3L7ZA

Crystal structure of the s. solfataricus archaeal exosome
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
271
structure length
251
Chain Sequence
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex exonuclease 2
publication title Crystal structure of the S. solfataricus archaeal exosome reveals conformational flexibility in the RNA-binding ring.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase/rna binding protein
total genus 73
structure length 251
sequence length 271
chains with identical sequence D, G
ec nomenclature ec 3.1.13.-:
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01138 RNase_PH 3' exoribonuclease family, domain 1
A PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 3l7zA01
4OO1A 4OO1B 4BA1B 1OYSA 3M7ND 2NN6F 4AIMA 5K36F 4NBQA 2NN6A 2NN6B 1UDQA 2WP8A 5K36A 3CDIA 5K36B 3GMEA 3GLLA 2JE6A 2JE6B 3L7ZA 3M85D 3CDJA 4IFDE 5C0XE 2PO1B 2BR2A 2BR2B 4BA1A 2C37B 3M7NG 4OO1E 5JEAF 5JEAC 5JEAB 2JEAA 2JEAB 2NN6E 5K36E 2C38A 1OYPA 2BA0D 2C38B 2WNRA 3M85G 2WNRB 3KRNA 5JEAD 1UDNA 2PO1A 2C39A 2JEBA 2C39B 2JEBB 2C37A 4AM3A 1UDOA 2BA1D 2PO0A 2PO0B 1UDSA 1OYRA 4IFDF 5C0XF 5JEAA 3B4TA 4IFDC 3H1CA 5C0XC 1R6MA 4IFDB 3DD6A 2BA0G 4OO1C 4BA2A 4BA2B 3HKMA 4IFDD 5C0XD 2PO2A 2PO2B 2BA1G 2NN6C 2PNZA 2PNZB 5K36C 2WP8B 3GCMA 4OO1D 1E3HA 4AIDA 3U1KA 4IFDA 1R6LA 5C0XA 1E3PA 5C0XB 5JEAE 2NN6D 3L7ZB 5K36D 4OO1F
chains in the Genus database with same CATH superfamily
2R42A 4OKGA 4YY3I 5GMEA 4N3OA 4B3RE 1H72C 4FW4A 4IZKA 4JV5E 4DV4I 4JG4A 4IS9A 4DR4E 2GQ0A 1KVKA 5IWAE 2NPFA 2VQFI 4OZEA 2ZBKB 5DNLA 3GLLA 4GKJI 1Y60A 4DR2I 1Z59A 3D4JA 2ZITA 3CDJA 2V8PA 2Z5BB 4DR1I 2BR2A 1H74A 3LPSA 4IZJB 2BR2B 4MYUA 4GKKI 2OI2A 2CZ9A 2A2DA 4FW5A 4LFCE 2HFSA 4DV1I 2PNMA 4OO1E 4NXME 5JEAF 4JI2I 2BM0A 4J3DA 4FW6A 1VI7A 2JEAA 2JEAB 2E5LE 3J80Q 2UUAI 4JI6I 2C38A 1XNRI 2C38B 2J65A 2WNRA 2WNRB 3PS3A 4XTJA 1HR0I 1XXEA 2C39A 2Z5CA 3QT5A 2C39B 1J5EE 4JI6E 1XMOI 4DR5E 4U3DA 5L3JA 4LCFA 1NHJA 2V2VA 4X64E 1Z0VA 2VF3A 2UXBE 2R3VA 2BM1A 2PNLA 1Z0CA 4IFDC 1Y4UA 3P76A 2Z5EA 5C0XC 4LF8E 3B8HA 3J81C 1XMQE 3OTOI 4MDTA 1NHIA 4GQUA 4AQYE 1OJ4A 4MYTA 5LMNE 4IFDD 1RREA 5C0XD 3PRYA 4X65E 5LMUI 4DR7E 2NN6C 1HNWE 5LL6R 4EMDA 1N0UA 4LF6E 4QNKA 4KQVA 4DV0E 1E3HA 3WU3A 2DEJA 4P52A 4JI5I 4FW3A 3JAMQ 5FLXQ 1IBLE 5DRRA 1YHCA 4ED4A 4QNJA 2NN6D 3L7ZB 2GO4A 4DV5I 4JI5E 1VISA 1EI1A 4OX9I 3T1YE 1ZXMA 1Z0TA 2NN6F 5IT9C 3WU4A 2WP8A 2IESA 4LF4E 5K36A 3B82A 3CDIA 5K36B 2ZM6E 3Q6NA 1MG7A 4USKA 4X66I 1Z5AA 4WUDA 4LF5E 3J7AM 4M1KA 3ZZTA 3M85D 4IFDE 4DPWA 4MU1A 5C0XE 4DV2E 4YHHI 1NHHA 1Z5CA 3PYFA 2C37B 3GONA 4B3TI 3M7NG 1B63A 4JI1I 4DUYE 2UXDI 3QT8A 1DARA 1B62A 4JI7E 1U2RA 1ZM9A 2UUCE 2HK2A 4WUBA 1N32I 1FWKA 5JEAC 4YY3E 2NN6E 4JI1E 4DPXA 4MU4A 2IOQA 1IBKI 3NZKA 1OYPA 2BA0D 4DV4E 1N32E 1KIJA 3P3GA 1MU5A 5JEAD 2Z5BA 4IZJA 1NZ0A 2VQFE 4DU7A 4GKJE 4AM3A 2VESA 4DR2E 1UDOA 2BA1D 1HNXI 1UDSA 4JI8I 2VQEI 3LNUA 4HXZA 4DR1E 4GKKE 2HKJA 3H1CA 4IFDB 3ZKDA 2O1VA 3DD6A 1FI4A 3PS1A 4JI3I 1PKPA 3B78A 4DV1E 3Q1QA 4DV3I 4JI2E 1IBMI 1ZXNA 3UHMA 4ISAA 1N34I 1N36I 4K0KI 4DUZI 4JI4I 4LF7I 1YH8A 2J7KA 4B3MI 4B3SI 2PO2A 2UUAE 2PO2B 1UEKA 2O1UA 2WW4A 1XNRE 2PNZA 2PNZB 2EFGA 3H4LA 3J7AG 3GCMA 1H7SA 4Z7CA 1I94I 1HR0E 4JI0I 5DRPA 3P3EA 1XMOE 3WU5A 1E3PA 3HULA 1RR9A 4URLA 5JEAE 4LFAI 1KKHA 3ZKBA 4MU3A 1WUUA 2HK3A 4OO1A 1Z5BA 4OO1B 4BA1B 2A2CA 4LF9I 1OYSA 3OTOE 4ZVIA 4LFAE 3PS2A 2UU9I 1K47A 3ZZ0A 4DV6I 1HNZI 3K85A 4IZJD 4LOMA 3GMEA 3J81Q 1XNQI 4FN5A 5LMUE 2HFUA 2HHHI 2UUBI 2BV3A 2JE6A 1HNZE 2JE6B 1EA6A 3L7ZA 1BKNA 4RPFA 2PO1B 4FWHA 2V34A 3LTOA 1Z0BA 4KHPI 5A2QC 3ZZUA 2O3ZA 1Z0GA 4DR3I 2HKEA 4UTGA 4NXNI 4DV5E 5JEAB 1XHKA 1A6FA 1FJGI 4PRXA 4OX9E 2IOPA 2XEXA 4FW9A 4UT4A 2X36A 4DR6I 4LFBI 3K1JA 3ZM7A 4DV7I 4NXNE 4LCGA 4HY1A 1FJGE 4LCHA 1UDNA 4X66E 1N33I 5IT9Q 2JEBA 4DU8A 2JEBB 2C37A 2O1TA 4JYAI 2AE8A 1Y6ZA 4X62I 3V5RA 2PO0A 2GO3A 3CWVA 2PO0B 1HK7A 1OYRA 5BR8I 4USMA 3HJCA 2UXCI 4YHHE 3M6AA 3B4TA 2F4VI 4B3TE 1R6MA 4X62E 1FWLA 1ZM4A 4B3RI 4HACA 2E1RA 4HACB 2CVEA 4FWDA 2UXDE 1S16A 4JV5I 2UXCE 1MX0A 4HYMA 4DR4I 2Q2EB 3Q6MA 2F4VE 4LPFA 1D6TA 5IWAI 3HKMA 5ELWA 4IZKB 1IBKE 1PVGA 2AJ4A 2F1DA 5K36C 4Z7YA 1USVA 4MU0A 4AIDA 2CGEA 2V2QA 4IFDA 1R6LA 5DNXA 4LFCI 5C0XA 5C0XB 1HNXE 3J80C 4FWGA 4JI8E 2VQEE 2O1WA 4NXMI 5K36D 5DRQA 4DPYA 2E5LI 3M7ND 4JI3E 4DV3E 4AIMA 1IBME 1FKAE 4NBQA 5K36F 2NN6A 2NN6B 1UDQA 1N34E 1N36E 4K0KE 2X7IA 5FWKA 4DUZE 4JI4E 4LF7E 4B3ME 4B3SE 1ZM3A 1J5EI 4DR5I 1Y4SA 2DEIA 4FW7A 3PYDA 5EL9A 4X64I 5DROA 1PIEA 3QT7A 4DPTA 1I94E 2UXBI 4R1FA 3WU6A 4JI0E 2Z5CB 4BA1A 3F0NA 4LF8I 2CG9A 1XMQI 1QZRA 1KTVA 1Y5YA 3K17A 4AQYI 1H7UA 1Z0EA 4LF9E 4I3HA 5LMNI 4X65I 2UU9E 5K36E 3JAMC 4DR7I 5FLXC 1USUA 4P7AA 3T1HI 1HNWI 3M85G 4DV6E 1P42A 1ELOA 2JT2A 3KRNA 4LF6I 2PO1A 1XNQE 4DV0I 4DPUA 2LJPA 1IBLI 2HHHE 2UUBE 4PRVA 3T1HE 1Z0WA 2IERA 4PU9A 1RHYA 4IFDF 5C0XF 5JEAA 3QT6A 4KHPE 4U3BA 3T1YI 2BA0G 4DR3E 3PYGA 3PYEA 4LF4I 4OO1C 2ZM6I 4BA2A 4BA2B 4DXLA 5A2QQ 4DR6E 4LFBE 1ZM2A 2V2ZA 2BA1G 5GMDA 4LF5I 1H73A 4DV7E 2WP8B 1N33E 3U1YA 5EKWA 4OO1D 4DV2I 4MQYA 3U1KA 1N0VC 2GS8A 4JYAE 3V2UC 3P06A 3P3CA 4DUYI 1S4EA 4WUCA 5BR8E 4JI7I 1FNMA 2UUCI 4OO1F
chains in the Genus database with same CATH topology
4OO1A 4OO1B 4BA1B 1OYSA 3M7ND 2NN6F 4AIMA 5K36F 4NBQA 2NN6A 2NN6B 1UDQA 2WP8A 5K36A 3CDIA 5K36B 3GMEA 3GLLA 2JE6A 2JE6B 3L7ZA 3M85D 3CDJA 4IFDE 5C0XE 2PO1B 2BR2A 2BR2B 4BA1A 2C37B 3M7NG 4OO1E 5JEAF 5JEAC 5JEAB 2JEAA 2JEAB 2NN6E 5K36E 2C38A 1OYPA 2BA0D 2C38B 2WNRA 3M85G 2WNRB 3KRNA 5JEAD 1UDNA 2PO1A 2C39A 2JEBA 2C39B 2JEBB 2C37A 4AM3A 1UDOA 2BA1D 2PO0A 2PO0B 1UDSA 1OYRA 4IFDF 5C0XF 5JEAA 3B4TA 4IFDC 3H1CA 5C0XC 1R6MA 4IFDB 3DD6A 2BA0G 4OO1C 4BA2A 4BA2B 3HKMA 4IFDD 5C0XD 2PO2A 2PO2B 2BA1G 2NN6C 2PNZA 2PNZB 5K36C 2WP8B 3GCMA 4OO1D 1E3HA 4AIDA 3U1KA 4IFDA 1R6LA 5C0XA 1E3PA 5C0XB 5JEAE 2NN6D 3L7ZB 5K36D 4OO1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 A;  4OO1 B;  4BA1 B;  1OYS A;  3M7N D;  2NN6 F;  4AIM A;  5K36 F;  4NBQ A;  2NN6 A;  2NN6 B;  1UDQ A;  2WP8 A;  5K36 A;  3CDI A;  5K36 B;  3GME A;  3GLL A;  2JE6 A;  2JE6 B;  3L7Z A;  3M85 D;  3CDJ A;  4IFD E;  5C0X E;  2PO1 B;  2BR2 A;  2BR2 B;  4BA1 A;  2C37 B;  3M7N G;  4OO1 E;  5JEA F;  5JEA C;  5JEA B;  2JEA A;  2JEA B;  2NN6 E;  5K36 E;  2C38 A;  1OYP A;  2BA0 D;  2C38 B;  2WNR A;  3M85 G;  2WNR B;  3KRN A;  5JEA D;  1UDN A;  2PO1 A;  2C39 A;  2JEB A;  2C39 B;  2JEB B;  2C37 A;  4AM3 A;  1UDO A;  2BA1 D;  2PO0 A;  2PO0 B;  1UDS A;  1OYR A;  4IFD F;  5C0X F;  5JEA A;  3B4T A;  4IFD C;  3H1C A;  5C0X C;  1R6M A;  4IFD B;  3DD6 A;  2BA0 G;  4OO1 C;  4BA2 A;  4BA2 B;  3HKM A;  4IFD D;  5C0X D;  2PO2 A;  2PO2 B;  2BA1 G;  2NN6 C;  2PNZ A;  2PNZ B;  5K36 C;  2WP8 B;  3GCM A;  4OO1 D;  1E3H A;  4AID A;  3U1K A;  4IFD A;  1R6L A;  5C0X A;  1E3P A;  5C0X B;  5JEA E;  2NN6 D;  3L7Z B;  5K36 D;  4OO1 F; 
#chains in the Genus database with same CATH topology
 2R42 A;  4OKG A;  4YY3 I;  5GME A;  4N3O A;  4B3R E;  1H72 C;  4FW4 A;  4IZK A;  4JV5 E;  4DV4 I;  4JG4 A;  4IS9 A;  4DR4 E;  2GQ0 A;  1KVK A;  5IWA E;  2NPF A;  2VQF I;  4OZE A;  2ZBK B;  5DNL A;  3GLL A;  4GKJ I;  1Y60 A;  4DR2 I;  1Z59 A;  3D4J A;  2ZIT A;  3CDJ A;  2V8P A;  2Z5B B;  4DR1 I;  2BR2 A;  1H74 A;  3LPS A;  4IZJ B;  2BR2 B;  4MYU A;  4GKK I;  2OI2 A;  2CZ9 A;  2A2D A;  4FW5 A;  4LFC E;  2HFS A;  4DV1 I;  2PNM A;  4OO1 E;  4NXM E;  5JEA F;  4JI2 I;  2BM0 A;  4J3D A;  4FW6 A;  1VI7 A;  2JEA A;  2JEA B;  2E5L E;  3J80 Q;  2UUA I;  4JI6 I;  2C38 A;  1XNR I;  2C38 B;  2J65 A;  2WNR A;  2WNR B;  3PS3 A;  4XTJ A;  1HR0 I;  1XXE A;  2C39 A;  2Z5C A;  3QT5 A;  2C39 B;  1J5E E;  4JI6 E;  1XMO I;  4DR5 E;  4U3D A;  5L3J A;  4LCF A;  1NHJ A;  2V2V A;  4X64 E;  1Z0V A;  2VF3 A;  2UXB E;  2R3V A;  2BM1 A;  2PNL A;  1Z0C A;  4IFD C;  1Y4U A;  3P76 A;  2Z5E A;  5C0X C;  4LF8 E;  3B8H A;  3J81 C;  1XMQ E;  3OTO I;  4MDT A;  1NHI A;  4GQU A;  4AQY E;  1OJ4 A;  4MYT A;  5LMN E;  4IFD D;  1RRE A;  5C0X D;  3PRY A;  4X65 E;  5LMU I;  4DR7 E;  2NN6 C;  1HNW E;  5LL6 R;  4EMD A;  1N0U A;  4LF6 E;  4QNK A;  4KQV A;  4DV0 E;  1E3H A;  3WU3 A;  2DEJ A;  4P52 A;  4JI5 I;  4FW3 A;  3JAM Q;  5FLX Q;  1IBL E;  5DRR A;  1YHC A;  4ED4 A;  4QNJ A;  2NN6 D;  3L7Z B;  2GO4 A;  4DV5 I;  4JI5 E;  1VIS A;  1EI1 A;  4OX9 I;  3T1Y E;  1ZXM A;  1Z0T A;  2NN6 F;  5IT9 C;  3WU4 A;  2WP8 A;  2IES A;  4LF4 E;  5K36 A;  3B82 A;  3CDI A;  5K36 B;  2ZM6 E;  3Q6N A;  1MG7 A;  4USK A;  4X66 I;  1Z5A A;  4WUD A;  4LF5 E;  3J7A M;  4M1K A;  3ZZT A;  3M85 D;  4IFD E;  4DPW A;  4MU1 A;  5C0X E;  4DV2 E;  4YHH I;  1NHH A;  1Z5C A;  3PYF A;  2C37 B;  3GON A;  4B3T I;  3M7N G;  1B63 A;  4JI1 I;  4DUY E;  2UXD I;  3QT8 A;  1DAR A;  1B62 A;  4JI7 E;  1U2R A;  1ZM9 A;  2UUC E;  2HK2 A;  4WUB A;  1N32 I;  1FWK A;  5JEA C;  4YY3 E;  2NN6 E;  4JI1 E;  4DPX A;  4MU4 A;  2IOQ A;  1IBK I;  3NZK A;  1OYP A;  2BA0 D;  4DV4 E;  1N32 E;  1KIJ A;  3P3G A;  1MU5 A;  5JEA D;  2Z5B A;  4IZJ A;  1NZ0 A;  2VQF E;  4DU7 A;  4GKJ E;  4AM3 A;  2VES A;  4DR2 E;  1UDO A;  2BA1 D;  1HNX I;  1UDS A;  4JI8 I;  2VQE I;  3LNU A;  4HXZ A;  4DR1 E;  4GKK E;  2HKJ A;  3H1C A;  4IFD B;  3ZKD A;  2O1V A;  3DD6 A;  1FI4 A;  3PS1 A;  4JI3 I;  1PKP A;  3B78 A;  4DV1 E;  3Q1Q A;  4DV3 I;  4JI2 E;  1IBM I;  1ZXN A;  3UHM A;  4ISA A;  1N34 I;  1N36 I;  4K0K I;  4DUZ I;  4JI4 I;  4LF7 I;  1YH8 A;  2J7K A;  4B3M I;  4B3S I;  2PO2 A;  2UUA E;  2PO2 B;  1UEK A;  2O1U A;  2WW4 A;  1XNR E;  2PNZ A;  2PNZ B;  2EFG A;  3H4L A;  3J7A G;  3GCM A;  1H7S A;  4Z7C A;  1I94 I;  1HR0 E;  4JI0 I;  5DRP A;  3P3E A;  1XMO E;  3WU5 A;  1E3P A;  3HUL A;  1RR9 A;  4URL A;  5JEA E;  4LFA I;  1KKH A;  3ZKB A;  4MU3 A;  1WUU A;  2HK3 A;  4OO1 A;  1Z5B A;  4OO1 B;  4BA1 B;  2A2C A;  4LF9 I;  1OYS A;  3OTO E;  4ZVI A;  4LFA E;  3PS2 A;  2UU9 I;  1K47 A;  3ZZ0 A;  4DV6 I;  1HNZ I;  3K85 A;  4IZJ D;  4LOM A;  3GME A;  3J81 Q;  1XNQ I;  4FN5 A;  5LMU E;  2HFU A;  2HHH I;  2UUB I;  2BV3 A;  2JE6 A;  1HNZ E;  2JE6 B;  1EA6 A;  3L7Z A;  1BKN A;  4RPF A;  2PO1 B;  4FWH A;  2V34 A;  3LTO A;  1Z0B A;  4KHP I;  5A2Q C;  3ZZU A;  2O3Z A;  1Z0G A;  4DR3 I;  2HKE A;  4UTG A;  4NXN I;  4DV5 E;  5JEA B;  1XHK A;  1A6F A;  1FJG I;  4PRX A;  4OX9 E;  2IOP A;  2XEX A;  4FW9 A;  4UT4 A;  2X36 A;  4DR6 I;  4LFB I;  3K1J A;  3ZM7 A;  4DV7 I;  4NXN E;  4LCG A;  4HY1 A;  1FJG E;  4LCH A;  1UDN A;  4X66 E;  1N33 I;  5IT9 Q;  2JEB A;  4DU8 A;  2JEB B;  2C37 A;  2O1T A;  4JYA I;  2AE8 A;  1Y6Z A;  4X62 I;  3V5R A;  2PO0 A;  2GO3 A;  3CWV A;  2PO0 B;  1HK7 A;  1OYR A;  5BR8 I;  4USM A;  3HJC A;  2UXC I;  4YHH E;  3M6A A;  3B4T A;  2F4V I;  4B3T E;  1R6M A;  4X62 E;  1FWL A;  1ZM4 A;  4B3R I;  4HAC A;  2E1R A;  4HAC B;  2CVE A;  4FWD A;  2UXD E;  1S16 A;  4JV5 I;  2UXC E;  1MX0 A;  4HYM A;  4DR4 I;  2Q2E B;  3Q6M A;  2F4V E;  4LPF A;  1D6T A;  5IWA I;  3HKM A;  5ELW A;  4IZK B;  1IBK E;  1PVG A;  2AJ4 A;  2F1D A;  5K36 C;  4Z7Y A;  1USV A;  4MU0 A;  4AID A;  2CGE A;  2V2Q A;  4IFD A;  1R6L A;  5DNX A;  4LFC I;  5C0X A;  5C0X B;  1HNX E;  3J80 C;  4FWG A;  4JI8 E;  2VQE E;  2O1W A;  4NXM I;  5K36 D;  5DRQ A;  4DPY A;  2E5L I;  3M7N D;  4JI3 E;  4DV3 E;  4AIM A;  1IBM E;  1FKA E;  4NBQ A;  5K36 F;  2NN6 A;  2NN6 B;  1UDQ A;  1N34 E;  1N36 E;  4K0K E;  2X7I A;  5FWK A;  4DUZ E;  4JI4 E;  4LF7 E;  4B3M E;  4B3S E;  1ZM3 A;  1J5E I;  4DR5 I;  1Y4S A;  2DEI A;  4FW7 A;  3PYD A;  5EL9 A;  4X64 I;  5DRO A;  1PIE A;  3QT7 A;  4DPT A;  1I94 E;  2UXB I;  4R1F A;  3WU6 A;  4JI0 E;  2Z5C B;  4BA1 A;  3F0N A;  4LF8 I;  2CG9 A;  1XMQ I;  1QZR A;  1KTV A;  1Y5Y A;  3K17 A;  4AQY I;  1H7U A;  1Z0E A;  4LF9 E;  4I3H A;  5LMN I;  4X65 I;  2UU9 E;  5K36 E;  3JAM C;  4DR7 I;  5FLX C;  1USU A;  4P7A A;  3T1H I;  1HNW I;  3M85 G;  4DV6 E;  1P42 A;  1ELO A;  2JT2 A;  3KRN A;  4LF6 I;  2PO1 A;  1XNQ E;  4DV0 I;  4DPU A;  2LJP A;  1IBL I;  2HHH E;  2UUB E;  4PRV A;  3T1H E;  1Z0W A;  2IER A;  4PU9 A;  1RHY A;  4IFD F;  5C0X F;  5JEA A;  3QT6 A;  4KHP E;  4U3B A;  3T1Y I;  2BA0 G;  4DR3 E;  3PYG A;  3PYE A;  4LF4 I;  4OO1 C;  2ZM6 I;  4BA2 A;  4BA2 B;  4DXL A;  5A2Q Q;  4DR6 E;  4LFB E;  1ZM2 A;  2V2Z A;  2BA1 G;  5GMD A;  4LF5 I;  1H73 A;  4DV7 E;  2WP8 B;  1N33 E;  3U1Y A;  5EKW A;  4OO1 D;  4DV2 I;  4MQY A;  3U1K A;  1N0V C;  2GS8 A;  4JYA E;  3V2U C;  3P06 A;  3P3C A;  4DUY I;  1S4E A;  4WUC A;  5BR8 E;  4JI7 I;  1FNM A;  2UUC I;  4OO1 F; 
#chains in the Genus database with same CATH homology
 4OO1 A;  4OO1 B;  4BA1 B;  1OYS A;  3M7N D;  2NN6 F;  4AIM A;  5K36 F;  4NBQ A;  2NN6 A;  2NN6 B;  1UDQ A;  2WP8 A;  5K36 A;  3CDI A;  5K36 B;  3GME A;  3GLL A;  2JE6 A;  2JE6 B;  3L7Z A;  3M85 D;  3CDJ A;  4IFD E;  5C0X E;  2PO1 B;  2BR2 A;  2BR2 B;  4BA1 A;  2C37 B;  3M7N G;  4OO1 E;  5JEA F;  5JEA C;  5JEA B;  2JEA A;  2JEA B;  2NN6 E;  5K36 E;  2C38 A;  1OYP A;  2BA0 D;  2C38 B;  2WNR A;  3M85 G;  2WNR B;  3KRN A;  5JEA D;  1UDN A;  2PO1 A;  2C39 A;  2JEB A;  2C39 B;  2JEB B;  2C37 A;  4AM3 A;  1UDO A;  2BA1 D;  2PO0 A;  2PO0 B;  1UDS A;  1OYR A;  4IFD F;  5C0X F;  5JEA A;  3B4T A;  4IFD C;  3H1C A;  5C0X C;  1R6M A;  4IFD B;  3DD6 A;  2BA0 G;  4OO1 C;  4BA2 A;  4BA2 B;  3HKM A;  4IFD D;  5C0X D;  2PO2 A;  2PO2 B;  2BA1 G;  2NN6 C;  2PNZ A;  2PNZ B;  5K36 C;  2WP8 B;  3GCM A;  4OO1 D;  1E3H A;  4AID A;  3U1K A;  4IFD A;  1R6L A;  5C0X A;  1E3P A;  5C0X B;  5JEA E;  2NN6 D;  3L7Z B;  5K36 D;  4OO1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...