3L7ZA

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
271
structure length
251
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
molecule keywords Probable exosome complex exonuclease 2
total genus 73
structure length 251
sequence length 271
chains with identical sequence D, G
ec nomenclature ec 3.1.13.-:
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3l7zA01
1UDQA 2PNZB 2NN6A 2BA1G 2BA0D 2JEBB 4NBQA 1R6LA 5C0XF 1E3PA 4BA2B 2JEBA 3M7ND 2NN6B 5K36A 1OYSA 2NN6C 3CDIA 4IFDA 5K36F 5C0XE 2NN6E 5K36D 2WP8A 3HKMA 4IFDD 4OO1A 2PNZA 3KRNA 2PO0B 4AIDA 3CDJA 3M7NG 2C38A 4BA1B 2PO1A 2C39A 5C0XB 4OO1E 2BR2B 5JEAB 1UDNA 3H1CA 2C39B 5JEAD 3DD6A 4BA1A 2PO2A 4IFDE 2WP8B 3GLLA 2PO0A 5C0XD 1UDSA 2NN6D 3B4TA 3GCMA 4IFDB 1E3HA 5K36B 4IFDC 1UDOA 5JEAC 4BA2A 4AM3A 2NN6F 4AIMA 2PO2B 3M85D 4OO1C 5K36E 2C37A 1R6MA 1OYPA 2WNRA 2JEAB 2PO1B 2JE6B 2C38B 4IFDF 3L7ZB 5C0XC 5K36C 4OO1B 5JEAE 3M85G 3L7ZA 5JEAA 4OO1F 2JE6A 2BR2A 3GMEA 2JEAA 2C37B 2WNRB 4OO1D 3U1KA 5C0XA 2BA0G 2BA1D 1OYRA 5JEAF
chains in the Genus database with same CATH superfamily
1UDQA 1Z0WA 2PNZB 1H7SA 2NN6A 4MU3A 4DUZI 4JI4E 4NBQA 1R6LA 3P06A 2GO4A 4U3DA 4DUZE 1J5EE 2O1VA 1FWKA 2F4VE 5K36A 2VESA 4USKA 1IBLE 4USMA 4OX9E 2NN6C 4MDTA 2GO3A 3CDIA 3LTOA 4GKKI 5EKWA 2UUCI 3QT8A 2CG9A 4DR4I 1ZM4A 2WP8A 3HKMA 4DR6E 4DR2E 3QT7A 2PO0B 1B62A 2O1UA 3P3CA 2C38A 4BA1B 1KKHA 1FNMA 2C39A 4DU7A 4LF4I 4DV5E 2UXCI 4LF4E 1KIJA 2BR2B 4JYAE 5FWKA 4NXME 4LFBI 3K1JA 4JYAI 4FW9A 1Y5YA 3H1CA 2GS8A 1Z5BA 3V5RA 4DXLA 4IFDE 3GLLA 4FW6A 2JT2A 2PO0A 3P76A 1H72C 4DU8A 2IOQA 2R42A 3HULA 4X64I 1N34E 4DV3E 3M6AA 4JI5E 4LF8I 1I94I 3B4TA 3PS1A 4IFDB 1E3HA 1XNRE 3PS3A 1EI1A 4QNKA 1NHHA 4PRVA 4Z7YA 3OTOI 4JI2E 3OTOE 4AIMA 3M85D 1HNZI 3CWVA 1VISA 1Y4SA 4JI3E 1FWLA 4JI5I 1I94E 4LPFA 4URLA 1OYPA 3PYDA 2JEAB 2OI2A 1N36I 3ZKBA 5IWAI 5C0XC 5LMUI 4DV4I 4OO1B 2O1WA 5JEAE 3J80Q 1PVGA 4K0KI 1HNWI 4OO1F 2JE6A 3T1YI 1HR0E 2BR2A 2ZBKB 5A2QC 1HR0I 1Z0VA 2O3ZA 3U1KA 4KHPE 2BV3A 3WU3A 1FI4A 2BA0G 4EMDA 1OYRA 2UU9E 3J81Q 4JI4I 5JEAF 2CZ9A 1N0VC 4YHHI 3B8HA 1ZM2A 1HK7A 1PKPA 1OJ4A 2BA1G 1QZRA 4DR2I 2JEBB 1E3PA 3P3EA 4DV4E 2JEBA 3M7ND 5DRPA 2HKJA 2Z5BA 4DPYA 4K0KE 2Z5CB 1OYSA 2IOPA 1NZ0A 1H7UA 4FWHA 1H73A 4DR1E 5LMNE 3PYFA 4LF9E 3Q6NA 1ZXNA 4DPXA 4GKKE 4LF5I 4LFCI 2HKEA 4DR3E 4ZVIA 2UXDE 4OO1A 1XNQE 2PNZA 4XTJA 4AIDA 3CDJA 3M7NG 2EFGA 5DROA 1BKNA 2J7KA 4JI8I 4OO1E 2PNLA 5JEAB 1UDNA 4MYUA 2V2QA 2C39B 2LJPA 5JEAD 2UUCE 2ZM6E 4OKGA 1XMOI 2X36A 4JI1I 4ISAA 4P7AA 2A2DA 3NZKA 4I3HA 4JG4A 3UHMA 4UT4A 3WU6A 1XXEA 4DV1I 1Y6ZA 4AQYI 1KTVA 4UTGA 3J7AG 1WUUA 5BR8E 5K36B 1N33I 4AQYE 3T1HI 1XHKA 3WU5A 4JI2I 2Z5CA 3ZZTA 1Z0EA 1MU5A 2V2VA 4Z7CA 4AM3A 4X66I 4DPWA 4DUYI 5K36E 4OO1C 4FN5A 4HACA 1DARA 2UUBE 4JI7E 1R6MA 4B3ME 4LF7E 4ED4A 2VQFI 1RREA 4GKJE 4X62E 4DR7E 4IFDF 1IBKE 3J7AM 1J5EI 4JI6I 3F0NA 2F4VI 1Z5AA 3T1YE 5IT9Q 1MG7A 1NHJA 4IZJB 4KHPI 4OO1D 1HNWE 1USUA 1FJGI 4B3RI 4HACB 4DV7I 1ZXMA 4P52A 4RPFA 2BA1D 2IESA 1P42A 3ZZ0A 4DR5E 4DR6I 4DV6I 2BA0D 1Z0TA 5IWAE 5FLXC 5DRRA 5C0XF 1MX0A 3HJCA 2NN6B 3B82A 1N32E 4FW3A 4NXNE 2HHHE 1FJGE 4IFDA 1K47A 4DR3I 4J3DA 5K36F 2GQ0A 4X65E 2NN6E 5C0XE 4B3TE 2UXBI 2UU9I 4LCGA 1XNQI 4X65I 4B3TI 4IFDD 2UXBE 1ZM9A 5L3JA 4FWGA 3KRNA 3U1YA 3LPSA 1Z0CA 2PO1A 3K85A 5C0XB 2HFUA 1FKAE 4DR1I 4QNJA 2J65A 4HY1A 3DD6A 4HYMA 2PO2A 4WUDA 2UUAE 2WP8B 5DNXA 4WUCA 5C0XD 1UDSA 2AE8A 2NN6D 4IZKB 1Z59A 4GQUA 2CVEA 4MU1A 1XNRI 1N33E 4DV5I 3GCMA 4MU4A 4PRXA 5GMDA 4FWDA 2Z5BB 4LF7I 4DV1E 4YY3I 2V8PA 3K17A 4GKJI 1N36E 2E1RA 4IFDC 1A6FA 1USVA 1UDOA 2PNMA 2ZM6I 3GONA 4BA2A 3J80C 1IBMI 1Y4UA 1N34I 4IZJD 1UEKA 4DV0I 1HNZE 4PU9A 4LOMA 1XMQI 2IERA 2E5LI 2DEIA 2VQEI 3PS2A 5BR8I 2VQEE 1IBKI 3T1HE 2PO1B 2A2CA 2C38B 4JI6E 2HK3A 4DPUA 3J81C 5K36C 1YH8A 4FW5A 1EA6A 1IBME 3L7ZA 1HNXI 2DEJA 4DV0E 5LMNI 3LNUA 4JV5E 4MQYA 3Q6MA 4MU0A 4JV5I 1ELOA 4JI7I 3QT6A 4DV2I 2V34A 4DR5I 1PIEA 4BA2B 4M1KA 1IBLI 3PRYA 4LF6I 1RHYA 2UXCE 4LF6E 2AJ4A 4HXZA 4R1FA 4NXNI 4LFBE 2Q2EB 5GMEA 2HHHI 2V2ZA 4LFCE 4KQVA 1U2RA 4LF9I 3JAMQ 1H74A 5K36D 5DNLA 1XMOE 4WUBA 4DR4E 3JAMC 3V2UC 4IS9A 1S16A 4DV6E 4X64E 3ZKDA 4DV3I 1D6TA 4U3BA 4FW4A 1S4EA 4YY3E 4IZJA 4JI8E 4NXMI 5EL9A 3P3GA 2ZITA 4BA1A 4LF5E 2VF3A 2UXDI 1Y60A 2UUAI 4LFAE 2HFSA 1Z0BA 3ZZUA 4JI1E 4OZEA 4LCHA 2UUBI 4DPTA 3B78A 4LF8E 4B3MI 3WU4A 1Z0GA 2VQFE 3D4JA 3QT5A 4IZKA 1VI7A 2Z5EA 5JEAC 5IT9C 1NHIA 3Q1QA 2NN6F 4JI3I 1B63A 1KVKA 2CGEA 2PO2B 4LFAI 2BM0A 4X66E 4JI0E 4MYTA 4N3OA 2C37A 2WW4A 2E5LE 4JI0I 2F1DA 1XMQE 3ZM7A 2XEXA 4B3SI 4DV2E 4X62I 4DR7I 2WNRA 1YHCA 1Z5CA 2JE6B 3L7ZB 5A2QQ 2X7IA 3PYGA 2BM1A 2O1TA 5DRQA 5LL6R 5LMUE 3PYEA 3M85G 1N32I 4DUYE 1RR9A 5JEAA 1N0UA 4B3RE 3GMEA 4OX9I 2JEAA 2C37B 2WNRB 2NPFA 2HK2A 5C0XA 5FLXQ 1HNXE 2R3VA 4FW7A 1ZM3A 4YHHE 4DV7E 5ELWA 4B3SE 3H4LA 4LCFA
chains in the Genus database with same CATH topology
1UDQA 2PNZB 2NN6A 2BA1G 2BA0D 2JEBB 4NBQA 1R6LA 5C0XF 1E3PA 4BA2B 2JEBA 3M7ND 2NN6B 5K36A 1OYSA 2NN6C 3CDIA 4IFDA 5K36F 5C0XE 2NN6E 5K36D 2WP8A 3HKMA 4IFDD 4OO1A 2PNZA 3KRNA 2PO0B 4AIDA 3CDJA 3M7NG 2C38A 4BA1B 2PO1A 2C39A 5C0XB 4OO1E 2BR2B 5JEAB 1UDNA 3H1CA 2C39B 5JEAD 3DD6A 4BA1A 2PO2A 4IFDE 2WP8B 3GLLA 2PO0A 5C0XD 1UDSA 2NN6D 3B4TA 3GCMA 4IFDB 1E3HA 5K36B 4IFDC 1UDOA 5JEAC 4BA2A 4AM3A 2NN6F 4AIMA 2PO2B 3M85D 4OO1C 5K36E 2C37A 1R6MA 1OYPA 2WNRA 2JEAB 2PO1B 2JE6B 2C38B 4IFDF 3L7ZB 5C0XC 5K36C 4OO1B 5JEAE 3M85G 3L7ZA 5JEAA 4OO1F 2JE6A 2BR2A 3GMEA 2JEAA 2C37B 2WNRB 4OO1D 3U1KA 5C0XA 2BA0G 2BA1D 1OYRA 5JEAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDQ A;  2PNZ B;  2NN6 A;  2BA1 G;  2BA0 D;  2JEB B;  4NBQ A;  1R6L A;  5C0X F;  1E3P A;  4BA2 B;  2JEB A;  3M7N D;  2NN6 B;  5K36 A;  1OYS A;  2NN6 C;  3CDI A;  4IFD A;  5K36 F;  5C0X E;  2NN6 E;  5K36 D;  2WP8 A;  3HKM A;  4IFD D;  4OO1 A;  2PNZ A;  3KRN A;  2PO0 B;  4AID A;  3CDJ A;  3M7N G;  2C38 A;  4BA1 B;  2PO1 A;  2C39 A;  5C0X B;  4OO1 E;  2BR2 B;  5JEA B;  1UDN A;  3H1C A;  2C39 B;  5JEA D;  3DD6 A;  4BA1 A;  2PO2 A;  4IFD E;  2WP8 B;  3GLL A;  2PO0 A;  5C0X D;  1UDS A;  2NN6 D;  3B4T A;  3GCM A;  4IFD B;  1E3H A;  5K36 B;  4IFD C;  1UDO A;  5JEA C;  4BA2 A;  4AM3 A;  2NN6 F;  4AIM A;  2PO2 B;  3M85 D;  4OO1 C;  5K36 E;  2C37 A;  1R6M A;  1OYP A;  2WNR A;  2JEA B;  2PO1 B;  2JE6 B;  2C38 B;  4IFD F;  3L7Z B;  5C0X C;  5K36 C;  4OO1 B;  5JEA E;  3M85 G;  3L7Z A;  5JEA A;  4OO1 F;  2JE6 A;  2BR2 A;  3GME A;  2JEA A;  2C37 B;  2WNR B;  4OO1 D;  3U1K A;  5C0X A;  2BA0 G;  2BA1 D;  1OYR A;  5JEA F; 
#chains in the Genus database with same CATH topology
 1UDQ A;  1Z0W A;  2PNZ B;  1H7S A;  2NN6 A;  4MU3 A;  4DUZ I;  4JI4 E;  4NBQ A;  1R6L A;  3P06 A;  2GO4 A;  4U3D A;  4DUZ E;  1J5E E;  2O1V A;  1FWK A;  2F4V E;  5K36 A;  2VES A;  4USK A;  1IBL E;  4USM A;  4OX9 E;  2NN6 C;  4MDT A;  2GO3 A;  3CDI A;  3LTO A;  4GKK I;  5EKW A;  2UUC I;  3QT8 A;  2CG9 A;  4DR4 I;  1ZM4 A;  2WP8 A;  3HKM A;  4DR6 E;  4DR2 E;  3QT7 A;  2PO0 B;  1B62 A;  2O1U A;  3P3C A;  2C38 A;  4BA1 B;  1KKH A;  1FNM A;  2C39 A;  4DU7 A;  4LF4 I;  4DV5 E;  2UXC I;  4LF4 E;  1KIJ A;  2BR2 B;  4JYA E;  5FWK A;  4NXM E;  4LFB I;  3K1J A;  4JYA I;  4FW9 A;  1Y5Y A;  3H1C A;  2GS8 A;  1Z5B A;  3V5R A;  4DXL A;  4IFD E;  3GLL A;  4FW6 A;  2JT2 A;  2PO0 A;  3P76 A;  1H72 C;  4DU8 A;  2IOQ A;  2R42 A;  3HUL A;  4X64 I;  1N34 E;  4DV3 E;  3M6A A;  4JI5 E;  4LF8 I;  1I94 I;  3B4T A;  3PS1 A;  4IFD B;  1E3H A;  1XNR E;  3PS3 A;  1EI1 A;  4QNK A;  1NHH A;  4PRV A;  4Z7Y A;  3OTO I;  4JI2 E;  3OTO E;  4AIM A;  3M85 D;  1HNZ I;  3CWV A;  1VIS A;  1Y4S A;  4JI3 E;  1FWL A;  4JI5 I;  1I94 E;  4LPF A;  4URL A;  1OYP A;  3PYD A;  2JEA B;  2OI2 A;  1N36 I;  3ZKB A;  5IWA I;  5C0X C;  5LMU I;  4DV4 I;  4OO1 B;  2O1W A;  5JEA E;  3J80 Q;  1PVG A;  4K0K I;  1HNW I;  4OO1 F;  2JE6 A;  3T1Y I;  1HR0 E;  2BR2 A;  2ZBK B;  5A2Q C;  1HR0 I;  1Z0V A;  2O3Z A;  3U1K A;  4KHP E;  2BV3 A;  3WU3 A;  1FI4 A;  2BA0 G;  4EMD A;  1OYR A;  2UU9 E;  3J81 Q;  4JI4 I;  5JEA F;  2CZ9 A;  1N0V C;  4YHH I;  3B8H A;  1ZM2 A;  1HK7 A;  1PKP A;  1OJ4 A;  2BA1 G;  1QZR A;  4DR2 I;  2JEB B;  1E3P A;  3P3E A;  4DV4 E;  2JEB A;  3M7N D;  5DRP A;  2HKJ A;  2Z5B A;  4DPY A;  4K0K E;  2Z5C B;  1OYS A;  2IOP A;  1NZ0 A;  1H7U A;  4FWH A;  1H73 A;  4DR1 E;  5LMN E;  3PYF A;  4LF9 E;  3Q6N A;  1ZXN A;  4DPX A;  4GKK E;  4LF5 I;  4LFC I;  2HKE A;  4DR3 E;  4ZVI A;  2UXD E;  4OO1 A;  1XNQ E;  2PNZ A;  4XTJ A;  4AID A;  3CDJ A;  3M7N G;  2EFG A;  5DRO A;  1BKN A;  2J7K A;  4JI8 I;  4OO1 E;  2PNL A;  5JEA B;  1UDN A;  4MYU A;  2V2Q A;  2C39 B;  2LJP A;  5JEA D;  2UUC E;  2ZM6 E;  4OKG A;  1XMO I;  2X36 A;  4JI1 I;  4ISA A;  4P7A A;  2A2D A;  3NZK A;  4I3H A;  4JG4 A;  3UHM A;  4UT4 A;  3WU6 A;  1XXE A;  4DV1 I;  1Y6Z A;  4AQY I;  1KTV A;  4UTG A;  3J7A G;  1WUU A;  5BR8 E;  5K36 B;  1N33 I;  4AQY E;  3T1H I;  1XHK A;  3WU5 A;  4JI2 I;  2Z5C A;  3ZZT A;  1Z0E A;  1MU5 A;  2V2V A;  4Z7C A;  4AM3 A;  4X66 I;  4DPW A;  4DUY I;  5K36 E;  4OO1 C;  4FN5 A;  4HAC A;  1DAR A;  2UUB E;  4JI7 E;  1R6M A;  4B3M E;  4LF7 E;  4ED4 A;  2VQF I;  1RRE A;  4GKJ E;  4X62 E;  4DR7 E;  4IFD F;  1IBK E;  3J7A M;  1J5E I;  4JI6 I;  3F0N A;  2F4V I;  1Z5A A;  3T1Y E;  5IT9 Q;  1MG7 A;  1NHJ A;  4IZJ B;  4KHP I;  4OO1 D;  1HNW E;  1USU A;  1FJG I;  4B3R I;  4HAC B;  4DV7 I;  1ZXM A;  4P52 A;  4RPF A;  2BA1 D;  2IES A;  1P42 A;  3ZZ0 A;  4DR5 E;  4DR6 I;  4DV6 I;  2BA0 D;  1Z0T A;  5IWA E;  5FLX C;  5DRR A;  5C0X F;  1MX0 A;  3HJC A;  2NN6 B;  3B82 A;  1N32 E;  4FW3 A;  4NXN E;  2HHH E;  1FJG E;  4IFD A;  1K47 A;  4DR3 I;  4J3D A;  5K36 F;  2GQ0 A;  4X65 E;  2NN6 E;  5C0X E;  4B3T E;  2UXB I;  2UU9 I;  4LCG A;  1XNQ I;  4X65 I;  4B3T I;  4IFD D;  2UXB E;  1ZM9 A;  5L3J A;  4FWG A;  3KRN A;  3U1Y A;  3LPS A;  1Z0C A;  2PO1 A;  3K85 A;  5C0X B;  2HFU A;  1FKA E;  4DR1 I;  4QNJ A;  2J65 A;  4HY1 A;  3DD6 A;  4HYM A;  2PO2 A;  4WUD A;  2UUA E;  2WP8 B;  5DNX A;  4WUC A;  5C0X D;  1UDS A;  2AE8 A;  2NN6 D;  4IZK B;  1Z59 A;  4GQU A;  2CVE A;  4MU1 A;  1XNR I;  1N33 E;  4DV5 I;  3GCM A;  4MU4 A;  4PRX A;  5GMD A;  4FWD A;  2Z5B B;  4LF7 I;  4DV1 E;  4YY3 I;  2V8P A;  3K17 A;  4GKJ I;  1N36 E;  2E1R A;  4IFD C;  1A6F A;  1USV A;  1UDO A;  2PNM A;  2ZM6 I;  3GON A;  4BA2 A;  3J80 C;  1IBM I;  1Y4U A;  1N34 I;  4IZJ D;  1UEK A;  4DV0 I;  1HNZ E;  4PU9 A;  4LOM A;  1XMQ I;  2IER A;  2E5L I;  2DEI A;  2VQE I;  3PS2 A;  5BR8 I;  2VQE E;  1IBK I;  3T1H E;  2PO1 B;  2A2C A;  2C38 B;  4JI6 E;  2HK3 A;  4DPU A;  3J81 C;  5K36 C;  1YH8 A;  4FW5 A;  1EA6 A;  1IBM E;  3L7Z A;  1HNX I;  2DEJ A;  4DV0 E;  5LMN I;  3LNU A;  4JV5 E;  4MQY A;  3Q6M A;  4MU0 A;  4JV5 I;  1ELO A;  4JI7 I;  3QT6 A;  4DV2 I;  2V34 A;  4DR5 I;  1PIE A;  4BA2 B;  4M1K A;  1IBL I;  3PRY A;  4LF6 I;  1RHY A;  2UXC E;  4LF6 E;  2AJ4 A;  4HXZ A;  4R1F A;  4NXN I;  4LFB E;  2Q2E B;  5GME A;  2HHH I;  2V2Z A;  4LFC E;  4KQV A;  1U2R A;  4LF9 I;  3JAM Q;  1H74 A;  5K36 D;  5DNL A;  1XMO E;  4WUB A;  4DR4 E;  3JAM C;  3V2U C;  4IS9 A;  1S16 A;  4DV6 E;  4X64 E;  3ZKD A;  4DV3 I;  1D6T A;  4U3B A;  4FW4 A;  1S4E A;  4YY3 E;  4IZJ A;  4JI8 E;  4NXM I;  5EL9 A;  3P3G A;  2ZIT A;  4BA1 A;  4LF5 E;  2VF3 A;  2UXD I;  1Y60 A;  2UUA I;  4LFA E;  2HFS A;  1Z0B A;  3ZZU A;  4JI1 E;  4OZE A;  4LCH A;  2UUB I;  4DPT A;  3B78 A;  4LF8 E;  4B3M I;  3WU4 A;  1Z0G A;  2VQF E;  3D4J A;  3QT5 A;  4IZK A;  1VI7 A;  2Z5E A;  5JEA C;  5IT9 C;  1NHI A;  3Q1Q A;  2NN6 F;  4JI3 I;  1B63 A;  1KVK A;  2CGE A;  2PO2 B;  4LFA I;  2BM0 A;  4X66 E;  4JI0 E;  4MYT A;  4N3O A;  2C37 A;  2WW4 A;  2E5L E;  4JI0 I;  2F1D A;  1XMQ E;  3ZM7 A;  2XEX A;  4B3S I;  4DV2 E;  4X62 I;  4DR7 I;  2WNR A;  1YHC A;  1Z5C A;  2JE6 B;  3L7Z B;  5A2Q Q;  2X7I A;  3PYG A;  2BM1 A;  2O1T A;  5DRQ A;  5LL6 R;  5LMU E;  3PYE A;  3M85 G;  1N32 I;  4DUY E;  1RR9 A;  5JEA A;  1N0U A;  4B3R E;  3GME A;  4OX9 I;  2JEA A;  2C37 B;  2WNR B;  2NPF A;  2HK2 A;  5C0X A;  5FLX Q;  1HNX E;  2R3V A;  4FW7 A;  1ZM3 A;  4YHH E;  4DV7 E;  5ELW A;  4B3S E;  3H4L A;  4LCF A; 
#chains in the Genus database with same CATH homology
 1UDQ A;  2PNZ B;  2NN6 A;  2BA1 G;  2BA0 D;  2JEB B;  4NBQ A;  1R6L A;  5C0X F;  1E3P A;  4BA2 B;  2JEB A;  3M7N D;  2NN6 B;  5K36 A;  1OYS A;  2NN6 C;  3CDI A;  4IFD A;  5K36 F;  5C0X E;  2NN6 E;  5K36 D;  2WP8 A;  3HKM A;  4IFD D;  4OO1 A;  2PNZ A;  3KRN A;  2PO0 B;  4AID A;  3CDJ A;  3M7N G;  2C38 A;  4BA1 B;  2PO1 A;  2C39 A;  5C0X B;  4OO1 E;  2BR2 B;  5JEA B;  1UDN A;  3H1C A;  2C39 B;  5JEA D;  3DD6 A;  4BA1 A;  2PO2 A;  4IFD E;  2WP8 B;  3GLL A;  2PO0 A;  5C0X D;  1UDS A;  2NN6 D;  3B4T A;  3GCM A;  4IFD B;  1E3H A;  5K36 B;  4IFD C;  1UDO A;  5JEA C;  4BA2 A;  4AM3 A;  2NN6 F;  4AIM A;  2PO2 B;  3M85 D;  4OO1 C;  5K36 E;  2C37 A;  1R6M A;  1OYP A;  2WNR A;  2JEA B;  2PO1 B;  2JE6 B;  2C38 B;  4IFD F;  3L7Z B;  5C0X C;  5K36 C;  4OO1 B;  5JEA E;  3M85 G;  3L7Z A;  5JEA A;  4OO1 F;  2JE6 A;  2BR2 A;  3GME A;  2JEA A;  2C37 B;  2WNR B;  4OO1 D;  3U1K A;  5C0X A;  2BA0 G;  2BA1 D;  1OYR A;  5JEA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...