3L7ZA

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
271
structure length
251
Chain Sequence
b'MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 2
molecule tags Hydrolase/rna binding protein
source organism Sulfolobus solfataricus
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
total genus 73
structure length 251
sequence length 271
chains with identical sequence D, G
ec nomenclature ec 3.1.13.-:
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3l7zA01
1UDSA 4OO1A 2JEAA 1R6LA 3M7NG 4OO1F 2JE6B 2PO0B 5C0XB 2BR2A 5K36E 5C0XF 5C0XA 2PO0A 1UDNA 3HKMA 1E3PA 3H1CA 5C0XC 4BA1A 5K36C 2NN6A 4AIDA 4NBQA 4BA1B 5JEAD 4IFDB 2C38B 1UDOA 1OYPA 3CDIA 3KRNA 5K36A 2C39B 4IFDF 4IFDD 3GMEA 3M85D 5K36B 1E3HA 2BA0D 2PNZB 5C0XE 2C38A 2BA0G 3M85G 1OYSA 3U1KA 2BR2B 2WNRA 2JE6A 3DD6A 2JEAB 5C0XD 1OYRA 5JEAC 4IFDC 3GCMA 5JEAA 2NN6D 1UDQA 5JEAF 3M7ND 5JEAE 4BA2A 2NN6B 4OO1E 3B4TA 4AM3A 4OO1D 2PO1A 2NN6C 4IFDE 2WNRB 2JEBA 3CDJA 4OO1B 2BA1G 2NN6E 2C37A 2PO2B 2PNZA 5JEAB 4OO1C 3L7ZA 2JEBB 2PO1B 3GLLA 3L7ZB 2BA1D 2C39A 4AIMA 4IFDA 2C37B 2NN6F 2PO2A 5K36F 5K36D 1R6MA 2WP8B 4BA2B 2WP8A
chains in the Genus database with same CATH superfamily
4DR6E 5LMUE 1BKNA 1USUA 4JV5I 1PVGA 2CVEA 1B63A 4HACA 4OO1A 4DV1I 2UXBI 1R6LA 4JYAI 4FWDA 2JE6B 2PO0B 4JI5E 4DV7I 4LOMA 4DU7A 1H74A 5DRQA 5C0XF 5C0XA 4LF6I 5L3JA 2V8PA 4JYAE 2AJ4A 4MYUA 4LFCI 1Z5CA 3QT5A 1KKHA 4IFDB 1EA6A 4FW9A 4JI1I 1Y6ZA 3K1JA 4DR7E 3D4JA 1PKPA 4JI1E 3GMEA 3P3GA 4LF9E 1E3HA 1Z0CA 4USMA 2UXCE 2PNZB 4DPWA 2UUBI 1XMQI 4JI4E 4LF9I 3ZKDA 3T1HI 1VI7A 2ZM6I 2WW4A 4DUZE 4DV4E 1XMOI 4JI6I 1MX0A 1MG7A 4JI3E 4YY3E 1IBKE 2UXDI 1OYRA 1XMOE 4JI6E 4MU4A 5JEAC 1Z0VA 1N33I 1H7SA 2V2ZA 1D6TA 2GS8A 2NN6D 2VQFI 1KVKA 4MQYA 4DR2E 2VQFE 1N0VC 2Z5CB 3B4TA 1FWKA 3PYGA 1HNXE 3PYDA 1FJGE 2NN6C 2VF3A 2WNRB 4HYMA 2CG9A 1HNXI 2HFUA 2ZITA 3CDJA 1ZXNA 2IOQA 2VQEI 2BA1G 2NPFA 4MYTA 1H73A 4X64E 1ZM9A 4X66E 4DR4I 3NZKA 4P52A 4DPXA 4GKJE 1FWLA 4DR1E 4LF7I 2J7KA 4WUCA 3T1YE 4MDTA 5FLXC 4DR7I 4LFBE 2O1UA 4LF7E 5EL9A 4IZKA 5IWAE 4IZKB 2HHHI 4NXME 5FWKA 1HNWI 5LMNI 3WU5A 4URLA 5BR8I 1XXEA 2HHHE 2V2QA 2JEAA 4OO1F 2BR2A 4DV2I 1J5EI 1Z0WA 2R42A 4B3TE 2IERA 4JV5E 5JEAD 4BA1B 1Z0GA 3LPSA 2C38B 2X7IA 4UT4A 3UHMA 4DPTA 2C39B 4U3DA 1HR0I 4DR3I 1Z59A 4IZJD 3M85D 4DXLA 1OJ4A 2BA0D 2A2CA 1RR9A 4B3MI 2DEJA 3U1YA 1XHKA 4NXNI 4FWHA 2UUAI 3ZM7A 1N36E 5DNLA 2IESA 4QNJA 4DV0I 1OYSA 3U1KA 1NHJA 2BR2B 2A2DA 2HKEA 4DR1I 2VQEE 3DD6A 5LMUI 4GKKE 4B3SI 3QT6A 5C0XD 4X66I 4DR4E 4KHPI 1N32E 2GO3A 1VISA 2UUBE 4JI4I 4AQYI 1IBMI 5JEAA 1P42A 4OKGA 1HNWE 3PS2A 5LMNE 4LCFA 4PRXA 5ELWA 3J80Q 4DV3I 4R1FA 4K0KE 1KIJA 3V5RA 4HXZA 2VESA 2JT2A 2UXCI 4DV6E 1WUUA 2PO1A 2BM0A 4J3DA 4FWGA 4JI8E 4DUYE 2X36A 4LF5I 4JI7I 4HACB 4OO1B 2NN6E 4FW3A 3PS1A 2PO2B 4JI0I 5JEAB 1KTVA 3T1HE 2Z5CA 2JEBB 1B62A 1S16A 4X62E 4IZJB 3L7ZB 1YHCA 2C39A 1FI4A 2BM1A 2UUAE 4IFDA 2PO2A 2NN6F 1HNZI 5K36F 2CGEA 4UTGA 3J7AG 2HK2A 4BA2B 2WP8A 5LL6R 2UUCI 1UDSA 3PYFA 1Y4UA 1I94I 1Y4SA 4JG4A 1EI1A 3M7NG 1USVA 4I3HA 4ED4A 5C0XB 3J81C 1I94E 5K36E 5GMEA 3JAMQ 4DV7E 2HK3A 4K0KI 5DRPA 5EKWA 4AIDA 3Q1QA 4NBQA 1IBME 1UDOA 4JI2E 1OYPA 1ZM2A 4B3RI 5K36A 2F1DA 1S4EA 4IFDF 2AE8A 4LF8I 5IT9C 4DV5I 1Y60A 2ZM6E 4WUBA 2F4VE 4RPFA 3M85G 3V2UC 4ZVIA 1DARA 1XMQE 2BV3A 4ISAA 4DPYA 5IWAI 2WNRA 3PYEA 2JEAB 1HR0E 1J5EE 5A2QQ 2Z5EA 2LJPA 2R3VA 3P76A 4DV6I 5DNXA 4LPFA 1ZM3A 4OX9I 2V34A 3WU4A 3K85A 3OTOE 4DR5E 1N34E 4YY3I 3GCMA 4U3BA 4HY1A 4MU1A 1RHYA 1FKAE 2O1WA 4DUYI 4LF5E 4DR6I 3HULA 5A2QC 4BA2A 1IBLI 3P3CA 4B3SE 2J65A 1H7UA 4KQVA 1Z0TA 4GQUA 4AM3A 4OO1D 5IT9Q 3Q6NA 2HKJA 4LFAI 4LFCE 4P7AA 2JEBA 4DR3E 2PNLA 4LFAE 2HFSA 3CWVA 3PRYA 4B3ME 1A6FA 4FW5A 2O1VA 2PNZA 4X65I 4YHHI 2E5LI 1XNRE 3L7ZA 3PS3A 4USKA 3J80C 4LCGA 3T1YI 4AQYE 4DU8A 2O3ZA 3M6AA 3GLLA 4JI2I 4Z7CA 4GKKI 1YH8A 1R6MA 4MU3A 4JI3I 5DRRA 2F4VI 4DV2E 4JI8I 4M1KA 5FLXQ 2UU9I 1N33E 4EMDA 1Z0BA 4DUZI 4DV4I 3GONA 5BR8E 1HNZE 4PRVA 2PO0A 1UDNA 3HKMA 4FW4A 4MU0A 1E3PA 3H1CA 1N0UA 5C0XC 3WU6A 4BA1A 1NHHA 3K17A 5K36C 2NN6A 5GMDA 4Z7YA 2OI2A 1Z5AA 1N34I 3QT8A 4B3TI 2XEXA 4DV1E 2UXBE 3H4LA 1FJGI 1HK7A 2Z5BB 3CDIA 3HJCA 3KRNA 4IFDD 1Z5BA 3Q6MA 5K36B 2CZ9A 5C0XE 1RREA 4FW7A 2C38A 4LF4I 2BA0G 3ZZ0A 4X64I 1FNMA 3P06A 4JI5I 4NXNE 1U2RA 2DEIA 3LNUA 4DR2I 2JE6A 1IBLE 4DV0E 1N32I 2GO4A 4FN5A 3J81Q 1QZRA 3P3EA 4X65E 4IS9A 4YHHE 4DV5E 2E5LE 1XNRI 2Q2EB 1PIEA 4IFDC 4DV3E 1Y5YA 4LF6E 4KHPE 2IOPA 1UDQA 5JEAF 3M7ND 5JEAE 4XTJA 1Z0EA 3WU3A 3ZKBA 4LFBI 4LCHA 3B82A 1NHIA 4LF8E 2NN6B 5DROA 1K47A 2PNMA 4OO1E 2O1TA 4NXMI 1ZXMA 3QT7A 4FW6A 4OX9E 4GKJI 4B3RE 4IFDE 1ELOA 3B8HA 2V2VA 4JI0E 1MU5A 1ZM4A 3ZZTA 1H72C 2C37A 2GQ0A 4DPUA 2UXDE 2E1RA 1NZ0A 3B78A 4JI7E 1UEKA 4OO1C 4WUDA 3ZZUA 4QNKA 3F0NA 1XNQE 3JAMC 2Z5BA 3J7AM 2UU9E 4N3OA 2PO1B 1XNQI 2BA1D 4AIMA 4IZJA 4LF4E 1IBKI 1N36I 3LTOA 2C37B 4X62I 5K36D 2UUCE 4OZEA 2ZBKB 2EFGA 4PU9A 3OTOI 4DR5I 2WP8B
chains in the Genus database with same CATH topology
1UDSA 4OO1A 2JEAA 1R6LA 3M7NG 4OO1F 2JE6B 2PO0B 5C0XB 2BR2A 5K36E 5C0XF 5C0XA 2PO0A 1UDNA 3HKMA 1E3PA 3H1CA 5C0XC 4BA1A 5K36C 2NN6A 4AIDA 4NBQA 4BA1B 5JEAD 4IFDB 2C38B 1UDOA 1OYPA 3CDIA 3KRNA 5K36A 2C39B 4IFDF 4IFDD 3GMEA 3M85D 5K36B 1E3HA 2BA0D 2PNZB 5C0XE 2C38A 2BA0G 3M85G 1OYSA 3U1KA 2BR2B 2WNRA 2JE6A 3DD6A 2JEAB 5C0XD 1OYRA 5JEAC 4IFDC 3GCMA 5JEAA 2NN6D 1UDQA 5JEAF 3M7ND 5JEAE 4BA2A 2NN6B 4OO1E 3B4TA 4AM3A 4OO1D 2PO1A 2NN6C 4IFDE 2WNRB 2JEBA 3CDJA 4OO1B 2BA1G 2NN6E 2C37A 2PO2B 2PNZA 5JEAB 4OO1C 3L7ZA 2JEBB 2PO1B 3GLLA 3L7ZB 2BA1D 2C39A 4AIMA 4IFDA 2C37B 2NN6F 2PO2A 5K36F 5K36D 1R6MA 2WP8B 4BA2B 2WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDS A;  4OO1 A;  2JEA A;  1R6L A;  3M7N G;  4OO1 F;  2JE6 B;  2PO0 B;  5C0X B;  2BR2 A;  5K36 E;  5C0X F;  5C0X A;  2PO0 A;  1UDN A;  3HKM A;  1E3P A;  3H1C A;  5C0X C;  4BA1 A;  5K36 C;  2NN6 A;  4AID A;  4NBQ A;  4BA1 B;  5JEA D;  4IFD B;  2C38 B;  1UDO A;  1OYP A;  3CDI A;  3KRN A;  5K36 A;  2C39 B;  4IFD F;  4IFD D;  3GME A;  3M85 D;  5K36 B;  1E3H A;  2BA0 D;  2PNZ B;  5C0X E;  2C38 A;  2BA0 G;  3M85 G;  1OYS A;  3U1K A;  2BR2 B;  2WNR A;  2JE6 A;  3DD6 A;  2JEA B;  5C0X D;  1OYR A;  5JEA C;  4IFD C;  3GCM A;  5JEA A;  2NN6 D;  1UDQ A;  5JEA F;  3M7N D;  5JEA E;  4BA2 A;  2NN6 B;  4OO1 E;  3B4T A;  4AM3 A;  4OO1 D;  2PO1 A;  2NN6 C;  4IFD E;  2WNR B;  2JEB A;  3CDJ A;  4OO1 B;  2BA1 G;  2NN6 E;  2C37 A;  2PO2 B;  2PNZ A;  5JEA B;  4OO1 C;  3L7Z A;  2JEB B;  2PO1 B;  3GLL A;  3L7Z B;  2BA1 D;  2C39 A;  4AIM A;  4IFD A;  2C37 B;  2NN6 F;  2PO2 A;  5K36 F;  5K36 D;  1R6M A;  2WP8 B;  4BA2 B;  2WP8 A; 
#chains in the Genus database with same CATH topology
 4DR6 E;  5LMU E;  1BKN A;  1USU A;  4JV5 I;  1PVG A;  2CVE A;  1B63 A;  4HAC A;  4OO1 A;  4DV1 I;  2UXB I;  1R6L A;  4JYA I;  4FWD A;  2JE6 B;  2PO0 B;  4JI5 E;  4DV7 I;  4LOM A;  4DU7 A;  1H74 A;  5DRQ A;  5C0X F;  5C0X A;  4LF6 I;  5L3J A;  2V8P A;  4JYA E;  2AJ4 A;  4MYU A;  4LFC I;  1Z5C A;  3QT5 A;  1KKH A;  4IFD B;  1EA6 A;  4FW9 A;  4JI1 I;  1Y6Z A;  3K1J A;  4DR7 E;  3D4J A;  1PKP A;  4JI1 E;  3GME A;  3P3G A;  4LF9 E;  1E3H A;  1Z0C A;  4USM A;  2UXC E;  2PNZ B;  4DPW A;  2UUB I;  1XMQ I;  4JI4 E;  4LF9 I;  3ZKD A;  3T1H I;  1VI7 A;  2ZM6 I;  2WW4 A;  4DUZ E;  4DV4 E;  1XMO I;  4JI6 I;  1MX0 A;  1MG7 A;  4JI3 E;  4YY3 E;  1IBK E;  2UXD I;  1OYR A;  1XMO E;  4JI6 E;  4MU4 A;  5JEA C;  1Z0V A;  1N33 I;  1H7S A;  2V2Z A;  1D6T A;  2GS8 A;  2NN6 D;  2VQF I;  1KVK A;  4MQY A;  4DR2 E;  2VQF E;  1N0V C;  2Z5C B;  3B4T A;  1FWK A;  3PYG A;  1HNX E;  3PYD A;  1FJG E;  2NN6 C;  2VF3 A;  2WNR B;  4HYM A;  2CG9 A;  1HNX I;  2HFU A;  2ZIT A;  3CDJ A;  1ZXN A;  2IOQ A;  2VQE I;  2BA1 G;  2NPF A;  4MYT A;  1H73 A;  4X64 E;  1ZM9 A;  4X66 E;  4DR4 I;  3NZK A;  4P52 A;  4DPX A;  4GKJ E;  1FWL A;  4DR1 E;  4LF7 I;  2J7K A;  4WUC A;  3T1Y E;  4MDT A;  5FLX C;  4DR7 I;  4LFB E;  2O1U A;  4LF7 E;  5EL9 A;  4IZK A;  5IWA E;  4IZK B;  2HHH I;  4NXM E;  5FWK A;  1HNW I;  5LMN I;  3WU5 A;  4URL A;  5BR8 I;  1XXE A;  2HHH E;  2V2Q A;  2JEA A;  4OO1 F;  2BR2 A;  4DV2 I;  1J5E I;  1Z0W A;  2R42 A;  4B3T E;  2IER A;  4JV5 E;  5JEA D;  4BA1 B;  1Z0G A;  3LPS A;  2C38 B;  2X7I A;  4UT4 A;  3UHM A;  4DPT A;  2C39 B;  4U3D A;  1HR0 I;  4DR3 I;  1Z59 A;  4IZJ D;  3M85 D;  4DXL A;  1OJ4 A;  2BA0 D;  2A2C A;  1RR9 A;  4B3M I;  2DEJ A;  3U1Y A;  1XHK A;  4NXN I;  4FWH A;  2UUA I;  3ZM7 A;  1N36 E;  5DNL A;  2IES A;  4QNJ A;  4DV0 I;  1OYS A;  3U1K A;  1NHJ A;  2BR2 B;  2A2D A;  2HKE A;  4DR1 I;  2VQE E;  3DD6 A;  5LMU I;  4GKK E;  4B3S I;  3QT6 A;  5C0X D;  4X66 I;  4DR4 E;  4KHP I;  1N32 E;  2GO3 A;  1VIS A;  2UUB E;  4JI4 I;  4AQY I;  1IBM I;  5JEA A;  1P42 A;  4OKG A;  1HNW E;  3PS2 A;  5LMN E;  4LCF A;  4PRX A;  5ELW A;  3J80 Q;  4DV3 I;  4R1F A;  4K0K E;  1KIJ A;  3V5R A;  4HXZ A;  2VES A;  2JT2 A;  2UXC I;  4DV6 E;  1WUU A;  2PO1 A;  2BM0 A;  4J3D A;  4FWG A;  4JI8 E;  4DUY E;  2X36 A;  4LF5 I;  4JI7 I;  4HAC B;  4OO1 B;  2NN6 E;  4FW3 A;  3PS1 A;  2PO2 B;  4JI0 I;  5JEA B;  1KTV A;  3T1H E;  2Z5C A;  2JEB B;  1B62 A;  1S16 A;  4X62 E;  4IZJ B;  3L7Z B;  1YHC A;  2C39 A;  1FI4 A;  2BM1 A;  2UUA E;  4IFD A;  2PO2 A;  2NN6 F;  1HNZ I;  5K36 F;  2CGE A;  4UTG A;  3J7A G;  2HK2 A;  4BA2 B;  2WP8 A;  5LL6 R;  2UUC I;  1UDS A;  3PYF A;  1Y4U A;  1I94 I;  1Y4S A;  4JG4 A;  1EI1 A;  3M7N G;  1USV A;  4I3H A;  4ED4 A;  5C0X B;  3J81 C;  1I94 E;  5K36 E;  5GME A;  3JAM Q;  4DV7 E;  2HK3 A;  4K0K I;  5DRP A;  5EKW A;  4AID A;  3Q1Q A;  4NBQ A;  1IBM E;  1UDO A;  4JI2 E;  1OYP A;  1ZM2 A;  4B3R I;  5K36 A;  2F1D A;  1S4E A;  4IFD F;  2AE8 A;  4LF8 I;  5IT9 C;  4DV5 I;  1Y60 A;  2ZM6 E;  4WUB A;  2F4V E;  4RPF A;  3M85 G;  3V2U C;  4ZVI A;  1DAR A;  1XMQ E;  2BV3 A;  4ISA A;  4DPY A;  5IWA I;  2WNR A;  3PYE A;  2JEA B;  1HR0 E;  1J5E E;  5A2Q Q;  2Z5E A;  2LJP A;  2R3V A;  3P76 A;  4DV6 I;  5DNX A;  4LPF A;  1ZM3 A;  4OX9 I;  2V34 A;  3WU4 A;  3K85 A;  3OTO E;  4DR5 E;  1N34 E;  4YY3 I;  3GCM A;  4U3B A;  4HY1 A;  4MU1 A;  1RHY A;  1FKA E;  2O1W A;  4DUY I;  4LF5 E;  4DR6 I;  3HUL A;  5A2Q C;  4BA2 A;  1IBL I;  3P3C A;  4B3S E;  2J65 A;  1H7U A;  4KQV A;  1Z0T A;  4GQU A;  4AM3 A;  4OO1 D;  5IT9 Q;  3Q6N A;  2HKJ A;  4LFA I;  4LFC E;  4P7A A;  2JEB A;  4DR3 E;  2PNL A;  4LFA E;  2HFS A;  3CWV A;  3PRY A;  4B3M E;  1A6F A;  4FW5 A;  2O1V A;  2PNZ A;  4X65 I;  4YHH I;  2E5L I;  1XNR E;  3L7Z A;  3PS3 A;  4USK A;  3J80 C;  4LCG A;  3T1Y I;  4AQY E;  4DU8 A;  2O3Z A;  3M6A A;  3GLL A;  4JI2 I;  4Z7C A;  4GKK I;  1YH8 A;  1R6M A;  4MU3 A;  4JI3 I;  5DRR A;  2F4V I;  4DV2 E;  4JI8 I;  4M1K A;  5FLX Q;  2UU9 I;  1N33 E;  4EMD A;  1Z0B A;  4DUZ I;  4DV4 I;  3GON A;  5BR8 E;  1HNZ E;  4PRV A;  2PO0 A;  1UDN A;  3HKM A;  4FW4 A;  4MU0 A;  1E3P A;  3H1C A;  1N0U A;  5C0X C;  3WU6 A;  4BA1 A;  1NHH A;  3K17 A;  5K36 C;  2NN6 A;  5GMD A;  4Z7Y A;  2OI2 A;  1Z5A A;  1N34 I;  3QT8 A;  4B3T I;  2XEX A;  4DV1 E;  2UXB E;  3H4L A;  1FJG I;  1HK7 A;  2Z5B B;  3CDI A;  3HJC A;  3KRN A;  4IFD D;  1Z5B A;  3Q6M A;  5K36 B;  2CZ9 A;  5C0X E;  1RRE A;  4FW7 A;  2C38 A;  4LF4 I;  2BA0 G;  3ZZ0 A;  4X64 I;  1FNM A;  3P06 A;  4JI5 I;  4NXN E;  1U2R A;  2DEI A;  3LNU A;  4DR2 I;  2JE6 A;  1IBL E;  4DV0 E;  1N32 I;  2GO4 A;  4FN5 A;  3J81 Q;  1QZR A;  3P3E A;  4X65 E;  4IS9 A;  4YHH E;  4DV5 E;  2E5L E;  1XNR I;  2Q2E B;  1PIE A;  4IFD C;  4DV3 E;  1Y5Y A;  4LF6 E;  4KHP E;  2IOP A;  1UDQ A;  5JEA F;  3M7N D;  5JEA E;  4XTJ A;  1Z0E A;  3WU3 A;  3ZKB A;  4LFB I;  4LCH A;  3B82 A;  1NHI A;  4LF8 E;  2NN6 B;  5DRO A;  1K47 A;  2PNM A;  4OO1 E;  2O1T A;  4NXM I;  1ZXM A;  3QT7 A;  4FW6 A;  4OX9 E;  4GKJ I;  4B3R E;  4IFD E;  1ELO A;  3B8H A;  2V2V A;  4JI0 E;  1MU5 A;  1ZM4 A;  3ZZT A;  1H72 C;  2C37 A;  2GQ0 A;  4DPU A;  2UXD E;  2E1R A;  1NZ0 A;  3B78 A;  4JI7 E;  1UEK A;  4OO1 C;  4WUD A;  3ZZU A;  4QNK A;  3F0N A;  1XNQ E;  3JAM C;  2Z5B A;  3J7A M;  2UU9 E;  4N3O A;  2PO1 B;  1XNQ I;  2BA1 D;  4AIM A;  4IZJ A;  4LF4 E;  1IBK I;  1N36 I;  3LTO A;  2C37 B;  4X62 I;  5K36 D;  2UUC E;  4OZE A;  2ZBK B;  2EFG A;  4PU9 A;  3OTO I;  4DR5 I;  2WP8 B; 
#chains in the Genus database with same CATH homology
 1UDS A;  4OO1 A;  2JEA A;  1R6L A;  3M7N G;  4OO1 F;  2JE6 B;  2PO0 B;  5C0X B;  2BR2 A;  5K36 E;  5C0X F;  5C0X A;  2PO0 A;  1UDN A;  3HKM A;  1E3P A;  3H1C A;  5C0X C;  4BA1 A;  5K36 C;  2NN6 A;  4AID A;  4NBQ A;  4BA1 B;  5JEA D;  4IFD B;  2C38 B;  1UDO A;  1OYP A;  3CDI A;  3KRN A;  5K36 A;  2C39 B;  4IFD F;  4IFD D;  3GME A;  3M85 D;  5K36 B;  1E3H A;  2BA0 D;  2PNZ B;  5C0X E;  2C38 A;  2BA0 G;  3M85 G;  1OYS A;  3U1K A;  2BR2 B;  2WNR A;  2JE6 A;  3DD6 A;  2JEA B;  5C0X D;  1OYR A;  5JEA C;  4IFD C;  3GCM A;  5JEA A;  2NN6 D;  1UDQ A;  5JEA F;  3M7N D;  5JEA E;  4BA2 A;  2NN6 B;  4OO1 E;  3B4T A;  4AM3 A;  4OO1 D;  2PO1 A;  2NN6 C;  4IFD E;  2WNR B;  2JEB A;  3CDJ A;  4OO1 B;  2BA1 G;  2NN6 E;  2C37 A;  2PO2 B;  2PNZ A;  5JEA B;  4OO1 C;  3L7Z A;  2JEB B;  2PO1 B;  3GLL A;  3L7Z B;  2BA1 D;  2C39 A;  4AIM A;  4IFD A;  2C37 B;  2NN6 F;  2PO2 A;  5K36 F;  5K36 D;  1R6M A;  2WP8 B;  4BA2 B;  2WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...