1Z0WA

Crystal structure of a. fulgidus lon proteolytic domain at 1.2a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVEGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 64
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0wA00
4FWDA 3B82A 1Z0TA 4HACB 4DV6E 3WU4A 4GKKI 1H74A 3PYDA 4DXLA 1Z0EA 3JAMC 5A2QC 1Z5BA 4LF9E 4FW9A 2UXBE 4HYMA 1ZM4A 2HHHI 1XNRE 4K0KI 1IBKE 1XHKA 4K0KE 3PYFA 2E1RA 3ZKBA 4RPFA 5BR8E 2AJ4A 1XMQE 4MYTA 4WUDA 4JI5I 4R1FA 4DV3E 1IBLI 5LL6R 1HNZI 1MU5A 1HNXI 4UTGA 4USKA 4DUYE 3J81C 4DV2E 5LMUE 1Z5CA 4DPXA 1IBMI 2V8PA 3T1HI 4B3SI 4XTJA 2BM1A 4FWHA 4DUZI 4FN5A 4DU7A 3LPSA 4NXME 3PYGA 3QT8A 2E5LE 4DPWA 2X7IA 2V2VA 4KQVA 4NXNI 4DV0I 4JI2I 4YHHE 1WUUA 4DV0E 2UXBI 4YHHI 3WU6A 4MYUA 3B78A 4LF8E 3V2UC 4JI0E 4JI7I 4LFBI 1KIJA 4PU9A 2UUAI 1XMOI 2VF3A 2J7KA 5GMEA 4WUCA 2R3VA 4HXZA 4DR7E 4DPUA 1N33E 4LF9I 4Z7CA 1PVGA 4DR2I 1IBME 1PIEA 2X36A 3V5RA 2UXCE 4X62E 1K47A 4DV3I 2HK2A 1MX0A 1N34E 4DR1E 4X66E 4DV1E 5LMNE 4JI1E 1Z0BA 3ZM7A 4DUZE 1XNQI 2E5LI 4LF8I 4JI6I 1FJGI 1NHHA 3JAMQ 2UUAE 2A2DA 2F4VE 3QT6A 1N34I 4JI2E 5FLXQ 4DR6E 4Z7YA 4B3ME 1N32E 1Z0GA 4NXMI 1S16A 4DV6I 3QT7A 1Z0VA 1KKHA 4JG4A 1D6TA 4YY3E 4OX9I 1FKAE 2DEIA 5BR8I 4DR4I 2ZBKB 4JI8I 1Z59A 5IT9Q 4JI3I 4M1KA 2HKEA 4ED4A 1IBKI 4JV5I 1S4EA 3WU3A 4HACA 4UT4A 1B62A 1Z0WA 4JI6E 1XMQI 4B3RI 4GKJE 1FNMA 2V2ZA 4DV7E 2UUBE 2OI2A 1ZXMA 5A2QQ 5LMNI 1NZ0A 4HY1A 4KHPI 2UXDE 4DPTA 2WW4A 3LTOA 1HR0E 5IT9C 4P52A 2DEJA 3J7AG 1ZM3A 2HK3A 3F0NA 4LF7E 4AQYE 1HNWI 2UU9E 4DR3I 2UXDI 1KTVA 4X64I 3K17A 4YY3I 4I3HA 2F4VI 1I94E 5IWAE 5L3JA 4DV4I 3ZZUA 5FLXC 4B3RE 1A6FA 1B63A 2UUBI 1FI4A 2HHHE 4EMDA 3OTOE 1H72C 4PRXA 3OTOI 3ZKDA 2ZM6I 1NHJA 3PYEA 4DR2E 4JI3E 1OJ4A 1H73A 4LFAE 2XEXA 1N0UA 4B3TE 4LFCE 4AQYI 4DV2I 4LFCI 4JYAI 1N33I 4B3SE 2HFUA 4DV5E 3J80Q 1U2RA 4B3MI 2HKJA 1HNWE 1N32I 1RR9A 4X65E 1H7UA 3M6AA 3J80C 2VQEI 4NXNE 3Q1QA 4KHPE 1ZXNA 4DPYA 3LNUA 1FWLA 1Z5AA 4DV4E 4DR1I 4USMA 2UUCI 4DV1I 2EFGA 4ZVIA 4JI0I 4JI7E 4LFBE 1N0VC 3H4LA 1PKPA 4LF4E 4JV5E 1MG7A 4OX9E 4DU8A 2V2QA 5IWAI 1Z0CA 2R42A 4DR4E 2ZITA 4DR5I 4JI8E 2V34A 4JI5E 1ELOA 1HNZE 4LF4I 3QT5A 1KVKA 1IBLE 1J5EI 1J5EE 3GONA 2GS8A 1HNXE 5LMUI 4DR5E 2CZ9A 3B8HA 1N36E 4DV7I 1FJGE 4LF5E 1ZM2A 2A2CA 1XNQE 2BV3A 2LJPA 4GKKE 3ZZTA 4DV5I 2UUCE 1UEKA 4X65I 2VQEE 3HULA 4X64E 2VQFI 4DR3E 3J7AM 1BKNA 4JI4I 2UXCI 4DR6I 3ZZ0A 4DR7I 4P7AA 3K1JA 2Q2EB 1RREA 1H7SA 2VQFE 1VISA 1NHIA 4LFAI 1XMOE 3J81Q 4B3TI 4JI1I 3WU5A 4URLA 3T1YI 4LF5I 1FWKA 3T1YE 2NPFA 2ZM6E 4PRVA 4FWGA 1XNRI 4GKJI 4X66I 1EI1A 1DARA 2HFSA 3D4JA 4DUYI 4X62I 2BM0A 2UU9I 3CWVA 4WUBA 5GMDA 4JYAE 1ZM9A 1HR0I 4JI4E 1I94I 3T1HE 1N36I 4LF6E 1EA6A 1QZRA 4LF6I 4LF7I
chains in the Genus database with same CATH superfamily
4FWDA 3B82A 1Z0TA 3GMEA 4HACB 4DV6E 3WU4A 4GKKI 1H74A 3PYDA 2NN6C 4MU3A 1Z0EA 4DXLA 4AM3A 3JAMC 5JEAE 5A2QC 1Z5BA 4LF9E 4FW9A 2UXBE 2Z5BB 2GQ0A 2JT2A 4HYMA 1ZM4A 2HHHI 1XNRE 4K0KI 1IBKE 1XHKA 4K0KE 3PYFA 2E1RA 2C37A 3ZKBA 4RPFA 2CG9A 2IOPA 2WNRA 2AJ4A 3DD6A 5BR8E 5JEAB 1XMQE 1YHCA 4MYTA 4WUDA 4JI5I 4R1FA 4DV3E 1IBLI 5LL6R 1HNZI 4OKGA 5JEAF 1MU5A 1HNXI 4UTGA 4USKA 4DUYE 3J81C 4DV2E 5LMUE 1Z5CA 4DPXA 2BR2A 2BA1D 2C39A 4LPFA 1IBMI 2V8PA 3T1HI 4B3SI 3CDJA 2GO4A 4XTJA 2BM1A 4FWHA 2Z5CA 2Z5EA 5K36D 2BA0G 3P76A 4FN5A 4DU7A 4DUZI 4MU1A 3LPSA 4NXME 3PYGA 4OO1D 3QT8A 2E5LE 4DPWA 2X7IA 2V2VA 4KQVA 4NXNI 1VI7A 2PO1B 4OO1A 3L7ZA 4FW7A 5C0XF 4DV0I 4JI2I 2WP8A 4YHHE 1WUUA 1P42A 4DV0E 2UXBI 4YHHI 3WU6A 1R6LA 4MYUA 3B78A 4LF8E 3V2UC 4JI0E 4JI7I 4LFBI 1KIJA 4PU9A 2UUAI 3KRNA 4NBQA 1XMOI 2PO0A 2VF3A 2J7KA 1E3HA 1UDOA 5GMEA 4FW3A 4WUCA 2R3VA 4HXZA 4DR7E 4DPUA 1N33E 3HJCA 4LF9I 4Z7CA 1PVGA 4DR2I 1IBME 1PIEA 4MDTA 2Z5CB 3Q6MA 2X36A 3V5RA 2UXCE 4IS9A 1R6MA 1XXEA 4BA2B 4X62E 1USVA 1UDQA 1K47A 4DV3I 2HK2A 2PNZA 1MX0A 1N34E 5DRPA 4DR1E 4X66E 4DV1E 5LMNE 4JI1E 1Z0BA 3ZM7A 4DUZE 1XNQI 2E5LI 4LF8I 4JI6I 1HK7A 1FJGI 1NHHA 2BA0D 3JAMQ 2UUAE 2A2DA 3HKMA 5EL9A 2F4VE 3QT6A 1N34I 4JI2E 5FLXQ 4QNKA 1YH8A 4DR6E 4Z7YA 2C38A 4B3ME 1N32E 3B4TA 4N3OA 1Z0GA 4NXMI 3L7ZB 2PNLA 1S16A 4DV6I 3QT7A 5DNLA 1Z0VA 1KKHA 4JG4A 1D6TA 4LCHA 4YY3E 4OX9I 4LCFA 1USUA 1FKAE 2DEIA 5BR8I 3PRYA 4DR4I 2ZBKB 4JI8I 1Z59A 1OYRA 5IT9Q 4JI3I 4M1KA 2HKEA 4ED4A 1IBKI 4JV5I 5ELWA 4IFDB 1S4EA 2O1VA 3WU3A 4HACA 4UT4A 4BA1B 1B62A 1Z0WA 4J3DA 4JI6E 1XMQI 4OZEA 4B3RI 4GKJE 1FNMA 2V2ZA 3M7ND 3U1KA 4DV7E 2UUBE 2OI2A 1ZXMA 5A2QQ 5LMNI 1NZ0A 5C0XD 4HY1A 2BR2B 4KHPI 2UXDE 4DPTA 2IESA 4ISAA 2WW4A 3LTOA 1HR0E 5IT9C 5K36F 4P52A 2DEJA 2BA1G 3J7AG 1ZM3A 2HK3A 2NN6E 3F0NA 2PO0B 5DRRA 4LF7E 2NN6F 4AQYE 1HNWI 2UU9E 1Y4SA 4DR3I 2UXDI 1KTVA 4X64I 3K17A 4YY3I 4IFDC 4I3HA 2F4VI 1I94E 5IWAE 5L3JA 3M85G 4DV4I 4FW4A 4FW6A 4LOMA 5JEAD 4IZJA 3ZZUA 2O1TA 5FLXC 4B3RE 1A6FA 1B63A 3H1CA 4IFDE 2UUBI 1FI4A 4AIMA 3UHMA 2HHHE 5C0XA 4EMDA 1OYPA 3OTOE 1H72C 1RHYA 4PRXA 3OTOI 4FW5A 4IZKB 4MQYA 3ZKDA 2JEAB 4U3BA 4IFDF 2ZM6I 1NHJA 3PYEA 4DR2E 4JI3E 1OJ4A 1H73A 4LFAE 2XEXA 2Z5BA 3PS2A 1N0UA 5C0XB 4B3TE 4LFCE 1UDNA 4AQYI 3NZKA 4DV2I 5K36C 4LFCI 4JYAI 1N33I 3U1YA 4OO1C 4B3SE 2CVEA 2HFUA 2WNRB 5JEAA 4DV5E 3J80Q 1U2RA 4B3MI 3Q6NA 2HKJA 1HNWE 1N32I 1RR9A 4X65E 5K36E 1H7UA 3M6AA 3J80C 2VQEI 4BA2A 2IOQA 4NXNE 3GCMA 3Q1QA 4KHPE 1ZXNA 4DPYA 3LNUA 1FWLA 1Z5AA 4DV4E 2NN6D 4DR1I 4USMA 2UUCI 5DRQA 4DV1I 2PO2B 2EFGA 5K36B 4ZVIA 4JI0I 4JI7E 4LFBE 1N0VC 3H4LA 1PKPA 3PS3A 4OO1F 4LF4E 4JV5E 1MG7A 4OX9E 4QNJA 4DU8A 2V2QA 5IWAI 2JEBB 2IERA 2O3ZA 1Z0CA 2R42A 4DR4E 2ZITA 4AIDA 4DR5I 4JI8E 2AE8A 2WP8B 2V34A 4JI5E 1ELOA 1HNZE 4LF4I 3QT5A 1KVKA 1IBLE 2GO3A 4LCGA 3GLLA 1J5EI 2JEAA 3P06A 3K85A 1J5EE 2JE6B 3GONA 1E3PA 3M7NG 3CDIA 2GS8A 1HNXE 5LMUI 4DR5E 2CZ9A 4OO1B 3B8HA 1N36E 2C37B 4DV7I 4IZKA 3PS1A 4MU4A 1FJGE 4LF5E 1ZM2A 2A2CA 1XNQE 4BA1A 2CGEA 3P3EA 2BV3A 2LJPA 1Y4UA 5DNXA 4GKKE 3ZZTA 4DV5I 5EKWA 2UUCE 2PO1A 1UEKA 4MU0A 4X65I 2VQEE 3HULA 4X64E 2VQFI 4DR3E 1UDSA 2PO2A 4IFDD 5K36A 4IZJB 2NN6B 3J7AM 1BKNA 4JI4I 1Y5YA 2UXCI 4DR6I 1OYSA 3ZZ0A 4DR7I 4P7AA 3K1JA 2Q2EB 1RREA 3P3GA 2JEBA 1H7SA 2VQFE 2J65A 1VISA 1NHIA 4LFAI 1XMOE 3J81Q 4B3TI 4JI1I 4U3DA 3WU5A 4URLA 5C0XC 3T1YI 4LF5I 2O1UA 5DROA 1Y6ZA 1FWKA 3T1YE 2NPFA 2ZM6E 4PRVA 2C38B 4FWGA 1XNRI 4GKJI 4IZJD 4X66I 1EI1A 1DARA 2PNZB 5C0XE 2HFSA 2C39B 3D4JA 4DUYI 4X62I 4IFDA 2BM0A 2UU9I 4OO1E 3CWVA 2NN6A 4WUBA 5GMDA 4GQUA 4JYAE 1ZM9A 1HR0I 2JE6A 4JI4E 3M85D 1I94I 3T1HE 1N36I 2VESA 3P3CA 5FWKA 4LF6E 1EA6A 1QZRA 1Y60A 2O1WA 4LF6I 2PNMA 5JEAC 2F1DA 4LF7I
chains in the Genus database with same CATH topology
4FWDA 3B82A 1Z0TA 4HACB 4DV6E 3WU4A 4GKKI 1H74A 3PYDA 4DXLA 1Z0EA 3JAMC 5A2QC 1Z5BA 4LF9E 4FW9A 2UXBE 2Z5BB 2GQ0A 4HYMA 1ZM4A 2HHHI 1XNRE 4K0KI 1IBKE 1XHKA 4K0KE 3PYFA 2E1RA 3ZKBA 4RPFA 5BR8E 2CG9A 2IOPA 2AJ4A 1XMQE 4MYTA 4WUDA 4JI5I 4R1FA 4DV3E 1IBLI 5LL6R 1HNZI 1MU5A 1HNXI 4UTGA 4USKA 4DUYE 3J81C 4DV2E 5LMUE 1Z5CA 4DPXA 1IBMI 2V8PA 3T1HI 4B3SI 4XTJA 2BM1A 4FWHA 2Z5CA 2Z5EA 4DUZI 4FN5A 4DU7A 3LPSA 4NXME 3PYGA 3QT8A 2E5LE 4DPWA 2X7IA 2V2VA 4KQVA 4NXNI 4DV0I 4JI2I 4YHHE 1WUUA 4DV0E 2UXBI 4YHHI 3WU6A 4MYUA 3B78A 4LF8E 3V2UC 4JI0E 4JI7I 4LFBI 1KIJA 4PU9A 2UUAI 1XMOI 2VF3A 2J7KA 5GMEA 4WUCA 2R3VA 4HXZA 4DR7E 4DPUA 1N33E 3HJCA 4LF9I 4Z7CA 1PVGA 4DR2I 1IBME 1PIEA 2Z5CB 3Q6MA 2X36A 3V5RA 2UXCE 4X62E 1USVA 1K47A 4DV3I 2HK2A 1MX0A 1N34E 4DR1E 4X66E 4DV1E 5LMNE 4JI1E 1Z0BA 3ZM7A 4DUZE 1XNQI 2E5LI 4LF8I 4JI6I 1HK7A 1FJGI 1NHHA 3JAMQ 2UUAE 2A2DA 2F4VE 3QT6A 1N34I 4JI2E 5FLXQ 4DR6E 4Z7YA 4B3ME 1N32E 4N3OA 1Z0GA 4NXMI 2PNLA 1S16A 4DV6I 3QT7A 1Z0VA 1KKHA 4JG4A 1D6TA 4YY3E 4OX9I 1USUA 1FKAE 2DEIA 5BR8I 3PRYA 4DR4I 2ZBKB 4JI8I 1Z59A 5IT9Q 4JI3I 4M1KA 2HKEA 4ED4A 1IBKI 4JV5I 1S4EA 2O1VA 3WU3A 4HACA 4UT4A 1B62A 1Z0WA 4JI6E 1XMQI 4B3RI 4GKJE 1FNMA 2V2ZA 4DV7E 2UUBE 2OI2A 1ZXMA 5A2QQ 5LMNI 1NZ0A 4HY1A 4KHPI 2UXDE 4DPTA 2WW4A 3LTOA 1HR0E 5IT9C 4P52A 2DEJA 3J7AG 1ZM3A 2HK3A 3F0NA 4LF7E 4AQYE 1HNWI 2UU9E 1Y4SA 4DR3I 2UXDI 1KTVA 4X64I 3K17A 4YY3I 4I3HA 2F4VI 1I94E 5IWAE 5L3JA 4DV4I 4IZJA 3ZZUA 2O1TA 5FLXC 4B3RE 1A6FA 1B63A 2UUBI 1FI4A 2HHHE 4EMDA 3OTOE 1H72C 4PRXA 3OTOI 4IZKB 3ZKDA 2ZM6I 1NHJA 3PYEA 4DR2E 4JI3E 1OJ4A 1H73A 4LFAE 2XEXA 2Z5BA 1N0UA 4B3TE 4LFCE 4AQYI 4DV2I 4LFCI 4JYAI 1N33I 4B3SE 2HFUA 4DV5E 3J80Q 1U2RA 4B3MI 3Q6NA 2HKJA 1HNWE 1N32I 1RR9A 4X65E 1H7UA 3M6AA 3J80C 2VQEI 2IOQA 4NXNE 3Q1QA 4KHPE 1ZXNA 4DPYA 3LNUA 1FWLA 1Z5AA 4DV4E 4DR1I 4USMA 2UUCI 4DV1I 2EFGA 4ZVIA 4JI0I 4JI7E 4LFBE 1N0VC 3H4LA 1PKPA 4LF4E 4JV5E 1MG7A 4OX9E 4DU8A 2V2QA 5IWAI 1Z0CA 2R42A 4DR4E 2ZITA 4DR5I 4JI8E 2V34A 4JI5E 1ELOA 1HNZE 4LF4I 3QT5A 1KVKA 1IBLE 1J5EI 3P06A 3K85A 1J5EE 3GONA 2GS8A 1HNXE 5LMUI 4DR5E 2CZ9A 3B8HA 1N36E 4DV7I 4IZKA 1FJGE 4LF5E 1ZM2A 2A2CA 1XNQE 2CGEA 2BV3A 2LJPA 1Y4UA 4GKKE 3ZZTA 4DV5I 2UUCE 1UEKA 4X65I 2VQEE 3HULA 4X64E 2VQFI 4DR3E 4IZJB 3J7AM 1BKNA 4JI4I 2UXCI 4DR6I 3ZZ0A 4DR7I 4P7AA 3K1JA 2Q2EB 1RREA 1H7SA 2VQFE 1VISA 1NHIA 4LFAI 1XMOE 3J81Q 4B3TI 4JI1I 3WU5A 4URLA 3T1YI 4LF5I 2O1UA 1Y6ZA 1FWKA 3T1YE 2NPFA 2ZM6E 4PRVA 4FWGA 1XNRI 4GKJI 4IZJD 4X66I 1EI1A 1DARA 2HFSA 3D4JA 4DUYI 4X62I 2BM0A 2UU9I 3CWVA 4WUBA 5GMDA 4JYAE 1ZM9A 1HR0I 4JI4E 1I94I 3T1HE 1N36I 5FWKA 4LF6E 1EA6A 1QZRA 2O1WA 4LF6I 2PNMA 4LF7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWD A;  3B82 A;  1Z0T A;  4HAC B;  4DV6 E;  3WU4 A;  4GKK I;  1H74 A;  3PYD A;  4DXL A;  1Z0E A;  3JAM C;  5A2Q C;  1Z5B A;  4LF9 E;  4FW9 A;  2UXB E;  4HYM A;  1ZM4 A;  2HHH I;  1XNR E;  4K0K I;  1IBK E;  1XHK A;  4K0K E;  3PYF A;  2E1R A;  3ZKB A;  4RPF A;  5BR8 E;  2AJ4 A;  1XMQ E;  4MYT A;  4WUD A;  4JI5 I;  4R1F A;  4DV3 E;  1IBL I;  5LL6 R;  1HNZ I;  1MU5 A;  1HNX I;  4UTG A;  4USK A;  4DUY E;  3J81 C;  4DV2 E;  5LMU E;  1Z5C A;  4DPX A;  1IBM I;  2V8P A;  3T1H I;  4B3S I;  4XTJ A;  2BM1 A;  4FWH A;  4DUZ I;  4FN5 A;  4DU7 A;  3LPS A;  4NXM E;  3PYG A;  3QT8 A;  2E5L E;  4DPW A;  2X7I A;  2V2V A;  4KQV A;  4NXN I;  4DV0 I;  4JI2 I;  4YHH E;  1WUU A;  4DV0 E;  2UXB I;  4YHH I;  3WU6 A;  4MYU A;  3B78 A;  4LF8 E;  3V2U C;  4JI0 E;  4JI7 I;  4LFB I;  1KIJ A;  4PU9 A;  2UUA I;  1XMO I;  2VF3 A;  2J7K A;  5GME A;  4WUC A;  2R3V A;  4HXZ A;  4DR7 E;  4DPU A;  1N33 E;  4LF9 I;  4Z7C A;  1PVG A;  4DR2 I;  1IBM E;  1PIE A;  2X36 A;  3V5R A;  2UXC E;  4X62 E;  1K47 A;  4DV3 I;  2HK2 A;  1MX0 A;  1N34 E;  4DR1 E;  4X66 E;  4DV1 E;  5LMN E;  4JI1 E;  1Z0B A;  3ZM7 A;  4DUZ E;  1XNQ I;  2E5L I;  4LF8 I;  4JI6 I;  1FJG I;  1NHH A;  3JAM Q;  2UUA E;  2A2D A;  2F4V E;  3QT6 A;  1N34 I;  4JI2 E;  5FLX Q;  4DR6 E;  4Z7Y A;  4B3M E;  1N32 E;  1Z0G A;  4NXM I;  1S16 A;  4DV6 I;  3QT7 A;  1Z0V A;  1KKH A;  4JG4 A;  1D6T A;  4YY3 E;  4OX9 I;  1FKA E;  2DEI A;  5BR8 I;  4DR4 I;  2ZBK B;  4JI8 I;  1Z59 A;  5IT9 Q;  4JI3 I;  4M1K A;  2HKE A;  4ED4 A;  1IBK I;  4JV5 I;  1S4E A;  3WU3 A;  4HAC A;  4UT4 A;  1B62 A;  1Z0W A;  4JI6 E;  1XMQ I;  4B3R I;  4GKJ E;  1FNM A;  2V2Z A;  4DV7 E;  2UUB E;  2OI2 A;  1ZXM A;  5A2Q Q;  5LMN I;  1NZ0 A;  4HY1 A;  4KHP I;  2UXD E;  4DPT A;  2WW4 A;  3LTO A;  1HR0 E;  5IT9 C;  4P52 A;  2DEJ A;  3J7A G;  1ZM3 A;  2HK3 A;  3F0N A;  4LF7 E;  4AQY E;  1HNW I;  2UU9 E;  4DR3 I;  2UXD I;  1KTV A;  4X64 I;  3K17 A;  4YY3 I;  4I3H A;  2F4V I;  1I94 E;  5IWA E;  5L3J A;  4DV4 I;  3ZZU A;  5FLX C;  4B3R E;  1A6F A;  1B63 A;  2UUB I;  1FI4 A;  2HHH E;  4EMD A;  3OTO E;  1H72 C;  4PRX A;  3OTO I;  3ZKD A;  2ZM6 I;  1NHJ A;  3PYE A;  4DR2 E;  4JI3 E;  1OJ4 A;  1H73 A;  4LFA E;  2XEX A;  1N0U A;  4B3T E;  4LFC E;  4AQY I;  4DV2 I;  4LFC I;  4JYA I;  1N33 I;  4B3S E;  2HFU A;  4DV5 E;  3J80 Q;  1U2R A;  4B3M I;  2HKJ A;  1HNW E;  1N32 I;  1RR9 A;  4X65 E;  1H7U A;  3M6A A;  3J80 C;  2VQE I;  4NXN E;  3Q1Q A;  4KHP E;  1ZXN A;  4DPY A;  3LNU A;  1FWL A;  1Z5A A;  4DV4 E;  4DR1 I;  4USM A;  2UUC I;  4DV1 I;  2EFG A;  4ZVI A;  4JI0 I;  4JI7 E;  4LFB E;  1N0V C;  3H4L A;  1PKP A;  4LF4 E;  4JV5 E;  1MG7 A;  4OX9 E;  4DU8 A;  2V2Q A;  5IWA I;  1Z0C A;  2R42 A;  4DR4 E;  2ZIT A;  4DR5 I;  4JI8 E;  2V34 A;  4JI5 E;  1ELO A;  1HNZ E;  4LF4 I;  3QT5 A;  1KVK A;  1IBL E;  1J5E I;  1J5E E;  3GON A;  2GS8 A;  1HNX E;  5LMU I;  4DR5 E;  2CZ9 A;  3B8H A;  1N36 E;  4DV7 I;  1FJG E;  4LF5 E;  1ZM2 A;  2A2C A;  1XNQ E;  2BV3 A;  2LJP A;  4GKK E;  3ZZT A;  4DV5 I;  2UUC E;  1UEK A;  4X65 I;  2VQE E;  3HUL A;  4X64 E;  2VQF I;  4DR3 E;  3J7A M;  1BKN A;  4JI4 I;  2UXC I;  4DR6 I;  3ZZ0 A;  4DR7 I;  4P7A A;  3K1J A;  2Q2E B;  1RRE A;  1H7S A;  2VQF E;  1VIS A;  1NHI A;  4LFA I;  1XMO E;  3J81 Q;  4B3T I;  4JI1 I;  3WU5 A;  4URL A;  3T1Y I;  4LF5 I;  1FWK A;  3T1Y E;  2NPF A;  2ZM6 E;  4PRV A;  4FWG A;  1XNR I;  4GKJ I;  4X66 I;  1EI1 A;  1DAR A;  2HFS A;  3D4J A;  4DUY I;  4X62 I;  2BM0 A;  2UU9 I;  3CWV A;  4WUB A;  5GMD A;  4JYA E;  1ZM9 A;  1HR0 I;  4JI4 E;  1I94 I;  3T1H E;  1N36 I;  4LF6 E;  1EA6 A;  1QZR A;  4LF6 I;  4LF7 I; 
#chains in the Genus database with same CATH topology
 4FWD A;  3B82 A;  1Z0T A;  3GME A;  4HAC B;  4DV6 E;  3WU4 A;  4GKK I;  1H74 A;  3PYD A;  2NN6 C;  4MU3 A;  1Z0E A;  4DXL A;  4AM3 A;  3JAM C;  5JEA E;  5A2Q C;  1Z5B A;  4LF9 E;  4FW9 A;  2UXB E;  2Z5B B;  2GQ0 A;  2JT2 A;  4HYM A;  1ZM4 A;  2HHH I;  1XNR E;  4K0K I;  1IBK E;  1XHK A;  4K0K E;  3PYF A;  2E1R A;  2C37 A;  3ZKB A;  4RPF A;  2CG9 A;  2IOP A;  2WNR A;  2AJ4 A;  3DD6 A;  5BR8 E;  5JEA B;  1XMQ E;  1YHC A;  4MYT A;  4WUD A;  4JI5 I;  4R1F A;  4DV3 E;  1IBL I;  5LL6 R;  1HNZ I;  4OKG A;  5JEA F;  1MU5 A;  1HNX I;  4UTG A;  4USK A;  4DUY E;  3J81 C;  4DV2 E;  5LMU E;  1Z5C A;  4DPX A;  2BR2 A;  2BA1 D;  2C39 A;  4LPF A;  1IBM I;  2V8P A;  3T1H I;  4B3S I;  3CDJ A;  2GO4 A;  4XTJ A;  2BM1 A;  4FWH A;  2Z5C A;  2Z5E A;  5K36 D;  2BA0 G;  3P76 A;  4FN5 A;  4DU7 A;  4DUZ I;  4MU1 A;  3LPS A;  4NXM E;  3PYG A;  4OO1 D;  3QT8 A;  2E5L E;  4DPW A;  2X7I A;  2V2V A;  4KQV A;  4NXN I;  1VI7 A;  2PO1 B;  4OO1 A;  3L7Z A;  4FW7 A;  5C0X F;  4DV0 I;  4JI2 I;  2WP8 A;  4YHH E;  1WUU A;  1P42 A;  4DV0 E;  2UXB I;  4YHH I;  3WU6 A;  1R6L A;  4MYU A;  3B78 A;  4LF8 E;  3V2U C;  4JI0 E;  4JI7 I;  4LFB I;  1KIJ A;  4PU9 A;  2UUA I;  3KRN A;  4NBQ A;  1XMO I;  2PO0 A;  2VF3 A;  2J7K A;  1E3H A;  1UDO A;  5GME A;  4FW3 A;  4WUC A;  2R3V A;  4HXZ A;  4DR7 E;  4DPU A;  1N33 E;  3HJC A;  4LF9 I;  4Z7C A;  1PVG A;  4DR2 I;  1IBM E;  1PIE A;  4MDT A;  2Z5C B;  3Q6M A;  2X36 A;  3V5R A;  2UXC E;  4IS9 A;  1R6M A;  1XXE A;  4BA2 B;  4X62 E;  1USV A;  1UDQ A;  1K47 A;  4DV3 I;  2HK2 A;  2PNZ A;  1MX0 A;  1N34 E;  5DRP A;  4DR1 E;  4X66 E;  4DV1 E;  5LMN E;  4JI1 E;  1Z0B A;  3ZM7 A;  4DUZ E;  1XNQ I;  2E5L I;  4LF8 I;  4JI6 I;  1HK7 A;  1FJG I;  1NHH A;  2BA0 D;  3JAM Q;  2UUA E;  2A2D A;  3HKM A;  5EL9 A;  2F4V E;  3QT6 A;  1N34 I;  4JI2 E;  5FLX Q;  4QNK A;  1YH8 A;  4DR6 E;  4Z7Y A;  2C38 A;  4B3M E;  1N32 E;  3B4T A;  4N3O A;  1Z0G A;  4NXM I;  3L7Z B;  2PNL A;  1S16 A;  4DV6 I;  3QT7 A;  5DNL A;  1Z0V A;  1KKH A;  4JG4 A;  1D6T A;  4LCH A;  4YY3 E;  4OX9 I;  4LCF A;  1USU A;  1FKA E;  2DEI A;  5BR8 I;  3PRY A;  4DR4 I;  2ZBK B;  4JI8 I;  1Z59 A;  1OYR A;  5IT9 Q;  4JI3 I;  4M1K A;  2HKE A;  4ED4 A;  1IBK I;  4JV5 I;  5ELW A;  4IFD B;  1S4E A;  2O1V A;  3WU3 A;  4HAC A;  4UT4 A;  4BA1 B;  1B62 A;  1Z0W A;  4J3D A;  4JI6 E;  1XMQ I;  4OZE A;  4B3R I;  4GKJ E;  1FNM A;  2V2Z A;  3M7N D;  3U1K A;  4DV7 E;  2UUB E;  2OI2 A;  1ZXM A;  5A2Q Q;  5LMN I;  1NZ0 A;  5C0X D;  4HY1 A;  2BR2 B;  4KHP I;  2UXD E;  4DPT A;  2IES A;  4ISA A;  2WW4 A;  3LTO A;  1HR0 E;  5IT9 C;  5K36 F;  4P52 A;  2DEJ A;  2BA1 G;  3J7A G;  1ZM3 A;  2HK3 A;  2NN6 E;  3F0N A;  2PO0 B;  5DRR A;  4LF7 E;  2NN6 F;  4AQY E;  1HNW I;  2UU9 E;  1Y4S A;  4DR3 I;  2UXD I;  1KTV A;  4X64 I;  3K17 A;  4YY3 I;  4IFD C;  4I3H A;  2F4V I;  1I94 E;  5IWA E;  5L3J A;  3M85 G;  4DV4 I;  4FW4 A;  4FW6 A;  4LOM A;  5JEA D;  4IZJ A;  3ZZU A;  2O1T A;  5FLX C;  4B3R E;  1A6F A;  1B63 A;  3H1C A;  4IFD E;  2UUB I;  1FI4 A;  4AIM A;  3UHM A;  2HHH E;  5C0X A;  4EMD A;  1OYP A;  3OTO E;  1H72 C;  1RHY A;  4PRX A;  3OTO I;  4FW5 A;  4IZK B;  4MQY A;  3ZKD A;  2JEA B;  4U3B A;  4IFD F;  2ZM6 I;  1NHJ A;  3PYE A;  4DR2 E;  4JI3 E;  1OJ4 A;  1H73 A;  4LFA E;  2XEX A;  2Z5B A;  3PS2 A;  1N0U A;  5C0X B;  4B3T E;  4LFC E;  1UDN A;  4AQY I;  3NZK A;  4DV2 I;  5K36 C;  4LFC I;  4JYA I;  1N33 I;  3U1Y A;  4OO1 C;  4B3S E;  2CVE A;  2HFU A;  2WNR B;  5JEA A;  4DV5 E;  3J80 Q;  1U2R A;  4B3M I;  3Q6N A;  2HKJ A;  1HNW E;  1N32 I;  1RR9 A;  4X65 E;  5K36 E;  1H7U A;  3M6A A;  3J80 C;  2VQE I;  4BA2 A;  2IOQ A;  4NXN E;  3GCM A;  3Q1Q A;  4KHP E;  1ZXN A;  4DPY A;  3LNU A;  1FWL A;  1Z5A A;  4DV4 E;  2NN6 D;  4DR1 I;  4USM A;  2UUC I;  5DRQ A;  4DV1 I;  2PO2 B;  2EFG A;  5K36 B;  4ZVI A;  4JI0 I;  4JI7 E;  4LFB E;  1N0V C;  3H4L A;  1PKP A;  3PS3 A;  4OO1 F;  4LF4 E;  4JV5 E;  1MG7 A;  4OX9 E;  4QNJ A;  4DU8 A;  2V2Q A;  5IWA I;  2JEB B;  2IER A;  2O3Z A;  1Z0C A;  2R42 A;  4DR4 E;  2ZIT A;  4AID A;  4DR5 I;  4JI8 E;  2AE8 A;  2WP8 B;  2V34 A;  4JI5 E;  1ELO A;  1HNZ E;  4LF4 I;  3QT5 A;  1KVK A;  1IBL E;  2GO3 A;  4LCG A;  3GLL A;  1J5E I;  2JEA A;  3P06 A;  3K85 A;  1J5E E;  2JE6 B;  3GON A;  1E3P A;  3M7N G;  3CDI A;  2GS8 A;  1HNX E;  5LMU I;  4DR5 E;  2CZ9 A;  4OO1 B;  3B8H A;  1N36 E;  2C37 B;  4DV7 I;  4IZK A;  3PS1 A;  4MU4 A;  1FJG E;  4LF5 E;  1ZM2 A;  2A2C A;  1XNQ E;  4BA1 A;  2CGE A;  3P3E A;  2BV3 A;  2LJP A;  1Y4U A;  5DNX A;  4GKK E;  3ZZT A;  4DV5 I;  5EKW A;  2UUC E;  2PO1 A;  1UEK A;  4MU0 A;  4X65 I;  2VQE E;  3HUL A;  4X64 E;  2VQF I;  4DR3 E;  1UDS A;  2PO2 A;  4IFD D;  5K36 A;  4IZJ B;  2NN6 B;  3J7A M;  1BKN A;  4JI4 I;  1Y5Y A;  2UXC I;  4DR6 I;  1OYS A;  3ZZ0 A;  4DR7 I;  4P7A A;  3K1J A;  2Q2E B;  1RRE A;  3P3G A;  2JEB A;  1H7S A;  2VQF E;  2J65 A;  1VIS A;  1NHI A;  4LFA I;  1XMO E;  3J81 Q;  4B3T I;  4JI1 I;  4U3D A;  3WU5 A;  4URL A;  5C0X C;  3T1Y I;  4LF5 I;  2O1U A;  5DRO A;  1Y6Z A;  1FWK A;  3T1Y E;  2NPF A;  2ZM6 E;  4PRV A;  2C38 B;  4FWG A;  1XNR I;  4GKJ I;  4IZJ D;  4X66 I;  1EI1 A;  1DAR A;  2PNZ B;  5C0X E;  2HFS A;  2C39 B;  3D4J A;  4DUY I;  4X62 I;  4IFD A;  2BM0 A;  2UU9 I;  4OO1 E;  3CWV A;  2NN6 A;  4WUB A;  5GMD A;  4GQU A;  4JYA E;  1ZM9 A;  1HR0 I;  2JE6 A;  4JI4 E;  3M85 D;  1I94 I;  3T1H E;  1N36 I;  2VES A;  3P3C A;  5FWK A;  4LF6 E;  1EA6 A;  1QZR A;  1Y60 A;  2O1W A;  4LF6 I;  2PNM A;  5JEA C;  2F1D A;  4LF7 I; 
#chains in the Genus database with same CATH homology
 4FWD A;  3B82 A;  1Z0T A;  4HAC B;  4DV6 E;  3WU4 A;  4GKK I;  1H74 A;  3PYD A;  4DXL A;  1Z0E A;  3JAM C;  5A2Q C;  1Z5B A;  4LF9 E;  4FW9 A;  2UXB E;  2Z5B B;  2GQ0 A;  4HYM A;  1ZM4 A;  2HHH I;  1XNR E;  4K0K I;  1IBK E;  1XHK A;  4K0K E;  3PYF A;  2E1R A;  3ZKB A;  4RPF A;  5BR8 E;  2CG9 A;  2IOP A;  2AJ4 A;  1XMQ E;  4MYT A;  4WUD A;  4JI5 I;  4R1F A;  4DV3 E;  1IBL I;  5LL6 R;  1HNZ I;  1MU5 A;  1HNX I;  4UTG A;  4USK A;  4DUY E;  3J81 C;  4DV2 E;  5LMU E;  1Z5C A;  4DPX A;  1IBM I;  2V8P A;  3T1H I;  4B3S I;  4XTJ A;  2BM1 A;  4FWH A;  2Z5C A;  2Z5E A;  4DUZ I;  4FN5 A;  4DU7 A;  3LPS A;  4NXM E;  3PYG A;  3QT8 A;  2E5L E;  4DPW A;  2X7I A;  2V2V A;  4KQV A;  4NXN I;  4DV0 I;  4JI2 I;  4YHH E;  1WUU A;  4DV0 E;  2UXB I;  4YHH I;  3WU6 A;  4MYU A;  3B78 A;  4LF8 E;  3V2U C;  4JI0 E;  4JI7 I;  4LFB I;  1KIJ A;  4PU9 A;  2UUA I;  1XMO I;  2VF3 A;  2J7K A;  5GME A;  4WUC A;  2R3V A;  4HXZ A;  4DR7 E;  4DPU A;  1N33 E;  3HJC A;  4LF9 I;  4Z7C A;  1PVG A;  4DR2 I;  1IBM E;  1PIE A;  2Z5C B;  3Q6M A;  2X36 A;  3V5R A;  2UXC E;  4X62 E;  1USV A;  1K47 A;  4DV3 I;  2HK2 A;  1MX0 A;  1N34 E;  4DR1 E;  4X66 E;  4DV1 E;  5LMN E;  4JI1 E;  1Z0B A;  3ZM7 A;  4DUZ E;  1XNQ I;  2E5L I;  4LF8 I;  4JI6 I;  1HK7 A;  1FJG I;  1NHH A;  3JAM Q;  2UUA E;  2A2D A;  2F4V E;  3QT6 A;  1N34 I;  4JI2 E;  5FLX Q;  4DR6 E;  4Z7Y A;  4B3M E;  1N32 E;  4N3O A;  1Z0G A;  4NXM I;  2PNL A;  1S16 A;  4DV6 I;  3QT7 A;  1Z0V A;  1KKH A;  4JG4 A;  1D6T A;  4YY3 E;  4OX9 I;  1USU A;  1FKA E;  2DEI A;  5BR8 I;  3PRY A;  4DR4 I;  2ZBK B;  4JI8 I;  1Z59 A;  5IT9 Q;  4JI3 I;  4M1K A;  2HKE A;  4ED4 A;  1IBK I;  4JV5 I;  1S4E A;  2O1V A;  3WU3 A;  4HAC A;  4UT4 A;  1B62 A;  1Z0W A;  4JI6 E;  1XMQ I;  4B3R I;  4GKJ E;  1FNM A;  2V2Z A;  4DV7 E;  2UUB E;  2OI2 A;  1ZXM A;  5A2Q Q;  5LMN I;  1NZ0 A;  4HY1 A;  4KHP I;  2UXD E;  4DPT A;  2WW4 A;  3LTO A;  1HR0 E;  5IT9 C;  4P52 A;  2DEJ A;  3J7A G;  1ZM3 A;  2HK3 A;  3F0N A;  4LF7 E;  4AQY E;  1HNW I;  2UU9 E;  1Y4S A;  4DR3 I;  2UXD I;  1KTV A;  4X64 I;  3K17 A;  4YY3 I;  4I3H A;  2F4V I;  1I94 E;  5IWA E;  5L3J A;  4DV4 I;  4IZJ A;  3ZZU A;  2O1T A;  5FLX C;  4B3R E;  1A6F A;  1B63 A;  2UUB I;  1FI4 A;  2HHH E;  4EMD A;  3OTO E;  1H72 C;  4PRX A;  3OTO I;  4IZK B;  3ZKD A;  2ZM6 I;  1NHJ A;  3PYE A;  4DR2 E;  4JI3 E;  1OJ4 A;  1H73 A;  4LFA E;  2XEX A;  2Z5B A;  1N0U A;  4B3T E;  4LFC E;  4AQY I;  4DV2 I;  4LFC I;  4JYA I;  1N33 I;  4B3S E;  2HFU A;  4DV5 E;  3J80 Q;  1U2R A;  4B3M I;  3Q6N A;  2HKJ A;  1HNW E;  1N32 I;  1RR9 A;  4X65 E;  1H7U A;  3M6A A;  3J80 C;  2VQE I;  2IOQ A;  4NXN E;  3Q1Q A;  4KHP E;  1ZXN A;  4DPY A;  3LNU A;  1FWL A;  1Z5A A;  4DV4 E;  4DR1 I;  4USM A;  2UUC I;  4DV1 I;  2EFG A;  4ZVI A;  4JI0 I;  4JI7 E;  4LFB E;  1N0V C;  3H4L A;  1PKP A;  4LF4 E;  4JV5 E;  1MG7 A;  4OX9 E;  4DU8 A;  2V2Q A;  5IWA I;  1Z0C A;  2R42 A;  4DR4 E;  2ZIT A;  4DR5 I;  4JI8 E;  2V34 A;  4JI5 E;  1ELO A;  1HNZ E;  4LF4 I;  3QT5 A;  1KVK A;  1IBL E;  1J5E I;  3P06 A;  3K85 A;  1J5E E;  3GON A;  2GS8 A;  1HNX E;  5LMU I;  4DR5 E;  2CZ9 A;  3B8H A;  1N36 E;  4DV7 I;  4IZK A;  1FJG E;  4LF5 E;  1ZM2 A;  2A2C A;  1XNQ E;  2CGE A;  2BV3 A;  2LJP A;  1Y4U A;  4GKK E;  3ZZT A;  4DV5 I;  2UUC E;  1UEK A;  4X65 I;  2VQE E;  3HUL A;  4X64 E;  2VQF I;  4DR3 E;  4IZJ B;  3J7A M;  1BKN A;  4JI4 I;  2UXC I;  4DR6 I;  3ZZ0 A;  4DR7 I;  4P7A A;  3K1J A;  2Q2E B;  1RRE A;  1H7S A;  2VQF E;  1VIS A;  1NHI A;  4LFA I;  1XMO E;  3J81 Q;  4B3T I;  4JI1 I;  3WU5 A;  4URL A;  3T1Y I;  4LF5 I;  2O1U A;  1Y6Z A;  1FWK A;  3T1Y E;  2NPF A;  2ZM6 E;  4PRV A;  4FWG A;  1XNR I;  4GKJ I;  4IZJ D;  4X66 I;  1EI1 A;  1DAR A;  2HFS A;  3D4J A;  4DUY I;  4X62 I;  2BM0 A;  2UU9 I;  3CWV A;  4WUB A;  5GMD A;  4JYA E;  1ZM9 A;  1HR0 I;  4JI4 E;  1I94 I;  3T1H E;  1N36 I;  5FWK A;  4LF6 E;  1EA6 A;  1QZR A;  2O1W A;  4LF6 I;  2PNM A;  4LF7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...