1Z0WA

Crystal structure of a. fulgidus lon proteolytic domain at 1.2a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 64
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0wA00
4JYAE 3LNUA 1ZM9A 2BV3A 3ZM7A 4GKJI 1FJGI 1N32I 4NXME 3B82A 1XMQI 3QT7A 2VQEE 2UUBI 4X65E 3CWVA 4DR3I 1ZXNA 4WUCA 4HY1A 2V2QA 1N0UA 1EI1A 4LF7E 4YHHI 4X64I 4DPYA 4GKKE 4JG4A 1RREA 1IBMI 1D6TA 2J7KA 2HFUA 3T1HI 2HK2A 2NPFA 1XNRI 4JI2I 3T1YI 4DV4I 5FLXQ 4K0KE 3ZZUA 4OX9E 1S16A 4HXZA 4URLA 4X66E 4DV2E 4B3RE 4DU8A 4JV5I 1FWKA 1N36I 1HNWI 4FWDA 1ZXMA 4JI7E 1K47A 1Z0VA 2BM0A 1KIJA 3B78A 3HULA 4JI3I 3JAMQ 4JI8E 2UXDI 4Z7CA 5LL6R 4USMA 3LTOA 4JI0I 1MX0A 4NXNI 4DV7E 2F4VE 4MYTA 1Z0CA 1Z59A 4LF5E 4YY3E 4DV5I 1Z0TA 2OI2A 2HKJA 4JYAI 4DR7E 1NHJA 1Z5CA 3Q1QA 4NXMI 1XHKA 2VQEI 4X65I 2LJPA 2HK3A 3J7AM 2HFSA 1H7SA 2R3VA 3J80Q 3QT5A 2HKEA 4HACA 4LF9E 4R1FA 3PYGA 4GKKI 1NHHA 5GMDA 3H4LA 4B3SE 3ZKDA 4DPWA 1KTVA 4HYMA 3WU5A 4LF6E 4DV1E 1H72C 4LF4E 2DEJA 4LFBE 4K0KI 3J81Q 4OX9I 5LMNE 4JI1I 4DR4E 4FWGA 4B3ME 4FW9A 1B63A 4X66I 4DV2I 4DR6E 4B3RI 4LF8E 1HNXI 1Z0GA 1Z5AA 5BR8I 2GS8A 4JI7I 3ZKBA 3K17A 3B8HA 1H7UA 1N33E 3QT8A 2UXBE 4DR2E 1KKHA 5FLXC 2E5LE 4JI8I 1BKNA 4JI1E 1IBKE 2X7IA 1ZM3A 4DV7I 4JI6E 4DPUA 1HNXE 2F4VI 5BR8E 2WW4A 3K1JA 4LF5I 2ZITA 3M6AA 4YY3I 5IWAE 4USKA 2ZBKB 2UUCE 1WUUA 3JAMC 3D4JA 2UXCE 4DR7I 3GONA 2A2DA 4B3TE 1PKPA 3V2UC 4DUZE 4RPFA 3WU6A 4LFAE 1OJ4A 4LF9I 1B62A 4DPXA 2XEXA 2ZM6E 2X36A 3ZZTA 3PYEA 4B3SI 1Z5BA 4LF6I 4ZVIA 4DV1I 1Z0WA 4LF4I 4LFBI 5LMNI 1N34E 4DR4I 4X62E 3J80C 4B3MI 1FI4A 4MYUA 4DR6I 1XNQE 4DV0E 4LF8I 1Z0EA 1ZM2A 5LMUE 2HHHE 4DV6E 5L3JA 1HR0E 1NZ0A 1N33I 2UXBI 2DEIA 4DR2I 3LPSA 3J81C 4ED4A 4JI4E 2E5LI 3V5RA 4KHPE 4P52A 1IBKI 2UUAE 4DR5E 1FKAE 4UT4A 4AQYE 4KQVA 4DU7A 4JI6I 1IBLI 4DXLA 2V8PA 4LFCE 5IT9C 5IWAI 4PRVA 5IT9Q 1J5EE 2UUCI 1DARA 4PU9A 2UXCI 1XMOE 1HNZE 4WUDA 4DR1E 2UU9E 4WUBA 2Q2EB 1S4EA 4DUYE 2V34A 1I94E 4B3TI 4DPTA 4DUZI 4FN5A 1IBLE 1FNMA 2R42A 4FWHA 4LFAI 3J7AG 3PYFA 4GKJE 1FJGE 1N32E 5GMEA 2CZ9A 1PIEA 2ZM6I 1XMQE 4JI5I 4DV3I 2UUBE 4I3HA 4DR3E 1PVGA 2E1RA 1A6FA 1NHIA 1FWLA 4YHHE 4X64E 3WU3A 1ZM4A 4HACB 1N34I 4X62I 2A2CA 1IBME 3ZZ0A 3T1HE 1XNQI 4DV0I 4EMDA 1XNRE 5LMUI 4JI2E 1Z0BA 3T1YE 4DV4E 2HHHI 4UTGA 2VQFI 4DV6I 2V2VA 1HR0I 4JI5E 3OTOI 2BM1A 4DV3E 1EA6A 1VISA 4Z7YA 3WU4A 1UEKA 1H73A 4JI4I 4JV5E 5A2QC 1MG7A 1N36E 1HNWE 1KVKA 5A2QQ 4KHPI 2UUAI 4DR5I 2V2ZA 1MU5A 4AQYI 4M1KA 1U2RA 4JI3E 4LFCI 2EFGA 2VQFE 2UXDE 3F0NA 1H74A 3OTOE 4JI0E 4NXNE 1J5EI 1N0VC 4P7AA 2VF3A 4LF7I 4PRXA 1XMOI 1HNZI 4DR1I 2UU9I 1I94I 4DUYI 2AJ4A 1QZRA 4XTJA 4DV5E 3QT6A 3PYDA 1ELOA 1RR9A
chains in the Genus database with same CATH superfamily
3HKMA 4JYAE 3LNUA 1ZM9A 2BV3A 3ZM7A 4GKJI 1FJGI 1N32I 4FW5A 4OO1B 4NXME 3B82A 1XMQI 3QT7A 4IFDC 2VQEE 2UUBI 4X65E 3CWVA 4DR3I 1ZXNA 4WUCA 2GO4A 4HY1A 2V2QA 1N0UA 2IERA 1EI1A 4LF7E 4YHHI 5JEAB 4X64I 3L7ZA 3PS1A 4DPYA 1Y6ZA 4GKKE 4JG4A 1RREA 1RHYA 1YHCA 1IBMI 1D6TA 2PNLA 5DROA 2J7KA 2HFUA 3T1HI 2HK2A 2NPFA 1XNRI 2GO3A 2O1VA 4JI2I 2O1WA 3T1YI 4FW3A 4DV4I 5FLXQ 4K0KE 3ZZUA 5K36D 4OX9E 1S16A 4HXZA 4URLA 2JE6A 2Z5EA 4X66E 4BA1B 4DV2E 4B3RE 2PNZB 4DU8A 3GMEA 4JV5I 1FWKA 2NN6B 1N36I 1HNWI 1P42A 4FWDA 1ZXMA 4JI7E 1K47A 1Z0VA 3P3EA 2BM0A 1KIJA 3B78A 3HULA 4JI3I 3JAMQ 1E3HA 4JI8E 4AM3A 1Y60A 2UXDI 5C0XB 4Z7CA 5LL6R 4USMA 5FWKA 2CG9A 3LTOA 4JI0I 1MX0A 4NXNI 5JEAD 3H1CA 4DV7E 2F4VE 4MYTA 1Z0CA 1Z59A 4QNJA 1UDQA 4LF5E 2PO0B 2C39B 5EL9A 4YY3E 4DV5I 3M7ND 2JEBB 1Z0TA 2OI2A 2BA0D 1UDNA 2HKJA 4JYAI 5DNLA 4DR7E 1NHJA 4LCGA 4IFDB 2WNRB 1Z5CA 3Q1QA 4NXMI 1XHKA 2VQEI 2BR2A 2LJPA 2HK3A 4X65I 3J7AM 4BA1A 2NN6D 2HFSA 1H7SA 2R3VA 2PNZA 2O1UA 3J80Q 2NN6A 3QT5A 1USUA 2HKEA 2AE8A 4HACA 4LF9E 4R1FA 3PYGA 4GKKI 5K36F 2IESA 1NHHA 5GMDA 3H4LA 2C37A 4B3SE 3ZKDA 4DPWA 1KTVA 4HYMA 3KRNA 3WU5A 5C0XD 4LF6E 4DV1E 3PS2A 1H72C 4LF4E 1XXEA 2DEJA 4LFBE 4K0KI 3J81Q 4GQUA 2BA1D 5LMNE 4OX9I 1R6MA 4JI1I 4DR4E 4FWGA 4B3ME 4FW9A 1B63A 4X66I 1VI7A 4DV2I 4DR6E 4B3RI 4LF8E 1HNXI 1Z0GA 1Z5AA 5BR8I 2GS8A 2PO0A 4U3DA 2C39A 4BA2A 4JI7I 4IZKA 3ZKBA 3HJCA 3K17A 3B8HA 4N3OA 1H7UA 1N33E 5JEAF 3QT8A 2UXBE 2PO2B 4MU0A 5K36E 2Z5CB 4DR2E 1KKHA 5FLXC 4FW4A 2E5LE 2WNRA 4JI8I 1BKNA 5K36C 4JI1E 1IBKE 5K36A 2X7IA 1ZM3A 2JT2A 4DV7I 4JI6E 4DPUA 1HNXE 2F4VI 5BR8E 2WW4A 3K1JA 3CDIA 4LF5I 2ZITA 4OO1E 3GLLA 3M6AA 4YY3I 3PS3A 5IWAE 2NN6F 4USKA 2C38B 2CGEA 4OO1C 2ZBKB 2UUCE 4OO1D 1WUUA 3JAMC 3D4JA 5JEAE 4OZEA 2UXCE 4DR7I 4OO1A 2F1DA 4AIDA 3GONA 4FW6A 2A2DA 4B3TE 5JEAC 3P76A 1PKPA 4LOMA 3V2UC 4DUZE 4NBQA 5JEAA 4RPFA 4MU3A 5C0XF 3WU6A 4LFAE 1OJ4A 4LF9I 3U1YA 1B62A 4LPFA 4MDTA 4DPXA 4IZJB 2XEXA 2ZM6E 2X36A 3ZZTA 2PNMA 3PYEA 4B3SI 1Z5BA 3B4TA 4LF6I 4ZVIA 4DV1I 3M85D 4LCFA 1UDOA 1Z0WA 2NN6E 4LF4I 4LFBI 3L7ZB 5LMNI 1N34E 1E3PA 4DR4I 2NN6C 4X62E 3J80C 4B3MI 1FI4A 3DD6A 4MYUA 2J65A 4DR6I 1XNQE 4DV0E 4LF8I 1Z0EA 1USVA 1ZM2A 1Y4SA 5LMUE 3M7NG 5C0XE 2CVEA 2HHHE 1OYSA 4DV6E 5L3JA 2GQ0A 1HR0E 1NZ0A 2BA0G 1N33I 2UXBI 5C0XC 2DEIA 4DR2I 3LPSA 3P3GA 3J81C 4ED4A 5C0XA 4JI4E 2E5LI 1OYRA 3V5RA 4FW7A 4KHPE 4P52A 1IBKI 3K85A 2UUAE 2O3ZA 4DR5E 1FKAE 4OO1F 4UT4A 4AQYE 4KQVA 4DU7A 4JI6I 4IZJD 1IBLI 2JEAB 4IFDE 4IS9A 4DXLA 4IZJA 2V8PA 4LFCE 2JEBA 5IT9C 3U1KA 5IWAI 4PRVA 5IT9Q 2WP8B 2PO1B 4IFDD 1Y5YA 1J5EE 5DRRA 2UUCI 1DARA 4PU9A 4IFDA 2UXCI 1XMOE 1HNZE 4WUDA 2BA1G 4DR1E 1R6LA 2UU9E 4WUBA 2Q2EB 1S4EA 4DUYE 2V34A 1I94E 4U3BA 4B3TI 4QNKA 4DPTA 4ISAA 4DUZI 4FN5A 1IBLE 1FNMA 2R42A 4FWHA 4LFAI 3J7AG 2Z5BB 3CDJA 5ELWA 3PYFA 4GKJE 1FJGE 1N32E 5GMEA 2CZ9A 1PIEA 2ZM6I 1XMQE 4JI5I 4DV3I 2UUBE 4I3HA 4DR3E 3PRYA 1PVGA 2BR2B 2E1RA 1A6FA 1NHIA 1Y4UA 1FWLA 4YHHE 4X64E 3WU3A 3Q6MA 4OKGA 1ZM4A 4HACB 1N34I 4X62I 2A2CA 1IBME 5DNXA 3Q6NA 3ZZ0A 2C37B 3T1HE 1HK7A 1XNQI 2JEAA 4DV0I 4EMDA 1XNRE 5LMUI 4JI2E 3UHMA 3P06A 1Z0BA 3T1YE 4DV4E 2HHHI 4UTGA 2VQFI 4DV6I 2V2VA 1HR0I 4JI5E 2WP8A 2BM1A 1YH8A 2PO2A 3OTOI 4DV3E 2O1TA 2PO1A 2Z5CA 1EA6A 2IOPA 1VISA 4Z7YA 3WU4A 1OYPA 1UEKA 1H73A 4JI4I 4JV5E 1UDSA 1MG7A 5A2QC 1N36E 1HNWE 1KVKA 5EKWA 5A2QQ 2VESA 4KHPI 4BA2B 4IZKB 3NZKA 4IFDF 2UUAI 4DR5I 2V2ZA 1MU5A 4AQYI 4M1KA 2Z5BA 4MU1A 1U2RA 4JI3E 4LFCI 2EFGA 4J3DA 4AIMA 2VQFE 3F0NA 2UXDE 1H74A 3P3CA 3OTOE 4MQYA 2C38A 4JI0E 4NXNE 1J5EI 3M85G 2JE6B 1N0VC 5K36B 4P7AA 2VF3A 4LF7I 4PRXA 1XMOI 1HNZI 4DR1I 5DRPA 2UU9I 1I94I 4DUYI 4LCHA 2AJ4A 1QZRA 4XTJA 3GCMA 4MU4A 4DV5E 3QT6A 3PYDA 2IOQA 1ELOA 5DRQA 1RR9A
chains in the Genus database with same CATH topology
4JYAE 3LNUA 1ZM9A 2BV3A 3ZM7A 4GKJI 1FJGI 1N32I 4NXME 3B82A 1XMQI 3QT7A 2VQEE 2UUBI 4X65E 3CWVA 4DR3I 1ZXNA 4WUCA 4HY1A 2V2QA 1N0UA 1EI1A 4LF7E 4YHHI 4X64I 4DPYA 1Y6ZA 4GKKE 4JG4A 1RREA 1IBMI 1D6TA 2PNLA 2J7KA 2HFUA 3T1HI 2HK2A 2NPFA 1XNRI 2O1VA 4JI2I 2O1WA 3T1YI 4DV4I 5FLXQ 4K0KE 3ZZUA 4OX9E 1S16A 4HXZA 4URLA 2Z5EA 4X66E 4DV2E 4B3RE 4DU8A 4JV5I 1FWKA 1N36I 1HNWI 4FWDA 1ZXMA 4JI7E 1K47A 1Z0VA 2BM0A 1KIJA 3B78A 3HULA 4JI3I 3JAMQ 4JI8E 2UXDI 4Z7CA 5LL6R 4USMA 5FWKA 2CG9A 3LTOA 4JI0I 1MX0A 4NXNI 4DV7E 2F4VE 4MYTA 1Z0CA 1Z59A 4LF5E 4YY3E 4DV5I 1Z0TA 2OI2A 2HKJA 4JYAI 4DR7E 1NHJA 1Z5CA 3Q1QA 4NXMI 1XHKA 2VQEI 4X65I 2LJPA 2HK3A 3J7AM 2HFSA 1H7SA 2R3VA 2O1UA 3J80Q 3QT5A 1USUA 2HKEA 4HACA 4LF9E 4R1FA 3PYGA 4GKKI 1NHHA 5GMDA 3H4LA 4B3SE 3ZKDA 4DPWA 1KTVA 4HYMA 3WU5A 4LF6E 4DV1E 1H72C 4LF4E 2DEJA 4LFBE 4K0KI 3J81Q 4OX9I 5LMNE 4JI1I 4DR4E 4FWGA 4B3ME 4FW9A 1B63A 4X66I 4DV2I 4DR6E 4B3RI 4LF8E 1HNXI 1Z0GA 1Z5AA 5BR8I 2GS8A 4JI7I 4IZKA 3ZKBA 3HJCA 3K17A 3B8HA 4N3OA 1H7UA 1N33E 3QT8A 2UXBE 2Z5CB 4DR2E 1KKHA 5FLXC 2E5LE 4JI8I 1BKNA 4JI1E 1IBKE 2X7IA 1ZM3A 4DV7I 4JI6E 4DPUA 1HNXE 2F4VI 5BR8E 2WW4A 3K1JA 4LF5I 2ZITA 3M6AA 4YY3I 5IWAE 4USKA 2CGEA 2ZBKB 2UUCE 1WUUA 3JAMC 3D4JA 2UXCE 4DR7I 3GONA 2A2DA 4B3TE 1PKPA 3V2UC 4DUZE 4RPFA 3WU6A 4LFAE 1OJ4A 4LF9I 1B62A 4DPXA 4IZJB 2XEXA 2ZM6E 2X36A 3ZZTA 2PNMA 3PYEA 4B3SI 1Z5BA 4LF6I 4ZVIA 4DV1I 1Z0WA 4LF4I 4LFBI 5LMNI 1N34E 4DR4I 4X62E 3J80C 4B3MI 1FI4A 4MYUA 4DR6I 1XNQE 4DV0E 4LF8I 1Z0EA 1USVA 1ZM2A 1Y4SA 5LMUE 2HHHE 4DV6E 5L3JA 2GQ0A 1HR0E 1NZ0A 1N33I 2UXBI 2DEIA 4DR2I 3LPSA 3J81C 4ED4A 4JI4E 2E5LI 3V5RA 4KHPE 4P52A 1IBKI 3K85A 2UUAE 4DR5E 1FKAE 4UT4A 4AQYE 4KQVA 4DU7A 4JI6I 4IZJD 1IBLI 4DXLA 4IZJA 2V8PA 4LFCE 5IT9C 5IWAI 4PRVA 5IT9Q 1J5EE 2UUCI 1DARA 4PU9A 2UXCI 1XMOE 1HNZE 4WUDA 4DR1E 2UU9E 4WUBA 2Q2EB 1S4EA 4DUYE 2V34A 1I94E 4B3TI 4DPTA 4DUZI 4FN5A 1IBLE 1FNMA 2R42A 4FWHA 4LFAI 3J7AG 2Z5BB 3PYFA 4GKJE 1FJGE 1N32E 5GMEA 2CZ9A 1PIEA 2ZM6I 1XMQE 4JI5I 4DV3I 2UUBE 4I3HA 4DR3E 3PRYA 1PVGA 2E1RA 1A6FA 1NHIA 1Y4UA 1FWLA 4YHHE 4X64E 3WU3A 3Q6MA 1ZM4A 4HACB 1N34I 4X62I 2A2CA 1IBME 3Q6NA 3ZZ0A 3T1HE 1HK7A 1XNQI 4DV0I 4EMDA 1XNRE 5LMUI 4JI2E 3P06A 1Z0BA 3T1YE 4DV4E 2HHHI 4UTGA 2VQFI 4DV6I 2V2VA 1HR0I 4JI5E 3OTOI 2BM1A 4DV3E 2O1TA 2Z5CA 1EA6A 2IOPA 1VISA 4Z7YA 3WU4A 1UEKA 1H73A 4JI4I 4JV5E 5A2QC 1MG7A 1N36E 1HNWE 1KVKA 5A2QQ 4KHPI 4IZKB 2UUAI 4DR5I 2V2ZA 1MU5A 4AQYI 4M1KA 2Z5BA 1U2RA 4JI3E 4LFCI 2EFGA 2VQFE 2UXDE 3F0NA 1H74A 3OTOE 4JI0E 4NXNE 1J5EI 1N0VC 4P7AA 2VF3A 4LF7I 4PRXA 1XMOI 1HNZI 4DR1I 2UU9I 1I94I 4DUYI 2AJ4A 1QZRA 4XTJA 4DV5E 3QT6A 3PYDA 2IOQA 1ELOA 1RR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  3LNU A;  1ZM9 A;  2BV3 A;  3ZM7 A;  4GKJ I;  1FJG I;  1N32 I;  4NXM E;  3B82 A;  1XMQ I;  3QT7 A;  2VQE E;  2UUB I;  4X65 E;  3CWV A;  4DR3 I;  1ZXN A;  4WUC A;  4HY1 A;  2V2Q A;  1N0U A;  1EI1 A;  4LF7 E;  4YHH I;  4X64 I;  4DPY A;  4GKK E;  4JG4 A;  1RRE A;  1IBM I;  1D6T A;  2J7K A;  2HFU A;  3T1H I;  2HK2 A;  2NPF A;  1XNR I;  4JI2 I;  3T1Y I;  4DV4 I;  5FLX Q;  4K0K E;  3ZZU A;  4OX9 E;  1S16 A;  4HXZ A;  4URL A;  4X66 E;  4DV2 E;  4B3R E;  4DU8 A;  4JV5 I;  1FWK A;  1N36 I;  1HNW I;  4FWD A;  1ZXM A;  4JI7 E;  1K47 A;  1Z0V A;  2BM0 A;  1KIJ A;  3B78 A;  3HUL A;  4JI3 I;  3JAM Q;  4JI8 E;  2UXD I;  4Z7C A;  5LL6 R;  4USM A;  3LTO A;  4JI0 I;  1MX0 A;  4NXN I;  4DV7 E;  2F4V E;  4MYT A;  1Z0C A;  1Z59 A;  4LF5 E;  4YY3 E;  4DV5 I;  1Z0T A;  2OI2 A;  2HKJ A;  4JYA I;  4DR7 E;  1NHJ A;  1Z5C A;  3Q1Q A;  4NXM I;  1XHK A;  2VQE I;  4X65 I;  2LJP A;  2HK3 A;  3J7A M;  2HFS A;  1H7S A;  2R3V A;  3J80 Q;  3QT5 A;  2HKE A;  4HAC A;  4LF9 E;  4R1F A;  3PYG A;  4GKK I;  1NHH A;  5GMD A;  3H4L A;  4B3S E;  3ZKD A;  4DPW A;  1KTV A;  4HYM A;  3WU5 A;  4LF6 E;  4DV1 E;  1H72 C;  4LF4 E;  2DEJ A;  4LFB E;  4K0K I;  3J81 Q;  4OX9 I;  5LMN E;  4JI1 I;  4DR4 E;  4FWG A;  4B3M E;  4FW9 A;  1B63 A;  4X66 I;  4DV2 I;  4DR6 E;  4B3R I;  4LF8 E;  1HNX I;  1Z0G A;  1Z5A A;  5BR8 I;  2GS8 A;  4JI7 I;  3ZKB A;  3K17 A;  3B8H A;  1H7U A;  1N33 E;  3QT8 A;  2UXB E;  4DR2 E;  1KKH A;  5FLX C;  2E5L E;  4JI8 I;  1BKN A;  4JI1 E;  1IBK E;  2X7I A;  1ZM3 A;  4DV7 I;  4JI6 E;  4DPU A;  1HNX E;  2F4V I;  5BR8 E;  2WW4 A;  3K1J A;  4LF5 I;  2ZIT A;  3M6A A;  4YY3 I;  5IWA E;  4USK A;  2ZBK B;  2UUC E;  1WUU A;  3JAM C;  3D4J A;  2UXC E;  4DR7 I;  3GON A;  2A2D A;  4B3T E;  1PKP A;  3V2U C;  4DUZ E;  4RPF A;  3WU6 A;  4LFA E;  1OJ4 A;  4LF9 I;  1B62 A;  4DPX A;  2XEX A;  2ZM6 E;  2X36 A;  3ZZT A;  3PYE A;  4B3S I;  1Z5B A;  4LF6 I;  4ZVI A;  4DV1 I;  1Z0W A;  4LF4 I;  4LFB I;  5LMN I;  1N34 E;  4DR4 I;  4X62 E;  3J80 C;  4B3M I;  1FI4 A;  4MYU A;  4DR6 I;  1XNQ E;  4DV0 E;  4LF8 I;  1Z0E A;  1ZM2 A;  5LMU E;  2HHH E;  4DV6 E;  5L3J A;  1HR0 E;  1NZ0 A;  1N33 I;  2UXB I;  2DEI A;  4DR2 I;  3LPS A;  3J81 C;  4ED4 A;  4JI4 E;  2E5L I;  3V5R A;  4KHP E;  4P52 A;  1IBK I;  2UUA E;  4DR5 E;  1FKA E;  4UT4 A;  4AQY E;  4KQV A;  4DU7 A;  4JI6 I;  1IBL I;  4DXL A;  2V8P A;  4LFC E;  5IT9 C;  5IWA I;  4PRV A;  5IT9 Q;  1J5E E;  2UUC I;  1DAR A;  4PU9 A;  2UXC I;  1XMO E;  1HNZ E;  4WUD A;  4DR1 E;  2UU9 E;  4WUB A;  2Q2E B;  1S4E A;  4DUY E;  2V34 A;  1I94 E;  4B3T I;  4DPT A;  4DUZ I;  4FN5 A;  1IBL E;  1FNM A;  2R42 A;  4FWH A;  4LFA I;  3J7A G;  3PYF A;  4GKJ E;  1FJG E;  1N32 E;  5GME A;  2CZ9 A;  1PIE A;  2ZM6 I;  1XMQ E;  4JI5 I;  4DV3 I;  2UUB E;  4I3H A;  4DR3 E;  1PVG A;  2E1R A;  1A6F A;  1NHI A;  1FWL A;  4YHH E;  4X64 E;  3WU3 A;  1ZM4 A;  4HAC B;  1N34 I;  4X62 I;  2A2C A;  1IBM E;  3ZZ0 A;  3T1H E;  1XNQ I;  4DV0 I;  4EMD A;  1XNR E;  5LMU I;  4JI2 E;  1Z0B A;  3T1Y E;  4DV4 E;  2HHH I;  4UTG A;  2VQF I;  4DV6 I;  2V2V A;  1HR0 I;  4JI5 E;  3OTO I;  2BM1 A;  4DV3 E;  1EA6 A;  1VIS A;  4Z7Y A;  3WU4 A;  1UEK A;  1H73 A;  4JI4 I;  4JV5 E;  5A2Q C;  1MG7 A;  1N36 E;  1HNW E;  1KVK A;  5A2Q Q;  4KHP I;  2UUA I;  4DR5 I;  2V2Z A;  1MU5 A;  4AQY I;  4M1K A;  1U2R A;  4JI3 E;  4LFC I;  2EFG A;  2VQF E;  2UXD E;  3F0N A;  1H74 A;  3OTO E;  4JI0 E;  4NXN E;  1J5E I;  1N0V C;  4P7A A;  2VF3 A;  4LF7 I;  4PRX A;  1XMO I;  1HNZ I;  4DR1 I;  2UU9 I;  1I94 I;  4DUY I;  2AJ4 A;  1QZR A;  4XTJ A;  4DV5 E;  3QT6 A;  3PYD A;  1ELO A;  1RR9 A; 
#chains in the Genus database with same CATH topology
 3HKM A;  4JYA E;  3LNU A;  1ZM9 A;  2BV3 A;  3ZM7 A;  4GKJ I;  1FJG I;  1N32 I;  4FW5 A;  4OO1 B;  4NXM E;  3B82 A;  1XMQ I;  3QT7 A;  4IFD C;  2VQE E;  2UUB I;  4X65 E;  3CWV A;  4DR3 I;  1ZXN A;  4WUC A;  2GO4 A;  4HY1 A;  2V2Q A;  1N0U A;  2IER A;  1EI1 A;  4LF7 E;  4YHH I;  5JEA B;  4X64 I;  3L7Z A;  3PS1 A;  4DPY A;  1Y6Z A;  4GKK E;  4JG4 A;  1RRE A;  1RHY A;  1YHC A;  1IBM I;  1D6T A;  2PNL A;  5DRO A;  2J7K A;  2HFU A;  3T1H I;  2HK2 A;  2NPF A;  1XNR I;  2GO3 A;  2O1V A;  4JI2 I;  2O1W A;  3T1Y I;  4FW3 A;  4DV4 I;  5FLX Q;  4K0K E;  3ZZU A;  5K36 D;  4OX9 E;  1S16 A;  4HXZ A;  4URL A;  2JE6 A;  2Z5E A;  4X66 E;  4BA1 B;  4DV2 E;  4B3R E;  2PNZ B;  4DU8 A;  3GME A;  4JV5 I;  1FWK A;  2NN6 B;  1N36 I;  1HNW I;  1P42 A;  4FWD A;  1ZXM A;  4JI7 E;  1K47 A;  1Z0V A;  3P3E A;  2BM0 A;  1KIJ A;  3B78 A;  3HUL A;  4JI3 I;  3JAM Q;  1E3H A;  4JI8 E;  4AM3 A;  1Y60 A;  2UXD I;  5C0X B;  4Z7C A;  5LL6 R;  4USM A;  5FWK A;  2CG9 A;  3LTO A;  4JI0 I;  1MX0 A;  4NXN I;  5JEA D;  3H1C A;  4DV7 E;  2F4V E;  4MYT A;  1Z0C A;  1Z59 A;  4QNJ A;  1UDQ A;  4LF5 E;  2PO0 B;  2C39 B;  5EL9 A;  4YY3 E;  4DV5 I;  3M7N D;  2JEB B;  1Z0T A;  2OI2 A;  2BA0 D;  1UDN A;  2HKJ A;  4JYA I;  5DNL A;  4DR7 E;  1NHJ A;  4LCG A;  4IFD B;  2WNR B;  1Z5C A;  3Q1Q A;  4NXM I;  1XHK A;  2VQE I;  2BR2 A;  2LJP A;  2HK3 A;  4X65 I;  3J7A M;  4BA1 A;  2NN6 D;  2HFS A;  1H7S A;  2R3V A;  2PNZ A;  2O1U A;  3J80 Q;  2NN6 A;  3QT5 A;  1USU A;  2HKE A;  2AE8 A;  4HAC A;  4LF9 E;  4R1F A;  3PYG A;  4GKK I;  5K36 F;  2IES A;  1NHH A;  5GMD A;  3H4L A;  2C37 A;  4B3S E;  3ZKD A;  4DPW A;  1KTV A;  4HYM A;  3KRN A;  3WU5 A;  5C0X D;  4LF6 E;  4DV1 E;  3PS2 A;  1H72 C;  4LF4 E;  1XXE A;  2DEJ A;  4LFB E;  4K0K I;  3J81 Q;  4GQU A;  2BA1 D;  5LMN E;  4OX9 I;  1R6M A;  4JI1 I;  4DR4 E;  4FWG A;  4B3M E;  4FW9 A;  1B63 A;  4X66 I;  1VI7 A;  4DV2 I;  4DR6 E;  4B3R I;  4LF8 E;  1HNX I;  1Z0G A;  1Z5A A;  5BR8 I;  2GS8 A;  2PO0 A;  4U3D A;  2C39 A;  4BA2 A;  4JI7 I;  4IZK A;  3ZKB A;  3HJC A;  3K17 A;  3B8H A;  4N3O A;  1H7U A;  1N33 E;  5JEA F;  3QT8 A;  2UXB E;  2PO2 B;  4MU0 A;  5K36 E;  2Z5C B;  4DR2 E;  1KKH A;  5FLX C;  4FW4 A;  2E5L E;  2WNR A;  4JI8 I;  1BKN A;  5K36 C;  4JI1 E;  1IBK E;  5K36 A;  2X7I A;  1ZM3 A;  2JT2 A;  4DV7 I;  4JI6 E;  4DPU A;  1HNX E;  2F4V I;  5BR8 E;  2WW4 A;  3K1J A;  3CDI A;  4LF5 I;  2ZIT A;  4OO1 E;  3GLL A;  3M6A A;  4YY3 I;  3PS3 A;  5IWA E;  2NN6 F;  4USK A;  2C38 B;  2CGE A;  4OO1 C;  2ZBK B;  2UUC E;  4OO1 D;  1WUU A;  3JAM C;  3D4J A;  5JEA E;  4OZE A;  2UXC E;  4DR7 I;  4OO1 A;  2F1D A;  4AID A;  3GON A;  4FW6 A;  2A2D A;  4B3T E;  5JEA C;  3P76 A;  1PKP A;  4LOM A;  3V2U C;  4DUZ E;  4NBQ A;  5JEA A;  4RPF A;  4MU3 A;  5C0X F;  3WU6 A;  4LFA E;  1OJ4 A;  4LF9 I;  3U1Y A;  1B62 A;  4LPF A;  4MDT A;  4DPX A;  4IZJ B;  2XEX A;  2ZM6 E;  2X36 A;  3ZZT A;  2PNM A;  3PYE A;  4B3S I;  1Z5B A;  3B4T A;  4LF6 I;  4ZVI A;  4DV1 I;  3M85 D;  4LCF A;  1UDO A;  1Z0W A;  2NN6 E;  4LF4 I;  4LFB I;  3L7Z B;  5LMN I;  1N34 E;  1E3P A;  4DR4 I;  2NN6 C;  4X62 E;  3J80 C;  4B3M I;  1FI4 A;  3DD6 A;  4MYU A;  2J65 A;  4DR6 I;  1XNQ E;  4DV0 E;  4LF8 I;  1Z0E A;  1USV A;  1ZM2 A;  1Y4S A;  5LMU E;  3M7N G;  5C0X E;  2CVE A;  2HHH E;  1OYS A;  4DV6 E;  5L3J A;  2GQ0 A;  1HR0 E;  1NZ0 A;  2BA0 G;  1N33 I;  2UXB I;  5C0X C;  2DEI A;  4DR2 I;  3LPS A;  3P3G A;  3J81 C;  4ED4 A;  5C0X A;  4JI4 E;  2E5L I;  1OYR A;  3V5R A;  4FW7 A;  4KHP E;  4P52 A;  1IBK I;  3K85 A;  2UUA E;  2O3Z A;  4DR5 E;  1FKA E;  4OO1 F;  4UT4 A;  4AQY E;  4KQV A;  4DU7 A;  4JI6 I;  4IZJ D;  1IBL I;  2JEA B;  4IFD E;  4IS9 A;  4DXL A;  4IZJ A;  2V8P A;  4LFC E;  2JEB A;  5IT9 C;  3U1K A;  5IWA I;  4PRV A;  5IT9 Q;  2WP8 B;  2PO1 B;  4IFD D;  1Y5Y A;  1J5E E;  5DRR A;  2UUC I;  1DAR A;  4PU9 A;  4IFD A;  2UXC I;  1XMO E;  1HNZ E;  4WUD A;  2BA1 G;  4DR1 E;  1R6L A;  2UU9 E;  4WUB A;  2Q2E B;  1S4E A;  4DUY E;  2V34 A;  1I94 E;  4U3B A;  4B3T I;  4QNK A;  4DPT A;  4ISA A;  4DUZ I;  4FN5 A;  1IBL E;  1FNM A;  2R42 A;  4FWH A;  4LFA I;  3J7A G;  2Z5B B;  3CDJ A;  5ELW A;  3PYF A;  4GKJ E;  1FJG E;  1N32 E;  5GME A;  2CZ9 A;  1PIE A;  2ZM6 I;  1XMQ E;  4JI5 I;  4DV3 I;  2UUB E;  4I3H A;  4DR3 E;  3PRY A;  1PVG A;  2BR2 B;  2E1R A;  1A6F A;  1NHI A;  1Y4U A;  1FWL A;  4YHH E;  4X64 E;  3WU3 A;  3Q6M A;  4OKG A;  1ZM4 A;  4HAC B;  1N34 I;  4X62 I;  2A2C A;  1IBM E;  5DNX A;  3Q6N A;  3ZZ0 A;  2C37 B;  3T1H E;  1HK7 A;  1XNQ I;  2JEA A;  4DV0 I;  4EMD A;  1XNR E;  5LMU I;  4JI2 E;  3UHM A;  3P06 A;  1Z0B A;  3T1Y E;  4DV4 E;  2HHH I;  4UTG A;  2VQF I;  4DV6 I;  2V2V A;  1HR0 I;  4JI5 E;  2WP8 A;  2BM1 A;  1YH8 A;  2PO2 A;  3OTO I;  4DV3 E;  2O1T A;  2PO1 A;  2Z5C A;  1EA6 A;  2IOP A;  1VIS A;  4Z7Y A;  3WU4 A;  1OYP A;  1UEK A;  1H73 A;  4JI4 I;  4JV5 E;  1UDS A;  1MG7 A;  5A2Q C;  1N36 E;  1HNW E;  1KVK A;  5EKW A;  5A2Q Q;  2VES A;  4KHP I;  4BA2 B;  4IZK B;  3NZK A;  4IFD F;  2UUA I;  4DR5 I;  2V2Z A;  1MU5 A;  4AQY I;  4M1K A;  2Z5B A;  4MU1 A;  1U2R A;  4JI3 E;  4LFC I;  2EFG A;  4J3D A;  4AIM A;  2VQF E;  3F0N A;  2UXD E;  1H74 A;  3P3C A;  3OTO E;  4MQY A;  2C38 A;  4JI0 E;  4NXN E;  1J5E I;  3M85 G;  2JE6 B;  1N0V C;  5K36 B;  4P7A A;  2VF3 A;  4LF7 I;  4PRX A;  1XMO I;  1HNZ I;  4DR1 I;  5DRP A;  2UU9 I;  1I94 I;  4DUY I;  4LCH A;  2AJ4 A;  1QZR A;  4XTJ A;  3GCM A;  4MU4 A;  4DV5 E;  3QT6 A;  3PYD A;  2IOQ A;  1ELO A;  5DRQ A;  1RR9 A; 
#chains in the Genus database with same CATH homology
 4JYA E;  3LNU A;  1ZM9 A;  2BV3 A;  3ZM7 A;  4GKJ I;  1FJG I;  1N32 I;  4NXM E;  3B82 A;  1XMQ I;  3QT7 A;  2VQE E;  2UUB I;  4X65 E;  3CWV A;  4DR3 I;  1ZXN A;  4WUC A;  4HY1 A;  2V2Q A;  1N0U A;  1EI1 A;  4LF7 E;  4YHH I;  4X64 I;  4DPY A;  1Y6Z A;  4GKK E;  4JG4 A;  1RRE A;  1IBM I;  1D6T A;  2PNL A;  2J7K A;  2HFU A;  3T1H I;  2HK2 A;  2NPF A;  1XNR I;  2O1V A;  4JI2 I;  2O1W A;  3T1Y I;  4DV4 I;  5FLX Q;  4K0K E;  3ZZU A;  4OX9 E;  1S16 A;  4HXZ A;  4URL A;  2Z5E A;  4X66 E;  4DV2 E;  4B3R E;  4DU8 A;  4JV5 I;  1FWK A;  1N36 I;  1HNW I;  4FWD A;  1ZXM A;  4JI7 E;  1K47 A;  1Z0V A;  2BM0 A;  1KIJ A;  3B78 A;  3HUL A;  4JI3 I;  3JAM Q;  4JI8 E;  2UXD I;  4Z7C A;  5LL6 R;  4USM A;  5FWK A;  2CG9 A;  3LTO A;  4JI0 I;  1MX0 A;  4NXN I;  4DV7 E;  2F4V E;  4MYT A;  1Z0C A;  1Z59 A;  4LF5 E;  4YY3 E;  4DV5 I;  1Z0T A;  2OI2 A;  2HKJ A;  4JYA I;  4DR7 E;  1NHJ A;  1Z5C A;  3Q1Q A;  4NXM I;  1XHK A;  2VQE I;  4X65 I;  2LJP A;  2HK3 A;  3J7A M;  2HFS A;  1H7S A;  2R3V A;  2O1U A;  3J80 Q;  3QT5 A;  1USU A;  2HKE A;  4HAC A;  4LF9 E;  4R1F A;  3PYG A;  4GKK I;  1NHH A;  5GMD A;  3H4L A;  4B3S E;  3ZKD A;  4DPW A;  1KTV A;  4HYM A;  3WU5 A;  4LF6 E;  4DV1 E;  1H72 C;  4LF4 E;  2DEJ A;  4LFB E;  4K0K I;  3J81 Q;  4OX9 I;  5LMN E;  4JI1 I;  4DR4 E;  4FWG A;  4B3M E;  4FW9 A;  1B63 A;  4X66 I;  4DV2 I;  4DR6 E;  4B3R I;  4LF8 E;  1HNX I;  1Z0G A;  1Z5A A;  5BR8 I;  2GS8 A;  4JI7 I;  4IZK A;  3ZKB A;  3HJC A;  3K17 A;  3B8H A;  4N3O A;  1H7U A;  1N33 E;  3QT8 A;  2UXB E;  2Z5C B;  4DR2 E;  1KKH A;  5FLX C;  2E5L E;  4JI8 I;  1BKN A;  4JI1 E;  1IBK E;  2X7I A;  1ZM3 A;  4DV7 I;  4JI6 E;  4DPU A;  1HNX E;  2F4V I;  5BR8 E;  2WW4 A;  3K1J A;  4LF5 I;  2ZIT A;  3M6A A;  4YY3 I;  5IWA E;  4USK A;  2CGE A;  2ZBK B;  2UUC E;  1WUU A;  3JAM C;  3D4J A;  2UXC E;  4DR7 I;  3GON A;  2A2D A;  4B3T E;  1PKP A;  3V2U C;  4DUZ E;  4RPF A;  3WU6 A;  4LFA E;  1OJ4 A;  4LF9 I;  1B62 A;  4DPX A;  4IZJ B;  2XEX A;  2ZM6 E;  2X36 A;  3ZZT A;  2PNM A;  3PYE A;  4B3S I;  1Z5B A;  4LF6 I;  4ZVI A;  4DV1 I;  1Z0W A;  4LF4 I;  4LFB I;  5LMN I;  1N34 E;  4DR4 I;  4X62 E;  3J80 C;  4B3M I;  1FI4 A;  4MYU A;  4DR6 I;  1XNQ E;  4DV0 E;  4LF8 I;  1Z0E A;  1USV A;  1ZM2 A;  1Y4S A;  5LMU E;  2HHH E;  4DV6 E;  5L3J A;  2GQ0 A;  1HR0 E;  1NZ0 A;  1N33 I;  2UXB I;  2DEI A;  4DR2 I;  3LPS A;  3J81 C;  4ED4 A;  4JI4 E;  2E5L I;  3V5R A;  4KHP E;  4P52 A;  1IBK I;  3K85 A;  2UUA E;  4DR5 E;  1FKA E;  4UT4 A;  4AQY E;  4KQV A;  4DU7 A;  4JI6 I;  4IZJ D;  1IBL I;  4DXL A;  4IZJ A;  2V8P A;  4LFC E;  5IT9 C;  5IWA I;  4PRV A;  5IT9 Q;  1J5E E;  2UUC I;  1DAR A;  4PU9 A;  2UXC I;  1XMO E;  1HNZ E;  4WUD A;  4DR1 E;  2UU9 E;  4WUB A;  2Q2E B;  1S4E A;  4DUY E;  2V34 A;  1I94 E;  4B3T I;  4DPT A;  4DUZ I;  4FN5 A;  1IBL E;  1FNM A;  2R42 A;  4FWH A;  4LFA I;  3J7A G;  2Z5B B;  3PYF A;  4GKJ E;  1FJG E;  1N32 E;  5GME A;  2CZ9 A;  1PIE A;  2ZM6 I;  1XMQ E;  4JI5 I;  4DV3 I;  2UUB E;  4I3H A;  4DR3 E;  3PRY A;  1PVG A;  2E1R A;  1A6F A;  1NHI A;  1Y4U A;  1FWL A;  4YHH E;  4X64 E;  3WU3 A;  3Q6M A;  1ZM4 A;  4HAC B;  1N34 I;  4X62 I;  2A2C A;  1IBM E;  3Q6N A;  3ZZ0 A;  3T1H E;  1HK7 A;  1XNQ I;  4DV0 I;  4EMD A;  1XNR E;  5LMU I;  4JI2 E;  3P06 A;  1Z0B A;  3T1Y E;  4DV4 E;  2HHH I;  4UTG A;  2VQF I;  4DV6 I;  2V2V A;  1HR0 I;  4JI5 E;  3OTO I;  2BM1 A;  4DV3 E;  2O1T A;  2Z5C A;  1EA6 A;  2IOP A;  1VIS A;  4Z7Y A;  3WU4 A;  1UEK A;  1H73 A;  4JI4 I;  4JV5 E;  5A2Q C;  1MG7 A;  1N36 E;  1HNW E;  1KVK A;  5A2Q Q;  4KHP I;  4IZK B;  2UUA I;  4DR5 I;  2V2Z A;  1MU5 A;  4AQY I;  4M1K A;  2Z5B A;  1U2R A;  4JI3 E;  4LFC I;  2EFG A;  2VQF E;  2UXD E;  3F0N A;  1H74 A;  3OTO E;  4JI0 E;  4NXN E;  1J5E I;  1N0V C;  4P7A A;  2VF3 A;  4LF7 I;  4PRX A;  1XMO I;  1HNZ I;  4DR1 I;  2UU9 I;  1I94 I;  4DUY I;  2AJ4 A;  1QZR A;  4XTJ A;  4DV5 E;  3QT6 A;  3PYD A;  2IOQ A;  1ELO A;  1RR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...