1Z0WA

Crystal structure of a. fulgidus lon proteolytic domain at 1.2a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
203
Chain Sequence
b'YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 64
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0wA00
1HNXE 4LF8E 1H7UA 3ZZTA 4DPTA 4DV1I 4JI4I 1KKHA 5LMNE 1XNQI 4DV3E 4X62I 3V2UC 2E5LE 4K0KE 1DARA 2R42A 3PYDA 1XMOI 3WU4A 3V5RA 1N32E 1HNWI 3K1JA 4LFAE 2X7IA 1ZXMA 4DU7A 5IWAE 4DV0I 2ZBKB 3QT6A 4JYAI 1PIEA 2V2VA 4LF6I 4MYTA 1N0UA 4HACA 3B78A 4JI1I 5IT9C 1ZM2A 4DR7E 1PVGA 1NZ0A 1S4EA 3F0NA 2BV3A 5A2QC 2OI2A 3J81C 5BR8I 2A2DA 1NHHA 1Z0BA 4GKKI 4PRVA 4DV1E 4JI4E 4LF5E 4DR3I 2V34A 4X62E 2UXBI 3H4LA 2UUBI 3WU3A 4P7AA 4DU8A 4HXZA 3T1HI 4I3HA 1XMOE 4FW9A 1FI4A 1Z5CA 1Z0TA 4UTGA 4DXLA 3LNUA 4JYAE 2BM0A 1FNMA 4LF6E 1N36I 2LJPA 4DR2E 1H74A 4JI7I 4YY3I 4B3TI 4JI2I 4B3MI 3GONA 2XEXA 5BR8E 1B62A 2WW4A 2HFUA 1D6TA 2VQFI 4ED4A 4GKKE 4JV5I 2HKEA 1IBLI 1Z59A 4DR3E 2UXBE 4ZVIA 4DR6I 3J80Q 1EI1A 3T1HE 4KHPI 2R3VA 1MG7A 3CWVA 4HYMA 1FKAE 1Z0CA 1RR9A 4LF4I 3QT8A 4DV4I 2ZM6I 1N36E 4JI7E 4YY3E 1HR0I 4DR5I 4OX9I 4DV6I 4JI5I 4B3TE 1MU5A 4JI2E 1ELOA 4B3ME 1H72C 1ZM3A 2VQFE 4DPXA 4JV5E 4WUBA 1MX0A 1QZRA 1IBLE 5LMUI 4JI0I 4DR6E 2GS8A 4Z7CA 4DR4E 3HULA 1EA6A 4LF9I 1I94I 3QT7A 1K47A 5FLXQ 3OTOI 3PYGA 4B3RI 2ZM6E 2HK2A 1HR0E 5LL6R 4DR5E 4OX9E 4DV6E 4JI5E 4USMA 3J80C 1Z0GA 3JAMC 3ZKDA 1XNQE 2V2ZA 1ZXNA 2F4VI 1HNWE 5LMUE 4UT4A 5GMEA 4JI0E 4DUYI 4JI3I 3WU5A 4DV0E 2DEIA 2HFSA 1U2RA 4USKA 4DV2I 4DV7I 4DV5I 4X65I 3Q1QA 1I94E 4DPUA 4JI1E 4JI8I 2UXDI 3OTOE 4NXNI 1XNRI 4B3RE 4HACB 3B82A 1N34I 1BKNA 3D4JA 2AJ4A 1HNXI 2HK3A 1NHJA 2UUBE 1FJGI 4MYUA 1FWKA 5FLXC 2J7KA 4WUCA 2F4VE 5IT9Q 1OJ4A 4DUYE 5A2QQ 4JI3E 3J81Q 3PYEA 1IBKI 4DR1I 2UU9I 4DV7E 3K17A 2DEJA 4DV5E 1N33I 5IWAI 4M1KA 4X65E 2UUAI 4JI6I 2UXDE 1KVKA 4YHHI 2HKJA 2Q2EB 4NXNE 1XNRE 3ZZ0A 4FN5A 1PKPA 1N34E 4DPYA 4B3SI 4JG4A 4X66I 1FJGE 4LF5I 4KHPE 4GKJI 1HNZI 3B8HA 4LFCI 1ZM4A 3ZZUA 4NXMI 4LF7I 1S16A 1IBKE 4DR1E 4LF4E 4DV4E 2UU9E 1N33E 2UUCI 1ZM9A 4FWHA 4PRXA 1UEKA 1N0VC 2UUAE 4JI6E 4YHHE 4DR2I 1H7SA 4FWGA 3ZM7A 2EFGA 3T1YI 2CZ9A 2HHHI 1Z5AA 3ZKBA 1Z0VA 4LFBI 2UXCI 2ZITA 1VISA 4B3SE 3WU6A 3QT5A 3LTOA 2VQEI 4X66E 1XHKA 4GKJE 4DPWA 2NPFA 1FWLA 1Z0WA 1HNZE 4LFCE 4LF9E 2E1RA 1B63A 3LPSA 4HY1A 4DUZI 4NXME 4LF7E 2A2CA 1H73A 1Z0EA 4AQYI 4WUDA 1IBMI 2UUCE 1J5EI 4X64I 2V8PA 1KTVA 4P52A 3J7AG 2V2QA 1XMQI 1Z5BA 4FWDA 4LF8I 4EMDA 2VF3A 3T1YE 3M6AA 2HHHE 1WUUA 5LMNI 4LFBE 4DV3I 5GMDA 2UXCE 2E5LI 4K0KI 4R1FA 1NHIA 4PU9A 2VQEE 4Z7YA 1N32I 4XTJA 4LFAI 2X36A 4DV2E 1KIJA 3JAMQ 4DR4I 4DUZE 4JI8E 3PYFA 2BM1A 1RREA 4URLA 4AQYE 4RPFA 1IBME 1A6FA 3J7AM 1J5EE 4KQVA 4X64E 5L3JA 4DR7I 1XMQE
chains in the Genus database with same CATH superfamily
4QNJA 2JEBA 1HNXE 5DNXA 4LF8E 1H7UA 3ZZTA 2BA0G 5K36D 3HJCA 4DPTA 4DV1I 4JI4I 1KKHA 5LMNE 1XNQI 4DV3E 4X62I 3V2UC 2E5LE 4K0KE 4IFDF 4AIDA 2O1WA 1OYPA 1DARA 2R42A 1Y5YA 2C38B 3PYDA 3WU4A 1XMOI 3V5RA 1N32E 2GO3A 3PS3A 4BA2B 1HNWI 3K1JA 4LFAE 2X7IA 1ZXMA 2GQ0A 4DU7A 4MU1A 4OO1A 5K36C 5IWAE 4DV0I 2ZBKB 3QT6A 4JYAI 1PIEA 2V2VA 2WNRB 2PO2A 2C37A 4MQYA 4LF6I 4MYTA 5DROA 2BA0D 4LPFA 1N0UA 4HACA 5C0XF 4IFDB 3B78A 2Z5CB 4JI1I 5IT9C 2BR2B 1ZM2A 4DR7E 1PVGA 1NZ0A 1S4EA 3F0NA 2BV3A 5A2QC 2OI2A 3J81C 5BR8I 4IFDD 1Y4SA 2A2DA 1NHHA 2O1VA 1Z0BA 4GKKI 4PRVA 4DV1E 4JI4E 4LF5E 3P3EA 3B4TA 2IOPA 4DR3I 2V34A 4IZKA 4X62E 2VESA 2UXBI 3H4LA 2UUBI 3WU3A 4P7AA 4IS9A 4DU8A 4HXZA 3T1HI 4I3HA 1XMOE 5DRRA 4FW9A 1FI4A 1Z5CA 2JE6A 4FW7A 1Z0TA 4UTGA 2NN6C 3LNUA 4DXLA 5JEAA 4IFDE 4JYAE 2BM0A 1FNMA 4LF6E 4MU4A 1N36I 2LJPA 4DR2E 1H74A 4JI7I 4LCGA 4YY3I 2PO2B 2C37B 4B3TI 4JI2I 4MU0A 4IZJD 4B3MI 3GONA 2XEXA 5BR8E 1B62A 2WW4A 2HFUA 1D6TA 2VQFI 4ED4A 2AE8A 5K36F 4GKKE 5C0XE 2PO0A 4JV5I 2HKEA 4FW4A 1IBLI 1Z59A 4DR3E 1HK7A 2UXBE 3Q6MA 4ZVIA 4DR6I 3J80Q 1EI1A 3T1HE 2JEAA 1Y60A 4KHPI 4OO1C 2R3VA 1MG7A 3CWVA 4HYMA 1FKAE 1Z0CA 3GMEA 1RR9A 3U1YA 3P76A 3GCMA 4LF4I 3QT8A 5JEAB 4DV4I 2ZM6I 1N36E 3Q6NA 5DRQA 4JI7E 4YY3E 1HR0I 1YHCA 4DR5I 4OX9I 4DV6I 4JI5I 4B3TE 1MU5A 2O3ZA 3PS1A 4JI2E 1ELOA 4B3ME 3NZKA 1H72C 1ZM3A 2CVEA 4GQUA 2VQFE 3CDIA 2NN6F 4DPXA 4J3DA 4JV5E 4WUBA 1MX0A 1QZRA 1IBLE 4FW5A 5LMUI 3HKMA 4JI0I 4DR6E 5FWKA 2GS8A 5K36E 4Z7CA 5JEAC 2IOQA 4DR4E 1RHYA 3M85G 3HULA 4LCHA 1EA6A 2JEAB 1UDSA 4LF9I 1I94I 3QT7A 1K47A 1OYRA 5FLXQ 1R6LA 2NN6B 4FW6A 3OTOI 3PYGA 4B3RI 3P3GA 4FW3A 2ZM6E 2HK2A 2NN6D 1HR0E 5LL6R 4DR5E 4OX9E 4DV6E 4JI5E 4USMA 3J80C 1Z0GA 2JEBB 3JAMC 4OO1F 3ZKDA 5EKWA 1XNQE 2V2ZA 4BA1A 1OYSA 2Z5EA 1ZXNA 3M85D 2F4VI 1P42A 1HNWE 5LMUE 2BA1D 4UT4A 1XXEA 5GMEA 2F1DA 4JI0E 2PNZA 4DUYI 2WP8A 4JI3I 2NN6E 3WU5A 4DV0E 2DEIA 2HFSA 1U2RA 4USKA 1E3PA 4OO1B 3L7ZA 4DV2I 4DV7I 4DV5I 4X65I 3Q1QA 1I94E 4DPUA 3PRYA 4JI1E 4JI8I 4OO1D 2UXDI 3OTOE 2O1TA 2C39A 4NXNI 1XNRI 4B3RE 4HACB 1R6MA 3B82A 1N34I 1USVA 1BKNA 2GO4A 3D4JA 2IERA 2CGEA 5JEAF 1Y4UA 2AJ4A 4OKGA 3U1KA 3K85A 1HNXI 2HK3A 1NHJA 2UUBE 4MDTA 1FJGI 4U3BA 4MYUA 1FWKA 4IZKB 3H1CA 5FLXC 2PO1A 2C38A 2J7KA 4WUCA 2F4VE 4OO1E 4LCFA 4BA2A 5IT9Q 1USUA 3UHMA 4N3OA 1OJ4A 4DUYE 2JE6B 5A2QQ 4JI3E 3J81Q 1E3HA 1VI7A 3PYEA 3DD6A 1IBKI 5DRPA 1Y6ZA 4DR1I 2UU9I 2WNRA 4DV7E 3K17A 2DEJA 4DV5E 1N33I 5DNLA 5IWAI 4M1KA 4X65E 3L7ZB 2UUAI 2O1UA 5JEAD 4JI6I 4IFDA 1KVKA 4YHHI 2HKJA 2Z5CA 2Q2EB 2UXDE 4NXNE 1XNRE 3ZZ0A 4FN5A 1PKPA 1N34E 1UDNA 4DPYA 4B3SI 2PO0B 4JG4A 4X66I 1FJGE 4LF5I 4AM3A 4KHPE 4GKJI 5JEAE 5C0XA 2BA1G 3M7NG 1HNZI 3B8HA 4LFCI 5ELWA 2PO1B 1ZM4A 3ZZUA 1UDOA 4NXMI 4LF7I 1S16A 1IBKE 4DR1E 4LF4E 4DV4E 2UU9E 2Z5BA 1N33E 4IZJA 2UUCI 1ZM9A 4FWHA 4PRXA 1UEKA 1N0VC 2UUAE 4JI6E 4YHHE 4DR2I 1H7SA 4FWGA 4U3DA 3ZM7A 2EFGA 3T1YI 2CZ9A 2HHHI 1Z5AA 3ZKBA 1Z0VA 4LFBI 4NBQA 2UXCI 2ZITA 1VISA 3M7ND 4B3SE 3WU6A 3QT5A 3LTOA 2VQEI 4X66E 3P3CA 1XHKA 4GKJE 4DPWA 2NPFA 1FWLA 1Z0WA 2PNMA 1HNZE 4LFCE 5EL9A 4LF9E 2E1RA 3CDJA 5C0XB 1B63A 3LPSA 2IESA 4HY1A 4MU3A 4DUZI 4NXME 2JT2A 4LF7E 2A2CA 1H73A 1Z0EA 5K36A 4ISAA 4IFDC 4AQYI 4WUDA 1IBMI 5C0XD 2UUCE 1J5EI 4X64I 2V8PA 1KTVA 4P52A 2Z5BB 3J7AG 2V2QA 4IZJB 1Z5BA 1XMQI 2J65A 4FWDA 3PS2A 4LF8I 4EMDA 2VF3A 1UDQA 3T1YE 3M6AA 2HHHE 1WUUA 5LMNI 2PNLA 4BA1B 4LFBE 4QNKA 4DV3I 5GMDA 2UXCE 3GLLA 2E5LI 4K0KI 4R1FA 1NHIA 5C0XC 4PU9A 4AIMA 2VQEE 4Z7YA 1N32I 2CG9A 3KRNA 4XTJA 4LFAI 2PNZB 2WP8B 2X36A 4DV2E 1KIJA 3JAMQ 4OZEA 4DR4I 4DUZE 1YH8A 4JI8E 3PYFA 2BM1A 1RREA 2NN6A 3P06A 2BR2A 4URLA 4AQYE 4RPFA 1IBME 4LOMA 1A6FA 3J7AM 1J5EE 2C39B 4KQVA 4X64E 5K36B 5L3JA 4DR7I 1XMQE
chains in the Genus database with same CATH topology
1HNXE 4LF8E 1H7UA 3ZZTA 3HJCA 4DPTA 4DV1I 4JI4I 1KKHA 5LMNE 1XNQI 4DV3E 4X62I 3V2UC 2E5LE 4K0KE 2O1WA 1DARA 2R42A 3PYDA 1XMOI 3WU4A 3V5RA 1N32E 1HNWI 3K1JA 4LFAE 2X7IA 1ZXMA 2GQ0A 4DU7A 5IWAE 4DV0I 2ZBKB 3QT6A 4JYAI 1PIEA 2V2VA 4LF6I 4MYTA 1N0UA 4HACA 3B78A 2Z5CB 4JI1I 5IT9C 1ZM2A 4DR7E 1PVGA 1NZ0A 1S4EA 3F0NA 2BV3A 5A2QC 2OI2A 3J81C 5BR8I 1Y4SA 2A2DA 1NHHA 2O1VA 1Z0BA 4GKKI 4PRVA 4DV1E 4JI4E 4LF5E 2IOPA 4DR3I 2V34A 4IZKA 4X62E 2UXBI 3H4LA 2UUBI 3WU3A 4P7AA 4DU8A 4HXZA 3T1HI 4I3HA 1XMOE 4FW9A 1FI4A 1Z5CA 1Z0TA 4UTGA 4DXLA 3LNUA 4JYAE 2BM0A 1FNMA 4LF6E 1N36I 2LJPA 4DR2E 1H74A 4JI7I 4YY3I 4B3TI 4JI2I 4IZJD 4B3MI 3GONA 2XEXA 5BR8E 1B62A 2WW4A 2HFUA 1D6TA 2VQFI 4ED4A 4GKKE 4JV5I 2HKEA 1IBLI 1Z59A 4DR3E 1HK7A 2UXBE 3Q6MA 4ZVIA 4DR6I 3J80Q 1EI1A 3T1HE 4KHPI 2R3VA 1MG7A 3CWVA 4HYMA 1FKAE 1Z0CA 1RR9A 4LF4I 3QT8A 4DV4I 2ZM6I 1N36E 3Q6NA 4JI7E 4YY3E 1HR0I 4DR5I 4OX9I 4DV6I 4JI5I 4B3TE 1MU5A 4JI2E 1ELOA 4B3ME 1H72C 1ZM3A 2VQFE 4DPXA 4JV5E 4WUBA 1MX0A 1QZRA 1IBLE 5LMUI 4JI0I 4DR6E 5FWKA 2GS8A 4Z7CA 2IOQA 4DR4E 3HULA 1EA6A 4LF9I 1I94I 3QT7A 1K47A 5FLXQ 3OTOI 3PYGA 4B3RI 2ZM6E 2HK2A 1HR0E 5LL6R 4DR5E 4OX9E 4DV6E 4JI5E 4USMA 3J80C 1Z0GA 3JAMC 3ZKDA 1XNQE 2V2ZA 2Z5EA 1ZXNA 2F4VI 1HNWE 5LMUE 4UT4A 5GMEA 4JI0E 4DUYI 4JI3I 3WU5A 4DV0E 2DEIA 2HFSA 1U2RA 4USKA 4DV2I 4DV7I 4DV5I 4X65I 3Q1QA 1I94E 4DPUA 3PRYA 4JI1E 4JI8I 2UXDI 3OTOE 2O1TA 4NXNI 1XNRI 4B3RE 4HACB 3B82A 1N34I 1USVA 1BKNA 3D4JA 2CGEA 1Y4UA 2AJ4A 3K85A 1HNXI 2HK3A 1NHJA 2UUBE 1FJGI 4MYUA 1FWKA 4IZKB 5FLXC 2J7KA 4WUCA 2F4VE 5IT9Q 1USUA 4N3OA 1OJ4A 4DUYE 5A2QQ 4JI3E 3J81Q 3PYEA 1IBKI 1Y6ZA 4DR1I 2UU9I 4DV7E 3K17A 2DEJA 4DV5E 1N33I 5IWAI 4M1KA 4X65E 2UUAI 2O1UA 4JI6I 2UXDE 1KVKA 4YHHI 2HKJA 2Z5CA 2Q2EB 4NXNE 1XNRE 3ZZ0A 4FN5A 1PKPA 1N34E 4DPYA 4B3SI 4JG4A 4X66I 1FJGE 4LF5I 4KHPE 4GKJI 1HNZI 3B8HA 4LFCI 1ZM4A 3ZZUA 4NXMI 4LF7I 1S16A 1IBKE 4DR1E 4LF4E 4DV4E 2UU9E 2Z5BA 1N33E 4IZJA 2UUCI 1ZM9A 4FWHA 4PRXA 1UEKA 1N0VC 2UUAE 4JI6E 4YHHE 4DR2I 1H7SA 4FWGA 3ZM7A 2EFGA 3T1YI 2CZ9A 2HHHI 1Z5AA 3ZKBA 1Z0VA 4LFBI 2UXCI 2ZITA 1VISA 4B3SE 3WU6A 3QT5A 3LTOA 2VQEI 4X66E 1XHKA 4GKJE 4DPWA 2NPFA 1FWLA 1Z0WA 2PNMA 1HNZE 4LFCE 4LF9E 2E1RA 1B63A 3LPSA 4HY1A 4DUZI 4NXME 4LF7E 2A2CA 1H73A 1Z0EA 4AQYI 4WUDA 1IBMI 2UUCE 1J5EI 4X64I 2V8PA 1KTVA 4P52A 2Z5BB 3J7AG 2V2QA 4IZJB 1Z5BA 1XMQI 4FWDA 4LF8I 4EMDA 2VF3A 3T1YE 3M6AA 2HHHE 1WUUA 5LMNI 2PNLA 4LFBE 4DV3I 5GMDA 2UXCE 2E5LI 4K0KI 4R1FA 1NHIA 4PU9A 2VQEE 4Z7YA 1N32I 2CG9A 4XTJA 4LFAI 2X36A 4DV2E 1KIJA 3JAMQ 4DR4I 4DUZE 4JI8E 3PYFA 2BM1A 1RREA 3P06A 4URLA 4AQYE 4RPFA 1IBME 1A6FA 3J7AM 1J5EE 4KQVA 4X64E 5L3JA 4DR7I 1XMQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX E;  4LF8 E;  1H7U A;  3ZZT A;  4DPT A;  4DV1 I;  4JI4 I;  1KKH A;  5LMN E;  1XNQ I;  4DV3 E;  4X62 I;  3V2U C;  2E5L E;  4K0K E;  1DAR A;  2R42 A;  3PYD A;  1XMO I;  3WU4 A;  3V5R A;  1N32 E;  1HNW I;  3K1J A;  4LFA E;  2X7I A;  1ZXM A;  4DU7 A;  5IWA E;  4DV0 I;  2ZBK B;  3QT6 A;  4JYA I;  1PIE A;  2V2V A;  4LF6 I;  4MYT A;  1N0U A;  4HAC A;  3B78 A;  4JI1 I;  5IT9 C;  1ZM2 A;  4DR7 E;  1PVG A;  1NZ0 A;  1S4E A;  3F0N A;  2BV3 A;  5A2Q C;  2OI2 A;  3J81 C;  5BR8 I;  2A2D A;  1NHH A;  1Z0B A;  4GKK I;  4PRV A;  4DV1 E;  4JI4 E;  4LF5 E;  4DR3 I;  2V34 A;  4X62 E;  2UXB I;  3H4L A;  2UUB I;  3WU3 A;  4P7A A;  4DU8 A;  4HXZ A;  3T1H I;  4I3H A;  1XMO E;  4FW9 A;  1FI4 A;  1Z5C A;  1Z0T A;  4UTG A;  4DXL A;  3LNU A;  4JYA E;  2BM0 A;  1FNM A;  4LF6 E;  1N36 I;  2LJP A;  4DR2 E;  1H74 A;  4JI7 I;  4YY3 I;  4B3T I;  4JI2 I;  4B3M I;  3GON A;  2XEX A;  5BR8 E;  1B62 A;  2WW4 A;  2HFU A;  1D6T A;  2VQF I;  4ED4 A;  4GKK E;  4JV5 I;  2HKE A;  1IBL I;  1Z59 A;  4DR3 E;  2UXB E;  4ZVI A;  4DR6 I;  3J80 Q;  1EI1 A;  3T1H E;  4KHP I;  2R3V A;  1MG7 A;  3CWV A;  4HYM A;  1FKA E;  1Z0C A;  1RR9 A;  4LF4 I;  3QT8 A;  4DV4 I;  2ZM6 I;  1N36 E;  4JI7 E;  4YY3 E;  1HR0 I;  4DR5 I;  4OX9 I;  4DV6 I;  4JI5 I;  4B3T E;  1MU5 A;  4JI2 E;  1ELO A;  4B3M E;  1H72 C;  1ZM3 A;  2VQF E;  4DPX A;  4JV5 E;  4WUB A;  1MX0 A;  1QZR A;  1IBL E;  5LMU I;  4JI0 I;  4DR6 E;  2GS8 A;  4Z7C A;  4DR4 E;  3HUL A;  1EA6 A;  4LF9 I;  1I94 I;  3QT7 A;  1K47 A;  5FLX Q;  3OTO I;  3PYG A;  4B3R I;  2ZM6 E;  2HK2 A;  1HR0 E;  5LL6 R;  4DR5 E;  4OX9 E;  4DV6 E;  4JI5 E;  4USM A;  3J80 C;  1Z0G A;  3JAM C;  3ZKD A;  1XNQ E;  2V2Z A;  1ZXN A;  2F4V I;  1HNW E;  5LMU E;  4UT4 A;  5GME A;  4JI0 E;  4DUY I;  4JI3 I;  3WU5 A;  4DV0 E;  2DEI A;  2HFS A;  1U2R A;  4USK A;  4DV2 I;  4DV7 I;  4DV5 I;  4X65 I;  3Q1Q A;  1I94 E;  4DPU A;  4JI1 E;  4JI8 I;  2UXD I;  3OTO E;  4NXN I;  1XNR I;  4B3R E;  4HAC B;  3B82 A;  1N34 I;  1BKN A;  3D4J A;  2AJ4 A;  1HNX I;  2HK3 A;  1NHJ A;  2UUB E;  1FJG I;  4MYU A;  1FWK A;  5FLX C;  2J7K A;  4WUC A;  2F4V E;  5IT9 Q;  1OJ4 A;  4DUY E;  5A2Q Q;  4JI3 E;  3J81 Q;  3PYE A;  1IBK I;  4DR1 I;  2UU9 I;  4DV7 E;  3K17 A;  2DEJ A;  4DV5 E;  1N33 I;  5IWA I;  4M1K A;  4X65 E;  2UUA I;  4JI6 I;  2UXD E;  1KVK A;  4YHH I;  2HKJ A;  2Q2E B;  4NXN E;  1XNR E;  3ZZ0 A;  4FN5 A;  1PKP A;  1N34 E;  4DPY A;  4B3S I;  4JG4 A;  4X66 I;  1FJG E;  4LF5 I;  4KHP E;  4GKJ I;  1HNZ I;  3B8H A;  4LFC I;  1ZM4 A;  3ZZU A;  4NXM I;  4LF7 I;  1S16 A;  1IBK E;  4DR1 E;  4LF4 E;  4DV4 E;  2UU9 E;  1N33 E;  2UUC I;  1ZM9 A;  4FWH A;  4PRX A;  1UEK A;  1N0V C;  2UUA E;  4JI6 E;  4YHH E;  4DR2 I;  1H7S A;  4FWG A;  3ZM7 A;  2EFG A;  3T1Y I;  2CZ9 A;  2HHH I;  1Z5A A;  3ZKB A;  1Z0V A;  4LFB I;  2UXC I;  2ZIT A;  1VIS A;  4B3S E;  3WU6 A;  3QT5 A;  3LTO A;  2VQE I;  4X66 E;  1XHK A;  4GKJ E;  4DPW A;  2NPF A;  1FWL A;  1Z0W A;  1HNZ E;  4LFC E;  4LF9 E;  2E1R A;  1B63 A;  3LPS A;  4HY1 A;  4DUZ I;  4NXM E;  4LF7 E;  2A2C A;  1H73 A;  1Z0E A;  4AQY I;  4WUD A;  1IBM I;  2UUC E;  1J5E I;  4X64 I;  2V8P A;  1KTV A;  4P52 A;  3J7A G;  2V2Q A;  1XMQ I;  1Z5B A;  4FWD A;  4LF8 I;  4EMD A;  2VF3 A;  3T1Y E;  3M6A A;  2HHH E;  1WUU A;  5LMN I;  4LFB E;  4DV3 I;  5GMD A;  2UXC E;  2E5L I;  4K0K I;  4R1F A;  1NHI A;  4PU9 A;  2VQE E;  4Z7Y A;  1N32 I;  4XTJ A;  4LFA I;  2X36 A;  4DV2 E;  1KIJ A;  3JAM Q;  4DR4 I;  4DUZ E;  4JI8 E;  3PYF A;  2BM1 A;  1RRE A;  4URL A;  4AQY E;  4RPF A;  1IBM E;  1A6F A;  3J7A M;  1J5E E;  4KQV A;  4X64 E;  5L3J A;  4DR7 I;  1XMQ E; 
#chains in the Genus database with same CATH topology
 4QNJ A;  2JEB A;  1HNX E;  5DNX A;  4LF8 E;  1H7U A;  3ZZT A;  2BA0 G;  5K36 D;  3HJC A;  4DPT A;  4DV1 I;  4JI4 I;  1KKH A;  5LMN E;  1XNQ I;  4DV3 E;  4X62 I;  3V2U C;  2E5L E;  4K0K E;  4IFD F;  4AID A;  2O1W A;  1OYP A;  1DAR A;  2R42 A;  1Y5Y A;  2C38 B;  3PYD A;  3WU4 A;  1XMO I;  3V5R A;  1N32 E;  2GO3 A;  3PS3 A;  4BA2 B;  1HNW I;  3K1J A;  4LFA E;  2X7I A;  1ZXM A;  2GQ0 A;  4DU7 A;  4MU1 A;  4OO1 A;  5K36 C;  5IWA E;  4DV0 I;  2ZBK B;  3QT6 A;  4JYA I;  1PIE A;  2V2V A;  2WNR B;  2PO2 A;  2C37 A;  4MQY A;  4LF6 I;  4MYT A;  5DRO A;  2BA0 D;  4LPF A;  1N0U A;  4HAC A;  5C0X F;  4IFD B;  3B78 A;  2Z5C B;  4JI1 I;  5IT9 C;  2BR2 B;  1ZM2 A;  4DR7 E;  1PVG A;  1NZ0 A;  1S4E A;  3F0N A;  2BV3 A;  5A2Q C;  2OI2 A;  3J81 C;  5BR8 I;  4IFD D;  1Y4S A;  2A2D A;  1NHH A;  2O1V A;  1Z0B A;  4GKK I;  4PRV A;  4DV1 E;  4JI4 E;  4LF5 E;  3P3E A;  3B4T A;  2IOP A;  4DR3 I;  2V34 A;  4IZK A;  4X62 E;  2VES A;  2UXB I;  3H4L A;  2UUB I;  3WU3 A;  4P7A A;  4IS9 A;  4DU8 A;  4HXZ A;  3T1H I;  4I3H A;  1XMO E;  5DRR A;  4FW9 A;  1FI4 A;  1Z5C A;  2JE6 A;  4FW7 A;  1Z0T A;  4UTG A;  2NN6 C;  3LNU A;  4DXL A;  5JEA A;  4IFD E;  4JYA E;  2BM0 A;  1FNM A;  4LF6 E;  4MU4 A;  1N36 I;  2LJP A;  4DR2 E;  1H74 A;  4JI7 I;  4LCG A;  4YY3 I;  2PO2 B;  2C37 B;  4B3T I;  4JI2 I;  4MU0 A;  4IZJ D;  4B3M I;  3GON A;  2XEX A;  5BR8 E;  1B62 A;  2WW4 A;  2HFU A;  1D6T A;  2VQF I;  4ED4 A;  2AE8 A;  5K36 F;  4GKK E;  5C0X E;  2PO0 A;  4JV5 I;  2HKE A;  4FW4 A;  1IBL I;  1Z59 A;  4DR3 E;  1HK7 A;  2UXB E;  3Q6M A;  4ZVI A;  4DR6 I;  3J80 Q;  1EI1 A;  3T1H E;  2JEA A;  1Y60 A;  4KHP I;  4OO1 C;  2R3V A;  1MG7 A;  3CWV A;  4HYM A;  1FKA E;  1Z0C A;  3GME A;  1RR9 A;  3U1Y A;  3P76 A;  3GCM A;  4LF4 I;  3QT8 A;  5JEA B;  4DV4 I;  2ZM6 I;  1N36 E;  3Q6N A;  5DRQ A;  4JI7 E;  4YY3 E;  1HR0 I;  1YHC A;  4DR5 I;  4OX9 I;  4DV6 I;  4JI5 I;  4B3T E;  1MU5 A;  2O3Z A;  3PS1 A;  4JI2 E;  1ELO A;  4B3M E;  3NZK A;  1H72 C;  1ZM3 A;  2CVE A;  4GQU A;  2VQF E;  3CDI A;  2NN6 F;  4DPX A;  4J3D A;  4JV5 E;  4WUB A;  1MX0 A;  1QZR A;  1IBL E;  4FW5 A;  5LMU I;  3HKM A;  4JI0 I;  4DR6 E;  5FWK A;  2GS8 A;  5K36 E;  4Z7C A;  5JEA C;  2IOQ A;  4DR4 E;  1RHY A;  3M85 G;  3HUL A;  4LCH A;  1EA6 A;  2JEA B;  1UDS A;  4LF9 I;  1I94 I;  3QT7 A;  1K47 A;  1OYR A;  5FLX Q;  1R6L A;  2NN6 B;  4FW6 A;  3OTO I;  3PYG A;  4B3R I;  3P3G A;  4FW3 A;  2ZM6 E;  2HK2 A;  2NN6 D;  1HR0 E;  5LL6 R;  4DR5 E;  4OX9 E;  4DV6 E;  4JI5 E;  4USM A;  3J80 C;  1Z0G A;  2JEB B;  3JAM C;  4OO1 F;  3ZKD A;  5EKW A;  1XNQ E;  2V2Z A;  4BA1 A;  1OYS A;  2Z5E A;  1ZXN A;  3M85 D;  2F4V I;  1P42 A;  1HNW E;  5LMU E;  2BA1 D;  4UT4 A;  1XXE A;  5GME A;  2F1D A;  4JI0 E;  2PNZ A;  4DUY I;  2WP8 A;  4JI3 I;  2NN6 E;  3WU5 A;  4DV0 E;  2DEI A;  2HFS A;  1U2R A;  4USK A;  1E3P A;  4OO1 B;  3L7Z A;  4DV2 I;  4DV7 I;  4DV5 I;  4X65 I;  3Q1Q A;  1I94 E;  4DPU A;  3PRY A;  4JI1 E;  4JI8 I;  4OO1 D;  2UXD I;  3OTO E;  2O1T A;  2C39 A;  4NXN I;  1XNR I;  4B3R E;  4HAC B;  1R6M A;  3B82 A;  1N34 I;  1USV A;  1BKN A;  2GO4 A;  3D4J A;  2IER A;  2CGE A;  5JEA F;  1Y4U A;  2AJ4 A;  4OKG A;  3U1K A;  3K85 A;  1HNX I;  2HK3 A;  1NHJ A;  2UUB E;  4MDT A;  1FJG I;  4U3B A;  4MYU A;  1FWK A;  4IZK B;  3H1C A;  5FLX C;  2PO1 A;  2C38 A;  2J7K A;  4WUC A;  2F4V E;  4OO1 E;  4LCF A;  4BA2 A;  5IT9 Q;  1USU A;  3UHM A;  4N3O A;  1OJ4 A;  4DUY E;  2JE6 B;  5A2Q Q;  4JI3 E;  3J81 Q;  1E3H A;  1VI7 A;  3PYE A;  3DD6 A;  1IBK I;  5DRP A;  1Y6Z A;  4DR1 I;  2UU9 I;  2WNR A;  4DV7 E;  3K17 A;  2DEJ A;  4DV5 E;  1N33 I;  5DNL A;  5IWA I;  4M1K A;  4X65 E;  3L7Z B;  2UUA I;  2O1U A;  5JEA D;  4JI6 I;  4IFD A;  1KVK A;  4YHH I;  2HKJ A;  2Z5C A;  2Q2E B;  2UXD E;  4NXN E;  1XNR E;  3ZZ0 A;  4FN5 A;  1PKP A;  1N34 E;  1UDN A;  4DPY A;  4B3S I;  2PO0 B;  4JG4 A;  4X66 I;  1FJG E;  4LF5 I;  4AM3 A;  4KHP E;  4GKJ I;  5JEA E;  5C0X A;  2BA1 G;  3M7N G;  1HNZ I;  3B8H A;  4LFC I;  5ELW A;  2PO1 B;  1ZM4 A;  3ZZU A;  1UDO A;  4NXM I;  4LF7 I;  1S16 A;  1IBK E;  4DR1 E;  4LF4 E;  4DV4 E;  2UU9 E;  2Z5B A;  1N33 E;  4IZJ A;  2UUC I;  1ZM9 A;  4FWH A;  4PRX A;  1UEK A;  1N0V C;  2UUA E;  4JI6 E;  4YHH E;  4DR2 I;  1H7S A;  4FWG A;  4U3D A;  3ZM7 A;  2EFG A;  3T1Y I;  2CZ9 A;  2HHH I;  1Z5A A;  3ZKB A;  1Z0V A;  4LFB I;  4NBQ A;  2UXC I;  2ZIT A;  1VIS A;  3M7N D;  4B3S E;  3WU6 A;  3QT5 A;  3LTO A;  2VQE I;  4X66 E;  3P3C A;  1XHK A;  4GKJ E;  4DPW A;  2NPF A;  1FWL A;  1Z0W A;  2PNM A;  1HNZ E;  4LFC E;  5EL9 A;  4LF9 E;  2E1R A;  3CDJ A;  5C0X B;  1B63 A;  3LPS A;  2IES A;  4HY1 A;  4MU3 A;  4DUZ I;  4NXM E;  2JT2 A;  4LF7 E;  2A2C A;  1H73 A;  1Z0E A;  5K36 A;  4ISA A;  4IFD C;  4AQY I;  4WUD A;  1IBM I;  5C0X D;  2UUC E;  1J5E I;  4X64 I;  2V8P A;  1KTV A;  4P52 A;  2Z5B B;  3J7A G;  2V2Q A;  4IZJ B;  1Z5B A;  1XMQ I;  2J65 A;  4FWD A;  3PS2 A;  4LF8 I;  4EMD A;  2VF3 A;  1UDQ A;  3T1Y E;  3M6A A;  2HHH E;  1WUU A;  5LMN I;  2PNL A;  4BA1 B;  4LFB E;  4QNK A;  4DV3 I;  5GMD A;  2UXC E;  3GLL A;  2E5L I;  4K0K I;  4R1F A;  1NHI A;  5C0X C;  4PU9 A;  4AIM A;  2VQE E;  4Z7Y A;  1N32 I;  2CG9 A;  3KRN A;  4XTJ A;  4LFA I;  2PNZ B;  2WP8 B;  2X36 A;  4DV2 E;  1KIJ A;  3JAM Q;  4OZE A;  4DR4 I;  4DUZ E;  1YH8 A;  4JI8 E;  3PYF A;  2BM1 A;  1RRE A;  2NN6 A;  3P06 A;  2BR2 A;  4URL A;  4AQY E;  4RPF A;  1IBM E;  4LOM A;  1A6F A;  3J7A M;  1J5E E;  2C39 B;  4KQV A;  4X64 E;  5K36 B;  5L3J A;  4DR7 I;  1XMQ E; 
#chains in the Genus database with same CATH homology
 1HNX E;  4LF8 E;  1H7U A;  3ZZT A;  3HJC A;  4DPT A;  4DV1 I;  4JI4 I;  1KKH A;  5LMN E;  1XNQ I;  4DV3 E;  4X62 I;  3V2U C;  2E5L E;  4K0K E;  2O1W A;  1DAR A;  2R42 A;  3PYD A;  1XMO I;  3WU4 A;  3V5R A;  1N32 E;  1HNW I;  3K1J A;  4LFA E;  2X7I A;  1ZXM A;  2GQ0 A;  4DU7 A;  5IWA E;  4DV0 I;  2ZBK B;  3QT6 A;  4JYA I;  1PIE A;  2V2V A;  4LF6 I;  4MYT A;  1N0U A;  4HAC A;  3B78 A;  2Z5C B;  4JI1 I;  5IT9 C;  1ZM2 A;  4DR7 E;  1PVG A;  1NZ0 A;  1S4E A;  3F0N A;  2BV3 A;  5A2Q C;  2OI2 A;  3J81 C;  5BR8 I;  1Y4S A;  2A2D A;  1NHH A;  2O1V A;  1Z0B A;  4GKK I;  4PRV A;  4DV1 E;  4JI4 E;  4LF5 E;  2IOP A;  4DR3 I;  2V34 A;  4IZK A;  4X62 E;  2UXB I;  3H4L A;  2UUB I;  3WU3 A;  4P7A A;  4DU8 A;  4HXZ A;  3T1H I;  4I3H A;  1XMO E;  4FW9 A;  1FI4 A;  1Z5C A;  1Z0T A;  4UTG A;  4DXL A;  3LNU A;  4JYA E;  2BM0 A;  1FNM A;  4LF6 E;  1N36 I;  2LJP A;  4DR2 E;  1H74 A;  4JI7 I;  4YY3 I;  4B3T I;  4JI2 I;  4IZJ D;  4B3M I;  3GON A;  2XEX A;  5BR8 E;  1B62 A;  2WW4 A;  2HFU A;  1D6T A;  2VQF I;  4ED4 A;  4GKK E;  4JV5 I;  2HKE A;  1IBL I;  1Z59 A;  4DR3 E;  1HK7 A;  2UXB E;  3Q6M A;  4ZVI A;  4DR6 I;  3J80 Q;  1EI1 A;  3T1H E;  4KHP I;  2R3V A;  1MG7 A;  3CWV A;  4HYM A;  1FKA E;  1Z0C A;  1RR9 A;  4LF4 I;  3QT8 A;  4DV4 I;  2ZM6 I;  1N36 E;  3Q6N A;  4JI7 E;  4YY3 E;  1HR0 I;  4DR5 I;  4OX9 I;  4DV6 I;  4JI5 I;  4B3T E;  1MU5 A;  4JI2 E;  1ELO A;  4B3M E;  1H72 C;  1ZM3 A;  2VQF E;  4DPX A;  4JV5 E;  4WUB A;  1MX0 A;  1QZR A;  1IBL E;  5LMU I;  4JI0 I;  4DR6 E;  5FWK A;  2GS8 A;  4Z7C A;  2IOQ A;  4DR4 E;  3HUL A;  1EA6 A;  4LF9 I;  1I94 I;  3QT7 A;  1K47 A;  5FLX Q;  3OTO I;  3PYG A;  4B3R I;  2ZM6 E;  2HK2 A;  1HR0 E;  5LL6 R;  4DR5 E;  4OX9 E;  4DV6 E;  4JI5 E;  4USM A;  3J80 C;  1Z0G A;  3JAM C;  3ZKD A;  1XNQ E;  2V2Z A;  2Z5E A;  1ZXN A;  2F4V I;  1HNW E;  5LMU E;  4UT4 A;  5GME A;  4JI0 E;  4DUY I;  4JI3 I;  3WU5 A;  4DV0 E;  2DEI A;  2HFS A;  1U2R A;  4USK A;  4DV2 I;  4DV7 I;  4DV5 I;  4X65 I;  3Q1Q A;  1I94 E;  4DPU A;  3PRY A;  4JI1 E;  4JI8 I;  2UXD I;  3OTO E;  2O1T A;  4NXN I;  1XNR I;  4B3R E;  4HAC B;  3B82 A;  1N34 I;  1USV A;  1BKN A;  3D4J A;  2CGE A;  1Y4U A;  2AJ4 A;  3K85 A;  1HNX I;  2HK3 A;  1NHJ A;  2UUB E;  1FJG I;  4MYU A;  1FWK A;  4IZK B;  5FLX C;  2J7K A;  4WUC A;  2F4V E;  5IT9 Q;  1USU A;  4N3O A;  1OJ4 A;  4DUY E;  5A2Q Q;  4JI3 E;  3J81 Q;  3PYE A;  1IBK I;  1Y6Z A;  4DR1 I;  2UU9 I;  4DV7 E;  3K17 A;  2DEJ A;  4DV5 E;  1N33 I;  5IWA I;  4M1K A;  4X65 E;  2UUA I;  2O1U A;  4JI6 I;  2UXD E;  1KVK A;  4YHH I;  2HKJ A;  2Z5C A;  2Q2E B;  4NXN E;  1XNR E;  3ZZ0 A;  4FN5 A;  1PKP A;  1N34 E;  4DPY A;  4B3S I;  4JG4 A;  4X66 I;  1FJG E;  4LF5 I;  4KHP E;  4GKJ I;  1HNZ I;  3B8H A;  4LFC I;  1ZM4 A;  3ZZU A;  4NXM I;  4LF7 I;  1S16 A;  1IBK E;  4DR1 E;  4LF4 E;  4DV4 E;  2UU9 E;  2Z5B A;  1N33 E;  4IZJ A;  2UUC I;  1ZM9 A;  4FWH A;  4PRX A;  1UEK A;  1N0V C;  2UUA E;  4JI6 E;  4YHH E;  4DR2 I;  1H7S A;  4FWG A;  3ZM7 A;  2EFG A;  3T1Y I;  2CZ9 A;  2HHH I;  1Z5A A;  3ZKB A;  1Z0V A;  4LFB I;  2UXC I;  2ZIT A;  1VIS A;  4B3S E;  3WU6 A;  3QT5 A;  3LTO A;  2VQE I;  4X66 E;  1XHK A;  4GKJ E;  4DPW A;  2NPF A;  1FWL A;  1Z0W A;  2PNM A;  1HNZ E;  4LFC E;  4LF9 E;  2E1R A;  1B63 A;  3LPS A;  4HY1 A;  4DUZ I;  4NXM E;  4LF7 E;  2A2C A;  1H73 A;  1Z0E A;  4AQY I;  4WUD A;  1IBM I;  2UUC E;  1J5E I;  4X64 I;  2V8P A;  1KTV A;  4P52 A;  2Z5B B;  3J7A G;  2V2Q A;  4IZJ B;  1Z5B A;  1XMQ I;  4FWD A;  4LF8 I;  4EMD A;  2VF3 A;  3T1Y E;  3M6A A;  2HHH E;  1WUU A;  5LMN I;  2PNL A;  4LFB E;  4DV3 I;  5GMD A;  2UXC E;  2E5L I;  4K0K I;  4R1F A;  1NHI A;  4PU9 A;  2VQE E;  4Z7Y A;  1N32 I;  2CG9 A;  4XTJ A;  4LFA I;  2X36 A;  4DV2 E;  1KIJ A;  3JAM Q;  4DR4 I;  4DUZ E;  4JI8 E;  3PYF A;  2BM1 A;  1RRE A;  3P06 A;  4URL A;  4AQY E;  4RPF A;  1IBM E;  1A6F A;  3J7A M;  1J5E E;  4KQV A;  4X64 E;  5L3J A;  4DR7 I;  1XMQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...