3L7ZA

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
271
structure length
251
Chain Sequence
b'MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 2
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
total genus 73
structure length 251
sequence length 271
chains with identical sequence D, G
ec nomenclature ec 3.1.13.-:
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3l7zA01
1E3HA 2PO2B 2NN6D 5JEAF 2JEAA 4OO1D 2PO0B 5C0XC 4BA2B 2BA1G 5JEAB 3GLLA 2C39A 3KRNA 3M7NG 2C38A 2BR2A 2NN6A 2JE6B 5K36E 1R6LA 4OO1A 2PO2A 4BA1B 1OYPA 2JEBB 2PO0A 2NN6C 4BA2A 5K36D 5JEAA 2WNRB 4AIMA 3L7ZB 4NBQA 2JE6A 3GMEA 3HKMA 5C0XF 5K36F 2WP8B 5JEAC 5C0XE 4AIDA 4BA1A 2JEBA 4IFDF 5C0XB 5K36B 4IFDE 3H1CA 2PO1B 2PNZB 5C0XD 2WNRA 3B4TA 4IFDB 4OO1C 3L7ZA 1UDOA 3GCMA 3U1KA 4IFDD 2WP8A 1E3PA 3M85D 1UDQA 3CDIA 2BA0D 5C0XA 5K36A 3M85G 2PO1A 2PNZA 2C37A 2BA1D 1R6MA 4IFDA 5JEAE 3M7ND 2C37B 5K36C 2JEAB 4AM3A 1OYRA 1UDNA 1UDSA 4IFDC 2NN6F 3DD6A 5JEAD 2NN6E 4OO1F 2C39B 1OYSA 2C38B 2BR2B 4OO1E 3CDJA 2NN6B 2BA0G 4OO1B
chains in the Genus database with same CATH superfamily
4LF5E 3PYFA 2F4VI 4IZJA 1MU5A 1IBKE 4DR4I 2HK2A 4OO1D 4FW7A 1FWLA 1YH8A 2UUBI 5C0XC 4FW4A 3F0NA 2VESA 1H74A 4FWGA 3WU3A 3ZZTA 3JAMQ 1FNMA 4LF8I 2C39A 5EKWA 4DR6I 3M7NG 3LPSA 2V34A 2ZITA 4JI7I 4DV1E 4DR3E 4LOMA 1R6LA 4FW5A 4OX9I 2V2VA 3JAMC 3CWVA 1Y4UA 4DPUA 2PO2A 3LNUA 4DV7I 4AQYI 4JI3E 1FKAE 2Z5CA 4DR1I 3V2UC 1HNZE 4LFCI 2ZM6E 1QZRA 2UXCE 1Z0EA 2GO4A 2E1RA 5LMNE 1EA6A 2V2QA 3L7ZB 1B62A 2F4VE 4DR4E 5K36F 2UUBE 1DARA 4AIDA 4JI6E 4LF8E 3V5RA 5K36B 3H1CA 4LPFA 4JI7E 1USVA 1ZXMA 4X65E 2PNZB 1N33I 1RREA 3WU4A 2R3VA 3T1HI 4OX9E 4FW6A 1Z0BA 4B3MI 2UU9I 4LFAE 1XNRE 1Z0TA 1E3PA 1UDQA 4LFCE 1ZXNA 1U2RA 1UEKA 4B3SI 4JI5E 3M85G 1NZ0A 1N0VC 2WW4A 4DV5I 2BV3A 4B3TE 4JI8I 4ISAA 2VQEI 2C37B 1K47A 2Z5BA 4IZJB 5FWKA 4DV6I 1UDSA 3B82A 1D6TA 1N33E 3P3CA 3T1HE 4LF6I 2C39B 4LF4I 4IS9A 2IESA 4DV4I 3Q1QA 4MDTA 4B3ME 4HXZA 2UU9E 4OO1E 3GONA 1IBKI 1KIJA 4USMA 4X62E 1HR0I 4LF7I 1Z0WA 2PO2B 4QNKA 1PVGA 4J3DA 4B3SE 3QT5A 2Z5CB 3Q6MA 4HY1A 3OTOI 4DU7A 4DUZI 4EMDA 1I94E 5BR8I 4DR5E 3GLLA 1B63A 4LFBI 3KRNA 3Q6NA 4U3BA 4DR7I 1VI7A 4I3HA 4OO1A 5LMUI 4DV6E 1Y6ZA 3H4LA 2ZM6I 5DNLA 2UXCI 3WU5A 3ZM7A 5LMNI 1ELOA 4LF6E 2PO0A 4LF4E 5K36D 4DV4E 1A6FA 2AJ4A 1EI1A 1ZM4A 4RPFA 5JEAA 1Z0CA 1HR0E 4USKA 4JI6I 4LF7E 4DU8A 2JE6A 3U1YA 5A2QQ 3T1YE 5JEAC 3OTOE 4X65I 4WUDA 4DUZE 4ED4A 1VISA 5L3JA 4JG4A 5BR8E 4DV0I 2UUAI 4LFBE 5A2QC 3J80C 4LFAI 5ELWA 1XNRI 2ZBKB 2HKEA 3HULA 4JI0I 2O1TA 5C0XD 4DR7E 2WNRA 5LMUE 2CZ9A 2J65A 4MQYA 2HFUA 1UDOA 2Z5BB 4JI5I 4HACA 4IFDD 3M85D 4B3TI 4DUYI 4FW9A 3D4JA 2CVEA 1N36I 4QNJA 2PO1A 2O3ZA 4GKJE 2BA1D 4Z7YA 2VF3A 3J81Q 4N3OA 1N32I 1RHYA 2Z5EA 4URLA 1HNXI 1XHKA 2BM1A 4DV0E 2UUAE 1OYRA 4IZKB 4JI4E 2PNMA 3J81C 3B8HA 1P42A 5IWAI 3DD6A 4X62I 4JI0E 3B78A 1Y4SA 4OO1F 1XMQI 1Z5AA 3K1JA 5LL6R 4OO1B 1ZM2A 1E3HA 4DUYE 1I94I 2NN6D 4MYUA 5JEAF 4DR5I 2Q2EB 2JEAA 4FWDA 1PKPA 3ZKDA 2PO0B 1N36E 1PIEA 4GQUA 4DV2E 2PNLA 3P3EA 2BA1G 5JEAB 5EL9A 4Z7CA 1N32E 2C38A 2BR2A 2AE8A 1HNXE 2R42A 2JE6B 5K36E 4KQVA 4MU0A 1WUUA 2A2CA 4KHPI 3ZKBA 5IWAE 1XMQE 5DRRA 1USUA 4BA2A 1BKNA 5GMDA 4K0KE 2CGEA 3T1YI 3P3GA 1FWKA 1H7UA 4DV3I 4PU9A 2UXBE 2WNRB 2LJPA 4LCHA 4B3RI 4LCFA 1XXEA 4AIMA 2F1DA 4NBQA 3GMEA 3HKMA 4HACB 4WUBA 3PS2A 1HK7A 1MX0A 5C0XE 4P7AA 1RR9A 4OZEA 4NXNI 4X66I 4BA1A 1H7SA 2JEBA 3J7AG 2EFGA 1IBLE 1Z5CA 5FLXC 4IFDE 2PO1B 1ZM3A 2V2ZA 4KHPE 4MYTA 4OO1C 3ZZ0A 3U1KA 2WP8A 4R1FA 3HJCA 3CDIA 4GKJI 2BA0D 3J80Q 1FJGE 4DV3E 1S4EA 3QT6A 4DPXA 1KKHA 4DPWA 5C0XA 4B3RE 2HHHI 2GS8A 3PRYA 1NHIA 2C37A 1R6MA 5GMEA 4JI4I 4IFDA 4DR2I 4X66E 4NXNE 4JI2I 2JEAB 4JYAI 4JV5I 2OI2A 4FW3A 1XNQI 1UDNA 1Z59A 1Y60A 4IFDC 4OKGA 2O1WA 2CG9A 4IZJD 5JEAD 4UT4A 4WUCA 2NN6E 1OYSA 3M6AA 2C38B 2BR2B 1N34I 4LF9E 4HYMA 2GO3A 3CDJA 1XMOI 2X7IA 1Z0VA 2XEXA 1HNWE 4DXLA 4XTJA 2VQFI 2NPFA 4DV2I 2BA0G 2DEIA 5IT9Q 2A2DA 3PYEA 4YHHE 1MG7A 1KVKA 2J7KA 1FI4A 3K17A 4BA2B 2HHHE 1H73A 2IOPA 5DROA 5IT9C 1NHJA 4DR2E 1NHHA 4JI2E 2NN6A 1IBMI 4JYAE 4JV5E 4M1KA 1XNQE 3NZKA 1J5EI 3PYGA 2UUCI 4DR6E 4K0KI 2UXBI 1S16A 2DEJA 4BA1B 1OYPA 2JEBB 4GKKI 3PS3A 2NN6C 2X36A 1N34E 4JI1I 1XMOE 4MU1A 3WU6A 2VQFE 4DV7E 1Z0GA 4AQYE 3P76A 2HK3A 4DR1E 1IBLI 5C0XF 1OJ4A 2WP8B 2O1UA 3PS1A 1N0UA 4MU3A 3J7AM 1Y5YA 2IERA 4IFDF 2UXDI 3K85A 4LCGA 5C0XB 5DRQA 1IBME 3QT7A 2GQ0A 4NXMI 3B4TA 4IFDB 4YY3I 1FJGI 1J5EE 2UUCE 3L7ZA 2BM0A 3ZZUA 3GCMA 4GKKE 2E5LI 1ZM9A 2V8PA 4X64I 4JI1E 5FLXQ 2HFSA 1YHCA 4FN5A 4ZVIA 4LF5I 4DPYA 5K36A 4DPTA 2PNZA 3P06A 2JT2A 4FWHA 3PYDA 1H72C 5JEAE 4IZKA 3M7ND 5K36C 4DV1I 4DR3I 3LTOA 4P52A 4DV5E 2UXDE 4AM3A 4JI8E 4LF9I 4U3DA 1KTVA 1HNWI 2NN6F 4PRVA 3QT8A 1Z5BA 5DRPA 5DNXA 2VQEE 2O1VA 2HKJA 4NXME 4JI3I 4YY3E 1HNZI 4UTGA 2NN6B 4YHHI 2IOQA 4PRXA 2E5LE 3UHMA 4MU4A 4X64E
chains in the Genus database with same CATH topology
1E3HA 2PO2B 2NN6D 5JEAF 2JEAA 4OO1D 2PO0B 5C0XC 4BA2B 2BA1G 5JEAB 3GLLA 2C39A 3KRNA 3M7NG 2C38A 2BR2A 2NN6A 2JE6B 5K36E 1R6LA 4OO1A 2PO2A 4BA1B 1OYPA 2JEBB 2PO0A 2NN6C 4BA2A 5K36D 5JEAA 2WNRB 4AIMA 3L7ZB 4NBQA 2JE6A 3GMEA 3HKMA 5C0XF 5K36F 2WP8B 5JEAC 5C0XE 4AIDA 4BA1A 2JEBA 4IFDF 5C0XB 5K36B 4IFDE 3H1CA 2PO1B 2PNZB 5C0XD 2WNRA 3B4TA 4IFDB 4OO1C 3L7ZA 1UDOA 3GCMA 3U1KA 4IFDD 2WP8A 1E3PA 3M85D 1UDQA 3CDIA 2BA0D 5C0XA 5K36A 3M85G 2PO1A 2PNZA 2C37A 2BA1D 1R6MA 4IFDA 5JEAE 3M7ND 2C37B 5K36C 2JEAB 4AM3A 1OYRA 1UDNA 1UDSA 4IFDC 2NN6F 3DD6A 5JEAD 2NN6E 4OO1F 2C39B 1OYSA 2C38B 2BR2B 4OO1E 3CDJA 2NN6B 2BA0G 4OO1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3H A;  2PO2 B;  2NN6 D;  5JEA F;  2JEA A;  4OO1 D;  2PO0 B;  5C0X C;  4BA2 B;  2BA1 G;  5JEA B;  3GLL A;  2C39 A;  3KRN A;  3M7N G;  2C38 A;  2BR2 A;  2NN6 A;  2JE6 B;  5K36 E;  1R6L A;  4OO1 A;  2PO2 A;  4BA1 B;  1OYP A;  2JEB B;  2PO0 A;  2NN6 C;  4BA2 A;  5K36 D;  5JEA A;  2WNR B;  4AIM A;  3L7Z B;  4NBQ A;  2JE6 A;  3GME A;  3HKM A;  5C0X F;  5K36 F;  2WP8 B;  5JEA C;  5C0X E;  4AID A;  4BA1 A;  2JEB A;  4IFD F;  5C0X B;  5K36 B;  4IFD E;  3H1C A;  2PO1 B;  2PNZ B;  5C0X D;  2WNR A;  3B4T A;  4IFD B;  4OO1 C;  3L7Z A;  1UDO A;  3GCM A;  3U1K A;  4IFD D;  2WP8 A;  1E3P A;  3M85 D;  1UDQ A;  3CDI A;  2BA0 D;  5C0X A;  5K36 A;  3M85 G;  2PO1 A;  2PNZ A;  2C37 A;  2BA1 D;  1R6M A;  4IFD A;  5JEA E;  3M7N D;  2C37 B;  5K36 C;  2JEA B;  4AM3 A;  1OYR A;  1UDN A;  1UDS A;  4IFD C;  2NN6 F;  3DD6 A;  5JEA D;  2NN6 E;  4OO1 F;  2C39 B;  1OYS A;  2C38 B;  2BR2 B;  4OO1 E;  3CDJ A;  2NN6 B;  2BA0 G;  4OO1 B; 
#chains in the Genus database with same CATH topology
 4LF5 E;  3PYF A;  2F4V I;  4IZJ A;  1MU5 A;  1IBK E;  4DR4 I;  2HK2 A;  4OO1 D;  4FW7 A;  1FWL A;  1YH8 A;  2UUB I;  5C0X C;  4FW4 A;  3F0N A;  2VES A;  1H74 A;  4FWG A;  3WU3 A;  3ZZT A;  3JAM Q;  1FNM A;  4LF8 I;  2C39 A;  5EKW A;  4DR6 I;  3M7N G;  3LPS A;  2V34 A;  2ZIT A;  4JI7 I;  4DV1 E;  4DR3 E;  4LOM A;  1R6L A;  4FW5 A;  4OX9 I;  2V2V A;  3JAM C;  3CWV A;  1Y4U A;  4DPU A;  2PO2 A;  3LNU A;  4DV7 I;  4AQY I;  4JI3 E;  1FKA E;  2Z5C A;  4DR1 I;  3V2U C;  1HNZ E;  4LFC I;  2ZM6 E;  1QZR A;  2UXC E;  1Z0E A;  2GO4 A;  2E1R A;  5LMN E;  1EA6 A;  2V2Q A;  3L7Z B;  1B62 A;  2F4V E;  4DR4 E;  5K36 F;  2UUB E;  1DAR A;  4AID A;  4JI6 E;  4LF8 E;  3V5R A;  5K36 B;  3H1C A;  4LPF A;  4JI7 E;  1USV A;  1ZXM A;  4X65 E;  2PNZ B;  1N33 I;  1RRE A;  3WU4 A;  2R3V A;  3T1H I;  4OX9 E;  4FW6 A;  1Z0B A;  4B3M I;  2UU9 I;  4LFA E;  1XNR E;  1Z0T A;  1E3P A;  1UDQ A;  4LFC E;  1ZXN A;  1U2R A;  1UEK A;  4B3S I;  4JI5 E;  3M85 G;  1NZ0 A;  1N0V C;  2WW4 A;  4DV5 I;  2BV3 A;  4B3T E;  4JI8 I;  4ISA A;  2VQE I;  2C37 B;  1K47 A;  2Z5B A;  4IZJ B;  5FWK A;  4DV6 I;  1UDS A;  3B82 A;  1D6T A;  1N33 E;  3P3C A;  3T1H E;  4LF6 I;  2C39 B;  4LF4 I;  4IS9 A;  2IES A;  4DV4 I;  3Q1Q A;  4MDT A;  4B3M E;  4HXZ A;  2UU9 E;  4OO1 E;  3GON A;  1IBK I;  1KIJ A;  4USM A;  4X62 E;  1HR0 I;  4LF7 I;  1Z0W A;  2PO2 B;  4QNK A;  1PVG A;  4J3D A;  4B3S E;  3QT5 A;  2Z5C B;  3Q6M A;  4HY1 A;  3OTO I;  4DU7 A;  4DUZ I;  4EMD A;  1I94 E;  5BR8 I;  4DR5 E;  3GLL A;  1B63 A;  4LFB I;  3KRN A;  3Q6N A;  4U3B A;  4DR7 I;  1VI7 A;  4I3H A;  4OO1 A;  5LMU I;  4DV6 E;  1Y6Z A;  3H4L A;  2ZM6 I;  5DNL A;  2UXC I;  3WU5 A;  3ZM7 A;  5LMN I;  1ELO A;  4LF6 E;  2PO0 A;  4LF4 E;  5K36 D;  4DV4 E;  1A6F A;  2AJ4 A;  1EI1 A;  1ZM4 A;  4RPF A;  5JEA A;  1Z0C A;  1HR0 E;  4USK A;  4JI6 I;  4LF7 E;  4DU8 A;  2JE6 A;  3U1Y A;  5A2Q Q;  3T1Y E;  5JEA C;  3OTO E;  4X65 I;  4WUD A;  4DUZ E;  4ED4 A;  1VIS A;  5L3J A;  4JG4 A;  5BR8 E;  4DV0 I;  2UUA I;  4LFB E;  5A2Q C;  3J80 C;  4LFA I;  5ELW A;  1XNR I;  2ZBK B;  2HKE A;  3HUL A;  4JI0 I;  2O1T A;  5C0X D;  4DR7 E;  2WNR A;  5LMU E;  2CZ9 A;  2J65 A;  4MQY A;  2HFU A;  1UDO A;  2Z5B B;  4JI5 I;  4HAC A;  4IFD D;  3M85 D;  4B3T I;  4DUY I;  4FW9 A;  3D4J A;  2CVE A;  1N36 I;  4QNJ A;  2PO1 A;  2O3Z A;  4GKJ E;  2BA1 D;  4Z7Y A;  2VF3 A;  3J81 Q;  4N3O A;  1N32 I;  1RHY A;  2Z5E A;  4URL A;  1HNX I;  1XHK A;  2BM1 A;  4DV0 E;  2UUA E;  1OYR A;  4IZK B;  4JI4 E;  2PNM A;  3J81 C;  3B8H A;  1P42 A;  5IWA I;  3DD6 A;  4X62 I;  4JI0 E;  3B78 A;  1Y4S A;  4OO1 F;  1XMQ I;  1Z5A A;  3K1J A;  5LL6 R;  4OO1 B;  1ZM2 A;  1E3H A;  4DUY E;  1I94 I;  2NN6 D;  4MYU A;  5JEA F;  4DR5 I;  2Q2E B;  2JEA A;  4FWD A;  1PKP A;  3ZKD A;  2PO0 B;  1N36 E;  1PIE A;  4GQU A;  4DV2 E;  2PNL A;  3P3E A;  2BA1 G;  5JEA B;  5EL9 A;  4Z7C A;  1N32 E;  2C38 A;  2BR2 A;  2AE8 A;  1HNX E;  2R42 A;  2JE6 B;  5K36 E;  4KQV A;  4MU0 A;  1WUU A;  2A2C A;  4KHP I;  3ZKB A;  5IWA E;  1XMQ E;  5DRR A;  1USU A;  4BA2 A;  1BKN A;  5GMD A;  4K0K E;  2CGE A;  3T1Y I;  3P3G A;  1FWK A;  1H7U A;  4DV3 I;  4PU9 A;  2UXB E;  2WNR B;  2LJP A;  4LCH A;  4B3R I;  4LCF A;  1XXE A;  4AIM A;  2F1D A;  4NBQ A;  3GME A;  3HKM A;  4HAC B;  4WUB A;  3PS2 A;  1HK7 A;  1MX0 A;  5C0X E;  4P7A A;  1RR9 A;  4OZE A;  4NXN I;  4X66 I;  4BA1 A;  1H7S A;  2JEB A;  3J7A G;  2EFG A;  1IBL E;  1Z5C A;  5FLX C;  4IFD E;  2PO1 B;  1ZM3 A;  2V2Z A;  4KHP E;  4MYT A;  4OO1 C;  3ZZ0 A;  3U1K A;  2WP8 A;  4R1F A;  3HJC A;  3CDI A;  4GKJ I;  2BA0 D;  3J80 Q;  1FJG E;  4DV3 E;  1S4E A;  3QT6 A;  4DPX A;  1KKH A;  4DPW A;  5C0X A;  4B3R E;  2HHH I;  2GS8 A;  3PRY A;  1NHI A;  2C37 A;  1R6M A;  5GME A;  4JI4 I;  4IFD A;  4DR2 I;  4X66 E;  4NXN E;  4JI2 I;  2JEA B;  4JYA I;  4JV5 I;  2OI2 A;  4FW3 A;  1XNQ I;  1UDN A;  1Z59 A;  1Y60 A;  4IFD C;  4OKG A;  2O1W A;  2CG9 A;  4IZJ D;  5JEA D;  4UT4 A;  4WUC A;  2NN6 E;  1OYS A;  3M6A A;  2C38 B;  2BR2 B;  1N34 I;  4LF9 E;  4HYM A;  2GO3 A;  3CDJ A;  1XMO I;  2X7I A;  1Z0V A;  2XEX A;  1HNW E;  4DXL A;  4XTJ A;  2VQF I;  2NPF A;  4DV2 I;  2BA0 G;  2DEI A;  5IT9 Q;  2A2D A;  3PYE A;  4YHH E;  1MG7 A;  1KVK A;  2J7K A;  1FI4 A;  3K17 A;  4BA2 B;  2HHH E;  1H73 A;  2IOP A;  5DRO A;  5IT9 C;  1NHJ A;  4DR2 E;  1NHH A;  4JI2 E;  2NN6 A;  1IBM I;  4JYA E;  4JV5 E;  4M1K A;  1XNQ E;  3NZK A;  1J5E I;  3PYG A;  2UUC I;  4DR6 E;  4K0K I;  2UXB I;  1S16 A;  2DEJ A;  4BA1 B;  1OYP A;  2JEB B;  4GKK I;  3PS3 A;  2NN6 C;  2X36 A;  1N34 E;  4JI1 I;  1XMO E;  4MU1 A;  3WU6 A;  2VQF E;  4DV7 E;  1Z0G A;  4AQY E;  3P76 A;  2HK3 A;  4DR1 E;  1IBL I;  5C0X F;  1OJ4 A;  2WP8 B;  2O1U A;  3PS1 A;  1N0U A;  4MU3 A;  3J7A M;  1Y5Y A;  2IER A;  4IFD F;  2UXD I;  3K85 A;  4LCG A;  5C0X B;  5DRQ A;  1IBM E;  3QT7 A;  2GQ0 A;  4NXM I;  3B4T A;  4IFD B;  4YY3 I;  1FJG I;  1J5E E;  2UUC E;  3L7Z A;  2BM0 A;  3ZZU A;  3GCM A;  4GKK E;  2E5L I;  1ZM9 A;  2V8P A;  4X64 I;  4JI1 E;  5FLX Q;  2HFS A;  1YHC A;  4FN5 A;  4ZVI A;  4LF5 I;  4DPY A;  5K36 A;  4DPT A;  2PNZ A;  3P06 A;  2JT2 A;  4FWH A;  3PYD A;  1H72 C;  5JEA E;  4IZK A;  3M7N D;  5K36 C;  4DV1 I;  4DR3 I;  3LTO A;  4P52 A;  4DV5 E;  2UXD E;  4AM3 A;  4JI8 E;  4LF9 I;  4U3D A;  1KTV A;  1HNW I;  2NN6 F;  4PRV A;  3QT8 A;  1Z5B A;  5DRP A;  5DNX A;  2VQE E;  2O1V A;  2HKJ A;  4NXM E;  4JI3 I;  4YY3 E;  1HNZ I;  4UTG A;  2NN6 B;  4YHH I;  2IOQ A;  4PRX A;  2E5L E;  3UHM A;  4MU4 A;  4X64 E; 
#chains in the Genus database with same CATH homology
 1E3H A;  2PO2 B;  2NN6 D;  5JEA F;  2JEA A;  4OO1 D;  2PO0 B;  5C0X C;  4BA2 B;  2BA1 G;  5JEA B;  3GLL A;  2C39 A;  3KRN A;  3M7N G;  2C38 A;  2BR2 A;  2NN6 A;  2JE6 B;  5K36 E;  1R6L A;  4OO1 A;  2PO2 A;  4BA1 B;  1OYP A;  2JEB B;  2PO0 A;  2NN6 C;  4BA2 A;  5K36 D;  5JEA A;  2WNR B;  4AIM A;  3L7Z B;  4NBQ A;  2JE6 A;  3GME A;  3HKM A;  5C0X F;  5K36 F;  2WP8 B;  5JEA C;  5C0X E;  4AID A;  4BA1 A;  2JEB A;  4IFD F;  5C0X B;  5K36 B;  4IFD E;  3H1C A;  2PO1 B;  2PNZ B;  5C0X D;  2WNR A;  3B4T A;  4IFD B;  4OO1 C;  3L7Z A;  1UDO A;  3GCM A;  3U1K A;  4IFD D;  2WP8 A;  1E3P A;  3M85 D;  1UDQ A;  3CDI A;  2BA0 D;  5C0X A;  5K36 A;  3M85 G;  2PO1 A;  2PNZ A;  2C37 A;  2BA1 D;  1R6M A;  4IFD A;  5JEA E;  3M7N D;  2C37 B;  5K36 C;  2JEA B;  4AM3 A;  1OYR A;  1UDN A;  1UDS A;  4IFD C;  2NN6 F;  3DD6 A;  5JEA D;  2NN6 E;  4OO1 F;  2C39 B;  1OYS A;  2C38 B;  2BR2 B;  4OO1 E;  3CDJ A;  2NN6 B;  2BA0 G;  4OO1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...