1Z0WA

Crystal structure of a. fulgidus lon proteolytic domain at 1.2a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 64
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0wA00
4ZVIA 2ZM6I 3B78A 1N0VC 1UEKA 3J7AG 4DV6E 2J7KA 4GKKI 3PYEA 3ZKBA 1N34I 4DR1I 4FN5A 3ZM7A 4DV5I 4JI2I 4X66E 4JI6E 4FWGA 1HR0E 4DV2E 3M6AA 1XMQI 1I94I 2E5LE 2UUCI 4DUYI 4AQYE 1FWLA 3K17A 2BM0A 4LF8I 3PYGA 4LFCI 4UTGA 3WU3A 1XNQE 2X7IA 3QT5A 1DARA 4LF5I 1HNXE 4DV7I 3OTOE 4LF7I 4JI6I 5LMNE 1J5EI 4DXLA 1IBME 1RREA 2UXBI 4DV2I 3T1YI 3K1JA 3T1HI 3QT7A 3PYDA 4XTJA 4KHPI 1PKPA 2Q2EB 4K0KE 1HNZI 1N32E 4LF6E 4NXMI 4DR4E 2UUAE 3JAMQ 3J7AM 1HNXI 2EFGA 1Z0GA 3WU5A 3OTOI 4JG4A 4DUZE 5LMNI 3B8HA 4DV0I 4B3SI 2F4VI 1H7SA 4X64I 1BKNA 4JYAE 1Z0WA 1ZM9A 4DPTA 5BR8E 3ZKDA 1XNRI 4K0KI 4GKKE 1HNWI 2ZITA 4HYMA 1N34E 4DR1E 4Z7YA 4DU8A 4DV5E 4JI2E 4URLA 4DR4I 4PU9A 1Z5AA 4X62I 1H74A 3CWVA 1XMQE 5IT9C 1I94E 1IBLI 4DUZI 3J80C 4USKA 2E1RA 1Z0TA 4DUYE 4DR3I 1Z59A 5BR8I 1IBKI 1A6FA 4DPXA 4LF8E 4LFCE 3QT6A 4R1FA 1KTVA 1NZ0A 4LF5E 2A2DA 1WUUA 4DV7E 1Z5BA 4I3HA 4LF7E 4YY3E 1N33I 1J5EE 1Z0EA 1K47A 1XHKA 4PRXA 2UXBE 1VISA 3PYFA 3T1YE 3HULA 5FLXQ 2V8PA 3T1HE 4KHPE 4M1KA 2V34A 1XMOE 4DV3I 4LFAI 1HNZE 4JI3I 1NHJA 4JV5I 2VF3A 3GONA 4NXME 1S4EA 4JI7I 1B62A 2XEXA 4YY3I 4JI0E 2UUBE 1ZXMA 4DV0E 1EA6A 4JI8E 4B3SE 2F4VE 1FJGI 1ELOA 4DR5I 4X64E 4JI4I 2BM1A 4DPUA 4DPWA 4B3TI 1H72C 2AJ4A 3D4JA 2R42A 4X65I 4FWHA 1XMOI 1XNRE 1N36I 4B3MI 1HNWE 1KKHA 1D6TA 1KVKA 4DV1I 4GKJI 5GMEA 4X62E 3H4LA 1IBLE 4JI0I 4DPYA 2GS8A 2UUBI 4JI8I 4P7AA 4OX9E 1PIEA 2DEJA 2V2VA 3ZZTA 4DR3E 1IBKE 1Z5CA 5LMUE 4KQVA 3LPSA 4HY1A 4HXZA 2VQEI 1NHHA 5LL6R 1FNMA 3JAMC 1N33E 4LF9I 1EI1A 2HHHI 4EMDA 2VQFI 4WUBA 4YHHI 1Z0CA 4ED4A 1ZM2A 4DR6E 4OX9I 4DV3E 1NHIA 2UU9I 4LFAE 4JI3E 4JI1I 4B3RI 4DR2E 4JV5E 4Z7CA 1ZXNA 2WW4A 2OI2A 5LMUI 3Q1QA 3QT8A 3J81Q 4JI7E 4FWDA 1H73A 2HKEA 1PVGA 1FJGE 2X36A 4DR5E 4JI4E 4LFBI 4NXNI 4B3TE 2UXCI 4X65E 4DR6I 4DR7E 3LTOA 1N36E 3ZZ0A 4B3ME 4DR2I 3J81C 4MYTA 4JI5I 4DV1E 4GKJE 4LF4I 5L3JA 5GMDA 2UXDI 2A2CA 4UT4A 5FLXC 1H7UA 1FWKA 4RPFA 1U2RA 2LJPA 5A2QQ 4MYUA 4DV6I 3V2UC 4DV4E 4USMA 4DR7I 2VQEE 2HK2A 1KIJA 4X66I 1HR0I 4LF9E 3ZZUA 2HHHE 3LNUA 3V5RA 1ZM3A 1FI4A 2E5LI 2VQFE 1FKAE 1Z0VA 4YHHE 4FW9A 5IWAE 2HFUA 1N0UA 4PRVA 4HACB 5A2QC 3WU4A 4AQYI 2UU9E 1Z0BA 4JI1E 4B3RE 1XNQI 4DV4I 4HACA 2HK3A 1MU5A 2HFSA 1S16A 1IBMI 5IT9Q 4WUCA 3J80Q 2V2ZA 4LFBE 4NXNE 2ZM6E 5IWAI 2UXCE 1MX0A 1N32I 2HKJA 4LF6I 3WU6A 1RR9A 2NPFA 2UUAI 4JI5E 2BV3A 1MG7A 2V2QA 4LF4E 1QZRA 2UUCE 2R3VA 1B63A 2DEIA 2UXDE 4DU7A 3B82A 1OJ4A 3F0NA 1ZM4A 4WUDA 2ZBKB 4JYAI 2CZ9A 4P52A
chains in the Genus database with same CATH superfamily
4ZVIA 2ZM6I 3B78A 1N0VC 1UEKA 3J7AG 4DV6E 2J7KA 4GKKI 2JEAA 4IZJD 3PYEA 3ZKBA 1YHCA 1N34I 5DNLA 2WNRA 4DR1I 4FN5A 5C0XF 3ZM7A 4DV5I 4JI2I 4X66E 4JI6E 4FWGA 1HR0E 2C39A 4DV2E 3M6AA 4BA1B 1XMQI 1I94I 2E5LE 2UUCI 5DRRA 5DRPA 4OO1D 1E3PA 4DUYI 4AQYE 4FW3A 1FWLA 3K17A 2BM0A 4FW7A 4LF8I 3PYGA 4IFDF 4LFCI 4UTGA 3WU3A 1XNQE 2X7IA 3QT5A 1DARA 4LF5I 3P76A 1HNXE 4DV7I 3OTOE 4LF7I 2PNLA 4JI6I 5K36F 5LMNE 1J5EI 4DXLA 1IBME 1RREA 4AM3A 2UXBI 4DV2I 4AIMA 3T1YI 3K1JA 3T1HI 1YH8A 3QT7A 3PYDA 2J65A 4XTJA 4KHPI 4OO1B 1PKPA 2Q2EB 4U3DA 4K0KE 1HNZI 2CGEA 1N32E 4LF6E 5JEAE 4NXMI 3P3CA 2IOPA 5ELWA 5JEAC 4DR4E 2C37B 4MU4A 2UUAE 3JAMQ 2JEBA 3J7AM 1HNXI 2EFGA 1Z0GA 3WU5A 3OTOI 4JG4A 4DUZE 5LMNI 2Z5CB 3B8HA 4DV0I 4B3SI 2BR2A 2F4VI 1H7SA 2C37A 4X64I 1BKNA 4JYAE 4BA2B 1Z0WA 1ZM9A 4NBQA 5BR8E 4DPTA 3GMEA 3ZKDA 1XNRI 4K0KI 4FW6A 4GKKE 1HNWI 2ZITA 4HYMA 1N34E 4DR1E 1UDSA 4Z7YA 5K36D 4DU8A 4DV5E 4JI2E 2JT2A 4URLA 1Y60A 4DR4I 4PU9A 1Z5AA 2C38A 2CG9A 4LOMA 4X62I 1H74A 3CWVA 2BA0G 1XMQE 5IT9C 1I94E 1IBLI 4DUZI 2WP8B 3J80C 4USKA 4OZEA 3K85A 2E1RA 1Z0TA 4DUYE 5JEAA 4DR3I 1Z59A 2Z5BA 5BR8I 4AIDA 1IBKI 1A6FA 2IESA 4DPXA 4LF8E 4LFCE 4FW5A 3QT6A 4R1FA 1KTVA 4MQYA 1NZ0A 4LF5E 4LCHA 2A2DA 1WUUA 4DV7E 1Z5BA 4I3HA 4LF7E 3DD6A 4YY3E 1N33I 1J5EE 1Z0EA 1K47A 1XHKA 4PRXA 2UXBE 2NN6B 1VISA 2O1TA 3PYFA 3T1YE 4OO1E 3HULA 5FLXQ 2V8PA 3T1HE 4OO1C 1R6LA 4KHPE 4M1KA 3M7NG 2V34A 1XMOE 4DV3I 4LFAI 1HNZE 4JI3I 1RHYA 1NHJA 2NN6A 4JV5I 2VF3A 2F1DA 4IZKB 4BA1A 2GQ0A 3GONA 3L7ZB 4NXME 5EL9A 3PS2A 1S4EA 4FW4A 4IZJB 4JI7I 1B62A 2XEXA 5JEAF 4YY3I 3PS3A 4JI0E 2UUBE 1ZXMA 2JE6B 1VI7A 4DV0E 1EA6A 4OKGA 4JI8E 2Z5EA 3GCMA 4B3SE 2F4VE 1FJGI 1ELOA 4DR5I 4IZJA 4X64E 4JI4I 2BM1A 4DPUA 4DPWA 4B3TI 4LPFA 1H72C 2AJ4A 3D4JA 2R42A 4X65I 4FWHA 3HKMA 1XMOI 1N36I 1XNRE 5DRQA 3UHMA 5C0XD 4B3MI 1KKHA 1HNWE 1D6TA 1KVKA 4LCFA 4DV1I 4GKJI 4OO1A 5GMEA 1OYRA 3Q6MA 4X62E 3H4LA 1USUA 1IBLE 5EKWA 4JI0I 4DPYA 2GS8A 2UUBI 4JI8I 5FWKA 4P7AA 3GLLA 4OX9E 1Y4UA 1PIEA 2DEJA 2V2VA 4MU3A 4IFDD 3ZZTA 4DR3E 1IBKE 1Z5CA 3HJCA 5LMUE 4KQVA 3LPSA 4HY1A 2Z5CA 4HXZA 5C0XB 2VQEI 1NHHA 2BA1G 5LL6R 3M85G 1FNMA 4BA2A 3JAMC 2NN6E 2NN6C 3B4TA 1N33E 4LF9I 1EI1A 2HHHI 4EMDA 2VQFI 4WUBA 4YHHI 2O3ZA 1Z0CA 4ED4A 1ZM2A 4QNKA 2PO1B 3PRYA 1Y5YA 2BA0D 4OX9I 4DR6E 4DV3E 4OO1F 1NHIA 2UU9I 4LFAE 4JI3E 4JI1I 4IFDB 4B3RI 4DR2E 4JV5E 4Z7CA 1ZXNA 2WW4A 2OI2A 5LMUI 2WP8A 4U3BA 3Q1QA 3QT8A 3J81Q 5K36B 4JI7E 4FWDA 2O1VA 3U1YA 1H73A 4QNJA 2HKEA 1PVGA 1XXEA 2WNRB 1FJGE 2X36A 4DR5E 4JI4E 4LFBI 4NXNI 5K36A 4B3TE 3Q6NA 3KRNA 2C39B 2UXCI 2PNZB 1UDQA 4LCGA 4X65E 4DR6I 4DR7E 3LTOA 4MU0A 2GO4A 1N36E 3ZZ0A 5DROA 4B3ME 2VESA 2AE8A 3M7ND 4DR2I 4GQUA 3J81C 1UDNA 4MYTA 1UDOA 4JI5I 4DV1E 4GKJE 2PNZA 4LF4I 4N3OA 5L3JA 5GMDA 2UXDI 1OYPA 2A2CA 4IZKA 4UT4A 5FLXC 1H7UA 3L7ZA 3P3GA 1FWKA 4RPFA 3PS1A 1U2RA 2LJPA 5C0XE 5A2QQ 4MYUA 5C0XC 4DV6I 3V2UC 3U1KA 4DV4E 4USMA 4DR7I 2JE6A 2VQEE 2PO2B 2HK2A 3P3EA 1KIJA 4X66I 1HR0I 4LF9E 3ZZUA 2HHHE 3NZKA 3LNUA 3V5RA 1ZM3A 1FI4A 2E5LI 2PO2A 2VQFE 1FKAE 1Z0VA 2NN6F 4YHHE 4FW9A 5IWAE 2HFUA 2O1WA 1N0UA 4PRVA 4HACB 4IFDE 4IFDC 2JEBB 2PNMA 5A2QC 1P42A 3WU4A 4AQYI 2UU9E 1Z0BA 4JI1E 5DNXA 4B3RE 2IERA 2BR2B 4IS9A 1XNQI 5K36E 4DV4I 4HACA 5K36C 2HK3A 5JEAD 1MU5A 4MU1A 2HFSA 1S16A 2BA1D 1Y4SA 1IBMI 5IT9Q 3M85D 2IOQA 4WUCA 3J80Q 2V2ZA 5C0XA 4LFBE 4NXNE 2ZM6E 1OYSA 2PO0B 5IWAI 2C38B 1USVA 3CDIA 2UXCE 1HK7A 4J3DA 1R6MA 1MX0A 1N32I 2CVEA 4MDTA 2HKJA 4LF6I 3WU6A 2PO0A 1RR9A 2NPFA 2UUAI 4JI5E 2BV3A 1E3HA 1MG7A 2V2QA 2PO1A 5JEAB 4LF4E 2NN6D 4ISAA 1QZRA 2Z5BB 2UUCE 2R3VA 1B63A 4IFDA 2DEIA 2UXDE 4DU7A 1Y6ZA 2JEAB 3B82A 1OJ4A 3F0NA 3H1CA 1ZM4A 4WUDA 2O1UA 2ZBKB 2GO3A 4JYAI 3CDJA 2CZ9A 4P52A 3P06A
chains in the Genus database with same CATH topology
4ZVIA 2ZM6I 3B78A 1N0VC 1UEKA 3J7AG 4DV6E 2J7KA 4GKKI 4IZJD 3PYEA 3ZKBA 1N34I 4DR1I 4FN5A 3ZM7A 4DV5I 4JI2I 4X66E 4JI6E 4FWGA 1HR0E 4DV2E 3M6AA 1XMQI 1I94I 2E5LE 2UUCI 4DUYI 4AQYE 1FWLA 3K17A 2BM0A 4LF8I 3PYGA 4LFCI 4UTGA 3WU3A 1XNQE 2X7IA 3QT5A 1DARA 4LF5I 1HNXE 4DV7I 3OTOE 4LF7I 2PNLA 4JI6I 5LMNE 1J5EI 4DXLA 1IBME 1RREA 2UXBI 4DV2I 3T1YI 3K1JA 3T1HI 3QT7A 3PYDA 4XTJA 4KHPI 1PKPA 2Q2EB 4K0KE 1HNZI 2CGEA 1N32E 4LF6E 4NXMI 2IOPA 4DR4E 2UUAE 3JAMQ 3J7AM 1HNXI 2EFGA 1Z0GA 3WU5A 3OTOI 4JG4A 4DUZE 5LMNI 2Z5CB 3B8HA 4DV0I 4B3SI 2F4VI 1H7SA 4X64I 1BKNA 4JYAE 1Z0WA 1ZM9A 4DPTA 5BR8E 3ZKDA 1XNRI 4K0KI 4GKKE 1HNWI 2ZITA 4HYMA 1N34E 4DR1E 4Z7YA 4DU8A 4DV5E 4JI2E 4URLA 4DR4I 4PU9A 1Z5AA 2CG9A 4X62I 1H74A 3CWVA 1XMQE 5IT9C 1I94E 1IBLI 4DUZI 3J80C 4USKA 3K85A 2E1RA 1Z0TA 4DUYE 4DR3I 1Z59A 2Z5BA 5BR8I 1IBKI 1A6FA 4DPXA 4LF8E 4LFCE 3QT6A 4R1FA 1KTVA 1NZ0A 4LF5E 2A2DA 1WUUA 4DV7E 1Z5BA 4I3HA 4LF7E 4YY3E 1N33I 1J5EE 1Z0EA 1K47A 1XHKA 4PRXA 2UXBE 2O1TA 1VISA 3PYFA 3T1YE 3HULA 5FLXQ 2V8PA 3T1HE 4KHPE 4M1KA 2V34A 1XMOE 4DV3I 4LFAI 1HNZE 4JI3I 1NHJA 4JV5I 2VF3A 4IZKB 2GQ0A 3GONA 4NXME 1S4EA 4IZJB 4JI7I 1B62A 2XEXA 4YY3I 4JI0E 2UUBE 1ZXMA 4DV0E 1EA6A 4JI8E 4B3SE 2Z5EA 2F4VE 1FJGI 1ELOA 4DR5I 4IZJA 4X64E 4JI4I 2BM1A 4DPUA 4DPWA 4B3TI 1H72C 2AJ4A 3D4JA 2R42A 4X65I 4FWHA 1XMOI 1XNRE 1N36I 4B3MI 1HNWE 1KKHA 1D6TA 1KVKA 4DV1I 4GKJI 5GMEA 3Q6MA 4X62E 3H4LA 1USUA 1IBLE 4JI0I 4DPYA 2GS8A 2UUBI 4JI8I 5FWKA 4P7AA 4OX9E 1Y4UA 1PIEA 2DEJA 2V2VA 3ZZTA 4DR3E 1IBKE 1Z5CA 3HJCA 5LMUE 4KQVA 3LPSA 4HY1A 2Z5CA 4HXZA 2VQEI 1NHHA 5LL6R 1FNMA 3JAMC 1N33E 4LF9I 1EI1A 2HHHI 4EMDA 2VQFI 4WUBA 4YHHI 1Z0CA 4ED4A 1ZM2A 3PRYA 4DR6E 4OX9I 4DV3E 1NHIA 2UU9I 4LFAE 4JI3E 4JI1I 4B3RI 4DR2E 4JV5E 4Z7CA 1ZXNA 2WW4A 2OI2A 5LMUI 3Q1QA 3QT8A 3J81Q 4JI7E 4FWDA 2O1VA 1H73A 2HKEA 1PVGA 1FJGE 2X36A 4DR5E 4JI4E 4LFBI 4NXNI 4B3TE 3Q6NA 2UXCI 4X65E 4DR6I 4DR7E 3LTOA 1N36E 3ZZ0A 4B3ME 4DR2I 3J81C 4MYTA 4JI5I 4DV1E 4GKJE 4LF4I 4N3OA 5L3JA 5GMDA 2UXDI 2A2CA 4IZKA 4UT4A 5FLXC 1H7UA 1FWKA 4RPFA 1U2RA 2LJPA 5A2QQ 4MYUA 4DV6I 3V2UC 4DV4E 4USMA 4DR7I 2VQEE 2HK2A 1KIJA 4X66I 1HR0I 4LF9E 3ZZUA 2HHHE 3LNUA 3V5RA 1ZM3A 1FI4A 2E5LI 2VQFE 1FKAE 1Z0VA 4YHHE 4FW9A 5IWAE 2HFUA 2O1WA 1N0UA 4PRVA 4HACB 2PNMA 5A2QC 3WU4A 4AQYI 2UU9E 1Z0BA 4JI1E 4B3RE 1XNQI 4DV4I 4HACA 2HK3A 1MU5A 2HFSA 1S16A 1Y4SA 1IBMI 5IT9Q 2IOQA 4WUCA 3J80Q 2V2ZA 4LFBE 4NXNE 2ZM6E 5IWAI 1USVA 2UXCE 1HK7A 1MX0A 1N32I 2HKJA 4LF6I 3WU6A 1RR9A 2NPFA 2UUAI 4JI5E 2BV3A 1MG7A 2V2QA 4LF4E 1QZRA 2Z5BB 2UUCE 2R3VA 1B63A 2DEIA 2UXDE 4DU7A 1Y6ZA 3B82A 1OJ4A 3F0NA 1ZM4A 4WUDA 2O1UA 2ZBKB 4JYAI 2CZ9A 4P52A 3P06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVI A;  2ZM6 I;  3B78 A;  1N0V C;  1UEK A;  3J7A G;  4DV6 E;  2J7K A;  4GKK I;  3PYE A;  3ZKB A;  1N34 I;  4DR1 I;  4FN5 A;  3ZM7 A;  4DV5 I;  4JI2 I;  4X66 E;  4JI6 E;  4FWG A;  1HR0 E;  4DV2 E;  3M6A A;  1XMQ I;  1I94 I;  2E5L E;  2UUC I;  4DUY I;  4AQY E;  1FWL A;  3K17 A;  2BM0 A;  4LF8 I;  3PYG A;  4LFC I;  4UTG A;  3WU3 A;  1XNQ E;  2X7I A;  3QT5 A;  1DAR A;  4LF5 I;  1HNX E;  4DV7 I;  3OTO E;  4LF7 I;  4JI6 I;  5LMN E;  1J5E I;  4DXL A;  1IBM E;  1RRE A;  2UXB I;  4DV2 I;  3T1Y I;  3K1J A;  3T1H I;  3QT7 A;  3PYD A;  4XTJ A;  4KHP I;  1PKP A;  2Q2E B;  4K0K E;  1HNZ I;  1N32 E;  4LF6 E;  4NXM I;  4DR4 E;  2UUA E;  3JAM Q;  3J7A M;  1HNX I;  2EFG A;  1Z0G A;  3WU5 A;  3OTO I;  4JG4 A;  4DUZ E;  5LMN I;  3B8H A;  4DV0 I;  4B3S I;  2F4V I;  1H7S A;  4X64 I;  1BKN A;  4JYA E;  1Z0W A;  1ZM9 A;  4DPT A;  5BR8 E;  3ZKD A;  1XNR I;  4K0K I;  4GKK E;  1HNW I;  2ZIT A;  4HYM A;  1N34 E;  4DR1 E;  4Z7Y A;  4DU8 A;  4DV5 E;  4JI2 E;  4URL A;  4DR4 I;  4PU9 A;  1Z5A A;  4X62 I;  1H74 A;  3CWV A;  1XMQ E;  5IT9 C;  1I94 E;  1IBL I;  4DUZ I;  3J80 C;  4USK A;  2E1R A;  1Z0T A;  4DUY E;  4DR3 I;  1Z59 A;  5BR8 I;  1IBK I;  1A6F A;  4DPX A;  4LF8 E;  4LFC E;  3QT6 A;  4R1F A;  1KTV A;  1NZ0 A;  4LF5 E;  2A2D A;  1WUU A;  4DV7 E;  1Z5B A;  4I3H A;  4LF7 E;  4YY3 E;  1N33 I;  1J5E E;  1Z0E A;  1K47 A;  1XHK A;  4PRX A;  2UXB E;  1VIS A;  3PYF A;  3T1Y E;  3HUL A;  5FLX Q;  2V8P A;  3T1H E;  4KHP E;  4M1K A;  2V34 A;  1XMO E;  4DV3 I;  4LFA I;  1HNZ E;  4JI3 I;  1NHJ A;  4JV5 I;  2VF3 A;  3GON A;  4NXM E;  1S4E A;  4JI7 I;  1B62 A;  2XEX A;  4YY3 I;  4JI0 E;  2UUB E;  1ZXM A;  4DV0 E;  1EA6 A;  4JI8 E;  4B3S E;  2F4V E;  1FJG I;  1ELO A;  4DR5 I;  4X64 E;  4JI4 I;  2BM1 A;  4DPU A;  4DPW A;  4B3T I;  1H72 C;  2AJ4 A;  3D4J A;  2R42 A;  4X65 I;  4FWH A;  1XMO I;  1XNR E;  1N36 I;  4B3M I;  1HNW E;  1KKH A;  1D6T A;  1KVK A;  4DV1 I;  4GKJ I;  5GME A;  4X62 E;  3H4L A;  1IBL E;  4JI0 I;  4DPY A;  2GS8 A;  2UUB I;  4JI8 I;  4P7A A;  4OX9 E;  1PIE A;  2DEJ A;  2V2V A;  3ZZT A;  4DR3 E;  1IBK E;  1Z5C A;  5LMU E;  4KQV A;  3LPS A;  4HY1 A;  4HXZ A;  2VQE I;  1NHH A;  5LL6 R;  1FNM A;  3JAM C;  1N33 E;  4LF9 I;  1EI1 A;  2HHH I;  4EMD A;  2VQF I;  4WUB A;  4YHH I;  1Z0C A;  4ED4 A;  1ZM2 A;  4DR6 E;  4OX9 I;  4DV3 E;  1NHI A;  2UU9 I;  4LFA E;  4JI3 E;  4JI1 I;  4B3R I;  4DR2 E;  4JV5 E;  4Z7C A;  1ZXN A;  2WW4 A;  2OI2 A;  5LMU I;  3Q1Q A;  3QT8 A;  3J81 Q;  4JI7 E;  4FWD A;  1H73 A;  2HKE A;  1PVG A;  1FJG E;  2X36 A;  4DR5 E;  4JI4 E;  4LFB I;  4NXN I;  4B3T E;  2UXC I;  4X65 E;  4DR6 I;  4DR7 E;  3LTO A;  1N36 E;  3ZZ0 A;  4B3M E;  4DR2 I;  3J81 C;  4MYT A;  4JI5 I;  4DV1 E;  4GKJ E;  4LF4 I;  5L3J A;  5GMD A;  2UXD I;  2A2C A;  4UT4 A;  5FLX C;  1H7U A;  1FWK A;  4RPF A;  1U2R A;  2LJP A;  5A2Q Q;  4MYU A;  4DV6 I;  3V2U C;  4DV4 E;  4USM A;  4DR7 I;  2VQE E;  2HK2 A;  1KIJ A;  4X66 I;  1HR0 I;  4LF9 E;  3ZZU A;  2HHH E;  3LNU A;  3V5R A;  1ZM3 A;  1FI4 A;  2E5L I;  2VQF E;  1FKA E;  1Z0V A;  4YHH E;  4FW9 A;  5IWA E;  2HFU A;  1N0U A;  4PRV A;  4HAC B;  5A2Q C;  3WU4 A;  4AQY I;  2UU9 E;  1Z0B A;  4JI1 E;  4B3R E;  1XNQ I;  4DV4 I;  4HAC A;  2HK3 A;  1MU5 A;  2HFS A;  1S16 A;  1IBM I;  5IT9 Q;  4WUC A;  3J80 Q;  2V2Z A;  4LFB E;  4NXN E;  2ZM6 E;  5IWA I;  2UXC E;  1MX0 A;  1N32 I;  2HKJ A;  4LF6 I;  3WU6 A;  1RR9 A;  2NPF A;  2UUA I;  4JI5 E;  2BV3 A;  1MG7 A;  2V2Q A;  4LF4 E;  1QZR A;  2UUC E;  2R3V A;  1B63 A;  2DEI A;  2UXD E;  4DU7 A;  3B82 A;  1OJ4 A;  3F0N A;  1ZM4 A;  4WUD A;  2ZBK B;  4JYA I;  2CZ9 A;  4P52 A; 
#chains in the Genus database with same CATH topology
 4ZVI A;  2ZM6 I;  3B78 A;  1N0V C;  1UEK A;  3J7A G;  4DV6 E;  2J7K A;  4GKK I;  2JEA A;  4IZJ D;  3PYE A;  3ZKB A;  1YHC A;  1N34 I;  5DNL A;  2WNR A;  4DR1 I;  4FN5 A;  5C0X F;  3ZM7 A;  4DV5 I;  4JI2 I;  4X66 E;  4JI6 E;  4FWG A;  1HR0 E;  2C39 A;  4DV2 E;  3M6A A;  4BA1 B;  1XMQ I;  1I94 I;  2E5L E;  2UUC I;  5DRR A;  5DRP A;  4OO1 D;  1E3P A;  4DUY I;  4AQY E;  4FW3 A;  1FWL A;  3K17 A;  2BM0 A;  4FW7 A;  4LF8 I;  3PYG A;  4IFD F;  4LFC I;  4UTG A;  3WU3 A;  1XNQ E;  2X7I A;  3QT5 A;  1DAR A;  4LF5 I;  3P76 A;  1HNX E;  4DV7 I;  3OTO E;  4LF7 I;  2PNL A;  4JI6 I;  5K36 F;  5LMN E;  1J5E I;  4DXL A;  1IBM E;  1RRE A;  4AM3 A;  2UXB I;  4DV2 I;  4AIM A;  3T1Y I;  3K1J A;  3T1H I;  1YH8 A;  3QT7 A;  3PYD A;  2J65 A;  4XTJ A;  4KHP I;  4OO1 B;  1PKP A;  2Q2E B;  4U3D A;  4K0K E;  1HNZ I;  2CGE A;  1N32 E;  4LF6 E;  5JEA E;  4NXM I;  3P3C A;  2IOP A;  5ELW A;  5JEA C;  4DR4 E;  2C37 B;  4MU4 A;  2UUA E;  3JAM Q;  2JEB A;  3J7A M;  1HNX I;  2EFG A;  1Z0G A;  3WU5 A;  3OTO I;  4JG4 A;  4DUZ E;  5LMN I;  2Z5C B;  3B8H A;  4DV0 I;  4B3S I;  2BR2 A;  2F4V I;  1H7S A;  2C37 A;  4X64 I;  1BKN A;  4JYA E;  4BA2 B;  1Z0W A;  1ZM9 A;  4NBQ A;  5BR8 E;  4DPT A;  3GME A;  3ZKD A;  1XNR I;  4K0K I;  4FW6 A;  4GKK E;  1HNW I;  2ZIT A;  4HYM A;  1N34 E;  4DR1 E;  1UDS A;  4Z7Y A;  5K36 D;  4DU8 A;  4DV5 E;  4JI2 E;  2JT2 A;  4URL A;  1Y60 A;  4DR4 I;  4PU9 A;  1Z5A A;  2C38 A;  2CG9 A;  4LOM A;  4X62 I;  1H74 A;  3CWV A;  2BA0 G;  1XMQ E;  5IT9 C;  1I94 E;  1IBL I;  4DUZ I;  2WP8 B;  3J80 C;  4USK A;  4OZE A;  3K85 A;  2E1R A;  1Z0T A;  4DUY E;  5JEA A;  4DR3 I;  1Z59 A;  2Z5B A;  5BR8 I;  4AID A;  1IBK I;  1A6F A;  2IES A;  4DPX A;  4LF8 E;  4LFC E;  4FW5 A;  3QT6 A;  4R1F A;  1KTV A;  4MQY A;  1NZ0 A;  4LF5 E;  4LCH A;  2A2D A;  1WUU A;  4DV7 E;  1Z5B A;  4I3H A;  4LF7 E;  3DD6 A;  4YY3 E;  1N33 I;  1J5E E;  1Z0E A;  1K47 A;  1XHK A;  4PRX A;  2UXB E;  2NN6 B;  1VIS A;  2O1T A;  3PYF A;  3T1Y E;  4OO1 E;  3HUL A;  5FLX Q;  2V8P A;  3T1H E;  4OO1 C;  1R6L A;  4KHP E;  4M1K A;  3M7N G;  2V34 A;  1XMO E;  4DV3 I;  4LFA I;  1HNZ E;  4JI3 I;  1RHY A;  1NHJ A;  2NN6 A;  4JV5 I;  2VF3 A;  2F1D A;  4IZK B;  4BA1 A;  2GQ0 A;  3GON A;  3L7Z B;  4NXM E;  5EL9 A;  3PS2 A;  1S4E A;  4FW4 A;  4IZJ B;  4JI7 I;  1B62 A;  2XEX A;  5JEA F;  4YY3 I;  3PS3 A;  4JI0 E;  2UUB E;  1ZXM A;  2JE6 B;  1VI7 A;  4DV0 E;  1EA6 A;  4OKG A;  4JI8 E;  2Z5E A;  3GCM A;  4B3S E;  2F4V E;  1FJG I;  1ELO A;  4DR5 I;  4IZJ A;  4X64 E;  4JI4 I;  2BM1 A;  4DPU A;  4DPW A;  4B3T I;  4LPF A;  1H72 C;  2AJ4 A;  3D4J A;  2R42 A;  4X65 I;  4FWH A;  3HKM A;  1XMO I;  1N36 I;  1XNR E;  5DRQ A;  3UHM A;  5C0X D;  4B3M I;  1KKH A;  1HNW E;  1D6T A;  1KVK A;  4LCF A;  4DV1 I;  4GKJ I;  4OO1 A;  5GME A;  1OYR A;  3Q6M A;  4X62 E;  3H4L A;  1USU A;  1IBL E;  5EKW A;  4JI0 I;  4DPY A;  2GS8 A;  2UUB I;  4JI8 I;  5FWK A;  4P7A A;  3GLL A;  4OX9 E;  1Y4U A;  1PIE A;  2DEJ A;  2V2V A;  4MU3 A;  4IFD D;  3ZZT A;  4DR3 E;  1IBK E;  1Z5C A;  3HJC A;  5LMU E;  4KQV A;  3LPS A;  4HY1 A;  2Z5C A;  4HXZ A;  5C0X B;  2VQE I;  1NHH A;  2BA1 G;  5LL6 R;  3M85 G;  1FNM A;  4BA2 A;  3JAM C;  2NN6 E;  2NN6 C;  3B4T A;  1N33 E;  4LF9 I;  1EI1 A;  2HHH I;  4EMD A;  2VQF I;  4WUB A;  4YHH I;  2O3Z A;  1Z0C A;  4ED4 A;  1ZM2 A;  4QNK A;  2PO1 B;  3PRY A;  1Y5Y A;  2BA0 D;  4OX9 I;  4DR6 E;  4DV3 E;  4OO1 F;  1NHI A;  2UU9 I;  4LFA E;  4JI3 E;  4JI1 I;  4IFD B;  4B3R I;  4DR2 E;  4JV5 E;  4Z7C A;  1ZXN A;  2WW4 A;  2OI2 A;  5LMU I;  2WP8 A;  4U3B A;  3Q1Q A;  3QT8 A;  3J81 Q;  5K36 B;  4JI7 E;  4FWD A;  2O1V A;  3U1Y A;  1H73 A;  4QNJ A;  2HKE A;  1PVG A;  1XXE A;  2WNR B;  1FJG E;  2X36 A;  4DR5 E;  4JI4 E;  4LFB I;  4NXN I;  5K36 A;  4B3T E;  3Q6N A;  3KRN A;  2C39 B;  2UXC I;  2PNZ B;  1UDQ A;  4LCG A;  4X65 E;  4DR6 I;  4DR7 E;  3LTO A;  4MU0 A;  2GO4 A;  1N36 E;  3ZZ0 A;  5DRO A;  4B3M E;  2VES A;  2AE8 A;  3M7N D;  4DR2 I;  4GQU A;  3J81 C;  1UDN A;  4MYT A;  1UDO A;  4JI5 I;  4DV1 E;  4GKJ E;  2PNZ A;  4LF4 I;  4N3O A;  5L3J A;  5GMD A;  2UXD I;  1OYP A;  2A2C A;  4IZK A;  4UT4 A;  5FLX C;  1H7U A;  3L7Z A;  3P3G A;  1FWK A;  4RPF A;  3PS1 A;  1U2R A;  2LJP A;  5C0X E;  5A2Q Q;  4MYU A;  5C0X C;  4DV6 I;  3V2U C;  3U1K A;  4DV4 E;  4USM A;  4DR7 I;  2JE6 A;  2VQE E;  2PO2 B;  2HK2 A;  3P3E A;  1KIJ A;  4X66 I;  1HR0 I;  4LF9 E;  3ZZU A;  2HHH E;  3NZK A;  3LNU A;  3V5R A;  1ZM3 A;  1FI4 A;  2E5L I;  2PO2 A;  2VQF E;  1FKA E;  1Z0V A;  2NN6 F;  4YHH E;  4FW9 A;  5IWA E;  2HFU A;  2O1W A;  1N0U A;  4PRV A;  4HAC B;  4IFD E;  4IFD C;  2JEB B;  2PNM A;  5A2Q C;  1P42 A;  3WU4 A;  4AQY I;  2UU9 E;  1Z0B A;  4JI1 E;  5DNX A;  4B3R E;  2IER A;  2BR2 B;  4IS9 A;  1XNQ I;  5K36 E;  4DV4 I;  4HAC A;  5K36 C;  2HK3 A;  5JEA D;  1MU5 A;  4MU1 A;  2HFS A;  1S16 A;  2BA1 D;  1Y4S A;  1IBM I;  5IT9 Q;  3M85 D;  2IOQ A;  4WUC A;  3J80 Q;  2V2Z A;  5C0X A;  4LFB E;  4NXN E;  2ZM6 E;  1OYS A;  2PO0 B;  5IWA I;  2C38 B;  1USV A;  3CDI A;  2UXC E;  1HK7 A;  4J3D A;  1R6M A;  1MX0 A;  1N32 I;  2CVE A;  4MDT A;  2HKJ A;  4LF6 I;  3WU6 A;  2PO0 A;  1RR9 A;  2NPF A;  2UUA I;  4JI5 E;  2BV3 A;  1E3H A;  1MG7 A;  2V2Q A;  2PO1 A;  5JEA B;  4LF4 E;  2NN6 D;  4ISA A;  1QZR A;  2Z5B B;  2UUC E;  2R3V A;  1B63 A;  4IFD A;  2DEI A;  2UXD E;  4DU7 A;  1Y6Z A;  2JEA B;  3B82 A;  1OJ4 A;  3F0N A;  3H1C A;  1ZM4 A;  4WUD A;  2O1U A;  2ZBK B;  2GO3 A;  4JYA I;  3CDJ A;  2CZ9 A;  4P52 A;  3P06 A; 
#chains in the Genus database with same CATH homology
 4ZVI A;  2ZM6 I;  3B78 A;  1N0V C;  1UEK A;  3J7A G;  4DV6 E;  2J7K A;  4GKK I;  4IZJ D;  3PYE A;  3ZKB A;  1N34 I;  4DR1 I;  4FN5 A;  3ZM7 A;  4DV5 I;  4JI2 I;  4X66 E;  4JI6 E;  4FWG A;  1HR0 E;  4DV2 E;  3M6A A;  1XMQ I;  1I94 I;  2E5L E;  2UUC I;  4DUY I;  4AQY E;  1FWL A;  3K17 A;  2BM0 A;  4LF8 I;  3PYG A;  4LFC I;  4UTG A;  3WU3 A;  1XNQ E;  2X7I A;  3QT5 A;  1DAR A;  4LF5 I;  1HNX E;  4DV7 I;  3OTO E;  4LF7 I;  2PNL A;  4JI6 I;  5LMN E;  1J5E I;  4DXL A;  1IBM E;  1RRE A;  2UXB I;  4DV2 I;  3T1Y I;  3K1J A;  3T1H I;  3QT7 A;  3PYD A;  4XTJ A;  4KHP I;  1PKP A;  2Q2E B;  4K0K E;  1HNZ I;  2CGE A;  1N32 E;  4LF6 E;  4NXM I;  2IOP A;  4DR4 E;  2UUA E;  3JAM Q;  3J7A M;  1HNX I;  2EFG A;  1Z0G A;  3WU5 A;  3OTO I;  4JG4 A;  4DUZ E;  5LMN I;  2Z5C B;  3B8H A;  4DV0 I;  4B3S I;  2F4V I;  1H7S A;  4X64 I;  1BKN A;  4JYA E;  1Z0W A;  1ZM9 A;  4DPT A;  5BR8 E;  3ZKD A;  1XNR I;  4K0K I;  4GKK E;  1HNW I;  2ZIT A;  4HYM A;  1N34 E;  4DR1 E;  4Z7Y A;  4DU8 A;  4DV5 E;  4JI2 E;  4URL A;  4DR4 I;  4PU9 A;  1Z5A A;  2CG9 A;  4X62 I;  1H74 A;  3CWV A;  1XMQ E;  5IT9 C;  1I94 E;  1IBL I;  4DUZ I;  3J80 C;  4USK A;  3K85 A;  2E1R A;  1Z0T A;  4DUY E;  4DR3 I;  1Z59 A;  2Z5B A;  5BR8 I;  1IBK I;  1A6F A;  4DPX A;  4LF8 E;  4LFC E;  3QT6 A;  4R1F A;  1KTV A;  1NZ0 A;  4LF5 E;  2A2D A;  1WUU A;  4DV7 E;  1Z5B A;  4I3H A;  4LF7 E;  4YY3 E;  1N33 I;  1J5E E;  1Z0E A;  1K47 A;  1XHK A;  4PRX A;  2UXB E;  2O1T A;  1VIS A;  3PYF A;  3T1Y E;  3HUL A;  5FLX Q;  2V8P A;  3T1H E;  4KHP E;  4M1K A;  2V34 A;  1XMO E;  4DV3 I;  4LFA I;  1HNZ E;  4JI3 I;  1NHJ A;  4JV5 I;  2VF3 A;  4IZK B;  2GQ0 A;  3GON A;  4NXM E;  1S4E A;  4IZJ B;  4JI7 I;  1B62 A;  2XEX A;  4YY3 I;  4JI0 E;  2UUB E;  1ZXM A;  4DV0 E;  1EA6 A;  4JI8 E;  4B3S E;  2Z5E A;  2F4V E;  1FJG I;  1ELO A;  4DR5 I;  4IZJ A;  4X64 E;  4JI4 I;  2BM1 A;  4DPU A;  4DPW A;  4B3T I;  1H72 C;  2AJ4 A;  3D4J A;  2R42 A;  4X65 I;  4FWH A;  1XMO I;  1XNR E;  1N36 I;  4B3M I;  1HNW E;  1KKH A;  1D6T A;  1KVK A;  4DV1 I;  4GKJ I;  5GME A;  3Q6M A;  4X62 E;  3H4L A;  1USU A;  1IBL E;  4JI0 I;  4DPY A;  2GS8 A;  2UUB I;  4JI8 I;  5FWK A;  4P7A A;  4OX9 E;  1Y4U A;  1PIE A;  2DEJ A;  2V2V A;  3ZZT A;  4DR3 E;  1IBK E;  1Z5C A;  3HJC A;  5LMU E;  4KQV A;  3LPS A;  4HY1 A;  2Z5C A;  4HXZ A;  2VQE I;  1NHH A;  5LL6 R;  1FNM A;  3JAM C;  1N33 E;  4LF9 I;  1EI1 A;  2HHH I;  4EMD A;  2VQF I;  4WUB A;  4YHH I;  1Z0C A;  4ED4 A;  1ZM2 A;  3PRY A;  4DR6 E;  4OX9 I;  4DV3 E;  1NHI A;  2UU9 I;  4LFA E;  4JI3 E;  4JI1 I;  4B3R I;  4DR2 E;  4JV5 E;  4Z7C A;  1ZXN A;  2WW4 A;  2OI2 A;  5LMU I;  3Q1Q A;  3QT8 A;  3J81 Q;  4JI7 E;  4FWD A;  2O1V A;  1H73 A;  2HKE A;  1PVG A;  1FJG E;  2X36 A;  4DR5 E;  4JI4 E;  4LFB I;  4NXN I;  4B3T E;  3Q6N A;  2UXC I;  4X65 E;  4DR6 I;  4DR7 E;  3LTO A;  1N36 E;  3ZZ0 A;  4B3M E;  4DR2 I;  3J81 C;  4MYT A;  4JI5 I;  4DV1 E;  4GKJ E;  4LF4 I;  4N3O A;  5L3J A;  5GMD A;  2UXD I;  2A2C A;  4IZK A;  4UT4 A;  5FLX C;  1H7U A;  1FWK A;  4RPF A;  1U2R A;  2LJP A;  5A2Q Q;  4MYU A;  4DV6 I;  3V2U C;  4DV4 E;  4USM A;  4DR7 I;  2VQE E;  2HK2 A;  1KIJ A;  4X66 I;  1HR0 I;  4LF9 E;  3ZZU A;  2HHH E;  3LNU A;  3V5R A;  1ZM3 A;  1FI4 A;  2E5L I;  2VQF E;  1FKA E;  1Z0V A;  4YHH E;  4FW9 A;  5IWA E;  2HFU A;  2O1W A;  1N0U A;  4PRV A;  4HAC B;  2PNM A;  5A2Q C;  3WU4 A;  4AQY I;  2UU9 E;  1Z0B A;  4JI1 E;  4B3R E;  1XNQ I;  4DV4 I;  4HAC A;  2HK3 A;  1MU5 A;  2HFS A;  1S16 A;  1Y4S A;  1IBM I;  5IT9 Q;  2IOQ A;  4WUC A;  3J80 Q;  2V2Z A;  4LFB E;  4NXN E;  2ZM6 E;  5IWA I;  1USV A;  2UXC E;  1HK7 A;  1MX0 A;  1N32 I;  2HKJ A;  4LF6 I;  3WU6 A;  1RR9 A;  2NPF A;  2UUA I;  4JI5 E;  2BV3 A;  1MG7 A;  2V2Q A;  4LF4 E;  1QZR A;  2Z5B B;  2UUC E;  2R3V A;  1B63 A;  2DEI A;  2UXD E;  4DU7 A;  1Y6Z A;  3B82 A;  1OJ4 A;  3F0N A;  1ZM4 A;  4WUD A;  2O1U A;  2ZBK B;  4JYA I;  2CZ9 A;  4P52 A;  3P06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...