WUB A;  1FKA E;  2PNZ B;  1HNZ I;  3T1H I;  4DUZ I;  3ZKB A;  1E3H A;  4MQY A;  4IFD C;  2E1R A;  3GCM A;  3L7Z B;  4Z7Y A;  1N34 I;  2HK3 A;  1OYP A;  3QT5 A;  4AQY I;  5C0X E;  1IBK I;  4OO1 A;  2CZ9 A;  4JI8 E;  3P76 A;  4GQU A;  1E3P A;  3P3G A;  4ZVI A;  2O1T A;  4LOM A;  3UHM A;  1I94 E;  2UUA E;  3Q1Q A;  3PYE A;  4YHH E;  4DUY E;  2AJ4 A;  1ZM3 A;  4OO1 B;  4AIM A;  3LTO A;  2VQE E;  1FJG E;  4X66 I;  4DPX A;  2V2Q A;  2DEI A;  4BA2 A;  4LCF A;  4FW5 A;  1Z0W A;  2C37 B;  1N33 I;  2Z5B A;  3P3C A;  3QT6 A;  4NXN I;  1Z59 A;  1XHK A;  1A6F A;  3H1C A;  4BA2 B;  4JI4 E;  4JI6 I;  5FWK A;  1IBL E;  3J80 Q;  3B4T A;  1UDN A;  4ISA A;  4DV3 I;  1KVK A;  1XNR I;  3DD6 A;  3WU4 A;  4JI3 I;  4MU4 A;  2PO2 A;  2X7I A;  2AE8 A;  1MG7 A;  5A2Q C;  1RHY A;  2HFU A;  2UUC I;  2UUB I;  4B3M I;  2PO1 A;  4BA1 A;  3NZK A;  3WU3 A;  3T1Y E;  2GS8 A;  2HKE A;  1H73 A;  4UTG A;  5LMN E;  2IOP A;  2PO2 B;  4B3S I;  3GME A;  4LPF A;  1IBM I;  2O1W A;  1VI7 A;  2UXD I;  1Y60 A;  4HAC A;  1ZM2 A;  2Z5E A;  2NN6 A;  4BA1 B;  4DR6 I;  1HNX I;  2PNM A;  1H74 A;  2BM0 A;  4JI5 E;  1WUU A;  4R1F A;  4LFA E;  3WU5 A;  2BM1 A;  4DU7 A;  1XMO E;  4HAC B;  5DRP A;  5JEA A;  2NN6 B;  1EA6 A;  3HUL A;  2F4V E;  4N3O A;  4J3D A;  1PIE A;  2JE6 A;  4YY3 I;  5LMU I;  4X62 I;  2X36 A;  5K36 F;  4GKJ E;  2C38 A;  1HNW E;  2UXC I;  5DRQ A;  5JEA B;  3M85 D;  4PRX A;  2E5L E;  4M1K A;  4DV0 E;  4DR3 I;  4JI2 I;  2JE6 B;  2HHH E;  4LF9 I;  5DRO A;  1XMQ I;  4IFD A;  1ZXM A;  1OJ4 A;  2O1V A;  3V5R A;  4IS9 A;  2F1D A;  4IFD B;  4OX9 E;  5C0X A;  2ZM6 E;  1OYS A;  2HFS A;  2IER A;  2UU9 I;  2PNZ A;  5GMD A;  4DV4 E;  4JI1 E;  2WW4 A;  1FWK A;  1Z0E A;  1UDQ A;  1H7U A;  4DV6 I;  3T1H E;  4DUZ E;  4FW4 A;  4DV2 E;  1N36 I;  4PRV A;  4DR4 E;  1N32 I;  1Z0V A;  5IWA I;  2XEX A;  4AQY E;  1IBK E;  3B82 A;  4OZE A;  4IZK A;  4HYM A;  5K36 B;  1ZM9 A;  1USV A;  5EKW A;  1RR9 A;  4AM3 A;  1Y4S A;  2C39 A;  2C37 A;  4LF7 I;  4IZK B;  4X66 E;  4DPY A;  3J80 C;  4DV1 E;  3U1Y A;  4MDT A;  1B62 A;  4P52 A;  5K36 E;  2UXB E;  2IOQ A;  2HKJ A;  2C39 B;  1N33 E;  4LF5 I;  3WU6 A;  4JI8 I;  5K36 C;  4NXN E;  3Q6M A;  4KHP I;  2LJP A;  4MYU A;  2NPF A;  4X65 I;  5L3J A;  2HK2 A;  4JI6 E;  4QNJ A;  2J65 A;  1UDS A;  5DRR A;  4QNK A;  1R6M A;  3B78 A;  3K85 A;  3QT8 A;  1XNR E;  1FJG I;  4DR7 I;  4JI3 E;  4MU1 A;  4NBQ A;  4DV7 I;  4DU8 A;  2WP8 A;  2UUC E;  4GKK I;  4B3M E;  1NHJ A;  5EL9 A;  3M7N G;  3J7A M;  3P3E A;  4B3S E;  2WP8 B;  1Z0C A;  3PRY A;  4U3D A;  1IBM E;  2UXD E;  2DEJ A;  2CG9 A;  4JG4 A;  4DR5 E;  4DR6 E;  4HY1 A;  1HNX E;  3K17 A;  4LFC I;  2CVE A;  1H7S A;  4EMD A;  1KKH A;  4IZJ D;  1HR0 E;  3F0N A;  4LF4 I;  3B8H A;  4JI7 I;  4KQV A;  4X64 I;  3T1Y I;  2OI2 A;  4DV5 I;  5C0X D;  3ZKD A;  4JI0 I;  4YY3 E;  5LMU E;  2V2Z A;  2UXC E;  5DNX A;  3ZZ0 A;  2VF3 A;  4DR3 E;  4MU3 A;  1QZR A;  4JI2 E;  2Z5C A;  3J81 Q;  4LF6 I;  4JV5 I;  4LCH A;  1OYR A;  4JI5 I;  4LF8 I;  3Q6N A;  2V2V A;  3JAM Q;  1XMO I;  4LF9 E;  1XMQ E;  2A2C A;  4P7A A;  4JYA I;  2VQF I;  2Z5C B;  3HJC A;  4B3R I;  1UEK A;  4OO1 D;  1HK7 A;  3OTO I;  1ZM4 A;  4DR2 E;  4FW9 A;  1J5E I;  3HKM A;  2UU9 E;  4NXM E;  2R42 A;  3PS3 A;  1RRE A;  1KTV A;  2JEA B;  1P42 A;  5BR8 I;  4K0K I;  1Y5Y A;  1XNQ I;  3D4J A;  4FN5 A;  1N36 E;  1HNZ E;  1B63 A;  2PNL A;  3ZZT A;  5K36 A;  3PS1 A;  1N32 E;  4DR1 I;  2PO0 A;  4FW7 A;  1FI4 A;  1S4E A;  1N34 E;  2BA0 G;  5IWA E;  1DAR A;  1K47 A;  4DXL A;  4DV4 I;  4LFB I;  2PO0 B;  1Y4U A;  3LNU A;  1ZXN A;  4LF7 E;  4B3T I;  4DV2 I;  4DR4 I;  4LCG A;  1D6T A;  3CDI A;  2V34 A;  4U3B A;  2IES A;  2O1U A;  2O3Z A;  2ZIT A;  4LF5 E;  2A2D A;  3PYG A;  1Z5A A;  2BA0 D;  5FLX C;  4KHP E;  2NN6 D;  4X65 E;  3U1K A;  1XXE A;  2CGE A;  1PVG A;  3LPS A;  5C0X C;  1I94 I;  4MU0 A;  2UUA I;  1NHI A;  4YHH I;  4DUY I;  4RPF A;  4DV3 E;  2BV3 A;  2NN6 F;  3QT7 A;  5JEA D;  2VQE I;  4DV1 I; 
#chains in the Genus database with same CATH homology
 4DR7 E;  3V2U C;  4DV7 E;  2UXB I;  4MYT A;  4WUD A;  4GKK E;  1Z0G A;  5FLX Q;  2UUB E;  4DPT A;  4I3H A;  3K1J A;  1FNM A;  1N0V C;  4JI4 I;  1IBL I;  2Z5B B;  1Z5C A;  1Z5B A;  5IT9 C;  3J7A G;  4USM A;  4LFC E;  4UT4 A;  4FWG A;  3J81 C;  4LF4 E;  4JI7 E;  4XTJ A;  4DPW A;  1Y6Z A;  3M6A A;  5LL6 R;  3JAM C;  4X64 E;  4DV5 E;  4FWH A;  1MX0 A;  3ZM7 A;  1Z0B A;  3GON A;  4JI0 E;  3PYF A;  1EI1 A;  2Q2E B;  4X62 E;  5LMN I;  5IT9 Q;  2R3V A;  2EFG A;  4DR5 I;  4JV5 E;  4LF6 E;  4Z7C A;  5A2Q Q;  4LF8 E;  1HR0 I;  3P06 A;  4LFA I;  1BKN A;  1MU5 A;  4JYA E;  3ZZU A;  3H4L A;  1S16 A;  1N0U A;  2VQF E;  3CWV A;  2F4V I;  4DPU A;  1FWL A;  5GME A;  4B3R E;  1ELO A;  1NZ0 A;  4GKJ I;  3OTO E;  1HNW I;  1KIJ A;  2E5L I;  1J5E E;  4DV0 I;  1U2R A;  1USU A;  2HHH I;  5BR8 E;  2ZBK B;  4K0K E;  4DV6 E;  1XNQ E;  1Z0T A;  4WUC A;  4IZJ A;  1H72 C;  1VIS A;  2GQ0 A;  2V8P A;  4ED4 A;  4DR1 E;  1NHH A;  2J7K A;  4FWD A;  4OX9 I;  2ZM6 I;  4DR2 I;  1PKP A;  3PYD A;  4IZJ B;  4PU9 A;  4NXM I;  4HXZ A;  4LFB E;  4JI1 I;  4B3T E;  4USK A;  4WUB A;  1FKA E;  1HNZ I;  3T1H I;  4DUZ I;  3ZKB A;  2E1R A;  4Z7Y A;  1N34 I;  2HK3 A;  3QT5 A;  4AQY I;  1IBK I;  2CZ9 A;  4JI8 E;  4ZVI A;  2O1T A;  1I94 E;  2UUA E;  3Q1Q A;  3PYE A;  4YHH E;  4DUY E;  2AJ4 A;  1ZM3 A;  3LTO A;  2VQE E;  1FJG E;  4X66 I;  4DPX A;  2V2Q A;  2DEI A;  1Z0W A;  1N33 I;  2Z5B A;  3QT6 A;  4NXN I;  1Z59 A;  1XHK A;  1A6F A;  4JI4 E;  4JI6 I;  5FWK A;  1IBL E;  3J80 Q;  4DV3 I;  1KVK A;  1XNR I;  3WU4 A;  4JI3 I;  2X7I A;  1MG7 A;  5A2Q C;  2UUC I;  2HFU A;  2UUB I;  4B3M I;  3WU3 A;  3T1Y E;  2GS8 A;  2HKE A;  1H73 A;  4UTG A;  5LMN E;  2IOP A;  4B3S I;  1IBM I;  2O1W A;  2UXD I;  4HAC A;  1ZM2 A;  2Z5E A;  4DR6 I;  1HNX I;  2PNM A;  1H74 A;  2BM0 A;  4JI5 E;  1WUU A;  4R1F A;  4LFA E;  3WU5 A;  2BM1 A;  4DU7 A;  1XMO E;  4HAC B;  1EA6 A;  3HUL A;  2F4V E;  4N3O A;  1PIE A;  4YY3 I;  5LMU I;  4X62 I;  2X36 A;  4GKJ E;  1HNW E;  2UXC I;  4PRX A;  2E5L E;  4M1K A;  4DV0 E;  4DR3 I;  4JI2 I;  2HHH E;  4LF9 I;  1XMQ I;  1ZXM A;  1OJ4 A;  2O1V A;  3V5R A;  4OX9 E;  2ZM6 E;  2HFS A;  2UU9 I;  5GMD A;  4DV4 E;  4JI1 E;  2WW4 A;  1FWK A;  1Z0E A;  1H7U A;  4DV6 I;  3T1H E;  4DUZ E;  4DV2 E;  1N36 I;  4PRV A;  4DR4 E;  1N32 I;  1Z0V A;  5IWA I;  2XEX A;  4AQY E;  1IBK E;  3B82 A;  4IZK A;  4HYM A;  1ZM9 A;  1USV A;  1RR9 A;  1Y4S A;  4LF7 I;  4IZK B;  4X66 E;  4DPY A;  3J80 C;  4DV1 E;  1B62 A;  4P52 A;  2UXB E;  2IOQ A;  2HKJ A;  1N33 E;  4LF5 I;  3WU6 A;  4JI8 I;  4NXN E;  3Q6M A;  4KHP I;  2LJP A;  4MYU A;  2NPF A;  4X65 I;  5L3J A;  2HK2 A;  4JI6 E;  3QT8 A;  3B78 A;  3K85 A;  1XNR E;  1FJG I;  4DR7 I;  4JI3 E;  4DV7 I;  4DU8 A;  2UUC E;  4GKK I;  4B3M E;  1NHJ A;  3J7A M;  4B3S E;  3PRY A;  1Z0C A;  1IBM E;  2UXD E;  2DEJ A;  2CG9 A;  4JG4 A;  4DR5 E;  4DR6 E;  4HY1 A;  1HNX E;  3K17 A;  4LFC I;  1H7S A;  4EMD A;  1KKH A;  4IZJ D;  1HR0 E;  3F0N A;  4LF4 I;  3B8H A;  4JI7 I;  4KQV A;  4X64 I;  3T1Y I;  2OI2 A;  4DV5 I;  3ZKD A;  4JI0 I;  4YY3 E;  5LMU E;  2V2Z A;  2UXC E;  3ZZ0 A;  2VF3 A;  4DR3 E;  1QZR A;  4JI2 E;  2Z5C A;  3J81 Q;  4LF6 I;  4JV5 I;  4JI5 I;  4LF8 I;  3Q6N A;  2V2V A;  3JAM Q;  1XMO I;  4LF9 E;  1XMQ E;  2A2C A;  4P7A A;  4JYA I;  2VQF I;  2Z5C B;  3HJC A;  4B3R I;  1UEK A;  1HK7 A;  3OTO I;  1ZM4 A;  4DR2 E;  4FW9 A;  1J5E I;  2UU9 E;  4NXM E;  2R42 A;  1RRE A;  1KTV A;  5BR8 I;  4K0K I;  1XNQ I;  3D4J A;  4FN5 A;  1N36 E;  1HNZ E;  1B63 A;  2PNL A;  3ZZT A;  1N32 E;  4DR1 I;  1FI4 A;  1S4E A;  1N34 E;  5IWA E;  1DAR A;  1K47 A;  4DXL A;  4DV4 I;  4LFB I;  1Y4U A;  3LNU A;  1ZXN A;  4LF7 E;  4B3T I;  4DV2 I;  4DR4 I;  1D6T A;  2V34 A;  2O1U A;  2ZIT A;  4LF5 E;  2A2D A;  3PYG A;  1Z5A A;  5FLX C;  4KHP E;  4X65 E;  2CGE A;  1PVG A;  3LPS A;  1I94 I;  2UUA I;  1NHI A;  4YHH I;  4DUY I;  4RPF A;  4DV3 E;  2BV3 A;  4URL A;  3QT7 A;  2VQE I;  4DV1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...