3L7ZA

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
271
structure length
251
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
molecule keywords Probable exosome complex exonuclease 2
total genus 73
structure length 251
sequence length 271
chains with identical sequence D, G
ec nomenclature ec 3.1.13.-:
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3l7zA01
1UDNA 5JEAA 3GMEA 2JEBA 3HKMA 2PNZA 2NN6C 4IFDE 4IFDB 5C0XE 3U1KA 5K36C 5JEAF 3M85G 2C37A 4OO1E 2PNZB 4BA2A 3DD6A 5JEAD 3CDJA 2NN6F 4AIMA 4IFDF 2JEAA 2C37B 5C0XB 5C0XA 5K36B 4OO1A 4AIDA 2BR2A 3L7ZB 2WP8B 2NN6D 5C0XD 4IFDD 4IFDA 4AM3A 3H1CA 2JEAB 2NN6A 2NN6B 4OO1B 5K36D 2PO1A 5C0XF 2PO0B 2WP8A 5K36E 2C38A 2WNRA 4BA1A 5K36F 4NBQA 2NN6E 4IFDC 5C0XC 1OYSA 4OO1C 3GLLA 3CDIA 3M85D 2PO2A 3KRNA 3GCMA 1UDSA 2BA1D 2WNRB 1E3HA 4BA1B 4OO1F 2JEBB 5JEAE 4BA2B 2BR2B 2PO0A 1E3PA 2BA1G 2C39A 1R6LA 4OO1D 3M7ND 2BA0G 1OYPA 2PO1B 5JEAC 3L7ZA 1UDOA 1UDQA 2BA0D 3B4TA 3M7NG 2PO2B 1OYRA 5JEAB 1R6MA 5K36A 2JE6B 2JE6A 2C39B 2C38B
chains in the Genus database with same CATH superfamily
4GKKE 4MU1A 3WU6A 4R1FA 1UDNA 1FJGI 2BV3A 1PVGA 1I94I 4GKJI 3HKMA 1XMQI 4JI5I 4DXLA 4LFCI 4X66I 1FKAE 4LF6I 1UEKA 4DUZE 2AE8A 2HKJA 4LF5E 4GQUA 4BA2A 4B3SE 4LFAE 1WUUA 2HFSA 4DPWA 2Z5BA 4EMDA 2NN6F 4HACB 4IFDF 1HNWE 2C37B 2Z5CA 5C0XB 2R3VA 1Y4UA 1Y60A 4YHHE 2BR2A 5GMDA 3J7AG 1Z5CA 3ZM7A 5C0XD 1ZM4A 1N34E 2ZM6I 2VQFI 4JI6E 2HHHE 4JI2I 2JEAB 1FJGE 3JAMC 1H74A 3QT6A 2OI2A 2UUCE 4DV4E 4OX9I 2PO1A 5K36D 4DR2I 2J7KA 3ZZUA 2E5LE 1FWKA 4DV2I 4JYAE 4LFBE 2V8PA 2HK2A 2C38A 4MQYA 1Z0VA 4IS9A 4BA1A 3J80Q 3F0NA 5LMUE 4NBQA 3HULA 4JI7E 2NN6E 5C0XC 3Q1QA 3CDIA 4ZVIA 4B3RI 4JI1I 4DV6E 4HYMA 5BR8E 3P3GA 5DNLA 1MX0A 4P52A 5FWKA 4DV5E 2BR2B 1N0UA 2PO0A 3PYGA 1EA6A 4P7AA 4AQYI 1E3PA 1Z0BA 3ZZTA 1N32I 2J65A 4OO1D 3WU4A 3J81C 3M7ND 3WU5A 3B8HA 4YY3I 1HK7A 3V2UC 1OYPA 5DRQA 4JI3I 3PS2A 4OKGA 2PO1B 4DR3I 5JEAC 5DRRA 1MG7A 1Z0EA 4K0KE 4WUBA 1ZM3A 1ELOA 4B3TI 1OYRA 4KHPE 3QT5A 4LF9E 4DU7A 4DV1I 3CWVA 5JEAB 1I94E 4UT4A 4DPUA 3T1HE 2GS8A 3PRYA 1Z0WA 2ZITA 4URLA 2XEXA 4MU0A 3LTOA 2C39B 4LOMA 2E1RA 2O1WA 4LF8E 5A2QC 3B82A 1HNXE 4PU9A 4LF7E 4JI7I 3K85A 4KQVA 4U3DA 2JT2A 2IESA 3ZZ0A 4B3MI 4IZJA 4X66E 4LFCE 2AJ4A 4B3TE 4KHPI 4IFDB 5C0XE 3U1KA 5LMNE 1NHJA 1H7UA 3U1YA 4JI8E 4MU3A 4DV7E 4HY1A 1HNZE 1ZXMA 4DUZI 2PNZB 1HR0E 3DD6A 5ELWA 2ZM6E 1KTVA 4FW6A 5JEAD 4LFAI 2UXBE 1VISA 2Z5EA 2UUBI 1NHHA 1XXEA 2A2DA 2F4VE 3PYFA 4OO1A 1Y4SA 3D4JA 4AIDA 4DR6I 4LF5I 2CG9A 1Y6ZA 2WP8B 1N34I 1IBLI 2VF3A 2UXCE 4RPFA 2O1TA 4FW9A 4LCHA 3OTOE 2ZBKB 4DV3E 4LF4E 4DR5I 2NN6B 3T1HI 3PYEA 1XMQE 3GONA 4LCFA 5GMEA 1N36E 4FW4A 3P76A 4JI4E 2WNRA 4LF9I 1NHIA 2EFGA 3J7AM 5EKWA 4IFDC 4JI0I 3Q6NA 2R42A 4J3DA 4M1KA 5LL6R 3K1JA 4JI4I 1UDSA 2BA1D 4BA1B 1S16A 4LF4I 4OO1F 1Z0GA 2JEBB 4DR6E 1K47A 2A2CA 4BA2B 5IWAE 4DR1I 4X65I 1PKPA 1XMOI 4JI1E 2CGEA 2CZ9A 3QT8A 2UUAI 4DV4I 1FNMA 4HXZA 4DR2E 2HFUA 4LPFA 1Z5AA 1BKNA 4U3BA 4JI0E 4FW5A 1ZM2A 3PS3A 2BA0D 3J80C 2V2QA 2UXDE 1Z0CA 2PO2B 1YHCA 3OTOI 4DR4E 2VQEI 1B62A 3M6AA 3UHMA 4IZKB 5K36A 4NXNI 4DPXA 1IBKI 1YH8A 5DROA 3JAMQ 1A6FA 1RR9A 2JE6A 4X62E 4LF8I 1H7SA 4HACA 4JI8I 4DU8A 1IBME 4LF7I 1XMOE 5JEAA 3GMEA 5FLXQ 1USUA 4JG4A 4OX9E 4JI3E 4YHHI 3P3CA 5IT9Q 3HJCA 3Q6MA 4IFDE 4MU4A 1Y5YA 2O3ZA 1XNRE 5JEAF 3PYDA 1IBMI 4FW3A 4DV1E 2UU9E 3M85G 2BM1A 4FWDA 2C37A 2Z5CB 4IZJD 5DRPA 2UUAE 4GKJE 1Z59A 3V5RA 1HR0I 2DEJA 4B3RE 4OZEA 4LF6E 3H4LA 2JEAA 1U2RA 2UU9I 3T1YI 3L7ZB 4WUCA 1NZ0A 1QZRA 4Z7CA 2F1DA 3P06A 4AM3A 2NN6A 4UTGA 4DV3I 2HK3A 4DPYA 1USVA 1ZM9A 5EL9A 1Z0TA 1VI7A 5IWAI 4DR1E 2PO0B 4WUDA 2IERA 4I3HA 2WP8A 1N36I 4IZJB 3B78A 1RREA 4DV6I 5FLXC 1KIJA 4DV7I 4DR4I 4DR5E 1D6TA 1XNQI 2X36A 4DV5I 1N33E 4DUYI 4DV2E 4B3ME 3M85D 2VQFE 2PO2A 1FI4A 3KRNA 4NXME 2WNRB 1E3HA 2V34A 1B63A 3P3EA 5JEAE 4X64I 5DNXA 1IBLE 4X65E 4X62I 2IOPA 2C39A 1H72C 5IT9C 4DV0E 5LMNI 3K17A 2BA0G 2GO4A 1HNXI 2X7IA 1ZXNA 4ISAA 2V2ZA 1DARA 3LPSA 1UDQA 2O1VA 3ZKDA 2HHHI 4JI2E 1KKHA 2LJPA 5LMUI 2UUBE 1R6MA 4QNKA 4FN5A 2PNLA 4LFBI 2JE6B 2C38B 2VESA 4ED4A 2JEBA 3LNUA 2CVEA 2PNZA 3QT7A 2NN6C 1XNRI 1PIEA 2Z5BB 5K36C 4YY3E 1H73A 2Q2EB 4OO1E 5L3JA 4MDTA 3PS1A 4JV5E 3NZKA 1KVKA 4QNJA 3CDJA 2PNMA 4AIMA 4XTJA 1EI1A 2V2VA 5C0XA 1IBKE 5BR8I 5K36B 1N0VC 2NN6D 2UXBI 4IFDD 4DPTA 4IFDA 2UXDI 3H1CA 2F4VI 4OO1B 1HNZI 4LCGA 4JYAI 5C0XF 2UUCI 4DR7I 5K36E 4DV0I 4NXMI 1S4EA 1J5EE 4FW7A 4JI6I 1HNWI 5K36F 2IOQA 4MYUA 2VQEE 4NXNE 3ZKBA 4MYTA 2WW4A 4DR7E 4K0KI 1OYSA 4USMA 3GLLA 4OO1C 2UXCI 3GCMA 1J5EI 4FWGA 4PRVA 4IZKA 2HKEA 3T1YE 3WU3A 1XNQE 4USKA 2E5LI 2GQ0A 4X64E 4JI5E 4FWHA 2BA1G 1R6LA 2O1UA 3J81Q 2BM0A 1OJ4A 5A2QQ 4DUYE 3L7ZA 1UDOA 4B3SI 4JV5I 2NPFA 1RHYA 2GO3A 1FWLA 3B4TA 4PRXA 3M7NG 4N3OA 1P42A 4GKKI 1MU5A 1N33I 2DEIA 4Z7YA 1XHKA 4DR3E 1Z5BA 4AQYE 1N32E
chains in the Genus database with same CATH topology
1UDNA 5JEAA 3GMEA 2JEBA 3HKMA 2PNZA 2NN6C 4IFDE 4IFDB 5C0XE 3U1KA 5K36C 5JEAF 3M85G 2C37A 4OO1E 2PNZB 4BA2A 3DD6A 5JEAD 3CDJA 2NN6F 4AIMA 4IFDF 2JEAA 2C37B 5C0XB 5C0XA 5K36B 4OO1A 4AIDA 2BR2A 3L7ZB 2WP8B 2NN6D 5C0XD 4IFDD 4IFDA 4AM3A 3H1CA 2JEAB 2NN6A 2NN6B 4OO1B 5K36D 2PO1A 5C0XF 2PO0B 2WP8A 5K36E 2C38A 2WNRA 4BA1A 5K36F 4NBQA 2NN6E 4IFDC 5C0XC 1OYSA 4OO1C 3GLLA 3CDIA 3M85D 2PO2A 3KRNA 3GCMA 1UDSA 2BA1D 2WNRB 1E3HA 4BA1B 4OO1F 2JEBB 5JEAE 4BA2B 2BR2B 2PO0A 1E3PA 2BA1G 2C39A 1R6LA 4OO1D 3M7ND 2BA0G 1OYPA 2PO1B 5JEAC 3L7ZA 1UDOA 1UDQA 2BA0D 3B4TA 3M7NG 2PO2B 1OYRA 5JEAB 1R6MA 5K36A 2JE6B 2JE6A 2C39B 2C38B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDN A;  5JEA A;  3GME A;  2JEB A;  3HKM A;  2PNZ A;  2NN6 C;  4IFD E;  4IFD B;  5C0X E;  3U1K A;  5K36 C;  5JEA F;  3M85 G;  2C37 A;  4OO1 E;  2PNZ B;  4BA2 A;  3DD6 A;  5JEA D;  3CDJ A;  2NN6 F;  4AIM A;  4IFD F;  2JEA A;  2C37 B;  5C0X B;  5C0X A;  5K36 B;  4OO1 A;  4AID A;  2BR2 A;  3L7Z B;  2WP8 B;  2NN6 D;  5C0X D;  4IFD D;  4IFD A;  4AM3 A;  3H1C A;  2JEA B;  2NN6 A;  2NN6 B;  4OO1 B;  5K36 D;  2PO1 A;  5C0X F;  2PO0 B;  2WP8 A;  5K36 E;  2C38 A;  2WNR A;  4BA1 A;  5K36 F;  4NBQ A;  2NN6 E;  4IFD C;  5C0X C;  1OYS A;  4OO1 C;  3GLL A;  3CDI A;  3M85 D;  2PO2 A;  3KRN A;  3GCM A;  1UDS A;  2BA1 D;  2WNR B;  1E3H A;  4BA1 B;  4OO1 F;  2JEB B;  5JEA E;  4BA2 B;  2BR2 B;  2PO0 A;  1E3P A;  2BA1 G;  2C39 A;  1R6L A;  4OO1 D;  3M7N D;  2BA0 G;  1OYP A;  2PO1 B;  5JEA C;  3L7Z A;  1UDO A;  1UDQ A;  2BA0 D;  3B4T A;  3M7N G;  2PO2 B;  1OYR A;  5JEA B;  1R6M A;  5K36 A;  2JE6 B;  2JE6 A;  2C39 B;  2C38 B; 
#chains in the Genus database with same CATH topology
 4GKK E;  4MU1 A;  3WU6 A;  4R1F A;  1UDN A;  1FJG I;  2BV3 A;  1PVG A;  1I94 I;  4GKJ I;  3HKM A;  1XMQ I;  4JI5 I;  4DXL A;  4LFC I;  4X66 I;  1FKA E;  4LF6 I;  1UEK A;  4DUZ E;  2AE8 A;  2HKJ A;  4LF5 E;  4GQU A;  4BA2 A;  4B3S E;  4LFA E;  1WUU A;  2HFS A;  4DPW A;  2Z5B A;  4EMD A;  2NN6 F;  4HAC B;  4IFD F;  1HNW E;  2C37 B;  2Z5C A;  5C0X B;  2R3V A;  1Y4U A;  1Y60 A;  4YHH E;  2BR2 A;  5GMD A;  3J7A G;  1Z5C A;  3ZM7 A;  5C0X D;  1ZM4 A;  1N34 E;  2ZM6 I;  2VQF I;  4JI6 E;  2HHH E;  4JI2 I;  2JEA B;  1FJG E;  3JAM C;  1H74 A;  3QT6 A;  2OI2 A;  2UUC E;  4DV4 E;  4OX9 I;  2PO1 A;  5K36 D;  4DR2 I;  2J7K A;  3ZZU A;  2E5L E;  1FWK A;  4DV2 I;  4JYA E;  4LFB E;  2V8P A;  2HK2 A;  2C38 A;  4MQY A;  1Z0V A;  4IS9 A;  4BA1 A;  3J80 Q;  3F0N A;  5LMU E;  4NBQ A;  3HUL A;  4JI7 E;  2NN6 E;  5C0X C;  3Q1Q A;  3CDI A;  4ZVI A;  4B3R I;  4JI1 I;  4DV6 E;  4HYM A;  5BR8 E;  3P3G A;  5DNL A;  1MX0 A;  4P52 A;  5FWK A;  4DV5 E;  2BR2 B;  1N0U A;  2PO0 A;  3PYG A;  1EA6 A;  4P7A A;  4AQY I;  1E3P A;  1Z0B A;  3ZZT A;  1N32 I;  2J65 A;  4OO1 D;  3WU4 A;  3J81 C;  3M7N D;  3WU5 A;  3B8H A;  4YY3 I;  1HK7 A;  3V2U C;  1OYP A;  5DRQ A;  4JI3 I;  3PS2 A;  4OKG A;  2PO1 B;  4DR3 I;  5JEA C;  5DRR A;  1MG7 A;  1Z0E A;  4K0K E;  4WUB A;  1ZM3 A;  1ELO A;  4B3T I;  1OYR A;  4KHP E;  3QT5 A;  4LF9 E;  4DU7 A;  4DV1 I;  3CWV A;  5JEA B;  1I94 E;  4UT4 A;  4DPU A;  3T1H E;  2GS8 A;  3PRY A;  1Z0W A;  2ZIT A;  4URL A;  2XEX A;  4MU0 A;  3LTO A;  2C39 B;  4LOM A;  2E1R A;  2O1W A;  4LF8 E;  5A2Q C;  3B82 A;  1HNX E;  4PU9 A;  4LF7 E;  4JI7 I;  3K85 A;  4KQV A;  4U3D A;  2JT2 A;  2IES A;  3ZZ0 A;  4B3M I;  4IZJ A;  4X66 E;  4LFC E;  2AJ4 A;  4B3T E;  4KHP I;  4IFD B;  5C0X E;  3U1K A;  5LMN E;  1NHJ A;  1H7U A;  3U1Y A;  4JI8 E;  4MU3 A;  4DV7 E;  4HY1 A;  1HNZ E;  1ZXM A;  4DUZ I;  2PNZ B;  1HR0 E;  3DD6 A;  5ELW A;  2ZM6 E;  1KTV A;  4FW6 A;  5JEA D;  4LFA I;  2UXB E;  1VIS A;  2Z5E A;  2UUB I;  1NHH A;  1XXE A;  2A2D A;  2F4V E;  3PYF A;  4OO1 A;  1Y4S A;  3D4J A;  4AID A;  4DR6 I;  4LF5 I;  2CG9 A;  1Y6Z A;  2WP8 B;  1N34 I;  1IBL I;  2VF3 A;  2UXC E;  4RPF A;  2O1T A;  4FW9 A;  4LCH A;  3OTO E;  2ZBK B;  4DV3 E;  4LF4 E;  4DR5 I;  2NN6 B;  3T1H I;  3PYE A;  1XMQ E;  3GON A;  4LCF A;  5GME A;  1N36 E;  4FW4 A;  3P76 A;  4JI4 E;  2WNR A;  4LF9 I;  1NHI A;  2EFG A;  3J7A M;  5EKW A;  4IFD C;  4JI0 I;  3Q6N A;  2R42 A;  4J3D A;  4M1K A;  5LL6 R;  3K1J A;  4JI4 I;  1UDS A;  2BA1 D;  4BA1 B;  1S16 A;  4LF4 I;  4OO1 F;  1Z0G A;  2JEB B;  4DR6 E;  1K47 A;  2A2C A;  4BA2 B;  5IWA E;  4DR1 I;  4X65 I;  1PKP A;  1XMO I;  4JI1 E;  2CGE A;  2CZ9 A;  3QT8 A;  2UUA I;  4DV4 I;  1FNM A;  4HXZ A;  4DR2 E;  2HFU A;  4LPF A;  1Z5A A;  1BKN A;  4U3B A;  4JI0 E;  4FW5 A;  1ZM2 A;  3PS3 A;  2BA0 D;  3J80 C;  2V2Q A;  2UXD E;  1Z0C A;  2PO2 B;  1YHC A;  3OTO I;  4DR4 E;  2VQE I;  1B62 A;  3M6A A;  3UHM A;  4IZK B;  5K36 A;  4NXN I;  4DPX A;  1IBK I;  1YH8 A;  5DRO A;  3JAM Q;  1A6F A;  1RR9 A;  2JE6 A;  4X62 E;  4LF8 I;  1H7S A;  4HAC A;  4JI8 I;  4DU8 A;  1IBM E;  4LF7 I;  1XMO E;  5JEA A;  3GME A;  5FLX Q;  1USU A;  4JG4 A;  4OX9 E;  4JI3 E;  4YHH I;  3P3C A;  5IT9 Q;  3HJC A;  3Q6M A;  4IFD E;  4MU4 A;  1Y5Y A;  2O3Z A;  1XNR E;  5JEA F;  3PYD A;  1IBM I;  4FW3 A;  4DV1 E;  2UU9 E;  3M85 G;  2BM1 A;  4FWD A;  2C37 A;  2Z5C B;  4IZJ D;  5DRP A;  2UUA E;  4GKJ E;  1Z59 A;  3V5R A;  1HR0 I;  2DEJ A;  4B3R E;  4OZE A;  4LF6 E;  3H4L A;  2JEA A;  1U2R A;  2UU9 I;  3T1Y I;  3L7Z B;  4WUC A;  1NZ0 A;  1QZR A;  4Z7C A;  2F1D A;  3P06 A;  4AM3 A;  2NN6 A;  4UTG A;  4DV3 I;  2HK3 A;  4DPY A;  1USV A;  1ZM9 A;  5EL9 A;  1Z0T A;  1VI7 A;  5IWA I;  4DR1 E;  2PO0 B;  4WUD A;  2IER A;  4I3H A;  2WP8 A;  1N36 I;  4IZJ B;  3B78 A;  1RRE A;  4DV6 I;  5FLX C;  1KIJ A;  4DV7 I;  4DR4 I;  4DR5 E;  1D6T A;  1XNQ I;  2X36 A;  4DV5 I;  1N33 E;  4DUY I;  4DV2 E;  4B3M E;  3M85 D;  2VQF E;  2PO2 A;  1FI4 A;  3KRN A;  4NXM E;  2WNR B;  1E3H A;  2V34 A;  1B63 A;  3P3E A;  5JEA E;  4X64 I;  5DNX A;  1IBL E;  4X65 E;  4X62 I;  2IOP A;  2C39 A;  1H72 C;  5IT9 C;  4DV0 E;  5LMN I;  3K17 A;  2BA0 G;  2GO4 A;  1HNX I;  2X7I A;  1ZXN A;  4ISA A;  2V2Z A;  1DAR A;  3LPS A;  1UDQ A;  2O1V A;  3ZKD A;  2HHH I;  4JI2 E;  1KKH A;  2LJP A;  5LMU I;  2UUB E;  1R6M A;  4QNK A;  4FN5 A;  2PNL A;  4LFB I;  2JE6 B;  2C38 B;  2VES A;  4ED4 A;  2JEB A;  3LNU A;  2CVE A;  2PNZ A;  3QT7 A;  2NN6 C;  1XNR I;  1PIE A;  2Z5B B;  5K36 C;  4YY3 E;  1H73 A;  2Q2E B;  4OO1 E;  5L3J A;  4MDT A;  3PS1 A;  4JV5 E;  3NZK A;  1KVK A;  4QNJ A;  3CDJ A;  2PNM A;  4AIM A;  4XTJ A;  1EI1 A;  2V2V A;  5C0X A;  1IBK E;  5BR8 I;  5K36 B;  1N0V C;  2NN6 D;  2UXB I;  4IFD D;  4DPT A;  4IFD A;  2UXD I;  3H1C A;  2F4V I;  4OO1 B;  1HNZ I;  4LCG A;  4JYA I;  5C0X F;  2UUC I;  4DR7 I;  5K36 E;  4DV0 I;  4NXM I;  1S4E A;  1J5E E;  4FW7 A;  4JI6 I;  1HNW I;  5K36 F;  2IOQ A;  4MYU A;  2VQE E;  4NXN E;  3ZKB A;  4MYT A;  2WW4 A;  4DR7 E;  4K0K I;  1OYS A;  4USM A;  3GLL A;  4OO1 C;  2UXC I;  3GCM A;  1J5E I;  4FWG A;  4PRV A;  4IZK A;  2HKE A;  3T1Y E;  3WU3 A;  1XNQ E;  4USK A;  2E5L I;  2GQ0 A;  4X64 E;  4JI5 E;  4FWH A;  2BA1 G;  1R6L A;  2O1U A;  3J81 Q;  2BM0 A;  1OJ4 A;  5A2Q Q;  4DUY E;  3L7Z A;  1UDO A;  4B3S I;  4JV5 I;  2NPF A;  1RHY A;  2GO3 A;  1FWL A;  3B4T A;  4PRX A;  3M7N G;  4N3O A;  1P42 A;  4GKK I;  1MU5 A;  1N33 I;  2DEI A;  4Z7Y A;  1XHK A;  4DR3 E;  1Z5B A;  4AQY E;  1N32 E; 
#chains in the Genus database with same CATH homology
 1UDN A;  5JEA A;  3GME A;  2JEB A;  3HKM A;  2PNZ A;  2NN6 C;  4IFD E;  4IFD B;  5C0X E;  3U1K A;  5K36 C;  5JEA F;  3M85 G;  2C37 A;  4OO1 E;  2PNZ B;  4BA2 A;  3DD6 A;  5JEA D;  3CDJ A;  2NN6 F;  4AIM A;  4IFD F;  2JEA A;  2C37 B;  5C0X B;  5C0X A;  5K36 B;  4OO1 A;  4AID A;  2BR2 A;  3L7Z B;  2WP8 B;  2NN6 D;  5C0X D;  4IFD D;  4IFD A;  4AM3 A;  3H1C A;  2JEA B;  2NN6 A;  2NN6 B;  4OO1 B;  5K36 D;  2PO1 A;  5C0X F;  2PO0 B;  2WP8 A;  5K36 E;  2C38 A;  2WNR A;  4BA1 A;  5K36 F;  4NBQ A;  2NN6 E;  4IFD C;  5C0X C;  1OYS A;  4OO1 C;  3GLL A;  3CDI A;  3M85 D;  2PO2 A;  3KRN A;  3GCM A;  1UDS A;  2BA1 D;  2WNR B;  1E3H A;  4BA1 B;  4OO1 F;  2JEB B;  5JEA E;  4BA2 B;  2BR2 B;  2PO0 A;  1E3P A;  2BA1 G;  2C39 A;  1R6L A;  4OO1 D;  3M7N D;  2BA0 G;  1OYP A;  2PO1 B;  5JEA C;  3L7Z A;  1UDO A;  1UDQ A;  2BA0 D;  3B4T A;  3M7N G;  2PO2 B;  1OYR A;  5JEA B;  1R6M A;  5K36 A;  2JE6 B;  2JE6 A;  2C39 B;  2C38 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...