3L7ZA

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
271
structure length
251
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna binding protein
molecule keywords Probable exosome complex exonuclease 2
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 73
structure length 251
sequence length 271
chains with identical sequence D, G
ec nomenclature ec 3.1.13.-:
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3l7zA01
3L7ZA 2PO2A 3H1CA 4BA2A 2NN6B 2PO1A 3M7NG 2C39A 2BA0D 4BA1B 2JEAB 1R6MA 2WP8A 1R6LA 5C0XF 5C0XE 2C37B 5C0XD 2BR2B 1OYRA 4IFDF 2JE6B 4IFDE 2PNZA 4IFDD 1UDQA 3HKMA 3M7ND 2BA1D 4NBQA 2NN6C 4AIDA 3GLLA 5C0XB 5JEAE 5JEAD 4IFDB 5K36F 5K36E 1E3HA 2NN6A 2JEBB 5K36D 4AM3A 4BA1A 2JEAA 3B4TA 3CDIA 3DD6A 2C37A 5JEAB 2BR2A 2JE6A 5K36B 3GMEA 4OO1B 3KRNA 5C0XC 3GCMA 2PO0B 2C38B 1UDNA 5JEAF 4IFDC 2WNRB 3M85G 4OO1F 5C0XA 4OO1E 3L7ZB 1OYPA 2PO2B 4OO1D 4IFDA 1OYSA 2JEBA 4BA2B 5JEAC 2PO1B 2C39B 4AIMA 1UDOA 5K36C 3CDJA 4OO1C 2BA1G 5JEAA 2WP8B 3M85D 5K36A 1UDSA 4OO1A 1E3PA 2NN6F 2PNZB 2PO0A 2NN6E 2BA0G 2C38A 2NN6D 3U1KA 2WNRA
chains in the Genus database with same CATH superfamily
4OKGA 3WU4A 1K47A 3L7ZA 4OZEA 4GKJE 2PO2A 2UXDI 4DUYE 4B3SI 4P7AA 3K17A 3ZZTA 4QNJA 4BA2A 2GQ0A 4DR3I 4JI7E 2HFSA 4LF6I 1Z0BA 2VQFI 1HNXI 4QNKA 4DPYA 3PRYA 4KHPI 2E5LI 4LFBI 4JI2E 4LCHA 2AE8A 2V2ZA 5C0XE 4JI5I 4JI6I 1ZXNA 4OX9I 4DR7I 3CWVA 5DROA 4LF8E 4DV2E 2BR2B 1OYRA 4U3BA 3P76A 4IFDD 1UDQA 4M1KA 2EFGA 1J5EI 1N36I 3HKMA 2UU9E 4NBQA 4DV7E 2NN6C 4IS9A 4MU4A 4AQYI 3GLLA 3Q6MA 4J3DA 1UEKA 5BR8E 2F1DA 3M6AA 1Y6ZA 4JI0I 4I3HA 4FN5A 1FJGI 1E3HA 2JEBB 2VQEE 5K36D 2Z5EA 1Z0EA 4DPXA 1IBLI 4LF4E 1Z0WA 5LMNI 1HR0E 4USMA 5ELWA 4JYAE 2UXBE 4JI3I 4LFCE 5JEAB 3PYDA 2BR2A 4JI1I 1NHIA 4GKKI 2JT2A 4U3DA 5C0XC 3GCMA 4LF9E 1QZRA 2PO0B 1S16A 2C38B 1UDNA 2IOQA 2GO4A 4DV0I 3ZZ0A 4Z7YA 4NXNI 2GS8A 4DR2E 2ZBKB 1IBKI 4OO1D 3P3CA 2IESA 1HK7A 2JEBA 1ZXMA 2PO1B 1D6TA 1UDOA 1U2RA 1XMOI 4GKJI 1A6FA 5FWKA 1HNWI 2PNLA 4MU1A 1XNQE 2O1UA 3PS1A 1VISA 5JEAA 2WP8B 4FW4A 4JI7I 4UTGA 2XEXA 3B78A 2HK3A 1RR9A 1ZM3A 1E3PA 2PO0A 2BA0G 2C38A 3P3GA 4YY3E 1N32I 4B3RE 4JI2I 4X66E 4DV3I 2X7IA 4LF5E 4P52A 1NZ0A 2UXCI 5DRQA 2NN6B 2PO1A 4DV7I 4PU9A 1FNMA 3M7NG 3QT6A 5BR8I 3LNUA 4FW9A 1N34E 2VF3A 5EKWA 2BM1A 2WP8A 2VQEI 2UUBI 2C37B 5IT9C 4IFDF 2JE6B 4FW5A 4YHHE 1HR0I 1N0VC 4DUZE 3Q6NA 2UXBI 4XTJA 2BA1D 4LFCI 1Y5YA 1Z5CA 4MU3A 3PYFA 2CZ9A 4JV5E 2CVEA 5C0XB 4LOMA 5JEAD 1MX0A 5K36F 2PNMA 2V2VA 2NN6A 1VI7A 4B3ME 5LL6R 4AM3A 2GO3A 4DR2I 4LF7E 1I94E 4MU0A 2DEIA 2AJ4A 4FW6A 5LMUE 3B4TA 2C37A 1Z0TA 5GMDA 2JE6A 3WU3A 3T1HE 3QT7A 1FWKA 5IT9Q 1MU5A 3KRNA 4HACB 1ELOA 1Z59A 3QT8A 3B82A 4DR5I 4X65E 3HJCA 3P3EA 2UUCE 4OO1F 2WW4A 5C0XA 1XXEA 1B63A 5IWAE 4WUCA 1Z0GA 4DU8A 2ZM6I 1EA6A 4IZJB 4DR6E 4WUDA 3HULA 4LF5I 2C39B 4X62I 3LTOA 2F4VE 4DR1E 4OO1C 2J65A 2HKJA 3H4LA 1EI1A 4DV5E 3LPSA 2BA1G 3M85D 4NXME 2HFUA 3F0NA 2V34A 1IBME 1MG7A 3T1YI 4LPFA 4PRXA 4HACA 2PNZB 4B3TE 1XMQE 2NN6D 4JI8E 4AQYE 1XHKA 4DV6I 2OI2A 3P06A 4MQYA 1Z0CA 4DPWA 2UUAI 2UXDE 1N33I 4YHHI 4HXZA 2O1TA 4DUYI 3H1CA 4IZJA 1BKNA 4DPUA 2VQFE 4LFAE 2C39A 4JV5I 4KHPE 3NZKA 2JEAB 4DR7E 4JI6E 1R6MA 1Z0VA 4FWDA 1R6LA 4DV1E 5C0XD 4LF7I 1I94I 4IFDE 4DR4E 2PNZA 4LF8I 4DV2I 3K85A 4FWHA 2LJPA 3ZM7A 2R42A 1FI4A 2Q2EB 4LCFA 4WUBA 4MYTA 2UU9I 3T1HI 3ZKDA 4GQUA 4KQVA 2R3VA 3V5RA 5K36E 1IBLE 1FKAE 4X65I 2CG9A 4IZKB 4HY1A 5LMNE 3OTOE 4EMDA 3J81C 2JEAA 2HHHE 4LF4I 4JI1E 4JYAI 1S4EA 3GMEA 4OO1B 2F4VI 1H74A 4ISAA 4FW7A 5A2QQ 4DV5I 2CGEA 2DEJA 4IFDC 4LF9I 4NXNE 5FLXC 4NXMI 1NHJA 1IBMI 4FWGA 4DV4E 4OO1E 2Z5BB 4URLA 1XMQI 1B62A 2IOPA 5DNLA 4IZKA 1Y60A 1XMOE 4PRVA 1HNWE 3J80C 5K36C 2J7KA 1KTVA 4HYMA 3J81Q 1KKHA 1Z5AA 1PVGA 4MDTA 2VESA 4LFAI 2BV3A 1XNQI 1P42A 1H72C 4OO1A 1N32E 2NN6F 1RREA 5GMEA 3U1KA 4DV3E 1XNRE 4DV1I 4YY3I 4FW3A 4B3RI 4JG4A 5FLXQ 4DR4I 4X66I 4K0KE 2Z5BA 3PS2A 2UXCE 2IERA 4X64E 1YHCA 5DNXA 5DRPA 4ZVIA 3PS3A 4UT4A 3WU5A 1WUUA 1KIJA 4Z7CA 2BA0D 4N3OA 4USKA 1HNZE 4LCGA 4BA1B 3J80Q 1H7SA 2UUBE 1PIEA 3WU6A 5C0XF 4JI4E 1N34I 3J7AG 1ZM4A 3OTOI 2O3ZA 1H73A 2HHHI 4B3SE 1YH8A 2X36A 5EL9A 2A2CA 2HK2A 3M7ND 5DRRA 4DUZI 4DR3E 2HKEA 4AIDA 4LF6E 1HNXE 1Z5BA 3V2UC 4DXLA 1H7UA 5JEAE 4IFDB 3J7AM 2E5LE 4LFBE 1NHHA 3QT5A 4JI5E 1KVKA 1N0UA 4OX9E 3PYGA 4DV4I 4DU7A 1OJ4A 4BA1A 4B3MI 2Z5CB 3GONA 3CDIA 1J5EE 1N36E 3D4JA 5LMUI 1USUA 3UHMA 5A2QC 3DD6A 4R1FA 1ZM9A 5K36B 3JAMC 2BM0A 4DR5E 4JI0E 5JEAF 1FJGE 1RHYA 3ZKBA 4DPTA 1Y4SA 2WNRB 3M85G 3K1JA 3B8HA 3L7ZB 1OYPA 2PO2B 2UUCI 2ZM6E 4IFDA 2V2QA 1OYSA 1XNRI 5IWAI 4JI3E 4BA2B 5JEAC 4X62E 2A2DA 5L3JA 2O1VA 3PYEA 4AIMA 4K0KI 2Z5CA 4DR6I 4ED4A 4X64I 4GKKE 2NPFA 3CDJA 3Q1QA 3ZZUA 2V8PA 3T1YE 4DR1I 4DV0E 4IZJD 2O1WA 2ZITA 5K36A 1UDSA 1HNZI 4MYUA 4RPFA 1IBKE 4DV6E 2NN6E 3JAMQ 1PKPA 1DARA 2UUAE 2E1RA 4JI4I 1Y4UA 3U1YA 4B3TI 1N33E 4JI8I 2WNRA 1USVA 1FWLA 1ZM2A
chains in the Genus database with same CATH topology
3L7ZA 2PO2A 3H1CA 4BA2A 2NN6B 2PO1A 3M7NG 2C39A 2BA0D 4BA1B 2JEAB 1R6MA 2WP8A 1R6LA 5C0XF 5C0XE 2C37B 5C0XD 2BR2B 1OYRA 4IFDF 2JE6B 4IFDE 2PNZA 4IFDD 1UDQA 3HKMA 3M7ND 2BA1D 4NBQA 2NN6C 4AIDA 3GLLA 5C0XB 5JEAE 5JEAD 4IFDB 5K36F 5K36E 1E3HA 2NN6A 2JEBB 5K36D 4AM3A 4BA1A 2JEAA 3B4TA 3CDIA 3DD6A 2C37A 5JEAB 2BR2A 2JE6A 5K36B 3GMEA 4OO1B 3KRNA 5C0XC 3GCMA 2PO0B 2C38B 1UDNA 5JEAF 4IFDC 2WNRB 3M85G 4OO1F 5C0XA 4OO1E 3L7ZB 1OYPA 2PO2B 4OO1D 4IFDA 1OYSA 2JEBA 4BA2B 5JEAC 2PO1B 2C39B 4AIMA 1UDOA 5K36C 3CDJA 4OO1C 2BA1G 5JEAA 2WP8B 3M85D 5K36A 1UDSA 4OO1A 1E3PA 2NN6F 2PNZB 2PO0A 2NN6E 2BA0G 2C38A 2NN6D 3U1KA 2WNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Z A;  2PO2 A;  3H1C A;  4BA2 A;  2NN6 B;  2PO1 A;  3M7N G;  2C39 A;  2BA0 D;  4BA1 B;  2JEA B;  1R6M A;  2WP8 A;  1R6L A;  5C0X F;  5C0X E;  2C37 B;  5C0X D;  2BR2 B;  1OYR A;  4IFD F;  2JE6 B;  4IFD E;  2PNZ A;  4IFD D;  1UDQ A;  3HKM A;  3M7N D;  2BA1 D;  4NBQ A;  2NN6 C;  4AID A;  3GLL A;  5C0X B;  5JEA E;  5JEA D;  4IFD B;  5K36 F;  5K36 E;  1E3H A;  2NN6 A;  2JEB B;  5K36 D;  4AM3 A;  4BA1 A;  2JEA A;  3B4T A;  3CDI A;  3DD6 A;  2C37 A;  5JEA B;  2BR2 A;  2JE6 A;  5K36 B;  3GME A;  4OO1 B;  3KRN A;  5C0X C;  3GCM A;  2PO0 B;  2C38 B;  1UDN A;  5JEA F;  4IFD C;  2WNR B;  3M85 G;  4OO1 F;  5C0X A;  4OO1 E;  3L7Z B;  1OYP A;  2PO2 B;  4OO1 D;  4IFD A;  1OYS A;  2JEB A;  4BA2 B;  5JEA C;  2PO1 B;  2C39 B;  4AIM A;  1UDO A;  5K36 C;  3CDJ A;  4OO1 C;  2BA1 G;  5JEA A;  2WP8 B;  3M85 D;  5K36 A;  1UDS A;  4OO1 A;  1E3P A;  2NN6 F;  2PNZ B;  2PO0 A;  2NN6 E;  2BA0 G;  2C38 A;  2NN6 D;  3U1K A;  2WNR A; 
#chains in the Genus database with same CATH topology
 4OKG A;  3WU4 A;  1K47 A;  3L7Z A;  4OZE A;  4GKJ E;  2PO2 A;  2UXD I;  4DUY E;  4B3S I;  4P7A A;  3K17 A;  3ZZT A;  4QNJ A;  4BA2 A;  2GQ0 A;  4DR3 I;  4JI7 E;  2HFS A;  4LF6 I;  1Z0B A;  2VQF I;  1HNX I;  4QNK A;  4DPY A;  3PRY A;  4KHP I;  2E5L I;  4LFB I;  4JI2 E;  4LCH A;  2AE8 A;  2V2Z A;  5C0X E;  4JI5 I;  4JI6 I;  1ZXN A;  4OX9 I;  4DR7 I;  3CWV A;  5DRO A;  4LF8 E;  4DV2 E;  2BR2 B;  1OYR A;  4U3B A;  3P76 A;  4IFD D;  1UDQ A;  4M1K A;  2EFG A;  1J5E I;  1N36 I;  3HKM A;  2UU9 E;  4NBQ A;  4DV7 E;  2NN6 C;  4IS9 A;  4MU4 A;  4AQY I;  3GLL A;  3Q6M A;  4J3D A;  1UEK A;  5BR8 E;  2F1D A;  3M6A A;  1Y6Z A;  4JI0 I;  4I3H A;  4FN5 A;  1FJG I;  1E3H A;  2JEB B;  2VQE E;  5K36 D;  2Z5E A;  1Z0E A;  4DPX A;  1IBL I;  4LF4 E;  1Z0W A;  5LMN I;  1HR0 E;  4USM A;  5ELW A;  4JYA E;  2UXB E;  4JI3 I;  4LFC E;  5JEA B;  3PYD A;  2BR2 A;  4JI1 I;  1NHI A;  4GKK I;  2JT2 A;  4U3D A;  5C0X C;  3GCM A;  4LF9 E;  1QZR A;  2PO0 B;  1S16 A;  2C38 B;  1UDN A;  2IOQ A;  2GO4 A;  4DV0 I;  3ZZ0 A;  4Z7Y A;  4NXN I;  2GS8 A;  4DR2 E;  2ZBK B;  1IBK I;  4OO1 D;  3P3C A;  2IES A;  1HK7 A;  2JEB A;  1ZXM A;  2PO1 B;  1D6T A;  1UDO A;  1U2R A;  1XMO I;  4GKJ I;  1A6F A;  5FWK A;  1HNW I;  2PNL A;  4MU1 A;  1XNQ E;  2O1U A;  3PS1 A;  1VIS A;  5JEA A;  2WP8 B;  4FW4 A;  4JI7 I;  4UTG A;  2XEX A;  3B78 A;  2HK3 A;  1RR9 A;  1ZM3 A;  1E3P A;  2PO0 A;  2BA0 G;  2C38 A;  3P3G A;  4YY3 E;  1N32 I;  4B3R E;  4JI2 I;  4X66 E;  4DV3 I;  2X7I A;  4LF5 E;  4P52 A;  1NZ0 A;  2UXC I;  5DRQ A;  2NN6 B;  2PO1 A;  4DV7 I;  4PU9 A;  1FNM A;  3M7N G;  3QT6 A;  5BR8 I;  3LNU A;  4FW9 A;  1N34 E;  2VF3 A;  5EKW A;  2BM1 A;  2WP8 A;  2VQE I;  2UUB I;  2C37 B;  5IT9 C;  4IFD F;  2JE6 B;  4FW5 A;  4YHH E;  1HR0 I;  1N0V C;  4DUZ E;  3Q6N A;  2UXB I;  4XTJ A;  2BA1 D;  4LFC I;  1Y5Y A;  1Z5C A;  4MU3 A;  3PYF A;  2CZ9 A;  4JV5 E;  2CVE A;  5C0X B;  4LOM A;  5JEA D;  1MX0 A;  5K36 F;  2PNM A;  2V2V A;  2NN6 A;  1VI7 A;  4B3M E;  5LL6 R;  4AM3 A;  2GO3 A;  4DR2 I;  4LF7 E;  1I94 E;  4MU0 A;  2DEI A;  2AJ4 A;  4FW6 A;  5LMU E;  3B4T A;  2C37 A;  1Z0T A;  5GMD A;  2JE6 A;  3WU3 A;  3T1H E;  3QT7 A;  1FWK A;  5IT9 Q;  1MU5 A;  3KRN A;  4HAC B;  1ELO A;  1Z59 A;  3QT8 A;  3B82 A;  4DR5 I;  4X65 E;  3HJC A;  3P3E A;  2UUC E;  4OO1 F;  2WW4 A;  5C0X A;  1XXE A;  1B63 A;  5IWA E;  4WUC A;  1Z0G A;  4DU8 A;  2ZM6 I;  1EA6 A;  4IZJ B;  4DR6 E;  4WUD A;  3HUL A;  4LF5 I;  2C39 B;  4X62 I;  3LTO A;  2F4V E;  4DR1 E;  4OO1 C;  2J65 A;  2HKJ A;  3H4L A;  1EI1 A;  4DV5 E;  3LPS A;  2BA1 G;  3M85 D;  4NXM E;  2HFU A;  3F0N A;  2V34 A;  1IBM E;  1MG7 A;  3T1Y I;  4LPF A;  4PRX A;  4HAC A;  2PNZ B;  4B3T E;  1XMQ E;  2NN6 D;  4JI8 E;  4AQY E;  1XHK A;  4DV6 I;  2OI2 A;  3P06 A;  4MQY A;  1Z0C A;  4DPW A;  2UUA I;  2UXD E;  1N33 I;  4YHH I;  4HXZ A;  2O1T A;  4DUY I;  3H1C A;  4IZJ A;  1BKN A;  4DPU A;  2VQF E;  4LFA E;  2C39 A;  4JV5 I;  4KHP E;  3NZK A;  2JEA B;  4DR7 E;  4JI6 E;  1R6M A;  1Z0V A;  4FWD A;  1R6L A;  4DV1 E;  5C0X D;  4LF7 I;  1I94 I;  4IFD E;  4DR4 E;  2PNZ A;  4LF8 I;  4DV2 I;  3K85 A;  4FWH A;  2LJP A;  3ZM7 A;  2R42 A;  1FI4 A;  2Q2E B;  4LCF A;  4WUB A;  4MYT A;  2UU9 I;  3T1H I;  3ZKD A;  4GQU A;  4KQV A;  2R3V A;  3V5R A;  5K36 E;  1IBL E;  1FKA E;  4X65 I;  2CG9 A;  4IZK B;  4HY1 A;  5LMN E;  3OTO E;  4EMD A;  3J81 C;  2JEA A;  2HHH E;  4LF4 I;  4JI1 E;  4JYA I;  1S4E A;  3GME A;  4OO1 B;  2F4V I;  1H74 A;  4ISA A;  4FW7 A;  5A2Q Q;  4DV5 I;  2CGE A;  2DEJ A;  4IFD C;  4LF9 I;  4NXN E;  5FLX C;  4NXM I;  1NHJ A;  1IBM I;  4FWG A;  4DV4 E;  4OO1 E;  2Z5B B;  4URL A;  1XMQ I;  1B62 A;  2IOP A;  5DNL A;  4IZK A;  1Y60 A;  1XMO E;  4PRV A;  1HNW E;  3J80 C;  5K36 C;  2J7K A;  1KTV A;  4HYM A;  3J81 Q;  1KKH A;  1Z5A A;  1PVG A;  4MDT A;  2VES A;  4LFA I;  2BV3 A;  1XNQ I;  1P42 A;  1H72 C;  4OO1 A;  1N32 E;  2NN6 F;  1RRE A;  5GME A;  3U1K A;  4DV3 E;  1XNR E;  4DV1 I;  4YY3 I;  4FW3 A;  4B3R I;  4JG4 A;  5FLX Q;  4DR4 I;  4X66 I;  4K0K E;  2Z5B A;  3PS2 A;  2UXC E;  2IER A;  4X64 E;  1YHC A;  5DNX A;  5DRP A;  4ZVI A;  3PS3 A;  4UT4 A;  3WU5 A;  1WUU A;  1KIJ A;  4Z7C A;  2BA0 D;  4N3O A;  4USK A;  1HNZ E;  4LCG A;  4BA1 B;  3J80 Q;  1H7S A;  2UUB E;  1PIE A;  3WU6 A;  5C0X F;  4JI4 E;  1N34 I;  3J7A G;  1ZM4 A;  3OTO I;  2O3Z A;  1H73 A;  2HHH I;  4B3S E;  1YH8 A;  2X36 A;  5EL9 A;  2A2C A;  2HK2 A;  3M7N D;  5DRR A;  4DUZ I;  4DR3 E;  2HKE A;  4AID A;  4LF6 E;  1HNX E;  1Z5B A;  3V2U C;  4DXL A;  1H7U A;  5JEA E;  4IFD B;  3J7A M;  2E5L E;  4LFB E;  1NHH A;  3QT5 A;  4JI5 E;  1KVK A;  1N0U A;  4OX9 E;  3PYG A;  4DV4 I;  4DU7 A;  1OJ4 A;  4BA1 A;  4B3M I;  2Z5C B;  3GON A;  3CDI A;  1J5E E;  1N36 E;  3D4J A;  5LMU I;  1USU A;  3UHM A;  5A2Q C;  3DD6 A;  4R1F A;  1ZM9 A;  5K36 B;  3JAM C;  2BM0 A;  4DR5 E;  4JI0 E;  5JEA F;  1FJG E;  1RHY A;  3ZKB A;  4DPT A;  1Y4S A;  2WNR B;  3M85 G;  3K1J A;  3B8H A;  3L7Z B;  1OYP A;  2PO2 B;  2UUC I;  2ZM6 E;  4IFD A;  2V2Q A;  1OYS A;  1XNR I;  5IWA I;  4JI3 E;  4BA2 B;  5JEA C;  4X62 E;  2A2D A;  5L3J A;  2O1V A;  3PYE A;  4AIM A;  4K0K I;  2Z5C A;  4DR6 I;  4ED4 A;  4X64 I;  4GKK E;  2NPF A;  3CDJ A;  3Q1Q A;  3ZZU A;  2V8P A;  3T1Y E;  4DR1 I;  4DV0 E;  4IZJ D;  2O1W A;  2ZIT A;  5K36 A;  1UDS A;  1HNZ I;  4MYU A;  4RPF A;  1IBK E;  4DV6 E;  2NN6 E;  3JAM Q;  1PKP A;  1DAR A;  2UUA E;  2E1R A;  4JI4 I;  1Y4U A;  3U1Y A;  4B3T I;  1N33 E;  4JI8 I;  2WNR A;  1USV A;  1FWL A;  1ZM2 A; 
#chains in the Genus database with same CATH homology
 3L7Z A;  2PO2 A;  3H1C A;  4BA2 A;  2NN6 B;  2PO1 A;  3M7N G;  2C39 A;  2BA0 D;  4BA1 B;  2JEA B;  1R6M A;  2WP8 A;  1R6L A;  5C0X F;  5C0X E;  2C37 B;  5C0X D;  2BR2 B;  1OYR A;  4IFD F;  2JE6 B;  4IFD E;  2PNZ A;  4IFD D;  1UDQ A;  3HKM A;  3M7N D;  2BA1 D;  4NBQ A;  2NN6 C;  4AID A;  3GLL A;  5C0X B;  5JEA E;  5JEA D;  4IFD B;  5K36 F;  5K36 E;  1E3H A;  2NN6 A;  2JEB B;  5K36 D;  4AM3 A;  4BA1 A;  2JEA A;  3B4T A;  3CDI A;  3DD6 A;  2C37 A;  5JEA B;  2BR2 A;  2JE6 A;  5K36 B;  3GME A;  4OO1 B;  3KRN A;  5C0X C;  3GCM A;  2PO0 B;  2C38 B;  1UDN A;  5JEA F;  4IFD C;  2WNR B;  3M85 G;  4OO1 F;  5C0X A;  4OO1 E;  3L7Z B;  1OYP A;  2PO2 B;  4OO1 D;  4IFD A;  1OYS A;  2JEB A;  4BA2 B;  5JEA C;  2PO1 B;  2C39 B;  4AIM A;  1UDO A;  5K36 C;  3CDJ A;  4OO1 C;  2BA1 G;  5JEA A;  2WP8 B;  3M85 D;  5K36 A;  1UDS A;  4OO1 A;  1E3P A;  2NN6 F;  2PNZ B;  2PO0 A;  2NN6 E;  2BA0 G;  2C38 A;  2NN6 D;  3U1K A;  2WNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...